BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6914_g1_i1 len=1426 path=[622:0-1425]

Length=1426
                                                                      Score     E

ref|XP_009788536.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    505   2e-174   
gb|ACE82566.1|  epoxide hydrolase                                       501   7e-173   Nicotiana benthamiana
emb|CDP17206.1|  unnamed protein product                                500   1e-172   
ref|XP_009629075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    496   4e-171   
gb|ACE82565.1|  epoxide hydrolase                                       495   1e-170   Nicotiana benthamiana
ref|XP_011092097.1|  PREDICTED: bifunctional epoxide hydrolase 2        493   1e-169   
ref|XP_006344695.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    483   7e-166   
ref|XP_004230258.1|  PREDICTED: bifunctional epoxide hydrolase 2        478   8e-164   
ref|XP_002283462.1|  PREDICTED: bifunctional epoxide hydrolase 2        475   7e-163   Vitis vinifera
ref|XP_002512456.1|  epoxide hydrolase, putative                        471   4e-161   Ricinus communis
ref|XP_011023717.1|  PREDICTED: bifunctional epoxide hydrolase 2        468   4e-160   
ref|XP_007031041.1|  Alpha/beta-Hydrolases superfamily protein          467   2e-159   
gb|KHG24497.1|  Epoxide hydrolase 2                                     466   5e-159   
gb|KDP23458.1|  hypothetical protein JCGZ_23291                         465   6e-159   
ref|XP_002318980.2|  epoxide hydrolase family protein                   464   2e-158   Populus trichocarpa [western balsam poplar]
ref|XP_006433457.1|  hypothetical protein CICLE_v10001881mg             461   3e-157   
gb|EYU42194.1|  hypothetical protein MIMGU_mgv1a010473mg                459   1e-156   
ref|XP_010094462.1|  Epoxide hydrolase 2                                456   4e-155   
ref|XP_010104146.1|  Epoxide hydrolase 2                                454   1e-154   
ref|XP_006472971.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    460   2e-153   
gb|KGN66047.1|  hypothetical protein Csa_1G569240                       449   2e-152   
emb|CBI39538.3|  unnamed protein product                                437   3e-148   
ref|XP_003626243.1|  Epoxide hydrolase                                  435   6e-147   
ref|XP_003554527.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    434   7e-147   
ref|XP_010043042.1|  PREDICTED: bifunctional epoxide hydrolase 2        434   2e-146   
ref|XP_006288215.1|  hypothetical protein CARUB_v10001452mg             432   7e-146   
gb|ACU19478.1|  unknown                                                 432   8e-146   Glycine max [soybeans]
ref|XP_003554633.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    432   1e-145   
emb|CDP17111.1|  unnamed protein product                                431   2e-145   
ref|XP_007050977.1|  Alpha/beta-Hydrolases superfamily protein          431   2e-145   
ref|NP_001240943.1|  uncharacterized protein LOC100803974               431   2e-145   
ref|XP_008450607.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    431   2e-145   
ref|XP_006396441.1|  hypothetical protein EUTSA_v10028814mg             430   3e-145   
ref|XP_007147002.1|  hypothetical protein PHAVU_006G088500g             430   4e-145   
ref|XP_007147001.1|  hypothetical protein PHAVU_006G088400g             430   5e-145   
gb|ACJ85188.1|  unknown                                                 430   5e-145   Medicago truncatula
ref|XP_007222764.1|  hypothetical protein PRUPE_ppa008756mg             430   6e-145   
ref|XP_003626241.1|  Epoxide hydrolase                                  429   7e-145   
ref|XP_010456047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    429   8e-145   
gb|KFK37968.1|  hypothetical protein AALP_AA3G053200                    429   1e-144   
emb|CDY05187.1|  BnaC05g46160D                                          430   1e-144   
gb|AES82458.2|  epoxide hydrolase                                       429   1e-144   
ref|XP_007222693.1|  hypothetical protein PRUPE_ppa008676mg             429   1e-144   
emb|CAZ86692.1|  epoxide hydrolase 1                                    429   2e-144   
ref|NP_567228.1|  putative epoxide hydrolase                            429   2e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429523.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    428   2e-144   
ref|XP_007163124.1|  hypothetical protein PHAVU_001G208300g             428   3e-144   
emb|CDY27752.1|  BnaA05g31610D                                          429   3e-144   
ref|XP_010422608.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    427   5e-144   
ref|XP_009147218.1|  PREDICTED: bifunctional epoxide hydrolase 2        427   7e-144   
ref|XP_008223222.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    426   1e-143   
ref|XP_009771842.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    426   2e-143   
ref|XP_004290776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    426   2e-143   
ref|XP_010546737.1|  PREDICTED: bifunctional epoxide hydrolase 2        425   7e-143   
ref|XP_002874922.1|  hypothetical protein ARALYDRAFT_490337             424   1e-142   
ref|XP_004494384.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    423   2e-142   
gb|KDO71745.1|  hypothetical protein CISIN_1g017221mg                   426   2e-142   
gb|KEH24510.1|  epoxide hydrolase                                       423   2e-142   
ref|XP_011079631.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    423   2e-142   
ref|XP_006489040.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    425   3e-142   
ref|XP_010556730.1|  PREDICTED: bifunctional epoxide hydrolase 2        422   5e-142   
ref|XP_006419515.1|  hypothetical protein CICLE_v10005186mg             424   6e-142   
gb|AFK39155.1|  unknown                                                 422   7e-142   
gb|EYU46741.1|  hypothetical protein MIMGU_mgv1a009984mg                422   7e-142   
ref|XP_007200440.1|  hypothetical protein PRUPE_ppa008875mg             422   7e-142   
ref|XP_004296863.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    422   7e-142   
emb|CDY50394.1|  BnaCnng19260D                                          421   1e-141   
ref|XP_002884518.1|  hypothetical protein ARALYDRAFT_317420             421   2e-141   
ref|NP_187211.1|  alpha/beta-Hydrolases superfamily protein             421   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352305.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    420   3e-141   
ref|XP_006604802.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    420   4e-141   
gb|KHG07158.1|  Epoxide hydrolase 2                                     420   4e-141   
emb|CDY65636.1|  BnaAnng20810D                                          420   5e-141   
ref|XP_010921626.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    419   5e-141   
gb|KDP28184.1|  hypothetical protein JCGZ_13955                         419   1e-140   
ref|XP_010486015.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    419   1e-140   
ref|XP_010464087.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    419   2e-140   
gb|ADP68585.1|  epoxide hydrolase A                                     418   2e-140   
ref|XP_003632381.1|  PREDICTED: bifunctional epoxide hydrolase 2        417   3e-140   
ref|XP_010269590.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    417   3e-140   
ref|XP_003550367.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    417   4e-140   
ref|XP_006299381.1|  hypothetical protein CARUB_v10015540mg             417   5e-140   
ref|XP_009111296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    417   5e-140   
ref|XP_006355815.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    417   6e-140   
ref|XP_008235117.1|  PREDICTED: bifunctional epoxide hydrolase 2        416   1e-139   
ref|XP_009620847.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    416   1e-139   
gb|KHG21329.1|  Epoxide hydrolase 2                                     419   1e-139   
ref|XP_003626240.1|  Epoxide hydrolase                                  431   2e-139   
ref|XP_004240550.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    415   2e-139   
gb|ACJ84799.1|  unknown                                                 415   3e-139   Medicago truncatula
ref|XP_008784769.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    415   3e-139   
ref|XP_004494576.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    415   3e-139   
gb|KEH24503.1|  epoxide hydrolase                                       415   3e-139   
ref|XP_009350800.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    415   3e-139   
ref|XP_003626244.1|  Epoxide hydrolase                                  415   3e-139   
ref|XP_007221833.1|  hypothetical protein PRUPE_ppa020197mg             415   3e-139   
gb|KHN43314.1|  Epoxide hydrolase 2                                     415   3e-139   
ref|NP_001238563.1|  epoxide hydrolase                                  416   5e-139   
gb|AFK45529.1|  unknown                                                 414   7e-139   
gb|ACJ84958.1|  unknown                                                 414   8e-139   Medicago truncatula
ref|XP_003626245.1|  Epoxide hydrolase                                  414   9e-139   
emb|CAA55294.1|  epoxide hydrolase                                      414   1e-138   Glycine max [soybeans]
ref|XP_003554635.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    414   1e-138   
ref|XP_007147004.1|  hypothetical protein PHAVU_006G088600g             414   1e-138   
gb|AES82420.2|  epoxide hydrolase                                       413   1e-138   
gb|AFK34299.1|  unknown                                                 412   4e-138   
gb|ACU23321.1|  unknown                                                 412   4e-138   Glycine max [soybeans]
gb|KHN20253.1|  Epoxide hydrolase 2                                     412   5e-138   
ref|XP_008355493.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    412   6e-138   
ref|XP_009391487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    412   6e-138   
ref|XP_007144960.1|  hypothetical protein PHAVU_007G198000g             412   7e-138   
gb|ACU19450.1|  unknown                                                 411   7e-138   Glycine max [soybeans]
ref|XP_003556522.1|  PREDICTED: bifunctional epoxide hydrolase 2 ...    412   8e-138   
ref|XP_010038230.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    411   9e-138   
ref|XP_010911257.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    411   1e-137   
ref|XP_009335707.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    411   1e-137   
ref|XP_010088294.1|  Epoxide hydrolase 2                                410   2e-137   
ref|XP_002523107.1|  epoxide hydrolase, putative                        410   2e-137   Ricinus communis
gb|AFK41660.1|  unknown                                                 410   4e-137   
ref|XP_002320333.2|  epoxide hydrolase family protein                   409   7e-137   Populus trichocarpa [western balsam poplar]
ref|XP_002523108.1|  epoxide hydrolase, putative                        409   9e-137   Ricinus communis
ref|XP_002302724.1|  epoxide hydrolase family protein                   408   1e-136   Populus trichocarpa [western balsam poplar]
ref|XP_010649574.1|  PREDICTED: bifunctional epoxide hydrolase 2        408   1e-136   
ref|XP_008386679.1|  PREDICTED: bifunctional epoxide hydrolase 2        408   2e-136   
gb|KFK30821.1|  hypothetical protein AALP_AA6G030400                    408   2e-136   
ref|XP_010105137.1|  Epoxide hydrolase 2                                408   2e-136   
ref|XP_007147005.1|  hypothetical protein PHAVU_006G088700g             407   3e-136   
ref|XP_010674075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    407   3e-136   
ref|XP_006444387.1|  hypothetical protein CICLE_v10021228mg             407   4e-136   
ref|XP_011041992.1|  PREDICTED: bifunctional epoxide hydrolase 2        407   5e-136   
ref|XP_009111297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    406   7e-136   
emb|CDY65635.1|  BnaAnng20800D                                          406   1e-135   
ref|XP_008340789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    406   1e-135   
ref|XP_002271210.1|  PREDICTED: bifunctional epoxide hydrolase 2        406   1e-135   Vitis vinifera
ref|XP_004494951.1|  PREDICTED: uncharacterized protein LOC101500941    417   1e-135   
ref|XP_007035641.1|  Alpha/beta-Hydrolases superfamily protein          409   2e-135   
ref|XP_006480000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    405   3e-135   
gb|KEH32298.1|  epoxide hydrolase                                       406   4e-135   
ref|XP_010088295.1|  Epoxide hydrolase 2                                404   5e-135   
ref|XP_011015179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    404   6e-135   
ref|XP_008341331.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    404   8e-135   
ref|XP_008371325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    404   9e-135   
ref|XP_006419522.1|  hypothetical protein CICLE_v10005425mg             404   9e-135   
ref|XP_007015353.1|  Alpha/beta-Hydrolases superfamily protein          404   1e-134   
ref|XP_009411662.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    404   1e-134   
emb|CDO98838.1|  unnamed protein product                                403   2e-134   
ref|XP_009386486.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    403   2e-134   
ref|XP_003626202.1|  Epoxide hydrolase                                  416   3e-134   
ref|XP_006489041.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    402   4e-134   
ref|XP_007154300.1|  hypothetical protein PHAVU_003G106900g             401   9e-134   
ref|XP_004290809.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    400   1e-133   
ref|XP_006444386.1|  hypothetical protein CICLE_v10023691mg             400   2e-133   
ref|XP_008361962.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    400   2e-133   
gb|KEH24395.1|  epoxide hydrolase                                       400   3e-133   
gb|KDP27825.1|  hypothetical protein JCGZ_18905                         399   4e-133   
gb|AAO27849.1|AF482450_1  soluble epoxide hydrolase                     399   5e-133   Euphorbia lagascae
ref|XP_010429482.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    400   5e-133   
ref|XP_011010961.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    399   8e-133   
ref|XP_009629123.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    398   1e-132   
ref|XP_006600362.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    400   1e-132   
ref|XP_011010960.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    398   1e-132   
gb|KHN03961.1|  Epoxide hydrolase 2                                     397   3e-132   
gb|AFK46740.1|  unknown                                                 397   3e-132   
ref|XP_010024724.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    397   4e-132   
gb|EPS67066.1|  pectinesterase                                          417   4e-132   
ref|XP_009775353.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    396   6e-132   
ref|XP_010693594.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    398   7e-132   
gb|AFK39700.1|  unknown                                                 396   9e-132   
ref|NP_001276233.1|  bifunctional epoxide hydrolase 2-like              396   1e-131   
gb|KDO87161.1|  hypothetical protein CISIN_1g048209mg                   397   1e-131   
ref|XP_004508197.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    395   4e-131   
ref|XP_004298141.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    394   6e-131   
ref|XP_007015342.1|  Alpha/beta-Hydrolases superfamily protein          394   7e-131   
ref|XP_008789846.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    393   9e-131   
gb|EYU43974.1|  hypothetical protein MIMGU_mgv1a009814mg                393   2e-130   
ref|XP_011091000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    392   3e-130   
ref|XP_008454322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    392   4e-130   
gb|EPS62395.1|  hypothetical protein M569_12392                         391   6e-130   
ref|XP_004239805.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    391   8e-130   
ref|XP_010038231.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    390   2e-129   
ref|XP_006349824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    390   2e-129   
ref|XP_004494577.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    391   2e-129   
ref|XP_006419517.1|  hypothetical protein CICLE_v10005451mg             389   3e-129   
ref|XP_010102979.1|  Epoxide hydrolase 2                                389   4e-129   
ref|XP_011006451.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    389   4e-129   
ref|XP_006299523.1|  hypothetical protein CARUB_v10015695mg             389   5e-129   
ref|XP_004239808.1|  PREDICTED: bifunctional epoxide hydrolase 2        389   6e-129   
ref|XP_008784772.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    389   7e-129   
ref|XP_008784771.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    389   9e-129   
ref|NP_001274962.1|  epoxide hydrolase                                  388   9e-129   
ref|XP_009622776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    389   1e-128   
ref|XP_008454327.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    388   1e-128   
ref|XP_004152242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    388   1e-128   
ref|XP_003604118.1|  Epoxide hydrolase                                  388   1e-128   
ref|XP_009393200.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    388   1e-128   
ref|XP_008784770.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    389   2e-128   
gb|EPS69185.1|  hypothetical protein M569_05583                         387   2e-128   
emb|CDO98837.1|  unnamed protein product                                387   3e-128   
ref|XP_004229258.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    387   3e-128   
dbj|BAK07144.1|  predicted protein                                      388   3e-128   
ref|XP_009757467.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    388   3e-128   
ref|XP_002270853.1|  PREDICTED: bifunctional epoxide hydrolase 2        387   4e-128   Vitis vinifera
gb|KDP27824.1|  hypothetical protein JCGZ_18904                         387   4e-128   
ref|NP_001274907.1|  epoxide hydrolase                                  386   7e-128   
ref|XP_010024723.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    386   8e-128   
ref|XP_006342824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    386   1e-127   
ref|XP_002516953.1|  epoxide hydrolase, putative                        385   1e-127   Ricinus communis
gb|EYU46742.1|  hypothetical protein MIMGU_mgv1a010264mg                385   2e-127   
ref|XP_009757465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   2e-127   
gb|KFK41013.1|  hypothetical protein AALP_AA2G073900                    385   2e-127   
ref|XP_009414133.1|  PREDICTED: bifunctional epoxide hydrolase 2        386   2e-127   
emb|CDP17110.1|  unnamed protein product                                385   2e-127   
ref|XP_010038234.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   3e-127   
ref|XP_010039296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   3e-127   
ref|XP_009622179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    384   5e-127   
ref|XP_008454330.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    384   5e-127   
ref|XP_010038235.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    384   6e-127   
ref|XP_004247402.1|  PREDICTED: bifunctional epoxide hydrolase 2        384   6e-127   
ref|XP_004239806.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    384   7e-127   
ref|XP_004252913.1|  PREDICTED: bifunctional epoxide hydrolase 2        383   9e-127   
ref|NP_001275417.1|  epoxide hydrolase                                  383   9e-127   
ref|XP_009788447.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    383   1e-126   
ref|XP_010684348.1|  PREDICTED: bifunctional epoxide hydrolase 2        383   2e-126   
pdb|3CXU|A  Chain A, Structure Of A Y149f Mutant Of Epoxide Hydro...    383   2e-126   
gb|KCW50060.1|  hypothetical protein EUGRSUZ_K03501                     383   2e-126   
ref|XP_011079630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   2e-126   
ref|XP_006359858.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   2e-126   
ref|XP_010649601.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    383   3e-126   
ref|NP_001275381.1|  epoxide hydrolase                                  382   3e-126   
ref|XP_010105136.1|  Epoxide hydrolase 2                                383   3e-126   
ref|XP_004152245.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   4e-126   
gb|EMT04118.1|  hypothetical protein F775_13984                         382   4e-126   
pdb|2CJP|A  Chain A, Structure Of Potato (Solanum Tuberosum) Epox...    382   4e-126   
gb|AFZ93648.1|  epoxide hydrolase                                       381   5e-126   
gb|KDP27828.1|  hypothetical protein JCGZ_18908                         381   6e-126   
ref|XP_009393199.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    381   6e-126   
ref|XP_006414412.1|  hypothetical protein EUTSA_v10025488mg             383   7e-126   
ref|XP_006342825.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    381   8e-126   
emb|CDY09722.1|  BnaC07g33390D                                          380   1e-125   
ref|XP_009136735.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   2e-125   
ref|XP_002314368.1|  hypothetical protein POPTR_0010s01430g             380   2e-125   Populus trichocarpa [western balsam poplar]
ref|XP_011006450.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    379   3e-125   
ref|XP_008807392.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    379   3e-125   
ref|XP_002314371.1|  hypothetical protein POPTR_0010s01440g             379   4e-125   Populus trichocarpa [western balsam poplar]
ref|XP_011090999.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    379   4e-125   
emb|CAJ19276.1|  putative epoxide hydrolase                             379   6e-125   Solanum commersonii
ref|XP_008775993.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    378   8e-125   
emb|CDX90550.1|  BnaA03g42310D                                          379   9e-125   
ref|XP_004229259.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    379   1e-124   
ref|XP_010039619.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    377   2e-124   
ref|XP_009622181.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    378   2e-124   
gb|KDP28185.1|  hypothetical protein JCGZ_13956                         377   2e-124   
gb|EYU21013.1|  hypothetical protein MIMGU_mgv1a010239mg                377   2e-124   
ref|NP_001055069.1|  Os05g0273800                                       377   3e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008454325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    377   3e-124   
gb|EYU43973.1|  hypothetical protein MIMGU_mgv1a010247mg                377   3e-124   
ref|XP_010914485.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    377   4e-124   
gb|EYU42746.1|  hypothetical protein MIMGU_mgv1a010198mg                376   4e-124   
ref|XP_006414587.1|  hypothetical protein EUTSA_v10025505mg             377   1e-123   
ref|XP_009598630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    375   1e-123   
gb|KDP28186.1|  hypothetical protein JCGZ_13957                         375   2e-123   
ref|XP_004152244.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    375   2e-123   
ref|XP_004156834.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    375   2e-123   
gb|AES82460.2|  epoxide hydrolase                                       384   2e-123   
ref|XP_010693593.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    376   2e-123   
ref|XP_011021885.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    375   3e-123   
ref|XP_003626242.1|  Epoxide hydrolase                                  384   3e-123   
ref|XP_006397371.1|  hypothetical protein EUTSA_v10022504mg             374   5e-123   
ref|XP_004152361.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    374   6e-123   
emb|CAD30841.1|  soluble epoxide hydrolase                              373   1e-122   Brassica napus [oilseed rape]
ref|XP_010914488.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    372   2e-122   
ref|XP_011039566.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    373   2e-122   
ref|XP_002306333.2|  hypothetical protein POPTR_0005s08280g             373   2e-122   Populus trichocarpa [western balsam poplar]
ref|XP_004965308.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    373   4e-122   
ref|XP_010039280.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    371   6e-122   
gb|AAM28292.1|  epoxide hydrolase                                       370   1e-121   Ananas comosus
ref|XP_009140747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    370   1e-121   
gb|KFK32480.1|  hypothetical protein AALP_AA6G247900                    370   2e-121   
emb|CDY48181.1|  BnaA04g15450D                                          370   2e-121   
ref|XP_010039627.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    370   2e-121   
ref|NP_001148885.1|  epoxide hydrolase 2                                369   3e-121   
emb|CDP10752.1|  unnamed protein product                                369   4e-121   
ref|XP_009775927.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    369   5e-121   
ref|XP_010914487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    368   1e-120   
ref|XP_002455386.1|  hypothetical protein SORBIDRAFT_03g009830          368   1e-120   
tpg|DAA53983.1|  TPA: epoxide hydrolase 2                               367   2e-120   
ref|XP_010449872.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    369   2e-120   
ref|XP_010434902.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    369   2e-120   
ref|NP_193331.6|  alpha/beta-Hydrolases superfamily protein             369   3e-120   
ref|XP_004134492.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    365   1e-119   
ref|XP_008775992.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    365   1e-119   
ref|XP_004967831.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    363   7e-119   
gb|KHG22415.1|  Epoxide hydrolase 2                                     362   2e-118   
ref|XP_003563920.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    363   3e-118   
ref|XP_002868171.1|  hypothetical protein ARALYDRAFT_329917             368   5e-118   
ref|XP_010038233.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    361   6e-118   
ref|XP_008438903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    362   2e-117   
ref|XP_002880830.1|  predicted protein                                  358   5e-117   
ref|XP_006296031.1|  hypothetical protein CARUB_v10025176mg             358   6e-117   
gb|ABK21215.1|  unknown                                                 358   8e-117   
ref|XP_006378063.1|  hypothetical protein POPTR_0010s01420g             357   1e-116   
ref|NP_180242.1|  soluble epoxide hydrolase                             357   1e-116   
ref|XP_006283220.1|  hypothetical protein CARUB_v10004250mg             370   1e-116   
ref|XP_002443185.1|  hypothetical protein SORBIDRAFT_08g014640          359   1e-116   
gb|EMT09897.1|  hypothetical protein F775_52362                         358   1e-116   
gb|AAA81893.1|  epoxide hydrolase                                       356   3e-116   
gb|ABR16314.1|  unknown                                                 356   3e-116   
ref|XP_009136732.1|  PREDICTED: bifunctional epoxide hydrolase 2        357   3e-116   
emb|CDX90553.1|  BnaA03g42280D                                          355   8e-116   
gb|EPS69728.1|  epoxide hydrolase                                       355   1e-115   
ref|XP_004981166.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    354   2e-115   
dbj|BAJ99775.1|  predicted protein                                      353   5e-115   
ref|XP_003566463.1|  PREDICTED: bifunctional epoxide hydrolase 2        353   6e-115   
ref|XP_010417820.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    352   9e-115   
emb|CAB46034.1|  putative epoxide hydrolase                             360   1e-114   
ref|XP_010449873.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    352   2e-114   
ref|XP_004152243.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    352   2e-114   
gb|KHG16220.1|  Epoxide hydrolase 2                                     352   2e-114   
gb|KFK41012.1|  hypothetical protein AALP_AA2G073800                    352   2e-114   
ref|NP_001150215.1|  epoxide hydrolase 2                                352   2e-114   
emb|CDY09727.1|  BnaC07g33340D                                          352   2e-114   
gb|ACF83934.1|  unknown                                                 352   3e-114   
ref|XP_002463580.1|  hypothetical protein SORBIDRAFT_01g002410          352   3e-114   
ref|XP_006408053.1|  hypothetical protein EUTSA_v100212090mg            349   5e-114   
ref|XP_010434903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    351   6e-114   
emb|CDM82646.1|  unnamed protein product                                350   7e-114   
ref|NP_001042621.1|  Os01g0255000                                       350   1e-113   
ref|XP_006414415.1|  hypothetical protein EUTSA_v10025689mg             350   1e-113   
ref|NP_001042622.1|  Os01g0255100                                       349   3e-113   
ref|XP_010440228.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    349   4e-113   
ref|XP_006644009.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    347   1e-112   
ref|XP_010473058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    347   2e-112   
ref|XP_010544298.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    346   4e-112   
ref|XP_010548981.1|  PREDICTED: bifunctional epoxide hydrolase 2        345   7e-112   
ref|NP_180243.1|  alpha/beta-hydrolases superfamily protein             345   1e-111   
ref|XP_006444395.1|  hypothetical protein CICLE_v10024303mg             342   4e-111   
ref|NP_001132040.1|  uncharacterized protein LOC100193450               345   5e-111   
gb|AFW56302.1|  hypothetical protein ZEAMMB73_530848                    345   1e-110   
ref|XP_010524544.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    344   1e-110   
ref|XP_008454324.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    343   1e-110   
ref|XP_006433456.1|  hypothetical protein CICLE_v10001881mg             339   2e-110   
emb|CAD31713.1|  epoxide hydrolase                                      340   2e-110   
dbj|BAK06387.1|  predicted protein                                      339   2e-109   
ref|XP_006414584.1|  hypothetical protein EUTSA_v10025778mg             338   4e-109   
ref|NP_001051780.1|  Os03g0829100                                       338   4e-109   
ref|XP_006650836.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    338   5e-109   
emb|CDY57860.1|  BnaC08g47760D                                          336   2e-108   
ref|XP_010440227.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    337   5e-108   
ref|XP_010229424.1|  PREDICTED: uncharacterized protein LOC100841009    348   1e-107   
gb|KHG02721.1|  Epoxide hydrolase 2                                     332   1e-107   
gb|AFK41347.1|  unknown                                                 330   7e-107   
ref|XP_010544295.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    330   5e-106   
gb|EAZ11286.1|  hypothetical protein OsJ_01142                          332   5e-106   
ref|XP_006838632.1|  hypothetical protein AMTR_s00002p00236030          328   4e-105   
ref|XP_008246047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    324   3e-104   
dbj|BAJ91671.1|  predicted protein                                      325   7e-104   
ref|XP_004981168.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    325   9e-104   
ref|NP_001154238.1|  alpha/beta-Hydrolases superfamily protein          323   2e-103   
dbj|BAJ89155.1|  predicted protein                                      324   2e-103   
ref|XP_004981167.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    323   3e-103   
gb|KHG02720.1|  Epoxide hydrolase 2                                     337   5e-103   
ref|XP_002979677.1|  hypothetical protein SELMODRAFT_111571             322   8e-103   
ref|XP_006838631.1|  hypothetical protein AMTR_s00002p00235860          321   2e-102   
ref|XP_006838629.1|  hypothetical protein AMTR_s00002p00235200          320   3e-102   
ref|XP_002985384.1|  hypothetical protein SELMODRAFT_181715             320   5e-102   
ref|XP_007147003.1|  hypothetical protein PHAVU_006G088600g             317   6e-102   
gb|KEH24512.1|  epoxide hydrolase                                       317   6e-102   
ref|XP_002967234.1|  hypothetical protein SELMODRAFT_87385              320   7e-102   
gb|KEH24504.1|  epoxide hydrolase                                       316   1e-101   
ref|XP_002960490.1|  hypothetical protein SELMODRAFT_266570             319   1e-101   
ref|XP_002310826.2|  epoxide hydrolase family protein                   318   2e-101   
emb|CDJ26688.1|  unnamed protein product                                318   2e-101   
ref|XP_006650837.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    318   4e-101   
ref|XP_010275536.1|  PREDICTED: bifunctional epoxide hydrolase 2        317   7e-101   
ref|NP_001151201.1|  epoxide hydrolase 2                                317   1e-100   
ref|XP_010100621.1|  Epoxide hydrolase 2                                314   2e-100   
ref|XP_008680999.1|  PREDICTED: uncharacterized protein LOC100191...    316   2e-100   
ref|XP_010042740.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    311   1e-99    
gb|EAY92418.1|  hypothetical protein OsI_14152                          314   2e-99    
ref|XP_006419521.1|  hypothetical protein CICLE_v10005425mg             310   2e-99    
ref|XP_002459617.1|  hypothetical protein SORBIDRAFT_02g007580          313   2e-99    
gb|KCW50054.1|  hypothetical protein EUGRSUZ_K03494                     310   2e-99    
ref|XP_011025873.1|  PREDICTED: bifunctional epoxide hydrolase 2        313   2e-99    
ref|XP_008338037.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    312   5e-99    
ref|XP_002880829.1|  predicted protein                                  311   5e-99    
ref|XP_009346065.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    312   6e-99    
gb|ACG46051.1|  epoxide hydrolase 2                                     312   6e-99    
ref|XP_006479996.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    309   8e-99    
ref|XP_009346066.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    311   8e-99    
ref|XP_008354646.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    311   2e-98    
ref|XP_007156093.1|  hypothetical protein PHAVU_003G257900g             311   2e-98    
ref|XP_011015180.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    307   5e-98    
gb|AGV54241.1|  epoxide hydrolase 2-like protein                        309   8e-98    
dbj|BAJ90007.1|  predicted protein                                      308   2e-97    
gb|EMT01002.1|  hypothetical protein F775_32452                         308   2e-97    
gb|ACN28644.1|  unknown                                                 306   2e-97    
gb|KDP37443.1|  hypothetical protein JCGZ_08284                         307   4e-97    
ref|XP_003577254.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    307   6e-97    
ref|XP_010557474.1|  PREDICTED: bifunctional epoxide hydrolase 2        306   9e-97    
ref|XP_008223225.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    303   2e-96    
ref|NP_001051781.1|  Os03g0829200                                       306   2e-96    
gb|KDO87174.1|  hypothetical protein CISIN_1g021158mg                   302   4e-96    
ref|XP_003577188.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    305   5e-96    
ref|XP_011100955.1|  PREDICTED: bifunctional epoxide hydrolase 2        304   8e-96    
emb|CDJ26419.1|  unnamed protein product                                302   4e-95    
gb|EMS55500.1|  Epoxide hydrolase 2                                     300   5e-95    
ref|XP_006433454.1|  hypothetical protein CICLE_v10003596mg             300   5e-95    
gb|KHN02949.1|  Epoxide hydrolase 2                                     299   8e-95    
emb|CAN77654.1|  hypothetical protein VITISV_032325                     301   9e-95    
ref|XP_010275537.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    301   1e-94    
gb|EAY73347.1|  hypothetical protein OsI_01224                          301   1e-94    
ref|XP_001753609.1|  predicted protein                                  301   2e-94    
gb|EAY92419.1|  hypothetical protein OsI_14153                          301   3e-94    
gb|AFK36273.1|  unknown                                                 300   3e-94    
ref|XP_002275186.1|  PREDICTED: bifunctional epoxide hydrolase 2        299   5e-94    
ref|XP_008354647.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    299   6e-94    
ref|XP_006296069.1|  hypothetical protein CARUB_v10025219mg             298   7e-94    
ref|XP_010028623.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    299   8e-94    
gb|KEH24396.1|  epoxide hydrolase                                       295   1e-93    
ref|XP_008337725.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    298   2e-93    
gb|KDO38861.1|  hypothetical protein CISIN_1g026419mg                   295   2e-93    
gb|AFK43935.1|  unknown                                                 298   2e-93    
ref|XP_010107837.1|  Epoxide hydrolase 2                                298   2e-93    
ref|XP_003520282.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    297   4e-93    
ref|XP_008241747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    296   4e-93    
ref|XP_004287856.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    297   6e-93    
ref|XP_008644360.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    296   8e-93    
emb|CDP01962.1|  unnamed protein product                                294   5e-92    
gb|AFK43554.1|  unknown                                                 294   7e-92    
ref|NP_001240134.1|  uncharacterized protein LOC100809053               293   1e-91    
ref|XP_008454323.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    291   2e-91    
ref|XP_002521508.1|  epoxide hydrolase, putative                        292   3e-91    
ref|XP_004509321.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    291   7e-91    
ref|XP_011006454.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    290   8e-91    
gb|KEH20402.1|  epoxide hydrolase                                       291   1e-90    
gb|AFK46496.1|  unknown                                                 290   2e-90    
ref|XP_007046807.1|  Alpha/beta-Hydrolases superfamily protein is...    290   2e-90    
dbj|BAK08144.1|  predicted protein                                      290   3e-90    
dbj|BAJ98388.1|  predicted protein                                      289   4e-90    
gb|KHN27037.1|  Epoxide hydrolase 2                                     289   8e-90    
ref|XP_003557340.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    286   7e-89    
ref|XP_010254690.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    286   1e-88    
ref|XP_008775994.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    283   1e-88    
gb|KHN00509.1|  Epoxide hydrolase 2                                     285   1e-88    
ref|XP_010649095.1|  PREDICTED: bifunctional epoxide hydrolase 2        285   1e-88    
ref|NP_190669.1|  alpha/beta-Hydrolases superfamily protein             285   2e-88    
ref|XP_006654297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    282   3e-88    
ref|XP_010033445.1|  PREDICTED: bifunctional epoxide hydrolase 2        285   3e-88    
ref|XP_008241748.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    283   7e-88    
gb|KCW50160.1|  hypothetical protein EUGRSUZ_K03595                     280   8e-88    
ref|XP_008366789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    283   1e-87    
gb|ACU23953.1|  unknown                                                 280   1e-87    
ref|XP_009346058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    281   4e-87    
ref|XP_007202253.1|  hypothetical protein PRUPE_ppa008854mg             281   5e-87    
gb|KCW84773.1|  hypothetical protein EUGRSUZ_B015792                    277   9e-87    
ref|XP_010503777.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    280   1e-86    
ref|XP_010426641.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    280   2e-86    
emb|CDY26530.1|  BnaC01g23690D                                          279   4e-86    
ref|XP_010515481.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    279   4e-86    
ref|XP_006291410.1|  hypothetical protein CARUB_v10017549mg             279   1e-85    
gb|KHG08034.1|  Epoxide hydrolase 2                                     278   1e-85    
ref|XP_004287855.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    278   1e-85    
ref|XP_002451255.1|  hypothetical protein SORBIDRAFT_05g026560          277   2e-85    
ref|XP_002877783.1|  hypothetical protein ARALYDRAFT_485452             277   3e-85    
ref|XP_006403966.1|  hypothetical protein EUTSA_v10010546mg             277   3e-85    
emb|CDY33304.1|  BnaA01g19710D                                          276   5e-85    
ref|XP_003579088.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    276   5e-85    
ref|XP_008677783.1|  PREDICTED: epoxide hydrolase 2 isoform X1          273   2e-84    
ref|XP_010254688.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    274   2e-84    
ref|XP_006489255.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    272   2e-84    
ref|XP_006487348.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    274   3e-84    
ref|XP_006423389.1|  hypothetical protein CICLE_v10028838mg             274   4e-84    
emb|CDY50393.1|  BnaCnng19250D                                          270   8e-84    
gb|KDO49467.1|  hypothetical protein CISIN_1g020621mg                   272   1e-83    
emb|CDX77971.1|  BnaA09g31660D                                          272   2e-83    
ref|XP_009115780.1|  PREDICTED: bifunctional epoxide hydrolase 2        272   2e-83    
gb|AFK36778.1|  unknown                                                 267   4e-83    
ref|XP_010547454.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    271   5e-83    
ref|XP_007046808.1|  Alpha/beta-Hydrolases superfamily protein is...    270   6e-83    
ref|WP_012852003.1|  epoxide hydrolase                                  270   1e-82    
ref|XP_009598691.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   3e-82    
ref|XP_010679802.1|  PREDICTED: bifunctional epoxide hydrolase 2        268   6e-82    
ref|NP_001152729.1|  LOC100286370                                       267   1e-81    
ref|XP_004963322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    267   2e-81    
ref|XP_009136579.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   3e-81    
ref|XP_010039297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    264   4e-81    
ref|XP_006382453.1|  hypothetical protein POPTR_0005s02320g             261   8e-81    
ref|XP_010544465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    262   3e-80    
ref|NP_001147768.1|  LOC100281378                                       264   3e-80    
dbj|BAK01028.1|  predicted protein                                      263   8e-80    
ref|XP_008662613.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    262   1e-79    
ref|XP_002443655.1|  hypothetical protein SORBIDRAFT_08g022970          261   3e-79    
ref|WP_020669616.1|  hypothetical protein                               260   5e-79    
ref|NP_001067364.1|  Os12g0636400                                       259   2e-78    
ref|XP_006664242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   4e-78    
gb|KFK34347.1|  hypothetical protein AALP_AA5G133500                    258   5e-78    
emb|CAN65686.1|  hypothetical protein VITISV_022460                     252   9e-78    
gb|EAZ29152.1|  hypothetical protein OsJ_13213                          256   9e-78    
ref|WP_016574863.1|  epoxide hydrolase                                  256   2e-77    
ref|WP_035692775.1|  epoxide hydrolase                                  256   2e-77    



>ref|XP_009788536.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=315

 Score =   505 bits (1300),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 237/307 (77%), Positives = 276/307 (90%), Gaps = 4/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TV VNGINMHVAEKGQGPV+LFLHGFPELWYTWRHQL  FA LGYRAVAPDLR
Sbjct  1     MEGIEHRTVNVNGINMHVAEKGQGPVVLFLHGFPELWYTWRHQLVAFADLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP+ + +SYTC HVVGDLVAL++SLGV+ VFLVAHDWGA+IGWY C+FRPDLVK
Sbjct  61    GYGDTDAPA-EAASYTCFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCLFRPDLVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPFRPRHP MKP+  MRAFFGDDYY+CRFQ+ G +E +IA +GSE VL+KI TD
Sbjct  120   AYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPG-MEDEIAKYGSEAVLKKILTD  178

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             RK GPPCLPKENPFGIS D  KLPSWLS+ DLKYY++K+D KGFTGGLNYYR+++LNWEL
Sbjct  179   RKPGPPCLPKENPFGISPDS-KLPSWLSQDDLKYYSTKFDQKGFTGGLNYYRALDLNWEL  237

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLL-EEIVVIEGGGHFLN  432
             TAAWTG +VKVPVKFMVG++D+VYTTPG+KEYVHGGGFKKDVP+L E++VV+EG  HF+N
Sbjct  238   TAAWTGAKVKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGAAHFIN  297

Query  431   QERPEEV  411
             QER ++ 
Sbjct  298   QERAQDT  304



>gb|ACE82566.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   501 bits (1289),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 235/307 (77%), Positives = 273/307 (89%), Gaps = 4/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH+TV VNGINMHVAEKG+GPV+LFLHGFPELWYTWRHQL  FA LGYRAVAPDLR
Sbjct  1     MESIEHRTVNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQLVAFADLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP+   +SYTC HVVGDLVAL++SLGV+ VFLVAHDWGA+IGWY C+FRPDLVK
Sbjct  61    GYGDTDAPA-DVASYTCFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCLFRPDLVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPFRPRHP MKP+  MRAFFGDDYY+CRFQ+  R+E +IA +GSE VL+KI TD
Sbjct  120   AYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDP-RMEDEIAKNGSEAVLKKILTD  178

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             RK GPPCLPKENPFGIS D  KLPSWLS+ DLKYY++K+D KGFTGGLNYYR+++LNWEL
Sbjct  179   RKPGPPCLPKENPFGISPDS-KLPSWLSQDDLKYYSTKFDQKGFTGGLNYYRALDLNWEL  237

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLL-EEIVVIEGGGHFLN  432
             TAAWTG + KVPVKFMVG++D+VYTTPG+KEYVHGGGFKKDVP+L E++VV+EG  HF+N
Sbjct  238   TAAWTGAKAKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGAAHFIN  297

Query  431   QERPEEV  411
             QER +E 
Sbjct  298   QERAQET  304



>emb|CDP17206.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   500 bits (1288),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 232/307 (76%), Positives = 272/307 (89%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEHK V +NGINMHVAEKG+GPV+LFLHGFPELWYTWRHQ+  FA LGYRAVAPDLR
Sbjct  1     MEGIEHKIVDLNGINMHVAEKGEGPVVLFLHGFPELWYTWRHQITAFATLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAPS   SSYTC H+VGDLVAL+QSLGVD VFLVAHDWGA+I WY C+FRPD+VK
Sbjct  61    GYGDTDAPS-SISSYTCFHIVGDLVALIQSLGVDHVFLVAHDWGAMIAWYLCLFRPDMVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +++PFRPR+P MKP+  +RAFFG++YY+CRFQE G IE++IA +GS+ VL+KI TD
Sbjct  120   AFVSLTLPFRPRNPKMKPIAGLRAFFGEEYYMCRFQEPGEIEAEIAKYGSKAVLKKILTD  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GPPCLPK NPFGIS D   KLP+WLSE+DLKYYA+KY  KGFTGGLNYYR+++LNWE
Sbjct  180   RKPGPPCLPKGNPFGISPDTDIKLPAWLSEEDLKYYANKYAQKGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG +VKVPVKF+VGD+DMVYTTPG +EYVHGGGFK+DVP LEE V+++G GHFL+
Sbjct  240   LTAAWTGAQVKVPVKFIVGDLDMVYTTPGTQEYVHGGGFKRDVPFLEEPVIMKGTGHFLH  299

Query  431   QERPEEV  411
             QER EE+
Sbjct  300   QERAEEI  306



>ref|XP_009629075.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=315

 Score =   496 bits (1278),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 235/307 (77%), Positives = 273/307 (89%), Gaps = 4/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH++V VNGINMHVAEKGQGPV+LFLHGFPELWYTWRHQL  FA LGYRAVAPDLR
Sbjct  1     MEGIEHRSVNVNGINMHVAEKGQGPVVLFLHGFPELWYTWRHQLVAFAELGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP  + +SYT  HVVGDLVAL++SLGV+ VFLVAHDWGA+IGWY C+FRPDLVK
Sbjct  61    GYGDTDAPG-EVASYTYFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCLFRPDLVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPFRPRHP MKP+  MRAFFGDDYY+CRFQ+ G +E +IA +GSE VL+KI TD
Sbjct  120   AYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPG-MEDEIAKYGSEAVLKKILTD  178

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             RK GPPCLPKENPFGIS+D  KLPSWLS+ DL YY+SK+D KGFTGGLNYYR+++L+WEL
Sbjct  179   RKPGPPCLPKENPFGISSDS-KLPSWLSQDDLNYYSSKFDQKGFTGGLNYYRALDLSWEL  237

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEE-IVVIEGGGHFLN  432
             TAAWTG  VKVPVKF+VG++D+VYTTPG+KEYVHGGGFKKDVP+LEE +VV+EG  HF+N
Sbjct  238   TAAWTGATVKVPVKFVVGELDLVYTTPGMKEYVHGGGFKKDVPMLEEDVVVMEGAAHFIN  297

Query  431   QERPEEV  411
             QER +E 
Sbjct  298   QERAQET  304



>gb|ACE82565.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   495 bits (1275),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 233/307 (76%), Positives = 274/307 (89%), Gaps = 4/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH+TV VNGINMHVAEKG+GPVILFLHGFPELWYTWRHQL  FA LG+RAVAPDLR
Sbjct  1     MESIEHRTVNVNGINMHVAEKGKGPVILFLHGFPELWYTWRHQLVAFADLGHRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP+ + +SYTC HVVGDLVAL++SLGV+ VFLVAHDWGA+IGWY C+FRPDLVK
Sbjct  61    GYGDTDAPA-EAASYTCFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCLFRPDLVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPFRPRHP MKP+  MRAFFGDDYY+CRFQ+ G +E +IA +GSE VL+KI TD
Sbjct  120   AYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPG-MEEEIAKYGSEVVLKKILTD  178

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             RK GPPCLPK +PFGIS D  KLPSWLS+ DL YY++K+D KGFTGGLNYYR+++LNWEL
Sbjct  179   RKPGPPCLPKGSPFGISPDS-KLPSWLSQDDLNYYSTKFDRKGFTGGLNYYRALDLNWEL  237

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLL-EEIVVIEGGGHFLN  432
             TAAWTG +VKVPVKFMVG++D+VYTTPG+KEYVHGGGFKKDVP+L E++VV+EG  HF+N
Sbjct  238   TAAWTGAKVKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGAAHFIN  297

Query  431   QERPEEV  411
             QER +E+
Sbjct  298   QERAQEI  304



>ref|XP_011092097.1| PREDICTED: bifunctional epoxide hydrolase 2 [Sesamum indicum]
Length=317

 Score =   493 bits (1268),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 228/307 (74%), Positives = 271/307 (88%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TV VNGINMHVAEKGQGP++LFLHGFPELWYTWRHQ+  FA LGYRAVAPDLR
Sbjct  1     MEGIEHRTVSVNGINMHVAEKGQGPIVLFLHGFPELWYTWRHQIVAFAALGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGV-DKVFLVAHDWGAIIGWYFCMFRPDLV  972
             GYG+TDAP+ + SSY+CLHVVGD+VAL++SLG  D+VFLVAHDWGA+IGWY C+FRPDLV
Sbjct  61    GYGDTDAPA-EVSSYSCLHVVGDIVALIESLGGGDQVFLVAHDWGAMIGWYLCLFRPDLV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V ++VPFRPRHP +KPVE MRAFFG+DYY+CRFQE G++ES+IA +G+E V++KI T
Sbjct  120   KAYVSLTVPFRPRHPNVKPVEGMRAFFGEDYYMCRFQEPGKMESEIARYGAEAVIKKILT  179

Query  791   DRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             DR  GPP LPKE PFG + D  KLP W +E DLKYYA  Y+ +GFTGGLNYYR+++LNWE
Sbjct  180   DRTPGPPYLPKETPFGSNIDDIKLPPWFTEDDLKYYAENYEKRGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG +V+VPVKF+VGD+DMVYTTPG+KEYVHGGGFK DVPLLEE VV++  GHFLN
Sbjct  240   LTAAWTGAKVRVPVKFVVGDVDMVYTTPGLKEYVHGGGFKNDVPLLEECVVMDNVGHFLN  299

Query  431   QERPEEV  411
             QE+ +EV
Sbjct  300   QEKADEV  306



>ref|XP_006344695.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=314

 Score =   483 bits (1242),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 223/306 (73%), Positives = 267/306 (87%), Gaps = 3/306 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+T+ VNGINMHVAEKG+GPV+LFLHGFPELWYTWRHQ+   A  GYRAVAPDLR
Sbjct  1     MEGIEHRTLNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQIVALADQGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP  + +SYT  HVVGDLVAL++SLGV+ VFLVAHDWGA+IGWY C+FRPDLVK
Sbjct  61    GYGDTDAPK-EVTSYTYFHVVGDLVALIESLGVENVFLVAHDWGAMIGWYLCLFRPDLVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVP RPRHP MKP+  MRAF GDDYY+CRFQ+ G +E ++A +GSE VL+KI  D
Sbjct  120   AYVCLSVPLRPRHPKMKPIPTMRAFLGDDYYMCRFQDPG-MEDEMAKYGSEAVLKKILID  178

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             RK GPPCLPK+NPFGISTD  KLP WLS+ DL YY++K+D KGFTGGLNYYR+++LNWEL
Sbjct  179   RKPGPPCLPKDNPFGISTDD-KLPLWLSQDDLNYYSTKFDQKGFTGGLNYYRALDLNWEL  237

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG++V VPVKF+VGD+D+VYTTPG+KEYVHGGGFKKDVP+L+++VV+EG  HF+NQ
Sbjct  238   TAPWTGVKVNVPVKFVVGDLDVVYTTPGMKEYVHGGGFKKDVPMLDDVVVLEGAAHFINQ  297

Query  428   ERPEEV  411
             ER +E 
Sbjct  298   ERAQET  303



>ref|XP_004230258.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=314

 Score =   478 bits (1229),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 223/306 (73%), Positives = 265/306 (87%), Gaps = 3/306 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+T+ VNGINMHVAEKG+GPV+LFLHGFPELWYTWRHQ+   A  GYRAVAPDLR
Sbjct  1     MEGIEHRTLNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQIVALADQGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP  + +SYT  HVVGDLVAL++SLGV+ VFLVAHDWGA+IGWY CMFRPDLVK
Sbjct  61    GYGDTDAPK-EVTSYTYFHVVGDLVALIESLGVESVFLVAHDWGAMIGWYLCMFRPDLVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPFRPR+P MKP+  MRAF GDDYY+CRFQ+ G +E +IA +GSE +L+KI  D
Sbjct  120   AYVCLSVPFRPRNPKMKPIPTMRAFLGDDYYMCRFQDPG-MEDEIAKYGSEAILKKILID  178

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R  GPP LPKENPFGIST+  KLP WLS+ DL YY++K+D KGFTGGLNYYR+++LNWEL
Sbjct  179   RTPGPPRLPKENPFGISTND-KLPLWLSQDDLNYYSTKFDQKGFTGGLNYYRALDLNWEL  237

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG++V VPVKF+VGD+D+VYTTPG+KEYVHGGGFKKDVP+LE +VV+EG  HF+NQ
Sbjct  238   TAPWTGVKVNVPVKFVVGDLDVVYTTPGVKEYVHGGGFKKDVPMLEGVVVLEGAAHFINQ  297

Query  428   ERPEEV  411
             ER +E 
Sbjct  298   ERAQET  303



>ref|XP_002283462.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 260/307 (85%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+ V VNGI MHVAEKGQGPV+LFLHGFPELWYTWRHQ+   A  GY AVAPDLR
Sbjct  1     MEGIEHRMVSVNGIKMHVAEKGQGPVVLFLHGFPELWYTWRHQIIAMASHGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GY +++AP+   +SYTCLHVVGDL+AL+  LG DKVFLV HDWGA IGWY C+FRPD VK
Sbjct  61    GYSDSEAPA-SFTSYTCLHVVGDLIALIDCLGADKVFLVGHDWGAQIGWYMCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V ++VPFRPR+P ++P+E MRAFFGDDYY+CRFQ+ G IE++IA  GS++VL++I TD
Sbjct  120   AYVSLTVPFRPRNPKIRPIEGMRAFFGDDYYMCRFQKPGEIEAEIARLGSKEVLKRILTD  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GPPCLPKENPFGI    P  LPSW SE+DL YYA KYD KGFTGGLNYYR+++LNWE
Sbjct  180   RKPGPPCLPKENPFGIKAIPPSPLPSWFSEEDLNYYARKYDEKGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG +V+VPVKF+VGD+DMVYTTPG+KEYV  G FKKDVP LE+IV+IEG GHF+N
Sbjct  240   LTAPWTGEQVRVPVKFVVGDLDMVYTTPGVKEYVDSGAFKKDVPCLEDIVIIEGAGHFIN  299

Query  431   QERPEEV  411
             QE+ EE+
Sbjct  300   QEKAEEI  306



>ref|XP_002512456.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF49908.1| epoxide hydrolase, putative [Ricinus communis]
Length=317

 Score =   471 bits (1212),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 261/307 (85%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI HKTV VNGI MH+AEKG+GPVILFLHGFPELWYTWRHQ+     LGYRAVAPDLR
Sbjct  1     MEGIMHKTVNVNGIKMHIAEKGEGPVILFLHGFPELWYTWRHQILGLTSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP+L  SSYTC H+VGDL+AL+  LGV++VFLVAHDWGAI+GWY C+FRPD VK
Sbjct  61    GYGDSDAPTLC-SSYTCHHIVGDLIALIDHLGVEQVFLVAHDWGAIMGWYLCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPFRPR+P MKPVE+MR  FGDDYY+CRFQE G IE++IA  G  +V++KI TD
Sbjct  120   AFVCLSVPFRPRNPKMKPVESMRLLFGDDYYVCRFQEPGEIEAEIARCGPAEVIKKILTD  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GP CL KEN FGI  + P  LPSWL+E+D+ YYA+ ++ KGFTG LNYYR+++L+WE
Sbjct  180   RKPGPSCLFKENAFGICPNNPITLPSWLTEEDVAYYAANFNQKGFTGALNYYRAMDLSWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG  VKVPVKF+VGD+DMVYTTPGIKEYVHGGGF+  VPLLEEIVV+E  GHF+N
Sbjct  240   LTAPWTGDSVKVPVKFVVGDLDMVYTTPGIKEYVHGGGFRYYVPLLEEIVVMEEVGHFIN  299

Query  431   QERPEEV  411
             QERPEE+
Sbjct  300   QERPEEI  306



>ref|XP_011023717.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   468 bits (1205),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 215/307 (70%), Positives = 265/307 (86%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+GI H+ VKVNGI+MH+AEKGQGPV+LFLHGFPELWY+WRHQ+   + LGY+AVAPDLR
Sbjct  1     MDGISHRMVKVNGIDMHIAEKGQGPVVLFLHGFPELWYSWRHQILALSSLGYQAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP+   SSY+CLH+VGDL+AL+  LGV+KVFLVAHDWGA+IGWY C+FRPD VK
Sbjct  61    GYGDTEAPA-SISSYSCLHIVGDLIALIDYLGVEKVFLVAHDWGALIGWYLCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVP+RPR+P MKPVE+M+  FG+DYY+CRFQE G +E +IA  G+E+VL+KI TD
Sbjct  120   AYVCLSVPYRPRNPKMKPVESMKLVFGEDYYMCRFQEPGVVEDEIARAGTEEVLKKILTD  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GP CLPKENPFGI  ++P  +PSWLSE DL +YA+KY  KGFTGGLNYYR+++LNWE
Sbjct  180   RKPGPLCLPKENPFGIYPEEPVTMPSWLSEADLSFYATKYSQKGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA+WTG  V VPVKF+VGD+DMVYT PG+KE+V+ GGFK  VPLLEEIVV+EG GHF+N
Sbjct  240   LTASWTGAPVNVPVKFVVGDLDMVYTNPGMKEFVNSGGFKHYVPLLEEIVVMEGVGHFIN  299

Query  431   QERPEEV  411
             QE+ EE+
Sbjct  300   QEKAEEI  306



>ref|XP_007031041.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY11543.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=317

 Score =   467 bits (1201),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 216/307 (70%), Positives = 261/307 (85%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+GI+H+ V VNGI MHVAEKGQGPVILFLHGFPELWYTWRHQ+   + LGY  VAPDLR
Sbjct  1     MDGIQHRMVNVNGITMHVAEKGQGPVILFLHGFPELWYTWRHQILALSSLGYHTVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+A S   +SYTCLH+VGDL+AL+ SLGV++VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTEA-STCVTSYTCLHIVGDLIALIDSLGVEQVFLVAHDWGAIIGWYLCMFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPF PR P MKPVE+MR  FG+DYYICRFQE G+IE++IA  G+ +VL+K+ + 
Sbjct  120   AFVCLSVPFMPRKPKMKPVESMRLLFGEDYYICRFQEPGKIEAEIAHVGTSEVLKKVLST  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R+ GPP LPK++ FGI  D P  LPSW SE+DL YYA+K++ KGFTGGLNYYR+++LNWE
Sbjct  180   REPGPPRLPKDDAFGIKPDTPVTLPSWFSEEDLSYYANKFNQKGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WT ++VK+PVKF+VGD+D VYTTPGIKEYV  GGFK+DVPLL+E+VV+EG GHF+N
Sbjct  240   LTAPWTNVQVKLPVKFIVGDLDTVYTTPGIKEYVQSGGFKRDVPLLDEVVVMEGVGHFIN  299

Query  431   QERPEEV  411
             QER EE+
Sbjct  300   QERAEEI  306



>gb|KHG24497.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   466 bits (1198),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 214/307 (70%), Positives = 259/307 (84%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I HK V VNGI+MHVAEKG+GPVILFLHGFPELWYTWRHQ+   + LGY AVAPDLR
Sbjct  1     MERIRHKMVNVNGISMHVAEKGEGPVILFLHGFPELWYTWRHQIIALSSLGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP+   SSY+C+ +VGDLVAL+ SLGV++VFLVAHDWGAIIGWY C+FRPD VK
Sbjct  61    GYGDTEAPT-AISSYSCMQIVGDLVALIDSLGVEQVFLVAHDWGAIIGWYLCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPF PR P MKPVE+MR FFGDDYYICRFQE G+IE++IA +G+  VL+KI + 
Sbjct  120   AFVCLSVPFMPRKPQMKPVESMRLFFGDDYYICRFQEPGKIEAEIARYGASNVLKKIISS  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GPPC+PK+N FGI  D P  LPSW SE+DL YYA+K++ KGFTG LNYYR+ +LNWE
Sbjct  180   RKPGPPCMPKDNAFGIKPDTPITLPSWFSEEDLSYYANKFNKKGFTGALNYYRAFDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
              TA WT  +VKVPVKF+VGD+D VYTTPG+KEYV+GG FK+D P+LEE+V+++G GHF+N
Sbjct  240   QTAPWTNTQVKVPVKFIVGDLDSVYTTPGMKEYVNGGDFKRDAPMLEEVVIMKGVGHFIN  299

Query  431   QERPEEV  411
             QER +E+
Sbjct  300   QERADEI  306



>gb|KDP23458.1| hypothetical protein JCGZ_23291 [Jatropha curcas]
Length=317

 Score =   465 bits (1197),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 258/307 (84%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I H+ V VNGINMH+AEKG+GP+ILFLHGFPELWYTWRHQ+   + LG+ AVAPDLR
Sbjct  1     MEEINHRVVNVNGINMHIAEKGEGPMILFLHGFPELWYTWRHQILSLSSLGFHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP+L  SSYTC H+VGDL+AL+  LG +KVFLV HDWGAIIGWY C+FRPD VK
Sbjct  61    GYGDTEAPALS-SSYTCHHIVGDLIALIDHLGAEKVFLVGHDWGAIIGWYLCLFRPDKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPF+PRHP +K VE+MR  FGD+YYICRFQ+ G IE +IA  G+E+VL+KIFTD
Sbjct  120   AFVCLSVPFKPRHPNIKTVESMRLLFGDEYYICRFQKPGEIEEEIARVGTEEVLKKIFTD  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GPPCLPKEN FG   + P  LPSWL+E+DL YY +K++ KGFTGGLNYYR+++LNWE
Sbjct  180   RKPGPPCLPKENAFGSCKENPVTLPSWLTEEDLAYYVTKFNQKGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG+ +KVPVKF+VGD DMVYTTPG+KEYV G GF   VP LE++VV+EG GHF++
Sbjct  240   LTAQWTGVAIKVPVKFVVGDADMVYTTPGMKEYVQGSGFSHYVPFLEDVVVMEGVGHFIS  299

Query  431   QERPEEV  411
             QERP+E+
Sbjct  300   QERPKEI  306



>ref|XP_002318980.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE94903.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   464 bits (1193),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 263/307 (86%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI H+ VKVN I+MH+AEKGQGPV+LFLHGFPELWY+WRHQ+   + LGY AVAPDLR
Sbjct  1     MEGISHRMVKVNDIDMHIAEKGQGPVVLFLHGFPELWYSWRHQILALSSLGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP+   SSY+CLH+VGDL+AL+  LGV++VFLVAHDWGA+IGWY C+FRPD VK
Sbjct  61    GYGDTEAPA-SISSYSCLHIVGDLIALIDYLGVEQVFLVAHDWGALIGWYLCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVP+RPR+P MKPVE+M+  FG+DYY+CRFQE G IE++IA  G+E+VL+KI T 
Sbjct  120   AYVCLSVPYRPRNPKMKPVESMKLVFGEDYYMCRFQEPGVIEAEIACAGTEEVLKKILTG  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GPPCLPKENPFGI  ++   +PSWL E DL +YA+KY  KGFTGGLNYYR+++LNWE
Sbjct  180   RKPGPPCLPKENPFGIYPEESVTMPSWLPEADLSFYATKYSQKGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA+WTG  V VPVKF+VGD+DMVYTTPG+KE+V+ GGFK  VPLLEE+VV+EG GHF+N
Sbjct  240   LTASWTGAPVIVPVKFVVGDLDMVYTTPGMKEFVNSGGFKHYVPLLEEVVVMEGVGHFIN  299

Query  431   QERPEEV  411
             QE+ EE+
Sbjct  300   QEKAEEI  306



>ref|XP_006433457.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
 gb|ESR46697.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
Length=317

 Score =   461 bits (1186),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 257/307 (84%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H  V VNGI MH+AEKG+GPV+LFLHGFPELWYTWR Q+   + LGYRA+APDLR
Sbjct  1     MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+APS   SSY+C H+VGDLVAL+ SLGV++VF+VAHDWGAII WY C+F P+ VK
Sbjct  61    GYGDTEAPS-SISSYSCHHIVGDLVALINSLGVEQVFVVAHDWGAIIAWYLCLFCPERVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPF PR+P +KPVE+MRA FGDDYYICRFQE G+IE+ IA  G+ +VL+ I  +
Sbjct  120   AFVCLSVPFLPRNPNIKPVESMRALFGDDYYICRFQEPGKIEAQIAQVGTAEVLKNILAN  179

Query  788   RKAGPPCLPKENPFGIS-TDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GP C P+EN FGI   ++  LPSW SEQDL +YA+K++  GFTG LNYYR++NLNWE
Sbjct  180   RKPGPSCFPEENAFGIDPENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             +TAAWT ++VKVPVKF+VG++DMVYTTPGIKEYVH GGFKKDVPLLEEIVVIE  GHF+N
Sbjct  240   MTAAWTEVQVKVPVKFIVGELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFIN  299

Query  431   QERPEEV  411
             QER EE+
Sbjct  300   QERAEEI  306



>gb|EYU42194.1| hypothetical protein MIMGU_mgv1a010473mg [Erythranthe guttata]
Length=311

 Score =   459 bits (1181),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 217/291 (75%), Positives = 250/291 (86%), Gaps = 5/291 (2%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQ--GPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAP  1158
             +MEGIEH+TV VNGINMH+AEKG   GPV+LFLHGFPELWYTWRHQL  FA LGYRAVAP
Sbjct  2     EMEGIEHRTVSVNGINMHLAEKGGEGGPVVLFLHGFPELWYTWRHQLTAFAALGYRAVAP  61

Query  1157  DLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFR  984
             DLRGYG++DAP+ + SSY+CLHVVGD+VAL+++LG     V LVAHDWGA+I WY C+FR
Sbjct  62    DLRGYGDSDAPA-EASSYSCLHVVGDIVALIETLGGGGAPVLLVAHDWGAMIAWYLCLFR  120

Query  983   PDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLR  804
             PDLVKAF  ++VPFRPRHP MKPVE MRAFFGDDYY+CRFQE G+IES+IA +G+EKV++
Sbjct  121   PDLVKAFAALTVPFRPRHPKMKPVEGMRAFFGDDYYMCRFQEPGKIESEIAEYGAEKVIK  180

Query  803   KIFTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
             KI  DR  G P LPKENPFG  TD  KLP WLS+QDL +YA KYD KGFTGGLNYYR+++
Sbjct  181   KILADRSPGLPRLPKENPFGSKTDDIKLPPWLSQQDLNFYAQKYDKKGFTGGLNYYRALD  240

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLE  471
             LNWELTAAWTG +VKVPVKF+VGD+DMVY TPG+KEYVHGGGFK DVPLL 
Sbjct  241   LNWELTAAWTGAKVKVPVKFIVGDIDMVYNTPGVKEYVHGGGFKNDVPLLS  291



>ref|XP_010094462.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB56095.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   456 bits (1172),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 214/308 (69%), Positives = 254/308 (82%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEG-IEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEG I H+TV VNGI MH+AEKG GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDL
Sbjct  1     MEGKITHRTVSVNGIEMHIAEKGNGPVVLFLHGFPELWYSWRHQISALSSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP+   +SYTCLHVVGDLV LV +LGV++V+LVA DWG ++ WY C+FRP+ V
Sbjct  61    RGYGDTDAPA-DVASYTCLHVVGDLVGLVDALGVEQVYLVAQDWGCLMAWYLCLFRPEKV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KAFV + VPFRPR+P MKPVE+MRAFFGDDYY+CRFQE G IE+++A  G+  VL+KI T
Sbjct  120   KAFVCLGVPFRPRNPKMKPVESMRAFFGDDYYMCRFQEPGEIEAEMAQVGASAVLKKILT  179

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              RK GPP LPK   F    D    LPSWLSE+DL YYA+K+ LKGFTGGLNYYR++++NW
Sbjct  180   TRKPGPPFLPKGKAFRADPDASVTLPSWLSEEDLNYYATKFKLKGFTGGLNYYRNLDINW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             EL AAW G EVKVPVKF+VGD+DMVYTTPG KEYVH GGFKKDVP L+E+VVIE  GHF+
Sbjct  240   ELMAAWDGAEVKVPVKFIVGDLDMVYTTPGTKEYVHNGGFKKDVPYLQEVVVIEDAGHFI  299

Query  434   NQERPEEV  411
             +QER EE+
Sbjct  300   SQERAEEI  307



>ref|XP_010104146.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB98711.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   454 bits (1169),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 214/308 (69%), Positives = 253/308 (82%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEG-IEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEG I H+TV VNGI MH+AEKG GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDL
Sbjct  1     MEGKITHRTVSVNGIEMHIAEKGNGPVVLFLHGFPELWYSWRHQISALSSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP+   +SYTCLHVVGDLV LV +LGV++V+LVA DWG ++ WY C+FRP+ V
Sbjct  61    RGYGDTDAPA-DVASYTCLHVVGDLVGLVDALGVEQVYLVAQDWGCLMAWYLCLFRPEKV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KAFV + VPFRPR+P MKPVE+MRAFFGDDYY+CRFQE G IE+++A  G+  VL+KI T
Sbjct  120   KAFVCLGVPFRPRNPKMKPVESMRAFFGDDYYMCRFQEPGEIEAEMAQVGASAVLKKILT  179

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              RK GPP LPK   F    D    LPSWLSE+DL YYA+K+ LKGFTGGLNYYR++++NW
Sbjct  180   TRKPGPPFLPKGKAFRADPDASVTLPSWLSEEDLNYYATKFKLKGFTGGLNYYRNLDINW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             EL AAW G EVKVPVKF+VGD+DMVYTTPG KEYVH GGFKKDVP L+E+VVIE  GHF+
Sbjct  240   ELMAAWDGAEVKVPVKFIVGDLDMVYTTPGTKEYVHNGGFKKDVPYLQEVVVIEDAGHFI  299

Query  434   NQERPEEV  411
              QER EE+
Sbjct  300   GQERAEEI  307



>ref|XP_006472971.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=571

 Score =   460 bits (1184),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 257/307 (84%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H  V VNGI MH+AEKG+GPV+LFLHGFPELWYTWR Q+   + LGYRA+APDLR
Sbjct  1     MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+APS   SSY+C H+VGDLVAL+ SLGV++VF+VAHDWGAII WY C+F P+ VK
Sbjct  61    GYGDTEAPS-SISSYSCHHIVGDLVALINSLGVEQVFVVAHDWGAIIAWYLCLFCPERVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPF PR+P +KPVE+MRA FGDDYYICRFQE G+IE+ IA  G+ +VL+ I  +
Sbjct  120   AFVCLSVPFLPRNPNIKPVESMRALFGDDYYICRFQEPGKIEAQIAQVGTAEVLKNILAN  179

Query  788   RKAGPPCLPKENPFGIS-TDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GP C P+EN FGI   ++  LPSW SEQDL +YA+K++  GFTG LNYYR++NLNWE
Sbjct  180   RKPGPSCFPEENAFGIDPENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             +TAAWT ++VKVPVKF+VG++DMVYTTPGIKEYVH GGFKKDVPLLEEIVVIE  GHF+N
Sbjct  240   MTAAWTEVQVKVPVKFIVGELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFIN  299

Query  431   QERPEEV  411
             QER EE+
Sbjct  300   QERAEEI  306


 Score =   299 bits (766),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 180/238 (76%), Gaps = 0/238 (0%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             KM+ I+H TV VNGI +H+AEKG+ PV+LFLHGFPE WY WRHQ+   + LGYRAVAPDL
Sbjct  320   KMDEIKHSTVNVNGIKIHIAEKGEVPVVLFLHGFPEFWYAWRHQILALSCLGYRAVAPDL  379

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+ PS   +SYTC HV GD++AL+  LGV++VF+VAHD+GAII W+ C+FRP+ V
Sbjct  380   RGYGDTEVPSSSFTSYTCFHVAGDIIALIDFLGVEQVFVVAHDFGAIIAWHLCLFRPERV  439

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             K+FV + +P+ P  P +KPVE +RA +GD++YIC+FQE G +E+ IA  GS+ +L    T
Sbjct  440   KSFVSLGMPYLPTDPNLKPVETLRAMYGDNFYICKFQEPGVLEAGIAHIGSKLMLASSLT  499

Query  791   DRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              R+ GPP + ++    ++ +   LP WLSE++  YY +K+D  GFTGGLNYYR+I+LN
Sbjct  500   TRRPGPPIISEDAIAHLARETINLPFWLSEEEFNYYVTKFDQTGFTGGLNYYRAIDLN  557



>gb|KGN66047.1| hypothetical protein Csa_1G569240 [Cucumis sativus]
Length=317

 Score =   449 bits (1154),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 207/307 (67%), Positives = 253/307 (82%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ I H+TV VNGINMH+AEKG+GP++LF+HGFPELWYTWRHQ+   + LGY AVAPDLR
Sbjct  1     MDTISHRTVSVNGINMHIAEKGEGPIVLFIHGFPELWYTWRHQILALSSLGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP    SSY+ +H+VGDLVALV+S GV +VF+VAHDWGA+I W  C+FR ++VK
Sbjct  61    GYGDSDAPD-SISSYSIMHIVGDLVALVESFGVKEVFVVAHDWGALIAWSLCLFRAEMVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPFRPRHP  KPVE MR  FGDDYYICRFQ  G IE ++A  G++ VLR I T 
Sbjct  120   AFVCLSVPFRPRHPNRKPVETMRMVFGDDYYICRFQNPGEIEEEMAQVGAKDVLRGILTT  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R+ GPP  PK+  F      P  LPSWLSE+DL Y+ASKY+ KGFTG LNYYRS++LNWE
Sbjct  180   RRQGPPIYPKKQAFRARAGPPSPLPSWLSEEDLSYFASKYEQKGFTGPLNYYRSMDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG++VKVPVKF+VGD+DMVYTTPG+KEYV+GGGFKKDVP L+++VV++G GHFLN
Sbjct  240   LTAPWTGVQVKVPVKFIVGDVDMVYTTPGVKEYVNGGGFKKDVPFLQDVVVMDGVGHFLN  299

Query  431   QERPEEV  411
             QE+PEE+
Sbjct  300   QEKPEEI  306



>emb|CBI39538.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   437 bits (1124),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/282 (72%), Positives = 238/282 (84%), Gaps = 2/282 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+ V VNGI MHVAEKGQGPV+LFLHGFPELWYTWRHQ+   A  GY AVAPDLR
Sbjct  1     MEGIEHRMVSVNGIKMHVAEKGQGPVVLFLHGFPELWYTWRHQIIAMASHGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GY +++AP+   +SYTCLHVVGDL+AL+  LG DKVFLV HDWGA IGWY C+FRPD VK
Sbjct  61    GYSDSEAPA-SFTSYTCLHVVGDLIALIDCLGADKVFLVGHDWGAQIGWYMCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V ++VPFRPR+P ++P+E MRAFFGDDYY+CRFQ+ G IE++IA  GS++VL++I TD
Sbjct  120   AYVSLTVPFRPRNPKIRPIEGMRAFFGDDYYMCRFQKPGEIEAEIARLGSKEVLKRILTD  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GPPCLPKENPFGI    P  LPSW SE+DL YYA KYD KGFTGGLNYYR+++LNWE
Sbjct  180   RKPGPPCLPKENPFGIKAIPPSPLPSWFSEEDLNYYARKYDEKGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKD  486
             LTA WTG +V+VPVKF+VGD+DMVYTTPG+KEYV  G FKKD
Sbjct  240   LTAPWTGEQVRVPVKFVVGDLDMVYTTPGVKEYVDSGAFKKD  281



>ref|XP_003626243.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08020.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82461.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   435 bits (1118),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 204/309 (66%), Positives = 254/309 (82%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP+   SSYT  H+VGD+VAL+ SLGVD+VFLVAHDWGA+IGWY CMFRP+ +
Sbjct  61    RGYGDTDAPA-SISSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAMIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVPF  R+PT+KP++  RA +GDDYYICRFQE G+IE++IA  G+  VL+ + T
Sbjct  120   KAYVCLSVPFNHRNPTVKPIDGRRAAYGDDYYICRFQEPGKIEAEIAEVGTAYVLKNVLT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              RK GPP LPK E   G + D P+ LP+WL+E DL Y+ SKY+  GFTGGLNYYR+ NLN
Sbjct  180   TRKTGPPILPKGEFGTGFNPDTPETLPTWLTEDDLAYFVSKYEKTGFTGGLNYYRNFNLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTA W+G+++KVPVKF+ GD+DMVYT+P +KEY+HGGGFK+DVP LEE++V +G  HF
Sbjct  240   WELTAPWSGVKIKVPVKFITGDLDMVYTSPHVKEYIHGGGFKEDVPNLEEVIVQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308



>ref|XP_003554527.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=317

 Score =   434 bits (1117),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 248/307 (81%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHKTV+ NGINMHVA  G GPV+LFLHGFPELWYTWRHQL   + +GYRA+APDLR
Sbjct  1     MEKIEHKTVRTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSAVGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    SSY+ LH+V DLV L+ +LG+++VFLV HDWGA I W+FC+ RPD VK
Sbjct  61    GYGDTDAPP-DASSYSALHIVADLVGLLDALGIERVFLVGHDWGASIAWHFCLLRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FRPR+P  KP++++RA  GDDYYICRFQ+ G +E + A  G+ ++++     
Sbjct  120   ALVNMSVVFRPRNPNRKPIQSLRAIMGDDYYICRFQKPGEVEEEFARAGAARIIKTFIAS  179

Query  788   RKAGPPCLPKENPFGISTD-QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   PPC+PKE  FG S D +  LPSWL+E+D+ YYASK++ KGFTGGLNYYR+++L WE
Sbjct  180   RDPRPPCVPKEIGFGGSPDLRIDLPSWLTEEDVNYYASKFEQKGFTGGLNYYRAMDLTWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG+++KVPVKF+VGD+D+ Y TPG+KEY+H GGFK+DVP L+E+VV+EG  HF+N
Sbjct  240   LTAAWTGVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELVVMEGVAHFIN  299

Query  431   QERPEEV  411
             QERP+E+
Sbjct  300   QERPQEI  306



>ref|XP_010043042.1| PREDICTED: bifunctional epoxide hydrolase 2 [Eucalyptus grandis]
 gb|KCW85062.1| hypothetical protein EUGRSUZ_B01907 [Eucalyptus grandis]
Length=318

 Score =   434 bits (1115),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 203/308 (66%), Positives = 246/308 (80%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+T+ VNGI MHVAEKG+GP +L LHGFPELWYTWR Q+   A  GYRAVAPDLR
Sbjct  1     MEGIEHRTLSVNGITMHVAEKGRGPAVLLLHGFPELWYTWRRQIHALAAQGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGV-DKVFLVAHDWGAIIGWYFCMFRPDLV  972
             GYG+T+AP+ +   YTC H VGD+VAL+  LG+ +   +V HDWGA++GWY CMFRP+ V
Sbjct  61    GYGDTEAPA-EVERYTCHHAVGDVVALMDELGLGEAAHVVGHDWGALVGWYLCMFRPERV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             +++V ++VPFRPR+P  KPVE++RA FGDDYYICRFQE G IESDI   G   VLRKI T
Sbjct  120   RSYVCLTVPFRPRNPAAKPVESLRAHFGDDYYICRFQEPGDIESDIERLGVRNVLRKILT  179

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             +RK GPP  PK   F     +P  LPSWLSE+DL YY SK++ +GFTGGLNYYR+++LNW
Sbjct  180   ERKPGPPMWPKGQDFSCRPGKPMALPSWLSEEDLDYYTSKFEKRGFTGGLNYYRALDLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WT   V+VPVKF+VGD+D+ YTTPG+KE+VHGGGFKK VPLLE++VVIEG  HF+
Sbjct  240   ELTAPWTDARVRVPVKFVVGDLDITYTTPGVKEFVHGGGFKKHVPLLEDVVVIEGASHFI  299

Query  434   NQERPEEV  411
             NQERPEEV
Sbjct  300   NQERPEEV  307



>ref|XP_006288215.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
 gb|EOA21113.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
Length=324

 Score =   432 bits (1111),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 238/306 (78%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GPVILFLHGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFATLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   P SY+ LH+VGDLV L+ SLGVD+VFLV HDWGAII W+ CM RPD V 
Sbjct  61    GYGDSDAPP-SPESYSILHIVGDLVGLLDSLGVDRVFLVGHDWGAIIAWWLCMIRPDRVS  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+PT+KPV+A RA FGDDYYICRFQE G IE D A   ++K++ K F  
Sbjct  120   ALVNTSVVFNPRNPTLKPVDAFRALFGDDYYICRFQEAGEIEEDFAQVDTKKLITKFFVS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+EQD+ +Y  K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+VY  PG KEY+H GG KK VP L+E+VV+EG GHFL Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDIVYNIPGTKEYIHDGGLKKHVPFLQEVVVMEGVGHFLQQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>gb|ACU19478.1| unknown [Glycine max]
 gb|KHN43316.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   432 bits (1110),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 247/307 (80%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H+ V+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MEQIKHRIVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP    SSY C H+VGDLVAL+ SLGV +VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTEAPP-SISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF PR+P +KPV+AMRA +GDDYYICRFQE G+ E ++A + +E+V++ +F  
Sbjct  120   AYVCLSVPFWPRNPKVKPVDAMRAIYGDDYYICRFQEPGKAEGELAKNSTEQVIKNVFIS  179

Query  788   RKAGPPCLPKEN-PFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK GPP L KE   F  +T  P LP+WLS++DL YYASK++  GFTGGLNYYR+ NLNWE
Sbjct  180   RKPGPPILEKEGMGFNPNTSMP-LPTWLSQEDLTYYASKFEKTGFTGGLNYYRNFNLNWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG +VKVPVKF+ GD+D+VYT+ G K Y+  G FKKDVP LEE+VV EG  HF N
Sbjct  239   LTAPWTGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAFKKDVPNLEEVVVQEGVAHFNN  298

Query  431   QERPEEV  411
             QE  E+V
Sbjct  299   QEAAEDV  305



>ref|XP_003554633.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=341

 Score =   432 bits (1112),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 248/308 (81%), Gaps = 3/308 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +ME I+H+ V+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDL
Sbjct  25    EMEQIKHRIVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDL  84

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+AP    SSY C H+VGDLVAL+ SLGV +VFLVAHDWGAIIGWY CMFRPD V
Sbjct  85    RGYGDTEAPP-SISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKV  143

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVPF PR+P +KPV+AMRA +GDDYYICRFQE G+ E ++A + +E+V++ +F 
Sbjct  144   KAYVCLSVPFWPRNPKVKPVDAMRAIYGDDYYICRFQEPGKAEGELAKNSTEQVIKNVFI  203

Query  791   DRKAGPPCLPKENP-FGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              RK GPP L KE   F  +T  P LP+WLS++DL YYASK++  GFTGGLNYYR+ NLNW
Sbjct  204   SRKPGPPILEKEGMGFNPNTSMP-LPTWLSQEDLTYYASKFEKTGFTGGLNYYRNFNLNW  262

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG +VKVPVKF+ GD+D+VYT+ G K Y+  G FKKDVP LEE+VV EG  HF 
Sbjct  263   ELTAPWTGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAFKKDVPNLEEVVVQEGVAHFN  322

Query  434   NQERPEEV  411
             NQE  E+V
Sbjct  323   NQEAAEDV  330



>emb|CDP17111.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   431 bits (1108),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 248/307 (81%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ I+H+ V VNGIN+HVAE G GP ILFLHGFPELWY+WRHQL   +  GYRA+APDLR
Sbjct  1     MDKIQHRQVPVNGINLHVAEIGDGPAILFLHGFPELWYSWRHQLLSLSAKGYRALAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   PS+YT LH+VGDLV L+ SLG+D+VFLV HDWGA++ WYFC+ RPD +K
Sbjct  61    GYGDSDAPP-SPSNYTALHIVGDLVGLLDSLGLDRVFLVGHDWGAVMAWYFCLLRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P  KP+EAMRA FGDDYYICRFQE G  E + A   + ++++K  T 
Sbjct  120   ALVNMSVVFTPRNPKRKPLEAMRARFGDDYYICRFQEPGEAEEEFARVDTARIIKKFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R+ GP C+PKE  FG S   P +LPSWLSE D+ Y+ASK+  KGFTGGLNYYR+++LNWE
Sbjct  180   RRPGPLCVPKEVGFGGSPHNPIQLPSWLSEDDVNYFASKFSQKGFTGGLNYYRAMDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG+++KVPVKF+VGD+D+ +TTPG+KEY+  GGFK+DVP L+E+VV+EG  HF+N
Sbjct  240   LTAPWTGLQIKVPVKFIVGDLDVTFTTPGVKEYIQKGGFKRDVPFLQELVVMEGVAHFVN  299

Query  431   QERPEEV  411
             QE+PEEV
Sbjct  300   QEKPEEV  306



>ref|XP_007050977.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX95134.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=316

 Score =   431 bits (1107),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 238/306 (78%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH  V  NGINMHVA  G GPVILFLHGFPELWY+WRHQL   + LGYR VAPDLR
Sbjct  1     MEKIEHTMVTTNGINMHVASVGSGPVILFLHGFPELWYSWRHQLLSLSSLGYRCVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP    +SYT  H+VGDLV L+ +LGVD VFLV HDWGA+I WYFC FRPD VK
Sbjct  61    GFGDTDAPP-SAASYTVFHIVGDLVGLLDALGVDSVFLVGHDWGAVIAWYFCHFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV +RPRH +MKPVE  RA FGDDYYICRFQE G IE D A   + K+++   T 
Sbjct  120   ALVNMSVAYRPRHRSMKPVEGFRALFGDDYYICRFQEPGEIEEDFAQMDTAKIMKIFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PKE  F    D P LPSWLSE+D+ Y+ASK++ KGFTGGLNYYR+++L+WEL
Sbjct  180   RNPRPPCIPKEIGFRGYPDPPPLPSWLSEEDINYFASKFNEKGFTGGLNYYRALDLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              A WTG+++KVPVKF+VGD+D+ Y  PG KEY+H GGFKKDVP L+E+VV+EG  HF+NQ
Sbjct  240   MAPWTGLQIKVPVKFIVGDLDITYHIPGAKEYIHNGGFKKDVPFLQEVVVMEGVAHFINQ  299

Query  428   ERPEEV  411
             E+ EE+
Sbjct  300   EKSEEI  305



>ref|NP_001240943.1| uncharacterized protein LOC100803974 [Glycine max]
 gb|ACU18288.1| unknown [Glycine max]
 gb|KHN03960.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   431 bits (1107),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 245/306 (80%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI H+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSNLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP+   SSYT LH+V D+VAL+ SL VD+VFLVAHDWGA+IGWY C+FRPD +K
Sbjct  61    GYGDTEAPA-SISSYTILHLVSDIVALIHSLAVDQVFLVAHDWGAVIGWYLCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF PR+P +KPV+AMRA +GDDYYICRFQE G+ E++ A +  E+V++ I T 
Sbjct  120   AYVCLSVPFMPRNPKVKPVDAMRALYGDDYYICRFQEPGKAEAEFANNSIEQVIKNILTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R+ GPP L KE     S     LP+WLS++D+ YYASK+   G TGGLNYYR++NLNWEL
Sbjct  180   RRPGPPILRKEGAGSNSDPSRPLPTWLSQEDVTYYASKFTKTGLTGGLNYYRNLNLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG++VKVPVKF+ GD+D VYT+ G+K Y+  G FKKDVP LEE+VV EG  HF NQ
Sbjct  240   TAPWTGVQVKVPVKFITGDLDAVYTSLGMKNYIESGAFKKDVPCLEEVVVQEGVAHFNNQ  299

Query  428   ERPEEV  411
             E  E+V
Sbjct  300   EAAEDV  305



>ref|XP_008450607.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=317

 Score =   431 bits (1107),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 200/307 (65%), Positives = 249/307 (81%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ I H+TV VNGIN+H+AEKG+GP++LF+HGFPELWYTWRHQ+   + LGY AVAPDLR
Sbjct  1     MDTINHRTVSVNGINVHIAEKGEGPIVLFIHGFPELWYTWRHQILALSSLGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP    SSY+ +H+VGDLVALV+SLGV +VF+VAHDWGA+I W  C+FR ++VK
Sbjct  61    GYGDSDAPD-SISSYSIMHIVGDLVALVESLGVKEVFVVAHDWGALIAWGLCLFRAEIVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPFRPRHP  KPVE MR  FGDDYYICRFQ  G IE ++A  G+++VLR I T 
Sbjct  120   AFVCLSVPFRPRHPNRKPVETMRKVFGDDYYICRFQNPGEIEEEMAQVGAKEVLRGILTT  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLS-EQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R+ GPP  PK+  F    +          E+DL Y+ASKY+ KGFTG LNYYRS++LNWE
Sbjct  180   RRQGPPIYPKKQAFRARPESSSPLPSWLSEEDLSYFASKYEQKGFTGPLNYYRSMDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG++VKVPVKF+VGD+DMVYTTPG+KEYV+GGGFKKDVP L+++V++EG GHFLN
Sbjct  240   LTAPWTGVQVKVPVKFIVGDVDMVYTTPGVKEYVNGGGFKKDVPFLQDVVIMEGVGHFLN  299

Query  431   QERPEEV  411
             QE+PEE+
Sbjct  300   QEKPEEI  306



>ref|XP_006396441.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
 gb|ESQ37894.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
Length=316

 Score =   430 bits (1106),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 241/306 (79%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGINMHVA  G GPVILFLHGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   P SYT LH+VGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD V 
Sbjct  61    GYGDSDAPP-SPDSYTILHIVGDLVGLLNSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVN  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P++KPV+A RA FGDDYY+CRFQE G IE D A   ++K++ + FT 
Sbjct  120   ALVNTSVVFNPRNPSVKPVDAFRALFGDDYYVCRFQEPGEIEEDFAQADTKKLINRFFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+EQD+++YA K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKTLGFRGLPDPPPLPAWLTEQDVRFYADKFSQKGFTGGLNYYRALNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+H GG KK VP L+E+VV+EG GHFL+Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDLTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLHQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_007147002.1| hypothetical protein PHAVU_006G088500g [Phaseolus vulgaris]
 gb|ESW18996.1| hypothetical protein PHAVU_006G088500g [Phaseolus vulgaris]
Length=320

 Score =   430 bits (1106),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 201/311 (65%), Positives = 251/311 (81%), Gaps = 7/311 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEG+EH+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MEGVEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSALGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP+   SSYT LH+V D+VAL+ SLGVD+VFLVAHDWGA++GWY C+FRPD +K
Sbjct  61    GYGDTDAPA-SVSSYTILHLVADVVALIDSLGVDQVFLVAHDWGALVGWYTCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF PR+P +KPV+AMRA +GDDYYICRFQE G++E+ +  +  E+ ++ + T 
Sbjct  120   AYVCLSVPFMPRNPKVKPVDAMRALYGDDYYICRFQEPGKMET-LYDNNIEEAIKNMLTS  178

Query  788   RKAGPPCLPKE----NPFGI-STDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
             R+ GPP LPKE    NP    S     LPSWLS++DL YYASK+   G TGGLNYYR++N
Sbjct  179   RRPGPPILPKEGAGSNPLASGSLPSRPLPSWLSQEDLTYYASKFGKTGLTGGLNYYRNLN  238

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
             LNWELTAAWTG++VKVPVKF+ GD+D+VYT+ G K+Y+  G FK+DVP LEE+VV EG  
Sbjct  239   LNWELTAAWTGVQVKVPVKFITGDLDIVYTSLGTKDYIESGAFKRDVPFLEEVVVQEGVA  298

Query  443   HFLNQERPEEV  411
             HF NQE  E+V
Sbjct  299   HFNNQEAAEDV  309



>ref|XP_007147001.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
 gb|ESW18995.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
Length=316

 Score =   430 bits (1105),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 247/307 (80%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I H+TV+VNGI MHVAEKG+GP +LFLHGFPELWYTWRHQ+   +  GY AVAPDLR
Sbjct  1     MEYIVHRTVEVNGIKMHVAEKGEGPAVLFLHGFPELWYTWRHQILDLSSRGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP+   SSY+C  +VGDLVAL+  LGVD+VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTEAPA-SMSSYSCFDIVGDLVALIDLLGVDQVFLVAHDWGAIIGWYLCMFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF PR+P +KPV+AMRA +GDDYYICRFQE G+ E ++A + +E+VL+K+ T+
Sbjct  120   AYVCLSVPFWPRNPKVKPVDAMRALYGDDYYICRFQEAGKAEGELAKNSTEEVLKKLLTN  179

Query  788   RKAGPPCLPKEN-PFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R  GPP L KE     ++T  P LPSWLS QDLKYYASK++  GFTGGLNYYR+INLNWE
Sbjct  180   RTPGPPILQKEGMGSNLNTSMP-LPSWLSLQDLKYYASKFEKTGFTGGLNYYRNINLNWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG +VKVPVKF+ GD+D VYT+ G+K Y+  G FKKDVP LEE++V EG  HF N
Sbjct  239   LTAPWTGAQVKVPVKFITGDLDSVYTSLGMKNYIESGAFKKDVPNLEEVIVQEGVAHFNN  298

Query  431   QERPEEV  411
             QE  E+V
Sbjct  299   QEAAEDV  305



>gb|ACJ85188.1| unknown [Medicago truncatula]
Length=316

 Score =   430 bits (1105),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 250/307 (81%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TD PS   +SYT  H+VGD+VAL+ SLGVD+VFLVAHDWGAI+GWY C+FRP+ V
Sbjct  61    RGYGDTDVPS-SVNSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAIVGWYLCLFRPERV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP+ PR+P +KPV+ MRA FGDDYYICRFQE G++E++IA   SE+V++ + T
Sbjct  120   KAYVCLSVPYLPRNPKVKPVDGMRALFGDDYYICRFQELGKMEAEIAKDSSEQVIKSMLT  179

Query  791   DRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
              R  GP  LPKE      + +P LPSWLS++D+ YYASK++  GF+GGLN+YR++NLNWE
Sbjct  180   GRTTGPLILPKERFLSHPSTKP-LPSWLSQEDVSYYASKFEKTGFSGGLNFYRNLNLNWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG ++KVP+KF+ GD D+VYT+ G K+Y+  GGFKKDVP LEE+V+ EG  HF N
Sbjct  239   LTAAWTGAQIKVPLKFITGDSDLVYTSSGTKQYIESGGFKKDVPNLEEVVIQEGVAHFNN  298

Query  431   QERPEEV  411
             QE  E++
Sbjct  299   QEAAEDI  305



>ref|XP_007222764.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
 gb|EMJ23963.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
Length=320

 Score =   430 bits (1105),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 252/309 (82%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+GIEH+TV+VNGINMH+AEKGQGP+ILF+HGFPELWY+WRHQ+   A LGYRAVAPDLR
Sbjct  1     MDGIEHRTVQVNGINMHIAEKGQGPLILFIHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+TDAP   P+SYTCLHVVGDL+AL+ ++  D  KVF+V HDWGA I WY C+FRPD 
Sbjct  61    GFGDTDAPD-SPTSYTCLHVVGDLIALLDTIAPDHDKVFVVGHDWGAFIAWYLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V++SV FRPR+P  K +E+++A +GDDYY+CRFQE G IE++ A  G+ +V+++  
Sbjct  120   VKALVNMSVAFRPRNPQRKNLESLKAVYGDDYYMCRFQEPGVIEAEFAKIGTARVMKEFL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R  GP  LPK+  FG S D P  LPSWLSE ++ YYASK++  GFTGG+NYYR+++LN
Sbjct  180   TYRNPGPLFLPKDKMFGHSLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTAAWTG +VKVPVKF+VGD D+ Y + G K+++H GGFKK VPLLEE+VV+EG  HF
Sbjct  240   WELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAHF  299

Query  437   LNQERPEEV  411
             +NQERP+E+
Sbjct  300   INQERPDEI  308



>ref|XP_003626241.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82459.1| epoxide hydrolase [Medicago truncatula]
Length=316

 Score =   429 bits (1104),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 250/307 (81%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TD PS   +SYT  H+VGD+VAL+ SLGVD+VFLVAHDWGAI+GWY C+FRP+ V
Sbjct  61    RGYGDTDVPS-SVNSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAIVGWYLCLFRPERV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP+ PR+P +KPV+ MRA FGDDYYICRFQE G++E++IA   SE+V++ + T
Sbjct  120   KAYVCLSVPYLPRNPKVKPVDGMRALFGDDYYICRFQELGKMEAEIAKDSSEQVIKSMLT  179

Query  791   DRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
              R  GP  LPKE      + +P LPSWLS++D+ YYASK++  GF+GGLN+YR++NLNWE
Sbjct  180   GRTTGPLILPKERFLSHPSTKP-LPSWLSQEDVAYYASKFEKTGFSGGLNFYRNLNLNWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG ++KVP+KF+ GD D+VYT+ G K+Y+  GGFKKDVP LEE+V+ EG  HF N
Sbjct  239   LTAAWTGAQIKVPLKFITGDSDLVYTSSGTKQYIESGGFKKDVPNLEEVVIQEGVAHFNN  298

Query  431   QERPEEV  411
             QE  E++
Sbjct  299   QEAAEDI  305



>ref|XP_010456047.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   429 bits (1104),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 237/306 (77%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGINMHVA  G G VILFLHGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGSVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   P SYT LH+VGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD VK
Sbjct  61    GYGDSDAPQ-SPESYTILHIVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+PT+KPV+  RA FGDDYYICRFQE G IE D A   ++K++ + F  
Sbjct  120   ALVNTSVVFNPRNPTVKPVDKFRALFGDDYYICRFQEAGEIEEDFAQVDTKKLITRFFVS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+EQD+ +Y  K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVSFYGDKFGQKGFTGGLNYYRAMNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+HGGG KK VP L+E+VV+EG GHFL Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHGGGLKKHVPFLQEVVVMEGVGHFLQQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>gb|KFK37968.1| hypothetical protein AALP_AA3G053200 [Arabis alpina]
Length=328

 Score =   429 bits (1104),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 249/314 (79%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             M GIEH+ V VNGI MH+AEKG  +GPV+L LHGFP+LWYTWRHQ+   + LGYRA+APD
Sbjct  1     MGGIEHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQITGLSSLGYRAIAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG+TD+P    S YTCL+VVGDLVAL+ S+  D  KVFLVAHDWGAIIGW+ C FRP
Sbjct  61    LRGYGDTDSPE-SFSEYTCLNVVGDLVALMDSVAGDQEKVFLVAHDWGAIIGWFICWFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D +K FV +SVP+RPRHP +KP++  +A FGDDYYICRFQE G+IE +IA  G  +VLR 
Sbjct  120   DKIKGFVCLSVPYRPRHPKVKPLQGFKAVFGDDYYICRFQEPGKIEGEIASAGPRRVLRN  179

Query  800   IFTDRKAGPPCLPKENPFG----ISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             IFT R  GPP LPKE PFG     +++  +LP W S++DL++Y SK++  GFTGGLNYYR
Sbjct  180   IFTGRALGPPILPKEKPFGENPNPNSEDIELPEWFSKEDLEFYVSKFEKAGFTGGLNYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +++LNWELTA WTG ++ VPVKF+ GD D VYTTPGIKEY+HGGGF  DVP L+EIVVIE
Sbjct  240   AMDLNWELTAPWTGAKIHVPVKFITGDFDTVYTTPGIKEYIHGGGFAADVPNLKEIVVIE  299

Query  452   GGGHFLNQERPEEV  411
               GHF+NQE+P+EV
Sbjct  300   DAGHFVNQEKPQEV  313



>emb|CDY05187.1| BnaC05g46160D [Brassica napus]
Length=340

 Score =   430 bits (1105),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 251/315 (80%), Gaps = 9/315 (3%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAP  1158
             +MEGI+H+ V VNGI MH+AEKG  +G V+L LHGFP+LWYTWRHQ+   + LGYRAVAP
Sbjct  9     EMEGIDHRMVSVNGITMHIAEKGPKEGTVVLLLHGFPDLWYTWRHQITALSSLGYRAVAP  68

Query  1157  DLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFR  984
             DLRGYG++D+P    S YTCLH+VGDLVAL+ S+  D  KVFLV HDWGAI+GWY C+FR
Sbjct  69    DLRGYGDSDSPE-SFSEYTCLHLVGDLVALLDSVVGDQEKVFLVGHDWGAIVGWYLCLFR  127

Query  983   PDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLR  804
             P+ +K FV +SVP+RPR+P +KPVE  +A FGDDYYICRFQE G+ E +IA     +VL+
Sbjct  128   PEKIKGFVCLSVPYRPRNPKVKPVEGFKAVFGDDYYICRFQEPGKAEGEIACADPRRVLK  187

Query  803   KIFTDRKAGPPCLPKENPFGIS----TDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYY  636
              IFT R+ GPP LPK+NPFG +     +Q +LP W S++DL YY SK++  GFTGGLNYY
Sbjct  188   NIFTGRELGPPILPKDNPFGANPNPNCEQVELPEWFSKEDLDYYVSKFEKTGFTGGLNYY  247

Query  635   RSINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVI  456
             R+++L WELTA WTG +++VPVKFM GD+DMVYTTPG+KEY+HGGGF  DVP L+E+VVI
Sbjct  248   RAMDLTWELTAPWTGAKIQVPVKFMTGDLDMVYTTPGVKEYIHGGGFAADVPNLQEVVVI  307

Query  455   EGGGHFLNQERPEEV  411
             E  GHF+NQE+P+EV
Sbjct  308   EDAGHFVNQEKPQEV  322



>gb|AES82458.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   429 bits (1102),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 249/311 (80%), Gaps = 8/311 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP+   SSYT  H+VGD+VAL+ SLGVD+VFLVAHDWGA+IGWY C+FRP+ +
Sbjct  61    RGYGDTDAPA-SISSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAMIGWYLCLFRPEKI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP+ PR+P MKPV+ MRA FGDDYYICRFQE G++ES+ A  G E +++ + T
Sbjct  120   KAYVCLSVPYLPRNPKMKPVDGMRALFGDDYYICRFQEPGKMESEFAKGGPELLIKNMLT  179

Query  791   DRKAGPPCLPKE----NPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
              R +GPP LPKE    NP    T    LPSWLS++D+ YYASK++  GF+G LNYYR++N
Sbjct  180   SRNSGPPILPKEGVIPNPHASGTKA--LPSWLSQEDITYYASKFEKTGFSGALNYYRNLN  237

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
             LNWELTAAWT  ++KVPVKF+ GD+D VYT+ G K+Y+  GGFKKDVP LEE+V+ EG  
Sbjct  238   LNWELTAAWTAAKIKVPVKFITGDLDAVYTSFGTKQYIESGGFKKDVPNLEEVVIQEGVA  297

Query  443   HFLNQERPEEV  411
             HF NQE  E++
Sbjct  298   HFNNQEAAEDI  308



>ref|XP_007222693.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
 gb|EMJ23892.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
Length=323

 Score =   429 bits (1102),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 197/310 (64%), Positives = 252/310 (81%), Gaps = 4/310 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +M+GIEH+TV+VNGINMH+AEKGQGP+ILF+HGFPELWY+WRHQ+   A LGYRAVAPDL
Sbjct  3     EMDGIEHRTVQVNGINMHIAEKGQGPLILFIHGFPELWYSWRHQITALASLGYRAVAPDL  62

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
             RG+G+TDAP   P+SYTCLHV+GDLVAL+ ++    DKVF+V HDWGA I WY C+FRPD
Sbjct  63    RGFGDTDAPD-SPTSYTCLHVIGDLVALLDAIAPDQDKVFVVGHDWGAFIAWYLCLFRPD  121

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P  K +E+++A +GDDYYICRFQE G IE++ A  G+ +V+++ 
Sbjct  122   RVKALVNMSVAFLPRNPQRKSLESLKAVYGDDYYICRFQEPGVIEAEFAKIGTARVMKEF  181

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R +GP  LPK+  FG   D P  LPSWLSE ++ YYASK++  GFTGG+NYYR+++L
Sbjct  182   LTYRNSGPLFLPKDKMFGHPLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDL  241

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTAAWTG +VKVPVKF+VGD D+ Y + G K+++H GGFKK VPLLEE+VV+EG  H
Sbjct  242   NWELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAH  301

Query  440   FLNQERPEEV  411
             F+NQERP+E+
Sbjct  302   FINQERPDEI  311



>emb|CAZ86692.1| epoxide hydrolase 1 [Prunus persica]
Length=323

 Score =   429 bits (1102),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 252/310 (81%), Gaps = 4/310 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +MEGIEH+TV+VNGINMH+AEKGQG +ILF+HGFPELWY+WRHQ+   A LGYRAVAPDL
Sbjct  3     EMEGIEHRTVQVNGINMHIAEKGQGLLILFIHGFPELWYSWRHQITALASLGYRAVAPDL  62

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             RG+G+TDAP   P+SYTCLHVVGDL+AL+ ++  D  KVF+V HDWGA I WY C+FRPD
Sbjct  63    RGFGDTDAPD-SPTSYTCLHVVGDLIALLDTIAPDHDKVFVVGHDWGAFIAWYLCLFRPD  121

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV FRPR+P  K +E+++A +GDDYY+CRFQE G IE++ A  G+ +V+++ 
Sbjct  122   RVKALVNMSVAFRPRNPQRKNLESLKAVYGDDYYMCRFQEPGVIEAEFAKIGTARVMKEF  181

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R  GP  LPK+  FG S D P  LPSWLSE ++ YYASK++  GFTGG+NYYR+++L
Sbjct  182   LTYRNPGPLFLPKDKMFGHSLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDL  241

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTAAWTG +VKVPVKF+VGD D+ Y + G K+++H GGFKK VPLLEE+VV+EG  H
Sbjct  242   NWELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAH  301

Query  440   FLNQERPEEV  411
             F+NQERP+E+
Sbjct  302   FINQERPDEI  311



>ref|NP_567228.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAC19281.1| T14P8.15 [Arabidopsis thaliana]
 emb|CAB80727.1| AT4g02340 [Arabidopsis thaliana]
 gb|AAM26670.1| AT4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AAN18121.1| At4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AEE82157.1| putative epoxide hydrolase [Arabidopsis thaliana]
Length=324

 Score =   429 bits (1102),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 241/306 (79%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGINMHVA  G GPVILF+HGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFVHGFPDLWYSWRHQLVSFAALGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP  +  SYT LH+VGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD V 
Sbjct  61    GYGDSDAPPSR-ESYTILHIVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVN  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P++KPV+A RA FGDDYYICRFQE G IE D A   ++K++ + FT 
Sbjct  120   ALVNTSVVFNPRNPSVKPVDAFRALFGDDYYICRFQEPGEIEEDFAQVDTKKLITRFFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+EQD+++Y  K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVRFYGDKFSQKGFTGGLNYYRALNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG+++KVPVKF+VGD+D+ Y  PG KEY+H GG KK VP L+E+VV+EG GHFL+Q
Sbjct  240   TAPWTGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLHQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_010429523.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   428 bits (1101),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 237/306 (77%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GPVILFLHGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   P SYT LH+VGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD VK
Sbjct  61    GYGDSDAPP-SPESYTILHIVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P++KPV+  R  FGDDYY+CRFQE G IE D A   ++K++ + F  
Sbjct  120   ALVNTSVVFNPRNPSVKPVDKFRDLFGDDYYVCRFQETGEIEEDFAQVDTKKLITRFFVS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+EQD+ +Y  K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+HGGG KK VP L+E+VV+EG GHFL Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHGGGLKKHVPFLQEVVVMEGVGHFLQQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_007163124.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
 gb|ESW35118.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
Length=317

 Score =   428 bits (1100),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 192/307 (63%), Positives = 243/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GPV+LFLHGFPELWYTWRHQL   + +GYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSSVGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    SSY+ LH+V DLV L+ +LG+D+VFLV HDWGA I WYFC+ RP+ +K
Sbjct  61    GYGDTDAPP-SASSYSVLHIVADLVGLLDALGIDQVFLVGHDWGASIAWYFCLLRPERLK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FRPR+P  KP++++RA  GDDYYICRFQ+ G +E D A  G+ ++++K    
Sbjct  120   ALVNMSVVFRPRNPKRKPIQSLRAMMGDDYYICRFQKPGEVEEDFARAGAARIIKKFLAS  179

Query  788   RKAGPPCLPKENPFGISTD-QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   PP   KE  FG S D    LPSWLSE+D+ YYASK++ KGFTGGLNYYR+++L WE
Sbjct  180   RDPRPPRASKEIGFGGSPDLHVALPSWLSEEDVNYYASKFEQKGFTGGLNYYRAMDLTWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG+++KVPVKF+VGD+D+ Y TPG+KEY+H GGFK+DVP L+E++V+EG  HF+N
Sbjct  240   LTAAWTGVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELIVMEGVAHFIN  299

Query  431   QERPEEV  411
             +ERPEE+
Sbjct  300   EERPEEI  306



>emb|CDY27752.1| BnaA05g31610D [Brassica napus]
Length=340

 Score =   429 bits (1102),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/315 (63%), Positives = 249/315 (79%), Gaps = 9/315 (3%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAP  1158
             +MEGI+H+ V VNGI MH+AEKG  +G V+L LHGFP+LWYTWRHQ+   + LG+RAVAP
Sbjct  9     EMEGIDHRMVSVNGITMHIAEKGPKEGTVVLLLHGFPDLWYTWRHQITALSSLGHRAVAP  68

Query  1157  DLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFR  984
             DLRGYGE+D+P    S YTCLH+VGDLVAL+ S+  D  KVFLV HDWGAI+GWY C+FR
Sbjct  69    DLRGYGESDSPECF-SEYTCLHLVGDLVALIDSVSGDQEKVFLVGHDWGAIVGWYLCLFR  127

Query  983   PDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLR  804
             P+ +K FV +SVP++PR+P +KPVE  +A FGDDYYICRFQE G+ E +IA     +VL+
Sbjct  128   PEKIKGFVCLSVPYKPRNPKVKPVEGFKAVFGDDYYICRFQEPGKAEREIACADPRRVLK  187

Query  803   KIFTDRKAGPPCLPKENPFGIS----TDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYY  636
              IF  R+ GPP LPK+NPFG +     +Q KLP W S++DL YY SK+   GFTGGLNYY
Sbjct  188   NIFIGRELGPPILPKDNPFGANPNPNCEQVKLPEWFSKEDLDYYVSKFKKTGFTGGLNYY  247

Query  635   RSINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVI  456
             R+++L WELTA WTG +++VPVKFM GD+DMVYTTPG+KEY+HGGGF  DVP L+E+VVI
Sbjct  248   RAMDLTWELTAPWTGAKIQVPVKFMTGDLDMVYTTPGVKEYIHGGGFAADVPNLQEVVVI  307

Query  455   EGGGHFLNQERPEEV  411
             E  GHF+NQE+P+EV
Sbjct  308   EDAGHFVNQEKPQEV  322



>ref|XP_010422608.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   427 bits (1099),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 237/306 (77%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGINMHV   G GPVILFLHGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MERIEHTTISTNGINMHVTSIGTGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   P SYT LH+VGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD VK
Sbjct  61    GYGDSDAPP-SPESYTILHIVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P++KPV+  RA FGDDYY+CRFQE G IE D A   ++K++ + F  
Sbjct  120   ALVNTSVVFNPRNPSVKPVDKFRALFGDDYYVCRFQEAGEIEEDFAQVDTKKLITRFFVS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+EQD+ +Y  K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+HGGG KK VP L+E+VV+EG GHFL Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYLHGGGLKKHVPFLQEVVVMEGVGHFLQQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_009147218.1| PREDICTED: bifunctional epoxide hydrolase 2 [Brassica rapa]
Length=331

 Score =   427 bits (1099),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 248/314 (79%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGI+H+ V VNGI MH+AEKG  +G V+L LHGFP+LWYTWRHQ+   + LG+RAVAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAEKGPKEGTVVLLLHGFPDLWYTWRHQITALSSLGHRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG++D+P    S YTCLH+VGDLVAL+ S+  D  KVFLV HDWGAI+GWY C+FRP
Sbjct  61    LRGYGDSDSPECF-SEYTCLHLVGDLVALLDSVAGDQEKVFLVGHDWGAIVGWYLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             + +K FV +SVP+RPR+P +KPVE  +A FGDDYYICRFQE G+ E +IA     +VL+ 
Sbjct  120   EKIKGFVCLSVPYRPRNPKVKPVEGFKAVFGDDYYICRFQEPGKAEREIACADPRRVLKN  179

Query  800   IFTDRKAGPPCLPKENPFGIS----TDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             IF  R+ GPP LPK+NPFG +     +Q KLP W S++DL YY SK+   GFTGGLNYYR
Sbjct  180   IFIGRELGPPILPKDNPFGANPNPNCEQVKLPEWFSKEDLDYYVSKFKKTGFTGGLNYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +++L WELTA WTG +++VPVKFM GD+DMVYTTPG+KEY+HGGGF  DVP L+E+VVIE
Sbjct  240   AMDLTWELTAPWTGAKIQVPVKFMTGDLDMVYTTPGVKEYIHGGGFAADVPNLQEVVVIE  299

Query  452   GGGHFLNQERPEEV  411
               GHF+NQE+P+EV
Sbjct  300   DAGHFVNQEKPQEV  313



>ref|XP_008223222.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Prunus mume]
Length=323

 Score =   426 bits (1096),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 251/310 (81%), Gaps = 4/310 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +MEG+EH+TV+VNGINMH+AEKGQGP+ILFLHGFPELWY+WRHQ+   A LGYRAVAPDL
Sbjct  3     EMEGVEHRTVQVNGINMHIAEKGQGPLILFLHGFPELWYSWRHQITALASLGYRAVAPDL  62

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
             RG+G+TDAP   P+SYTCLHV+GDLVAL+ ++    DKVF+V HDWGA+I WY C+FRPD
Sbjct  63    RGFGDTDAPD-SPTSYTCLHVIGDLVALLDAIAPDQDKVFVVGHDWGALIAWYLCLFRPD  121

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P  K +E+++A +GDDYYICRFQE G IE++ A  G+ +V+++ 
Sbjct  122   RVKALVNMSVVFPPRNPRRKTLESLKAVYGDDYYICRFQEPGVIEAEFAKIGTARVMKEF  181

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R  GP  LPK+  FG   D P  LPSWLSE ++ YYASK++  GFTGG+NYYR++NL
Sbjct  182   LTYRNPGPLFLPKDIMFGHPPDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLNL  241

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWEL AAWTG +VKVPVKF+VGD D+ Y + G K+++H GGFKK VPLLEE+VV+EG  H
Sbjct  242   NWELIAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKCVPLLEEVVVMEGVAH  301

Query  440   FLNQERPEEV  411
             F+NQERP+E+
Sbjct  302   FINQERPDEI  311



>ref|XP_009771842.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=318

 Score =   426 bits (1095),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 194/308 (63%), Positives = 245/308 (80%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPV-ILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME I+HK + VNGINMH+AE G+GP  ILFLHGFPELWYTWRHQL   +  GYRA+APDL
Sbjct  1     MEKIQHKNLSVNGINMHIAEIGEGPTAILFLHGFPELWYTWRHQLISLSSRGYRAIAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP   PSSYT  H+VGDL+AL+ +LG+D+VFLV HDWGAII WY C+ RPD +
Sbjct  61    RGYGDTDAPP-SPSSYTVFHIVGDLIALLDTLGLDQVFLVGHDWGAIIAWYLCLLRPDRI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V++SV F PRHP  KP+E+MRA  GDDYYICRFQE G++E + A   + +++ K   
Sbjct  120   KALVNMSVVFHPRHPKRKPIESMRAVLGDDYYICRFQEYGQVEEEFARVDTARLIAKFLI  179

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R   P  + KE  FG S+  P KLPSWLSE+D+ YYA+K+  KGFTGGLNYYR+++LNW
Sbjct  180   SRNPAPLRVSKEKGFGGSSHTPIKLPSWLSEEDIDYYANKFSQKGFTGGLNYYRAMDLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG+++KVPVKF+VGD+D+ Y TPG+KEY+H GGF+K VP L+E+V++EG GHF+
Sbjct  240   ELTAPWTGMQIKVPVKFIVGDLDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVGHFI  299

Query  434   NQERPEEV  411
             N+ERPEE+
Sbjct  300   NEERPEEI  307



>ref|XP_004290776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   426 bits (1094),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 249/310 (80%), Gaps = 5/310 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEHKT+KVNGINMHVAEKGQGPVILFLHGFPELWY WRHQ+   A LGYRAVAPDLR
Sbjct  1     MEGIEHKTIKVNGINMHVAEKGQGPVILFLHGFPELWYCWRHQMHALASLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+TDAP+ + SSYTCLHVVGDL+AL+ ++  D  KVF+V HDWGA+I W+ C+FRPD 
Sbjct  61    GFGDTDAPA-EASSYTCLHVVGDLIALLDAVAADQEKVFVVGHDWGAVIAWHLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V++SV F PR+P  KPV A++A +G DYY+CRFQEEG IE ++A  G ++V+++  
Sbjct  120   VKALVNLSVAFTPRNPQFKPVPALKAVYGGDYYMCRFQEEGDIEDELASLGCDRVMKEFL  179

Query  794   TDRKAGPPCLPKENPFG-ISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
             ++R  GP  LPK   FG  S D P  LPSWLSE D+ YYAS ++ KGFTG LNY+R+++ 
Sbjct  180   SNRNPGPLMLPKGKGFGNASPDAPVTLPSWLSEDDIHYYASNFEKKGFTGALNYFRNLDR  239

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG ++ VPVKF+VGD D+VY + G K+Y+H GGFKK VPLLEE+VV+EG  H
Sbjct  240   NWELTAPWTGSKILVPVKFIVGDQDLVYNSMGAKDYIHKGGFKKYVPLLEEVVVMEGVAH  299

Query  440   FLNQERPEEV  411
             F+N+ERPEE+
Sbjct  300   FINEERPEEI  309



>ref|XP_010546737.1| PREDICTED: bifunctional epoxide hydrolase 2 [Tarenaya hassleriana]
Length=327

 Score =   425 bits (1092),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 198/311 (64%), Positives = 241/311 (77%), Gaps = 6/311 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGIEH+ VKVNGINMH+AEKG  +GPV+L LHGFP+LWYTWRHQ+   A  GYRAVAPD
Sbjct  1     MEGIEHRMVKVNGINMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQIDGLASAGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYG+TD+P    S YTC HVVGDLV L+ SLG D+VFLV HDWGA++GWY C FRPD 
Sbjct  61    LRGYGDTDSPE-SFSEYTCHHVVGDLVDLINSLGQDQVFLVGHDWGALVGWYLCQFRPDK  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             ++A+  +SVPFR R+P +K V+ +RA FG+ YYICRFQ  G IE +I   G+ ++LRKI 
Sbjct  120   IRAYACLSVPFRARNPKIKQVDGLRAAFGEYYYICRFQAPGEIEKEIDCVGARRILRKIL  179

Query  794   TDRKAGPPCLPKENPFGISTD---QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
             T +  G P LPK NPFGI  D    P LP+W SE+DL +Y S+++  GFTGGLNYYR++N
Sbjct  180   TSKNPGAPFLPKVNPFGIDPDPSRDPALPAWFSEEDLDFYTSQFEKSGFTGGLNYYRAMN  239

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
             LNWELTA WTG  VKVPV FM GD+D VYTTPGI+EY+H G F  +VP L+E+VV+EG G
Sbjct  240   LNWELTAPWTGTRVKVPVMFMAGDLDNVYTTPGIREYIHDGAFASEVPNLQEVVVMEGVG  299

Query  443   HFLNQERPEEV  411
             HFLNQE+P+E 
Sbjct  300   HFLNQEKPQET  310



>ref|XP_002874922.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51181.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   424 bits (1090),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 238/306 (78%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GPVILFLHGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP  +  SYT LH+VGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD V 
Sbjct  61    GYGDSDAPPSR-ESYTILHIVGDLVGLLNSLGVDRVFLVGHDWGAIVAWWLCMIRPDRVN  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P++KPV+A RA FGDDYYICRFQE G IE D A   ++K++ + F  
Sbjct  120   ALVNTSVVFNPRNPSVKPVDAFRALFGDDYYICRFQEPGEIEEDFAQVDTKKLITRFFIS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+E+D+ +Y  K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSVGFRGLPDPPSLPAWLTEEDVSFYGDKFSQKGFTGGLNYYRALNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+H GG KK VP L+E+VV+EG GHFL+Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVLEGVGHFLHQ  299

Query  428   ERPEEV  411
             E+P+E+
Sbjct  300   EKPDEI  305



>ref|XP_004494384.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=317

 Score =   423 bits (1088),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 240/307 (78%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGI MH+A  G GPVILFLHGFPELWY+WRHQL   + LGYRA+APDLR
Sbjct  1     MEKIEHTTVNTNGIKMHIASIGSGPVILFLHGFPELWYSWRHQLLSLSSLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP   PSSY+ LH+VGDLV L+  LGVD+VFLV HDWGA + WYFC+ +PD VK
Sbjct  61    GYGDTDAPPC-PSSYSALHIVGDLVGLLDGLGVDRVFLVGHDWGAAMAWYFCLLKPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FRPR+P  KPV+ MRA  GDDYYICRFQ+ G  E + A  G+ ++++   T 
Sbjct  120   ALVNMSVVFRPRNPIRKPVQTMRALMGDDYYICRFQKPGEAEEEFARAGANRIIKSFLTL  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R     C+PKE  FG S + P  LPSWLSE+D+ YYA+KY+ KGFTGGLNYYR+++L WE
Sbjct  180   RDPRALCVPKEIGFGGSPNTPITLPSWLSEEDVNYYATKYEQKGFTGGLNYYRALDLTWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             L A WTG ++KVPVKF+VGD+D+ Y TPG+KEY+H GGF+++VP L+E+VV+EG  HF+N
Sbjct  240   LMAPWTGEQIKVPVKFIVGDLDLTYNTPGVKEYIHNGGFRREVPYLQEMVVMEGVAHFIN  299

Query  431   QERPEEV  411
             QERPEE+
Sbjct  300   QERPEEI  306



>gb|KDO71745.1| hypothetical protein CISIN_1g017221mg [Citrus sinensis]
Length=375

 Score =   426 bits (1094),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/308 (64%), Positives = 246/308 (80%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             E I+HK V VNGINMHVAEKGQGP+ILF+HGFP LWY+WRHQ+   A LGYRAVAPDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFIHGFPLLWYSWRHQITALASLGYRAVAPDLRG  117

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+  PS YTCLH+VGD++AL+ ++  D  KVF+V HDWGA+I WY C+FRPD V
Sbjct  118   YGDTDAPAEVPS-YTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDRV  176

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V++SV F PR+P MKP++  +A +GDDYYICRFQE G IE++ A  G+E VL++  T
Sbjct  177   KALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLT  236

Query  791   DRKAGPPCLPKENPFGISTD-QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GP  LPK   FG   D Q  LPSWLSE+D+KYYASKY+  GFTGG+NYYR+I LNW
Sbjct  237   YRNPGPLFLPKGKGFGHPPDAQIALPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNW  296

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             EL A WTG ++KVPVKF+VGD+D+ Y  PG K+Y++ GGFKK VPLLEE++V+EG GHF+
Sbjct  297   ELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFI  356

Query  434   NQERPEEV  411
             N+E+P+EV
Sbjct  357   NEEKPDEV  364



>gb|KEH24510.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   423 bits (1088),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/310 (64%), Positives = 249/310 (80%), Gaps = 6/310 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME IEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEEIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQISALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP+   SSYT  H+VGD+VAL+ SLGVD+VFLVAHDWGAIIGWY C+FRP+ +
Sbjct  61    RGYGDTDAPA-SISSYTIFHLVGDIVALIDSLGVDRVFLVAHDWGAIIGWYLCLFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP+ PR+P +KPV+ MRA +GDDYYICRFQE G++E++IA   SE +++ + T
Sbjct  120   KAYVCLSVPYLPRNPKLKPVDGMRAVYGDDYYICRFQEPGKMEAEIAKGSSELLIKAMLT  179

Query  791   DRKAGPPCLPKENPF---GISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              R  GPP LPKE       +S+  P LPSWL+ +D+ YYASK++  GF+GGLNYYR+ NL
Sbjct  180   SRNPGPPILPKEGILSHPSVSSTMP-LPSWLTLEDVAYYASKFEQTGFSGGLNYYRNFNL  238

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTAAWTG  +KVPVKF++GD+D+VYT+ G K+Y+  GGFK DVP LEE+V+ +G  H
Sbjct  239   NWELTAAWTGSHIKVPVKFIIGDLDLVYTSFGTKQYIESGGFKNDVPNLEEVVIQKGVAH  298

Query  440   FLNQERPEEV  411
             F NQE  EE+
Sbjct  299   FNNQEAAEEI  308



>ref|XP_011079631.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   423 bits (1087),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 246/307 (80%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H+ ++ NGIN+HVAE G+GP ILFLHGFPELWYTWRHQ+   +  GYRA+APDLR
Sbjct  1     MERIQHRHIQTNGINIHVAEIGEGPAILFLHGFPELWYTWRHQMLSLSSRGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP    SSYT  H++GDLV L+ +LG+D+VFLV HDWGA++ WYFC+FRPD +K
Sbjct  61    GYGDSDAPP-SASSYTAFHIIGDLVGLLDALGLDQVFLVGHDWGAVMAWYFCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F+PR+P  KPVE+MRA  GDDYYICRFQ+ G  E + A   + ++++K    
Sbjct  120   ALVNMSVVFQPRNPRRKPVESMRAILGDDYYICRFQKPGEAEEEFARVDTAQLIKKFLIS  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   P  +PKE  FG  TD+P  LPSWLSE D++YYA+K++ KGFTGGLNYYR+++L WE
Sbjct  180   RNPTPLRVPKEVGFGGRTDKPIILPSWLSEDDVQYYATKFNKKGFTGGLNYYRAMDLTWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG+++KVPVKF+VGD+D+ Y TPG+KEY+H GGF+K VP L+E+V++EG  HFLN
Sbjct  240   LTAAWTGVQIKVPVKFIVGDLDLTYNTPGVKEYIHNGGFRKQVPFLQELVIMEGVAHFLN  299

Query  431   QERPEEV  411
             QE+PEE+
Sbjct  300   QEKPEEI  306



>ref|XP_006489040.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=375

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 247/308 (80%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             E I+HK V VNGINMHVAEKGQGP+ILF+HGFP LWY+WRHQ+   A LGYRAVAPDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFIHGFPLLWYSWRHQIAALASLGYRAVAPDLRG  117

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+ + SSYTCLH+VGD++AL+ ++  D  KVF+V HDWGA+I WY C+FRPD V
Sbjct  118   YGDTDAPA-EVSSYTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDRV  176

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V++SV F PR+P MKP++  +A +GDDYYICRFQE G IE++ A  G+E VL++  T
Sbjct  177   KALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLT  236

Query  791   DRKAGPPCLPKENPFGISTD-QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GP  LPK   FG   D +  LPSWLSE+D+KYYASKY+  GFTGG+NYYR+I LNW
Sbjct  237   YRNPGPLFLPKGKGFGHPPDARIDLPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNW  296

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             EL A WTG ++KVPVKF+VGD+D+ Y  PG K+Y++ GGFKK VPLLEE++V+EG GHF+
Sbjct  297   ELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFI  356

Query  434   NQERPEEV  411
             N+E+P+EV
Sbjct  357   NEEKPDEV  364



>ref|XP_010556730.1| PREDICTED: bifunctional epoxide hydrolase 2 [Tarenaya hassleriana]
Length=316

 Score =   422 bits (1085),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 236/307 (77%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I H TV  NGINMHVA  G GP ILFLHGFP+LWY+WRHQL   + LGYRA+APDLR
Sbjct  1     MEKIVHTTVSTNGINMHVASIGSGPPILFLHGFPDLWYSWRHQLLSLSALGYRAIAPDLR  60

Query  1148  GYGETDAP-SLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             GYG++DAP SL+  SYT LH+VGDLV L+ SLG+D+VFLV HDWGAI+ W+ C+ RPD V
Sbjct  61    GYGDSDAPPSLE--SYTVLHLVGDLVGLLDSLGLDRVFLVGHDWGAIVAWWLCLIRPDRV  118

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
              A V+ SV F PR+P +KPV+  RA FGDDYYICRFQE G IE D A  G++K++ K  T
Sbjct  119   NALVNTSVAFSPRNPAVKPVDGFRALFGDDYYICRFQERGEIEEDFAQAGAKKLITKFLT  178

Query  791   DRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
              R   PPC+PK   F    D P LP WL+EQD+ YYA K+  KGFTGGLNYYR++NL+WE
Sbjct  179   SRNPRPPCIPKALGFRGLPDPPSLPDWLTEQDIDYYAEKFSQKGFTGGLNYYRAMNLSWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG ++KVPVKFMVGD+D+ Y  PG+KEY+H GG KK VP L+E+VV+EG GHFL 
Sbjct  239   LTAPWTGAQIKVPVKFMVGDLDVTYHIPGVKEYIHEGGIKKQVPFLQEVVVLEGVGHFLQ  298

Query  431   QERPEEV  411
             QE+PEE+
Sbjct  299   QEKPEEI  305



>ref|XP_006419515.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
 gb|ESR32755.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
Length=375

 Score =   424 bits (1090),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 246/308 (80%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             E I+HK V VNGINMHVAEKGQGP+ILF HGFP LWY+WRHQ+   A LGYRAVAPDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFFHGFPLLWYSWRHQIAALASLGYRAVAPDLRG  117

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+ + SSYTCLH+VGD++AL+ ++  D  KVF+V HDWGA+I WY C+FRPD V
Sbjct  118   YGDTDAPA-EVSSYTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDRV  176

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V++SV F PR+P MKP++  +A +GDDYYICRFQE G IE++ A  G+E VL++  T
Sbjct  177   KALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLT  236

Query  791   DRKAGPPCLPKENPFGISTD-QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GP  LPK   FG   D +  LPSWLSE+D+KYYASKY+  GFTGG+NYYR+I LNW
Sbjct  237   YRNPGPLFLPKGKGFGHPPDARIDLPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNW  296

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             EL A WTG ++KVPVKF+VGD+D+ Y  PG K+Y++ GGFKK VPLLEE++V+EG GHF+
Sbjct  297   ELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFI  356

Query  434   NQERPEEV  411
             N+E+P+EV
Sbjct  357   NEEKPDEV  364



>gb|AFK39155.1| unknown [Medicago truncatula]
Length=316

 Score =   422 bits (1084),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 248/307 (81%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGI H+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIVHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TD PS   +SYT  H+VGD+VAL+ SLGVD+VFLVAHDWGAI+GWY C+FRP+ V
Sbjct  61    RGYGDTDVPS-SVNSYTIFHLVGDVVALIDSLGVDQVFLVAHDWGAIVGWYLCLFRPERV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP+ PR+P +KPV+ MRA  GDDYYICRFQE G++E++IA   SE+V++ + T
Sbjct  120   KAYVCLSVPYLPRNPKVKPVDGMRALSGDDYYICRFQELGKMEAEIAKDSSEQVIKSMLT  179

Query  791   DRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
              R  GP  LPKE      + +P LPSWLS++D+ YYASK++  GF+GGLN+YR++NLNWE
Sbjct  180   GRTTGPLILPKERFLFHPSTKP-LPSWLSQEDVAYYASKFEKTGFSGGLNFYRNLNLNWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG ++KVP+KF+ GD D+VYT+ G K+Y+  GGFKKDVP LEE+V+ EG  HF N
Sbjct  239   LTAAWTGAQIKVPLKFITGDFDLVYTSSGTKQYIESGGFKKDVPNLEEVVIQEGVAHFNN  298

Query  431   QERPEEV  411
             QE  E++
Sbjct  299   QEAAEDI  305



>gb|EYU46741.1| hypothetical protein MIMGU_mgv1a009984mg [Erythranthe guttata]
Length=325

 Score =   422 bits (1085),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 184/307 (60%), Positives = 245/307 (80%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ I+HK ++ NGIN+HVAE G+GP +LFLHGFPELWY+WRHQ+ F +  GYRA+APDLR
Sbjct  1     MDKIQHKNIRSNGINIHVAEIGRGPAVLFLHGFPELWYSWRHQMLFLSSRGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP    SSYT  H++GDLV L+ +LG+D+V+LV HDWGA++ WY C+ RPD +K
Sbjct  61    GYGDSDAPP-SASSYTAFHIIGDLVGLLDALGLDRVYLVGHDWGAVMAWYLCLLRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P  KPVE+MRA  G+DYYICRFQE G  ES+ A   + ++++K  T 
Sbjct  120   ALVNLSVVFHPRNPKRKPVESMRAILGNDYYICRFQEPGEAESEFARVDTARLIKKFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   P  +PKE  FG S  +P  +PSWLSE+D++YYASK+ LKGFTGGLNYYR+++LNWE
Sbjct  180   RNPAPLIVPKEVGFGGSPHKPITMPSWLSEEDVQYYASKFSLKGFTGGLNYYRAMDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA W+ +++KVPVKF+VGD+D+ Y TPG+KEY+HGGGFK+ VP L+E+V++EG  HF+N
Sbjct  240   LTAPWSSVQIKVPVKFIVGDLDLTYNTPGVKEYIHGGGFKRQVPFLQELVIMEGVAHFIN  299

Query  431   QERPEEV  411
             QE+PEE 
Sbjct  300   QEKPEET  306



>ref|XP_007200440.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
 emb|CAZ86693.1| epoxide hydrolase 2 [Prunus persica]
 gb|EMJ01639.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
Length=316

 Score =   422 bits (1084),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 234/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMH+A  G GPV+LFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTTVSTNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP   P+SY+ LH+VGDL+ L+  LG+D+VFLV HDWGA+I W+FC+FRPD VK
Sbjct  61    GFGDTDAPP-SPASYSALHIVGDLIGLLDHLGIDQVFLVGHDWGAVIAWWFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P  KPV+  RA FGDDYYICRFQE G IE + A + +  +++K  T 
Sbjct  120   ALVNMSVAFSPRNPKRKPVDGFRALFGDDYYICRFQEPGEIEKEFAGYDTTSIMKKFLTG  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPCLPKE           LP WLSE+DL Y+ASK+   GF GGLNYYR++NL WEL
Sbjct  180   RSPKPPCLPKELGLRAWKTPETLPPWLSEEDLNYFASKFSKTGFVGGLNYYRALNLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             T  WTG++VKVPVKF+VGD+D+ Y  PG+K Y+H GGFK+DVP L+E+VVIE G HF+NQ
Sbjct  240   TGPWTGLQVKVPVKFIVGDLDITYHIPGVKNYIHNGGFKRDVPFLQEVVVIEDGAHFINQ  299

Query  428   ERPEEV  411
             ERP+E+
Sbjct  300   ERPDEI  305



>ref|XP_004296863.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   422 bits (1084),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 244/309 (79%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TVKVNGINMHVAEKGQGPVILF+HGFPELWY WRHQ+Q  A +GYRAVAPDLR
Sbjct  1     MEGIEHRTVKVNGINMHVAEKGQGPVILFIHGFPELWYCWRHQIQALAAVGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             GYG+TDAP+ Q SSYTCLHVVGDLVAL+ ++  D  KVF+V HDWGA+I WY C+FRPD 
Sbjct  61    GYGDTDAPADQ-SSYTCLHVVGDLVALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V++SV F PR+P  K  E +RA +GDDYY+CRFQE G IE++ A  G+ +V+++  
Sbjct  120   VKALVNLSVAFSPRNPQRKTTEMLRAVYGDDYYMCRFQEPGEIEAEFAQIGTARVMKEFL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R  GP  LPK   F    D P  LPSWLSE D+ YY S ++ KGFTGG+NYYR+ + N
Sbjct  180   TYRHPGPLFLPKGKGFRHPPDAPIPLPSWLSEDDVNYYVSFFEKKGFTGGINYYRNFDRN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTA WTG  +KVPVKF+VGD D+VY + G K+++H GGFKK VPLLEE+VV+EG GHF
Sbjct  240   WELTAPWTGARIKVPVKFIVGDQDLVYNSLGAKDFIHKGGFKKYVPLLEEVVVMEGVGHF  299

Query  437   LNQERPEEV  411
             +N+ERP E+
Sbjct  300   INEERPNEI  308



>emb|CDY50394.1| BnaCnng19260D [Brassica napus]
Length=316

 Score =   421 bits (1082),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 238/306 (78%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGIN+HVA  G GP ILFLHGFP+LWY+WR QL  FAGLGYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSFAGLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++D+P     SYT LHVVGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD VK
Sbjct  61    GYGDSDSPPSH-ESYTVLHVVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWMCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P++KPV+A +A FG+DYYICRFQE G IE D A   ++K++ + FT 
Sbjct  120   ALVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+E+D+ +YA K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSLGFRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+H GG KK VP L+E+VV+EG GHFL Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_002884518.1| hypothetical protein ARALYDRAFT_317420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60777.1| hypothetical protein ARALYDRAFT_317420 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 247/314 (79%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGI+H+ V VNGI MH+AEKG  +GPV+L LHGFP+LWYTWRHQ+   + LGYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQICGLSSLGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG++D+P    S YTCL+VVGDLVAL+ S+  D  KVFLV HDWGAIIGW+ C+FRP
Sbjct  61    LRGYGDSDSPE-SFSEYTCLNVVGDLVALLDSVAGDQEKVFLVGHDWGAIIGWFLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             + +K FV +SVP+R R+P +KPV+  +A FGDDYYICRFQE G+ E++IA       LR 
Sbjct  120   EKIKGFVCLSVPYRSRNPLVKPVQGFKAVFGDDYYICRFQEPGKTEAEIASADPRIFLRN  179

Query  800   IFTDRKAGPPCLPKENPFG----ISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             +FT R  GPP LPK+NPFG     +++  +LP W S++DL +Y SK++  GFTGGLNYYR
Sbjct  180   LFTGRSLGPPILPKDNPFGENPNPNSENIELPEWFSKKDLDFYVSKFEKTGFTGGLNYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +++LNWELT  WTG +V+VPVKFM GD DMVYTTPG+KEY+HGGGF  DVP L+EIVVIE
Sbjct  240   AMDLNWELTTPWTGAKVQVPVKFMTGDFDMVYTTPGMKEYIHGGGFSADVPTLQEIVVIE  299

Query  452   GGGHFLNQERPEEV  411
               GHF+NQE+P+EV
Sbjct  300   DAGHFVNQEKPQEV  313



>ref|NP_187211.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAF26137.1|AC011620_13 putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAL49778.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAM51432.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AEE74264.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=331

 Score =   421 bits (1082),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 247/314 (79%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGI+H+ V VNGI MH+AEKG  +GPV+L LHGFP+LWYTWRHQ+   + LGYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQISGLSSLGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG++D+P    S YTCL+VVGDLVAL+ S+    +KVFLV HDWGAIIGW+ C+FRP
Sbjct  61    LRGYGDSDSPE-SFSEYTCLNVVGDLVALLDSVAGNQEKVFLVGHDWGAIIGWFLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             + +  FV +SVP+R R+P +KPV+  +A FGDDYYICRFQE G+IE +IA       LR 
Sbjct  120   EKINGFVCLSVPYRSRNPKVKPVQGFKAVFGDDYYICRFQEPGKIEGEIASADPRIFLRN  179

Query  800   IFTDRKAGPPCLPKENPFG----ISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             +FT R  GPP LPK+NPFG     +++  +LP W S++DL +Y SK++  GFTGGLNYYR
Sbjct  180   LFTGRTLGPPILPKDNPFGEKPNPNSENIELPEWFSKKDLDFYVSKFEKAGFTGGLNYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +++LNWELTA WTG +++VPVKFM GD DMVYTTPG+KEY+HGGGF  DVP L+EIVVIE
Sbjct  240   AMDLNWELTAPWTGAKIQVPVKFMTGDFDMVYTTPGMKEYIHGGGFAADVPTLQEIVVIE  299

Query  452   GGGHFLNQERPEEV  411
               GHF+NQE+P+EV
Sbjct  300   DAGHFVNQEKPQEV  313



>ref|XP_009352305.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   420 bits (1080),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/308 (63%), Positives = 248/308 (81%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             EGIEH+TV+VNGINMHVAEKG GP+ILF+HGFP+LWY+WRHQ+   + LGYR VAPDLRG
Sbjct  4     EGIEHRTVQVNGINMHVAEKGHGPLILFIHGFPDLWYSWRHQILALSALGYRTVAPDLRG  63

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+  PSSYTCLHVVGDLVAL+ ++  D+  VF+VAHDWG+II WY C+FRPD +
Sbjct  64    YGDTDAPA-SPSSYTCLHVVGDLVALLDTIAPDQEQVFVVAHDWGSIIAWYLCLFRPDRL  122

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V +SV F PR+P  K +++++A +GDDYYICRFQE G IE++ A  G+ ++L++  T
Sbjct  123   KALVSLSVAFSPRNPQRKIIKSLQAVYGDDYYICRFQEPGVIEAEFAQMGTTRILKEFLT  182

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GP  LPK   FG  TD P  LPSWLSE ++ YYA+K++  GFTGG+NYYR+++LNW
Sbjct  183   YRNPGPLFLPKGKGFGRPTDAPIVLPSWLSEDEVNYYATKFEKTGFTGGINYYRNLDLNW  242

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELT AWTG +VKVPVKF+VGD D+VY +PG K+++H GGFKK  PLLE++VV+EG  HFL
Sbjct  243   ELTTAWTGAQVKVPVKFIVGDQDLVYNSPGAKDFIHKGGFKKYAPLLEQVVVMEGVAHFL  302

Query  434   NQERPEEV  411
              QE+P+E+
Sbjct  303   QQEKPDEI  310



>ref|XP_006604802.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43315.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   420 bits (1079),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 198/308 (64%), Positives = 244/308 (79%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MEGIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP    SSY C H+VGDLVAL+ SLGV +VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTEAPP-SISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF  R P ++ V+ MRA +GDDYY+CRFQ+ G +E+ +A  G+  VL+ I T 
Sbjct  120   AYVCLSVPFLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTGYVLKNILTS  179

Query  788   RKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             RK GPP LP  E   G + D    LPSWL+E DL YY SK++  GFTGGLNYYR+ NL+W
Sbjct  180   RKTGPPFLPHGEFGTGFNPDMSDSLPSWLTEDDLAYYVSKFEKTGFTGGLNYYRNFNLDW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG+++KVPVKF+ G++D VYT+  +KEY+HGGGFK+DVP LE+++V +G  HF 
Sbjct  240   ELTAPWTGVQIKVPVKFITGELDSVYTSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFN  299

Query  434   NQERPEEV  411
             NQE  EE+
Sbjct  300   NQEAAEEI  307



>gb|KHG07158.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=316

 Score =   420 bits (1079),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 235/306 (77%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGI MHVA  G GP+ILFLHGFPELWYTWR QL   + LGYR VAPDLR
Sbjct  1     MEKIEHTTVTTNGIKMHVASIGSGPIILFLHGFPELWYTWRRQLLSLSSLGYRCVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   P SYT  HVVGDLV L+ +LGVDKVFLV HDWGA+I W FC+FRPD +K
Sbjct  61    GYGDSDAPP-SPESYTVFHVVGDLVGLLDALGVDKVFLVGHDWGAMIAWNFCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SVP+ PR+P +K V+  RA FGDD+YICRFQ  G  E+  A   + KVL+K  T 
Sbjct  120   ALVNLSVPYHPRNPKVKTVDGYRALFGDDFYICRFQVPGEAEAHFAQMDTAKVLKKFLTT  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PKE       D P LPSWLSE ++ Y+A+K++ KGFTGGLNYYR++NLNWEL
Sbjct  180   RDPNPPCIPKETGLKALPDPPALPSWLSEDEINYFATKFNQKGFTGGLNYYRAMNLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              A WTG++++VPVKF+VGD+D+ Y  PG+KEY+  GGFKK+VP L+E+VV+EG  HF+NQ
Sbjct  240   MAPWTGLQIQVPVKFIVGDLDITYHIPGVKEYLQNGGFKKNVPFLQELVVMEGVAHFINQ  299

Query  428   ERPEEV  411
             E+P+E+
Sbjct  300   EKPQEI  305



>emb|CDY65636.1| BnaAnng20810D [Brassica napus]
Length=316

 Score =   420 bits (1079),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 237/306 (77%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGIN+HVA  G GP ILFLHGFP+LWY+WR QL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSFADLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP     SYT LHVVGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD VK
Sbjct  61    GYGDSDAPPSH-ESYTVLHVVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWMCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P++KPV+A +A FG+DYYICRFQE G IE D A   ++K++ + FT 
Sbjct  120   ALVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+E+D+ +YA K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSLGFRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+H GG KK VP L+E+VV+EG GHFL Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_010921626.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   419 bits (1078),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 243/308 (79%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEG-IEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEG I H+ V VNGINMH+AEKG+GPV+L LHGFPELWY+WRHQ+   +  GYRA+APDL
Sbjct  1     MEGEIHHRFVAVNGINMHIAEKGEGPVVLLLHGFPELWYSWRHQILALSAAGYRAIAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RG+G+TDAP  + SSYT  HVVGDLVAL+ +LG +KVF+V HDWGA++ W  CMFRPD V
Sbjct  61    RGFGDTDAPP-EASSYTMFHVVGDLVALIHTLGQEKVFVVGHDWGAMVAWSLCMFRPDKV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             +A V++SV FRPR P  KPVE +RA +GDDYYIC FQE GR E++ A   +  V++K  T
Sbjct  120   RALVNLSVAFRPRSPDRKPVETLRAVYGDDYYICTFQEPGRTEAEFACIPTALVIKKFLT  179

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
                  P  +PKEN F  S D+   LPSWLSE+D+ Y+ASK+D  GFTGGLNYYR+++LNW
Sbjct  180   YHDPSPVIVPKENGFAASPDKEITLPSWLSEEDINYFASKFDKSGFTGGLNYYRALDLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG+++KVPVKF+VG+ D++Y  PG+K+Y+H GGFKKDVP LE++VVIEG GHF+
Sbjct  240   ELTAPWTGMQIKVPVKFIVGNQDLMYNIPGVKDYIHKGGFKKDVPFLEDVVVIEGAGHFI  299

Query  434   NQERPEEV  411
             NQE+P+E 
Sbjct  300   NQEKPQET  307



>gb|KDP28184.1| hypothetical protein JCGZ_13955 [Jatropha curcas]
Length=315

 Score =   419 bits (1076),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 235/306 (77%), Gaps = 2/306 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGINMHVA  G GPVILFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTTIPTNGINMHVASIGTGPVILFLHGFPELWYSWRHQLLSLSALGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP   P+ YT LH+VGDLV L+ SLG+++VFLV HDWGAI+ W+ C+FRPD +K
Sbjct  61    GYGDTDAPP-SPTQYTILHLVGDLVGLLDSLGIEQVFLVGHDWGAIVAWHMCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P  KP+E  R   GDD+YICRFQE G IE D A  G+ KVLR+    
Sbjct  120   ALVNTSVVFTPRNPNHKPLEKYRELLGDDFYICRFQEPGEIEEDFAQAGAAKVLRRFLAS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK    G+  D P LP WLSE+D+ YY SK++ KGFTGGLNYYR ++LNWEL
Sbjct  180   RNPKPPCIPKIGFRGLP-DNPSLPPWLSEEDINYYVSKFNQKGFTGGLNYYRCLDLNWEL  238

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG+++KVPVKF+VGD+D+ Y  PG+KEY+H GG KK VP L+E+V++EG  H+LNQ
Sbjct  239   TAPWTGLQIKVPVKFIVGDLDVTYHFPGVKEYIHNGGLKKYVPFLQEVVIMEGVCHYLNQ  298

Query  428   ERPEEV  411
             E+PEE+
Sbjct  299   EKPEEI  304



>ref|XP_010486015.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=331

 Score =   419 bits (1077),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 245/314 (78%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGI+HK V VNGI MH+AEKG   GPV+L LHGFP+LWYTWRHQ+   + LGYRAVAPD
Sbjct  1     MEGIDHKMVSVNGITMHIAEKGPIDGPVVLLLHGFPDLWYTWRHQITGLSSLGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG++D+P    S YTCL+VVGDLVAL+ S+  D  KVFLV HDWGAIIGW+ C+FRP
Sbjct  61    LRGYGDSDSPK-SFSEYTCLNVVGDLVALLDSVAGDQEKVFLVGHDWGAIIGWFLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             + +K FV +SVP++PR+P +KP++  +A FG++YYICRFQE G+IE +IA     + LR 
Sbjct  120   EKIKGFVCLSVPYKPRNPNVKPIQGFKAVFGENYYICRFQEAGKIEEEIARADPRRFLRN  179

Query  800   IFTDRKAGPPCLPKENPFGIST----DQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             IFT R  GP  LPK +PFG +     +  +LP W S++DL +YASK+D  GFTG LNYYR
Sbjct  180   IFTGRTLGPSILPKNDPFGENPKPNYENIELPKWFSKEDLDFYASKFDKTGFTGALNYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +++LNWELTA WTG +++VPVKFM GD DMVYTTPGIKEYVHGGGF   VP L+EIVVIE
Sbjct  240   AMDLNWELTAPWTGAKIQVPVKFMTGDFDMVYTTPGIKEYVHGGGFAAAVPNLQEIVVIE  299

Query  452   GGGHFLNQERPEEV  411
               GHF+NQE+P+EV
Sbjct  300   DAGHFVNQEKPQEV  313



>ref|XP_010464087.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=331

 Score =   419 bits (1076),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 248/314 (79%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGI+H+ V VNGI MH+AEKG   GPV+L LHGFP+LWYTWRHQ+   + LGYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAEKGPIDGPVVLLLHGFPDLWYTWRHQINGLSSLGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG++D+P    S Y+CL+VVGDLVAL++S+  D  KVFLVAHDWGAIIGW+ C+FRP
Sbjct  61    LRGYGDSDSPK-SFSEYSCLNVVGDLVALLESVAGDQEKVFLVAHDWGAIIGWFLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             + +K FV +SVP++PR+P +KP++  +A FG++YYICRFQE G+ E +IA     + LR 
Sbjct  120   EKIKGFVCLSVPYKPRNPNVKPIQGFKAVFGENYYICRFQEPGKTEEEIARADPRRFLRN  179

Query  800   IFTDRKAGPPCLPKENPFGIST----DQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             IFT R  GP  LPK +PFG +     +  +LP+W S++DL +YASK+D  GFTG LNYYR
Sbjct  180   IFTGRTPGPSILPKNDPFGENPKPNYENIELPNWFSKEDLDFYASKFDKTGFTGALNYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +++LNWELTA WTG +++VPVKFM GD+DMVYTTPGIKEY+HGG F  DVP L+EIVVIE
Sbjct  240   AMDLNWELTAPWTGAKIQVPVKFMTGDVDMVYTTPGIKEYIHGGRFAADVPNLQEIVVIE  299

Query  452   GGGHFLNQERPEEV  411
               GHF+NQE+P+EV
Sbjct  300   DAGHFVNQEKPQEV  313



>gb|ADP68585.1| epoxide hydrolase A [Vigna radiata]
Length=319

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 250/313 (80%), Gaps = 12/313 (4%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   +  GYRAVAPDLR
Sbjct  1     MEEIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP    SSYT +H+VGD+VAL+ SLGV +VFLVAHDWGAI+GWY C+FRP+ +K
Sbjct  61    GYGDTEAPE-SISSYTIMHLVGDIVALIDSLGVGQVFLVAHDWGAIVGWYLCLFRPEKIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSE----KVLRK  801
             A+V +SVPF PR+P ++PV+AMRA +GDDYYICRFQE G+ E   A++GS     +V++ 
Sbjct  120   AYVCLSVPFMPRNPKVRPVDAMRALYGDDYYICRFQEPGKAE---ALYGSNNNIGEVIKS  176

Query  800   IFTDRKAGPPCLPKEN---PFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRS  630
             I T+R+ GPP LPKE    P G    +P LPSWLSE+D+ YYASK+   G TGGLNYYR+
Sbjct  177   ILTNRRPGPPILPKEGVALPSGSLPSRP-LPSWLSEEDVTYYASKFSKTGLTGGLNYYRN  235

Query  629   INLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEG  450
             +NLNWELTAAWTG +VKVPVKF+ GD+D+VYT+ GIK+Y+  G FK+DV  LEE+VV EG
Sbjct  236   LNLNWELTAAWTGAKVKVPVKFITGDLDVVYTSLGIKDYIDSGAFKRDVHYLEEVVVQEG  295

Query  449   GGHFLNQERPEEV  411
               HF NQE  E++
Sbjct  296   VAHFNNQEAAEDI  308



>ref|XP_003632381.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   417 bits (1073),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 243/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H+ ++VNGINMHVAE G+GP ILFLHGFPELWY+WRHQL   + LGYRA+APDLR
Sbjct  1     MEKIQHRNLRVNGINMHVAEIGEGPPILFLHGFPELWYSWRHQLLSLSSLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   P+SYT LH+VGDL+AL+ SL + +VFLV HDWGA I WYFC+ RPD VK
Sbjct  61    GYGDSDAPP-SPASYTALHIVGDLIALLDSLRLGQVFLVGHDWGAAIAWYFCLLRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FRPR+PT KP+E+MR  FGDDYY+CRFQE G  E++ A  G+E V++     
Sbjct  120   ALVNMSVVFRPRNPTRKPIESMRVLFGDDYYMCRFQEPGLAENEFARLGTETVMKIFLGS  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   PP +PKE+ +  +   P  LP WLS++D+ Y+ASK++  GFTGGLNYYR+++L+WE
Sbjct  180   RNPRPPRMPKESWYSGALKTPTALPPWLSQEDIDYFASKFNQNGFTGGLNYYRALDLSWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
               A WTG+ +KVPVKF+VGD+D  Y TPG+KEY+H GGFK++VP L+E+V++EG  HF+N
Sbjct  240   ALAPWTGVPIKVPVKFIVGDLDTTYNTPGVKEYIHNGGFKREVPFLQELVIMEGVAHFIN  299

Query  431   QERPEEV  411
             QERPEE+
Sbjct  300   QERPEEI  306



>ref|XP_010269590.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nelumbo nucifera]
Length=318

 Score =   417 bits (1073),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 191/309 (62%), Positives = 245/309 (79%), Gaps = 5/309 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+ V VNGINMH+AEKG+GPV+LF+HGFPELWY+WRHQ+   A  GYRAVAPDLR
Sbjct  1     MEGIEHRMVSVNGINMHIAEKGEGPVVLFIHGFPELWYSWRHQIVALAARGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    +SY+  H+VGDL+AL+  LG D+VF+V HDWGAII WY C+FRPD VK
Sbjct  61    GYGDTDAPP-SITSYSVFHIVGDLIALLNILGQDQVFVVGHDWGAIIAWYLCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P  K V+ +RA FGD+YYICRFQE G IE++ A  G+ K+++   T 
Sbjct  120   ALVNLSVSFMPRNPAGKTVQRLRAAFGDNYYICRFQEPGEIEAEFAQAGATKIMKYFLTY  179

Query  788   RKAGPPCLPKENPFGISTDQPK---LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             +K GP  LPK +  G+  D P+   LP WL+E+D+ YYA+K++ KGFTGGLNYYR+++L 
Sbjct  180   KKTGPLILPKGSIRGLH-DAPQVDELPPWLTEEDVNYYATKFEQKGFTGGLNYYRALDLT  238

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WE+TA WT ++VKVP KF+VGD D+ YTTPG KEY+HGGGFK+DVP L+E+VV+EG GHF
Sbjct  239   WEITAPWTNVQVKVPAKFIVGDQDVTYTTPGAKEYIHGGGFKRDVPFLQEVVVMEGVGHF  298

Query  437   LNQERPEEV  411
             + QER +E+
Sbjct  299   ITQERADEI  307



>ref|XP_003550367.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Glycine 
max]
Length=319

 Score =   417 bits (1073),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 191/309 (62%), Positives = 246/309 (80%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+T+ VNGINMH+AEKG+GP+ILF+HGFP+LWY+WRHQ+   A LGYR VAPDLR
Sbjct  1     MEGIEHQTLNVNGINMHIAEKGEGPLILFIHGFPDLWYSWRHQITALASLGYRCVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             GYG+TD P+  P++YT LHVVGDLV L+ ++  D  KVF+V HDWGA+  W   ++RP+ 
Sbjct  61    GYGDTDVPA-NPTAYTSLHVVGDLVGLLDAIVGDEEKVFVVGHDWGAMTAWSLSLYRPER  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             ++A V++SV F PR+P  KP++ +RA +G+DYYICRFQE G IE++ A  G+ +VL++  
Sbjct  120   IRALVNLSVVFTPRNPKRKPLDTLRAVYGNDYYICRFQEPGEIEAEFAQIGTARVLKEFL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R  GP  LPK   F   TD P  LPSWLSE++  YYASKYD  GFTGGLNYYR+++LN
Sbjct  180   TYRNPGPLYLPKGKAFAHPTDSPIALPSWLSEEECDYYASKYDKTGFTGGLNYYRNLDLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTA+WTG +VKVPVKF+VGD+D+ Y  PG KEY+H GGFK+DVPLLE++VV+EG GHF
Sbjct  240   WELTASWTGAQVKVPVKFIVGDLDLTYNAPGAKEYIHKGGFKRDVPLLEDVVVLEGAGHF  299

Query  437   LNQERPEEV  411
             L+QERP+E+
Sbjct  300   LHQERPDEI  308



>ref|XP_006299381.1| hypothetical protein CARUB_v10015540mg [Capsella rubella]
 gb|EOA32279.1| hypothetical protein CARUB_v10015540mg [Capsella rubella]
Length=328

 Score =   417 bits (1073),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/312 (63%), Positives = 244/312 (78%), Gaps = 8/312 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGI+H+ V VNGI +HVAEKG  +GPV+L LHGFP+LWYTWRHQ+   + LGYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITLHVAEKGPKEGPVVLLLHGFPDLWYTWRHQITGLSSLGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYG++D+P    S YTCL+VVGDL++L+ +L    VFLV HDWGAIIGW+ C+FRP+ 
Sbjct  61    LRGYGDSDSPE-SFSEYTCLNVVGDLISLLDTLFAGDVFLVGHDWGAIIGWHLCLFRPEK  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             +K FV +SVP++PR+P +KPV+  +A FGDDYYICRFQE G+IE +IA     + LR IF
Sbjct  120   IKGFVCLSVPYKPRNPKVKPVQGFKAVFGDDYYICRFQEPGKIEGEIA-SDPRRFLRSIF  178

Query  794   TDRKAGPPCLPKENPFGIST----DQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
             T R  GPP LPK +PF  +     +  +LP W S++DL +Y SK+D  GFTGGLNYYR++
Sbjct  179   TGRTLGPPILPKNDPFAENPKPDYESIELPKWFSKEDLDFYTSKFDKTGFTGGLNYYRAM  238

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             +LNWELTA WTG +++VPVKFM GD DMVYTTPGIKEY+HGGGF  DVP L+EIVVIE  
Sbjct  239   DLNWELTAPWTGAKIQVPVKFMTGDFDMVYTTPGIKEYIHGGGFAADVPNLQEIVVIEDA  298

Query  446   GHFLNQERPEEV  411
             GHF+NQE+P EV
Sbjct  299   GHFVNQEKPREV  310



>ref|XP_009111296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=316

 Score =   417 bits (1072),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 236/306 (77%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGIN+HVA  G GP ILFLHGFP+LWY+WR QL   A LGYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSLADLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++D+P     SYT LHVVGDLV L+ SLGVD+VFLV HDWGAI+ W+ CM RPD VK
Sbjct  61    GYGDSDSPPSH-ESYTVLHVVGDLVGLLDSLGVDRVFLVGHDWGAIVAWWMCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P++KPV+A +A FG+DYYICRFQE G IE D A   ++K++ + FT 
Sbjct  120   ALVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F    D P LP+WL+E+D+ +YA K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKSLGFRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+H GG KK VP L+E+VV+EG GHFL Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_006355815.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   417 bits (1071),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 241/308 (78%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGP-VILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME I+HK + VNGINMHVAE G+GP  ILFLHGFPELWYTWRHQL   +  GYRA+APDL
Sbjct  1     MENIQHKNLSVNGINMHVAEIGEGPSTILFLHGFPELWYTWRHQLISLSSKGYRAIAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TD+P   PSSYT  H+VGDL+AL+ +LG+D+VFLV HDWGA+I W+ C+ RPD +
Sbjct  61    RGYGDTDSPP-SPSSYTVFHIVGDLIALLDALGLDQVFLVGHDWGAVIAWHVCLLRPDRI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V++SV F PR+P  KP+E+MRA  GDDYYICRFQE G  E + A   + +++ K  T
Sbjct  120   KALVNMSVVFHPRNPKRKPIESMRAVLGDDYYICRFQEYGEAEEEFARVDTARLIAKFLT  179

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R   P  +PKE  FG S   P  LPSWLSE+D+ YYA+K+   GFTGGLNYYR+++LNW
Sbjct  180   SRNPAPLRVPKEKGFGGSPHTPITLPSWLSEEDVNYYANKFRQSGFTGGLNYYRAMDLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG+++KVPVKF++GD+D+ Y TPG+KEY+H GGF+K VP L+E+V++EG  HF+
Sbjct  240   ELTAPWTGVQIKVPVKFIIGDVDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVAHFI  299

Query  434   NQERPEEV  411
             NQERPEE+
Sbjct  300   NQERPEEI  307



>ref|XP_008235117.1| PREDICTED: bifunctional epoxide hydrolase 2 [Prunus mume]
Length=316

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 233/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV+ NGINMH+A  G GPV+LFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTTVRTNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP   P+SY+ LH+VGDL+ L+  LG+D+VFLV HDWGA+I W+FC+FRPD VK
Sbjct  61    GFGDTDAPP-SPASYSALHIVGDLIGLLDHLGIDQVFLVGHDWGAVIAWWFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P  KPV+  RA FGDDYYICRFQE G IE + A   +  +++K  T 
Sbjct  120   ALVNMSVAFSPRNPKRKPVDGFRALFGDDYYICRFQEPGEIEKEFAGFDAASIMKKFLTG  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPCLPKE           LP WL E+D+ Y+ASK+   GF GGLNYYR++NL WEL
Sbjct  180   RSPKPPCLPKELGLRAWKTPETLPPWLLEEDVNYFASKFSKTGFVGGLNYYRALNLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             T  WTG+++KVPVKF+VGD+D+ Y  PG+KEY+H GGFK+DVP L+E+VVIE G HF+NQ
Sbjct  240   TGPWTGLQIKVPVKFIVGDLDITYHIPGMKEYIHNGGFKRDVPFLQEVVVIEDGAHFINQ  299

Query  428   ERPEEV  411
             E+P E+
Sbjct  300   EKPHEI  305



>ref|XP_009620847.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 242/308 (79%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQG-PVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME I+HK + VNGINMH+AE G+G   ILFLHGFPELWYTWRHQL   +  GYRA+APDL
Sbjct  1     MEKIQHKNLTVNGINMHIAEIGEGQSAILFLHGFPELWYTWRHQLLALSSKGYRAIAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP   PSSYT  H+VGDL+AL+ +L +D+VFLV HDWGAII W+ C+ RPD +
Sbjct  61    RGYGDTDAPP-SPSSYTVFHIVGDLIALLDTLRLDQVFLVGHDWGAIIAWHLCLLRPDRI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V++SV F PRHP  KP+E+MRA  GDDYYICRFQE G++E + A   + +++ K   
Sbjct  120   KALVNMSVVFHPRHPKRKPIESMRAVLGDDYYICRFQEYGQVEEEFARVDTARLIAKFLI  179

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R   P  + KE  FG S+  P KLPSWLSE+D+ YYA+K+  KGFTGGLNYYR+++LNW
Sbjct  180   SRNPAPLRVSKEKGFGGSSHTPIKLPSWLSEEDINYYANKFSQKGFTGGLNYYRAMDLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG ++KVPVKF+VGD+D+ Y TPG+KEY+H GGF+K VP L+E+V++EG GHF+
Sbjct  240   ELTAPWTGQQIKVPVKFIVGDLDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVGHFI  299

Query  434   NQERPEEV  411
             N+E+PEE+
Sbjct  300   NEEKPEEI  307



>gb|KHG21329.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=386

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/309 (64%), Positives = 240/309 (78%), Gaps = 3/309 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +MEGIEH+ +K NGINMHVAEKG+GPVILFLHGFPELWYTWRHQ+  FA LGYRA+APDL
Sbjct  68    EMEGIEHRVIKANGINMHVAEKGKGPVILFLHGFPELWYTWRHQITAFASLGYRALAPDL  127

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPD  978
             RG+GET+AP    S+YT L VVGDL+AL+  +  D+  VF+V HDWGA+I W+ CMFRPD
Sbjct  128   RGFGETEAPD-DASTYTSLDVVGDLIALLDVVAADQDQVFVVGHDWGALIAWWLCMFRPD  186

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P MKP+E +RA +GDDYYICRFQE G IE++    G E+VL+  
Sbjct  187   RVKALVNMSVAFNPRNPNMKPLEGLRALYGDDYYICRFQEPGVIEAEFREMGYERVLKGF  246

Query  797   FTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             FT R   P  +PK   FG       LPSW SE+D KYY S+Y+ KGFTG LNYYR+INLN
Sbjct  247   FTYRDPCPLLIPKGKYFGQPDTPISLPSWFSEEDCKYYLSQYEKKGFTGALNYYRNINLN  306

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             W+LTA WTG +VKVPVKF+VGD D+ Y  PGIK+Y+H GG KK+VPLLE++VV+EG  HF
Sbjct  307   WQLTAPWTGSKVKVPVKFIVGDQDLTYNGPGIKDYLHKGGLKKNVPLLEQVVVMEGVAHF  366

Query  437   LNQERPEEV  411
             L +E P+EV
Sbjct  367   LQEENPDEV  375



>ref|XP_003626240.1| Epoxide hydrolase [Medicago truncatula]
Length=752

 Score =   431 bits (1107),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 250/312 (80%), Gaps = 8/312 (3%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             +MEGIEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPD
Sbjct  433   EMEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPD  492

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYG+TDAP+   SSYT  H+VGD+VAL+ SLGVD+VFLVAHDWGA+IGWY C+FRP+ 
Sbjct  493   LRGYGDTDAPA-SISSYTIFHLVGDIVALIDSLGVDQVFLVAHDWGAMIGWYLCLFRPEK  551

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             +KA+V +SVP+ PR+P MKPV+ MRA FGDDYYICRFQE G++ES+ A  G E +++ + 
Sbjct  552   IKAYVCLSVPYLPRNPKMKPVDGMRALFGDDYYICRFQEPGKMESEFAKGGPELLIKNML  611

Query  794   TDRKAGPPCLPKE----NPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
             T R +GPP LPKE    NP    T    LPSWLS++D+ YYASK++  GF+G LNYYR++
Sbjct  612   TSRNSGPPILPKEGVIPNPHASGTK--ALPSWLSQEDITYYASKFEKTGFSGALNYYRNL  669

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             NLNWELTAAWT  ++KVPVKF+ GD+D VYT+ G K+Y+  GGFKKDVP LEE+V+ EG 
Sbjct  670   NLNWELTAAWTAAKIKVPVKFITGDLDAVYTSFGTKQYIESGGFKKDVPNLEEVVIQEGV  729

Query  446   GHFLNQERPEEV  411
              HF NQE  E++
Sbjct  730   AHFNNQEAAEDI  741


 Score =   328 bits (840),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/240 (63%), Positives = 192/240 (80%), Gaps = 6/240 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME IEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEEIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQISALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP+   SSYT  H+VGD+VAL+ SLGVD+VFLVAHDWGAIIGWY C+FRP+ +
Sbjct  61    RGYGDTDAPA-SISSYTIFHLVGDIVALIDSLGVDRVFLVAHDWGAIIGWYLCLFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP+ PR+P +KPV+ MRA +GDDYYICRFQE G++E++IA   SE +++ + T
Sbjct  120   KAYVCLSVPYLPRNPKLKPVDGMRAVYGDDYYICRFQEPGKMEAEIAKGSSELLIKAMLT  179

Query  791   DRKAGPPCLPKENPF---GISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              R  GPP LPKE       +S+  P LPSWL+ +D+ YYASK++  GF+GGLNYYR+ N 
Sbjct  180   SRNPGPPILPKEGILSHPSVSSTMP-LPSWLTLEDVAYYASKFEQTGFSGGLNYYRNFNF  238


 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -3

Query  623  LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
            +NWELTAAWTG  +KVPVKF++GD+D+VYT+ G K+Y+  GGFK DVP LEE+V+ +G  
Sbjct  328  INWELTAAWTGSHIKVPVKFIIGDLDLVYTSFGTKQYIESGGFKNDVPNLEEVVIQKGVA  387

Query  443  HFLNQERPEEV  411
            HF NQE  EE+
Sbjct  388  HFNNQEAAEEI  398



>ref|XP_004240550.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=318

 Score =   415 bits (1067),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 241/308 (78%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGP-VILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME I+HK + VNGINMH+AE G+GP  ILFLHGFPELWY+WRHQL   +  GYRA+APDL
Sbjct  1     MENIQHKNLTVNGINMHIAEIGEGPSTILFLHGFPELWYSWRHQLISLSSKGYRAIAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TD+P   PSSYT  H+VGDL+AL+ +LG+D+VFLV HDWGA+I W+ C+ RPD +
Sbjct  61    RGYGDTDSPP-SPSSYTVFHIVGDLIALLDALGLDQVFLVGHDWGAVIAWHVCLLRPDRI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V++SV F PR+P  KP+E+MRA  GDDYYICRFQE G  E + A   + +++ K  T
Sbjct  120   KALVNMSVVFHPRNPKRKPIESMRAVLGDDYYICRFQEYGEAEEEFARVDTARLIAKFLT  179

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R   P  +PKE  FG S   P  LPSWLSE+D+ YYA+K+   GFTGGLNYYR+++LNW
Sbjct  180   SRNPAPLRVPKEKGFGGSPHTPITLPSWLSEEDVNYYANKFRQSGFTGGLNYYRAMDLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG+++KVPVKF+VGD+D+ Y TPG+KEY+H GGF+K VP L+E+V++EG  HF+
Sbjct  240   ELTAPWTGVQIKVPVKFIVGDVDLTYNTPGVKEYIHKGGFQKVVPFLQEVVIMEGVAHFI  299

Query  434   NQERPEEV  411
             NQERPEE+
Sbjct  300   NQERPEEI  307



>gb|ACJ84799.1| unknown [Medicago truncatula]
Length=319

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/309 (63%), Positives = 245/309 (79%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+ V+VNGI MH+AEKG +GPV+LFLHGFP LWY+WRHQ+   + LGYRAVAPDL
Sbjct  1     MEGIEHRRVEVNGIKMHIAEKGKEGPVVLFLHGFPGLWYSWRHQIVALSSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAPS   SSYT  H+VGDLVAL+  LGVD+VFLVAHDWGAIIGWY CMFRP+ +
Sbjct  61    RGYGDTDAPS-SVSSYTGFHIVGDLVALIDFLGVDQVFLVAHDWGAIIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP   R+P ++ V+AM A +GDDYYICRFQE G++E+++A  G+  V++   T
Sbjct  120   KAYVCLSVPLLRRNPKIRTVDAMHAAYGDDYYICRFQEPGKMEAEMAEVGTAYVMKSTLT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              RK GPP  PK E   G ++D P  LPSWL+E DL Y+ SK++  GFTG LNYYR+ NLN
Sbjct  180   TRKTGPPIFPKGEFGTGFNSDTPDTLPSWLTEDDLTYFVSKFEKTGFTGALNYYRNFNLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G+++KVPVKF+ GD+DMVYT+  +KEY+HGGGFK+DVP LEE+++ +GG HF
Sbjct  240   WELMAPWNGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGGAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308



>ref|XP_008784769.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=322

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 241/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M  I H+ V+VNGINMH+AEKG+GPV+L LHGFPELWY+WRHQ+   A  GYRA+APDLR
Sbjct  6     MAEISHRLVEVNGINMHIAEKGEGPVVLLLHGFPELWYSWRHQILALAARGYRAIAPDLR  65

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP    SSYT  HVVGDLVAL+ +LG +KVF+V HDWGA++ W  C+FRPD V+
Sbjct  66    GFGDTDAPP-DVSSYTMFHVVGDLVALIHTLGQEKVFVVGHDWGALVAWSLCLFRPDKVR  124

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FRPR P  KPVE  RA +GDDYYIC FQE GR E++ A   +  V++K  T 
Sbjct  125   ALVNLSVAFRPRSPDRKPVETFRALYGDDYYICTFQEPGRTEAEFARIPTALVIKKFLTY  184

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
                GP  + KEN F  S D+   LPSWLSE+D+ Y+ASK+D  GFTGGLNYYR+++LNWE
Sbjct  185   HDPGPVIVSKENGFAASPDKEITLPSWLSEEDVDYFASKFDKSGFTGGLNYYRALDLNWE  244

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG+++KVPVKF+VG+ D++Y  PG+K+Y+H GGF++DVP LE++VVIEG GHF+N
Sbjct  245   LTAPWTGMQIKVPVKFIVGNQDLIYNIPGVKDYIHKGGFERDVPFLEDVVVIEGAGHFIN  304

Query  431   QERPEEV  411
             QE+P+E+
Sbjct  305   QEKPQEI  311



>ref|XP_004494576.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=319

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 244/310 (79%), Gaps = 6/310 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+TV+ NGI +H+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRTVEANGIKIHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP    +SYT  H+VGD+V ++ +LGVD+VFLVAHDWGAI+GWY C+FRP+ +
Sbjct  61    RGYGDTDAPG-SVNSYTIFHLVGDIVGVIDALGVDQVFLVAHDWGAIVGWYLCLFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVPF PR+P  K V+AMRA +GDDYYICRFQE G+ E + A  G+E +L+ + T
Sbjct  120   KAYVALSVPFMPRNPKFKTVDAMRALYGDDYYICRFQEPGKAEGEFAKVGAELLLKGMLT  179

Query  791   DRKAGPPCLPKENPFGISTDQPK---LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              R+ GPP LPKE   G + D      LPSWLS++DL YYASK+D  GFTG LNYYR++NL
Sbjct  180   SRRTGPPILPKEG-MGSNLDPSSPHPLPSWLSQEDLSYYASKFDKSGFTGPLNYYRNLNL  238

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTAAWT  +VKVPVKF+ GD+D+VY + G K+Y+  GGFK+DVP LEE+V+ EG  H
Sbjct  239   NWELTAAWTRAKVKVPVKFITGDLDLVYNSLGTKQYIESGGFKRDVPNLEEVVIQEGVAH  298

Query  440   FLNQERPEEV  411
             F NQE  E++
Sbjct  299   FNNQEAAEDI  308



>gb|KEH24503.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 196/309 (63%), Positives = 245/309 (79%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+ V+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRRVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+APS   SSYT  H+VGDLVAL+  LGVD+VFLVAHDWGAIIGWY CMFRP+ +
Sbjct  61    RGYGDTEAPS-SISSYTGFHIVGDLVALIDLLGVDQVFLVAHDWGAIIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVPF  R+P ++ V+ MRA +GDDYYI RFQE G++E+ +A  G+  V++   T
Sbjct  120   KAYVCLSVPFTRRNPKIRTVDGMRAAYGDDYYISRFQEPGKMEAQMAEVGTAYVMKSTLT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              RK GPP  PK E   G + D P KLPSWL+E DL Y+ SK++  GF GGLNYYR++NLN
Sbjct  180   TRKTGPPIFPKGEFGTGFNPDTPDKLPSWLTEDDLAYFVSKFEKTGFVGGLNYYRNLNLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G+++KVPVKF+ GD+D+VYT+P +KEY+HGGGFK+DVP LEE++V +G  HF
Sbjct  240   WELMAPWNGVKIKVPVKFITGDLDIVYTSPKVKEYIHGGGFKEDVPNLEEVIVQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308



>ref|XP_009350800.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/308 (63%), Positives = 244/308 (79%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             +GIEH+TV+VNGINMHVAEKG GP+ILFLHGFPELWY+WRHQ+   + LGYRAVAPDLRG
Sbjct  4     QGIEHRTVQVNGINMHVAEKGNGPLILFLHGFPELWYSWRHQILALSALGYRAVAPDLRG  63

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+  PSSYTCLH+VGDLVAL+ ++  D  KVF+VAHDWGA+I WY C+FRPD V
Sbjct  64    YGDTDAPA-SPSSYTCLHMVGDLVALLDAIAPDQEKVFVVAHDWGALIAWYLCLFRPDRV  122

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V +SV F PR+P  K +E+  A +GDDYY+CRFQE G IE++ A  G+ +V+++  T
Sbjct  123   KALVSLSVQFMPRNPRRKVIESFHAAYGDDYYMCRFQEPGVIEAEFAQMGTTRVIKEFLT  182

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GP  LPK   FG  TD P  LPSWLSE D+ YY +K+D  GFTG +NYYR++++NW
Sbjct  183   YRNPGPLFLPKGKAFGHPTDTPIVLPSWLSEDDVNYYTAKFDKTGFTGPVNYYRNLDVNW  242

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG +VKVPVKF+VGD D+VY + G  +++H GGFKK VPLLEE+VV+EG  HFL
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSQGAPDFIHKGGFKKFVPLLEEVVVLEGVAHFL  302

Query  434   NQERPEEV  411
              QE+P+E+
Sbjct  303   QQEKPDEI  310



>ref|XP_003626244.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08021.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82462.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/309 (63%), Positives = 245/309 (79%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+ V+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDL
Sbjct  1     MEGIEHRRVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALSSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAPS   SSYT  H+VGDLVAL+  LGVD+VFLVAHDWGAIIGWY CMFRP+ +
Sbjct  61    RGYGDTDAPS-SVSSYTGFHIVGDLVALIDFLGVDQVFLVAHDWGAIIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP   R+P ++ V+AM A +GDDYYICRFQE G++E+++A  G+  V++   T
Sbjct  120   KAYVCLSVPLLRRNPKIRTVDAMHAAYGDDYYICRFQEPGKMEAEMAEVGTAYVMKSTLT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              RK GPP  PK E   G ++D P  LPSWL+E DL Y+ SK++  GFTG LNYYR+ NLN
Sbjct  180   TRKTGPPIFPKGEFGTGFNSDTPDTLPSWLTEDDLTYFVSKFEKTGFTGALNYYRNFNLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G+++KVPVKF+ GD+DMVYT+  +KEY+HGGGFK+DVP LEE+++ +G  HF
Sbjct  240   WELMAPWNGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308



>ref|XP_007221833.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
 gb|EMJ23032.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
Length=320

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 191/309 (62%), Positives = 248/309 (80%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TV+VNGINMH+AEKGQGP+ILF+HGFPELWY+W HQ+   A  GYRAVAPDLR
Sbjct  1     MEGIEHRTVQVNGINMHIAEKGQGPLILFVHGFPELWYSWSHQITALASFGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+TDAP   P+SYTCLHVVGDL+AL+ ++    DKVF+V HDWGA + W+ C+FRPD 
Sbjct  61    GFGDTDAPD-SPTSYTCLHVVGDLIALLDAIAPDQDKVFVVGHDWGAYLAWFLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V++SV F PR+P  K +E+++A +GDDYY+CRFQE G +E++ A  G+ +V+++  
Sbjct  120   VKALVNLSVAFMPRNPQRKFIESVKAVYGDDYYMCRFQEPGVMEAEFAKLGTARVMKEFL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R  GP  LPK+  FG + D P  LPSWLSE ++ YYASK++  GFTG LNYYR+++LN
Sbjct  180   TYRNPGPLFLPKDKMFGHAPDAPIVLPSWLSEDEVNYYASKFEKTGFTGALNYYRNLDLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTAAWT ++VKVPVKF+VGD D+VY +   K+++H GGFKK VPLLEE+VV+EG  HF
Sbjct  240   WELTAAWTEVQVKVPVKFIVGDQDLVYNSLHAKDFIHKGGFKKYVPLLEEVVVMEGVAHF  299

Query  437   LNQERPEEV  411
             +NQERP+E+
Sbjct  300   INQERPDEI  308



>gb|KHN43314.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   415 bits (1066),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 241/307 (79%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI H+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP    SSY C H+VGDLVAL+ SLGV +VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTEAPP-SISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVP   R P ++ V+ MRA +GDDYY+CRFQ+ G +E+ +A  G+E VL  I T 
Sbjct  120   AYVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILTT  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R  GPP LPK   F  + + P  LPSWL+E+DL YY SK++  GFTG LNYYR+ NLNWE
Sbjct  180   RNPGPPILPKGR-FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG ++KVPVK++ G++DMVY +  +KEY+HGGGFK+DVP LE+++V +G  HF N
Sbjct  239   LTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNN  298

Query  431   QERPEEV  411
             QE  EE+
Sbjct  299   QEAAEEI  305



>ref|NP_001238563.1| epoxide hydrolase [Glycine max]
 dbj|BAA09852.1| Epoxide hydrolase [Glycine max]
 emb|CAA55293.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   416 bits (1068),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/308 (63%), Positives = 243/308 (79%), Gaps = 3/308 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +ME I+H+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDL
Sbjct  25    EMEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDL  84

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+AP    SSY C H+VGDLVAL+ SLGV +VFLVAHDWGAIIGWY CMFRPD V
Sbjct  85    RGYGDTEAPP-SISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKV  143

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP   R P ++ V+ MRA +GDDYY+CRFQ+ G +E+ +A  G+E VL+ I T
Sbjct  144   KAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLKNILT  203

Query  791   DRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GPP LPK   F  + + P  LPSWL+E+DL YY SK++  GFTG LNYYR+ NLNW
Sbjct  204   TRNPGPPILPKGR-FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNW  262

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG ++KVPVK++ G++DMVY +  +KEY+HGGGFK+DVP LE+++V +G  HF 
Sbjct  263   ELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFN  322

Query  434   NQERPEEV  411
             NQE  EE+
Sbjct  323   NQEAAEEI  330



>gb|AFK45529.1| unknown [Medicago truncatula]
Length=319

 Score =   414 bits (1064),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 194/309 (63%), Positives = 245/309 (79%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+ V+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDL
Sbjct  1     MEGIEHRRVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALSSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAPS   SSYT  H+VGDLVAL+  LGVD+VFLVAHDWGAIIGWY CMFRP+ +
Sbjct  61    RGYGDTDAPS-SVSSYTGFHIVGDLVALIDFLGVDQVFLVAHDWGAIIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP   R+P ++ V+AM A +GDDYYICRFQE G++E+++A  G+  V++   T
Sbjct  120   KAYVCLSVPLLRRNPKIRTVDAMHAAYGDDYYICRFQEPGKMEAEMAEVGTAYVMKSTLT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              RK GPP  P+ E   G ++D P  LPSWL+E DL Y+ SK++  GFTG LNYYR+ NLN
Sbjct  180   TRKTGPPIFPRGEFGTGFNSDTPDTLPSWLTEDDLTYFVSKFEKTGFTGALNYYRNFNLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G+++KVPVKF+ GD+DMVYT+  +KEY+HGGGFK+DVP LEE+++ +G  HF
Sbjct  240   WELMAPWNGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308



>gb|ACJ84958.1| unknown [Medicago truncatula]
 gb|AFK43465.1| unknown [Medicago truncatula]
Length=319

 Score =   414 bits (1064),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 195/309 (63%), Positives = 246/309 (80%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+APS   SSYT  H+VGDLVAL+  LGVD+VFLVAHDWGAIIGWY CMFRP+ +
Sbjct  61    RGYGDTEAPS-SISSYTGFHIVGDLVALIDLLGVDQVFLVAHDWGAIIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP   R+P +K V+AMRA +GDDYYI RFQE G++E+++A  G+  V++ I T
Sbjct  120   KAYVCLSVPLLRRNPKIKTVDAMRAAYGDDYYISRFQEPGKMEAEMAEVGTAYVMKNILT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              R+ GPP  PK E   G + D P  LPSWL+E+DL Y+ SK++  GFTG LNYYR+ N+N
Sbjct  180   TRQTGPPIFPKGEYGTGFNPDTPDTLPSWLTEEDLAYFVSKFEKTGFTGALNYYRNFNVN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G+++KVPVKF+ GD+DMVYT+  +KEY+HGGGFK+DVP LEE+++ +G  HF
Sbjct  240   WELMAPWNGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308



>ref|XP_003626245.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08024.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82463.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   414 bits (1064),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 195/309 (63%), Positives = 246/309 (80%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+APS   SSYT  H+VGDLVAL+  LGVD+VFLVAHDWGAIIGWY CMFRP+ +
Sbjct  61    RGYGDTEAPS-SISSYTGFHIVGDLVALIDLLGVDQVFLVAHDWGAIIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP   R+P +K V+AMRA +GDDYYI RFQE G++E+++A  G+  V++ I T
Sbjct  120   KAYVCLSVPLLRRNPKIKTVDAMRAAYGDDYYISRFQEPGKMEAEMAEVGTAYVMKNILT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              R+ GPP  PK E   G + D P  LPSWL+E+DL Y+ SK++  GFTG LNYYR+ N+N
Sbjct  180   TRQTGPPIFPKGEYGTGFNPDTPDTLPSWLTEEDLAYFVSKFEKTGFTGALNYYRNFNVN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G+++KVPVKF+ GD+DMVYT+  +KEY+HGGGFK+DVP LEE+++ +G  HF
Sbjct  240   WELMAPWNGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308



>emb|CAA55294.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   414 bits (1065),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/308 (63%), Positives = 242/308 (79%), Gaps = 3/308 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +ME I+H+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDL
Sbjct  25    EMEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDL  84

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+AP    SSY C H+VGDLVAL+ SLGV +VFLVAHDWGAIIGWY CMFRPD V
Sbjct  85    RGYGDTEAPP-SISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKV  143

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP   R P ++ V+ MRA +GDDYY+CRFQ+ G +E+ +A  G+E VL  I T
Sbjct  144   KAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILT  203

Query  791   DRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GPP LPK   F  + + P  LPSWL+E+DL YY SK++  GFTG LNYYR+ NLNW
Sbjct  204   TRNPGPPILPKGR-FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNW  262

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG ++KVPVK++ G++DMVY +  +KEY+HGGGFK+DVP LE+++V +G  HF 
Sbjct  263   ELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFN  322

Query  434   NQERPEEV  411
             NQE  EE+
Sbjct  323   NQEAAEEI  330



>ref|XP_003554635.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43313.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 246/308 (80%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEG+ H+TV+VNGI MH+AEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MEGVIHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP     SYTC H+VGDLVAL+ SLGV +VFLVAHDWGA++GWY CMFRP+ VK
Sbjct  61    GYGDTEAPP-SIDSYTCFHIVGDLVALIDSLGVQQVFLVAHDWGALMGWYLCMFRPEKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF PR+P ++ V+ +RA +G+DYYI RFQ+ G +E+ +A  G+E VL+ + T 
Sbjct  120   AYVCLSVPFIPRNPNVRTVDGLRAMYGEDYYISRFQKPGEMEAQMAEVGTEYVLKNLLTT  179

Query  788   RKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             RK GPP  PK E   G + +    LPSWL+E+DL YY SK++  GFTGGLNYYR+IN NW
Sbjct  180   RKTGPPTFPKGEYGTGFNPNMTDILPSWLTEEDLAYYVSKFEKTGFTGGLNYYRNINSNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELT  WT +++KVPVKF+ G++DMVYT+ GIKEY+HGGGFK+DVP LE+++V +G  HF 
Sbjct  240   ELTTPWTRVQIKVPVKFIAGELDMVYTSLGIKEYIHGGGFKEDVPNLEQVIVQKGVAHFN  299

Query  434   NQERPEEV  411
             NQE  E++
Sbjct  300   NQEAAEDI  307



>ref|XP_007147004.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
 gb|ESW18998.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
Length=318

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 243/308 (79%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI+HK V+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   +  GYRAVAPDLR
Sbjct  1     MEGIQHKEVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP+   SSY+C  +VGDLVAL+  LGV++VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTEAPASM-SSYSCFDIVGDLVALIDLLGVEQVFLVAHDWGAIIGWYLCMFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVP   R+P ++ V+AMRA +GDDYYICRFQ+ G +E+ +A  G+E VL+ I T 
Sbjct  120   AYVCLSVPLLHRNPEIRTVDAMRAMYGDDYYICRFQKPGEMEAQMAEVGTEYVLKNILTT  179

Query  788   RKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             RK GPP  PK E   G + D    LPSWLS+ DL YY SK+   GFTG LNYYR++N NW
Sbjct  180   RKPGPPIFPKGEYGTGFNPDMTNSLPSWLSQHDLAYYVSKFQKTGFTGPLNYYRNMNPNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA W+G ++KVPVKF+ GD+DMVYT+  +KEY+HGGGFK+DVP LEE++V +G  HF 
Sbjct  240   ELTAPWSGAKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVAHFN  299

Query  434   NQERPEEV  411
             NQE  EE+
Sbjct  300   NQEAAEEI  307



>gb|AES82420.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   413 bits (1062),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 195/309 (63%), Positives = 244/309 (79%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME IEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MERIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TD PS   SSYTC HVVGD+V+L+  LGV++VFLV HD GAIIGWY CMFRP+ +
Sbjct  61    RGYGDTDVPS-SISSYTCFHVVGDIVSLIDLLGVEQVFLVGHDMGAIIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVPF  R+P ++ V+ MRA +GDDYYICRFQE G +E+ +A  G+  V++ I T
Sbjct  120   KAYVCLSVPFLHRNPKIRTVDGMRAVYGDDYYICRFQEPGEMEAQMAEVGTTYVMKNILT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              RK GPP  PK E   G + D P  LPSWL+E DL Y+ SK++  GFTGGLNYYR+ NLN
Sbjct  180   TRKTGPPIFPKGEYGTGFNPDTPDNLPSWLTEDDLAYFVSKFEKTGFTGGLNYYRNFNLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTA WTG+++KVPVKF+ G++DMVYT+  +KEY+HGGGFK+DVP LEE+++ +G  HF
Sbjct  240   WELTAPWTGVKIKVPVKFITGELDMVYTSFNLKEYIHGGGFKEDVPNLEEVIIQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAEEEI  308



>gb|AFK34299.1| unknown [Lotus japonicus]
Length=318

 Score =   412 bits (1059),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 245/308 (80%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TV+VNGI MH+AEKGQGPV+LFLHGFPELWY+WRHQ+   +  GY AVAPDLR
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGQGPVVLFLHGFPELWYSWRHQILTLSSRGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TD+P +  ++YTC H+VGD+VAL+  LG  +VFLVAHDWG+IIG Y CMFRP+ VK
Sbjct  61    GYGDTDSP-ISITTYTCFHIVGDIVALIDHLGAKQVFLVAHDWGSIIGRYLCMFRPERVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF PR+P ++ V+ MR  +GDDYYICRFQE G +E+ +A  G+E VL+ I T 
Sbjct  120   AYVCLSVPFLPRNPEIRTVDGMRHAYGDDYYICRFQEPGEMEAQMAEVGTEYVLKNILTT  179

Query  788   RKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             RK GPP  PK E   G + D P  LPSWL+++DL Y+ SK++  GFTGGLNYYR++NLNW
Sbjct  180   RKPGPPIFPKGEYGTGFNPDTPNTLPSWLTQEDLAYFVSKFEKTGFTGGLNYYRNLNLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA W+G ++ VPVKF+ G++DMVYT+  +KEY+H GGFK+DVP LEE++V +G  HF 
Sbjct  240   ELTAPWSGRKINVPVKFITGELDMVYTSLNMKEYIHDGGFKEDVPDLEEVIVQKGVAHFN  299

Query  434   NQERPEEV  411
             NQE P+E+
Sbjct  300   NQETPDEI  307



>gb|ACU23321.1| unknown [Glycine max]
Length=318

 Score =   412 bits (1059),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 245/308 (80%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEG+ H+TV+VNGI MH+AEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MEGVIHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+ P     SYTC H+VGDLVAL+ SLGV +VFLVAHDWGA++GWY CMFRP+ VK
Sbjct  61    GYGDTETPP-SIDSYTCFHIVGDLVALIDSLGVQQVFLVAHDWGALMGWYLCMFRPEKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF PR+P ++ V+ +RA +G+DYYI RFQ+ G +E+ +A  G+E VL+ + T 
Sbjct  120   AYVCLSVPFIPRNPNVRTVDGLRAMYGEDYYISRFQKPGEMEAQMAEVGTEYVLKNLLTT  179

Query  788   RKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             RK GPP  PK E   G + +    LPSWL+E+DL YY SK++  GFTGGLNYYR+IN NW
Sbjct  180   RKTGPPTFPKGEYGTGFNPNMTDILPSWLTEEDLAYYVSKFEKTGFTGGLNYYRNINSNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELT  WT +++KVPVKF+ G++DMVYT+ GIKEY+HGGGFK+DVP LE+++V +G  HF 
Sbjct  240   ELTTPWTRVQIKVPVKFIAGELDMVYTSLGIKEYIHGGGFKEDVPNLEQVIVQKGVAHFN  299

Query  434   NQERPEEV  411
             NQE  E++
Sbjct  300   NQEAAEDI  307



>gb|KHN20253.1| Epoxide hydrolase 2 [Glycine soja]
Length=322

 Score =   412 bits (1059),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 246/312 (79%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH+TV+VNGI MHVAEKG+G V+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MESIEHRTVEVNGIKMHVAEKGEGAVVLFLHGFPELWYSWRHQILALSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+APS   +SYTC H+VGD++AL+ SLGVDKVFLVAHDWGAIIGWY C+FRPD +K
Sbjct  61    GYGDTEAPS-TVNSYTCFHLVGDIIALIDSLGVDKVFLVAHDWGAIIGWYLCLFRPDRIK  119

Query  968   AFVDISVPFRP---RHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
             A+V +SVPFRP   R+P  K V+   + +GDDYYICRFQE G++E+++A   +  +++ I
Sbjct  120   AYVCLSVPFRPFLGRNPKQKTVDFFHSLYGDDYYICRFQEPGKMEAEMAGVDTAYLMKNI  179

Query  797   FTDRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
              T RK GPP  PK E   G +   P  LPSW+S++DL YY +K++  GF+GGLNYYR++N
Sbjct  180   LTTRKTGPPTFPKGEYGTGFNPGTPDTLPSWISQEDLDYYVTKFNKTGFSGGLNYYRNLN  239

Query  623   LNWELTAAWTGIE-VKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             LNWELTA WTG   V VPVKF+ G +D+VYT+PG+KEY+H GGFKKDVP LEE+VV EG 
Sbjct  240   LNWELTAPWTGAGIVDVPVKFITGGVDLVYTSPGMKEYIHNGGFKKDVPTLEEVVVQEGV  299

Query  446   GHFLNQERPEEV  411
              HF NQE  E+V
Sbjct  300   AHFNNQEAAEDV  311



>ref|XP_008355493.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=316

 Score =   412 bits (1058),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 232/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GP +LFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MENIEHTTVPTNGINMHVASIGTGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP   P+SYT +H+VGDL+ L+  LG+D+VFLVAHDWGA++ W+FC+FRPD VK
Sbjct  61    GFGDTDAPP-SPTSYTAMHIVGDLIGLLDHLGIDQVFLVAHDWGAVMAWWFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P  KP++  RA FGDDYYICRFQE G IE D     +  V++   T 
Sbjct  120   ALVNMSVAFSPRNPKRKPIDTFRALFGDDYYICRFQEPGEIEQDFDSIDTAAVMKCFLTG  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK+           LP+WL+E+D+ Y+ASK+   GFTGGLNYYR++NL WEL
Sbjct  180   RSPKPPCIPKDQGLKSWAAPVTLPAWLTEEDVNYFASKFSKTGFTGGLNYYRALNLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             T  WTG+++KVPVKF+VGD+D+ Y  PGI+ Y+H GGFK+DVP L+E+VV+E   HF+NQ
Sbjct  240   TGPWTGLQIKVPVKFIVGDLDITYHIPGIQNYIHKGGFKRDVPFLQEVVVMEDAAHFINQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_009391487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   412 bits (1058),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 242/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I H+TV VNGINMHVAEKG+GPV+L +HGFPELWY+WRHQ+   A  GY AVAPDLR
Sbjct  1     MEEITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYSWRHQIVALAAHGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP    +SYT  HVVGD+V L+++LG D+VF+V HDWGA++ W  CMFRPD VK
Sbjct  61    GFGDTDAPP-AVTSYTMFHVVGDIVGLIEALGRDQVFVVGHDWGALVAWCLCMFRPDKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FRPR+PT KPVE +R  +GDDYY+CRFQE GR E++    G+  +++K  T 
Sbjct  120   ALVNLSVVFRPRNPTGKPVETLRTAYGDDYYVCRFQEPGRTEAEFGRVGTSLIIKKFLTY  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
                GP  +PKE  FG + D+   LPSWLSE DL Y+A K++  GFTGGLNYYR+++LNWE
Sbjct  180   HDPGPVIVPKEKGFGDAPDKENALPSWLSEDDLNYFAGKFEKSGFTGGLNYYRALDLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG+++KVPVKF+VGD D+ Y  PG+++Y+  GGFK+DVPLLE++VV+EG GHF+N
Sbjct  240   LTAPWTGVQIKVPVKFIVGDQDLAYHFPGVQDYISKGGFKRDVPLLEDMVVMEGVGHFIN  299

Query  431   QERPEEV  411
             QERP+E+
Sbjct  300   QERPQEI  306



>ref|XP_007144960.1| hypothetical protein PHAVU_007G198000g [Phaseolus vulgaris]
 gb|ESW16954.1| hypothetical protein PHAVU_007G198000g [Phaseolus vulgaris]
Length=322

 Score =   412 bits (1058),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 247/312 (79%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I H+ V++NGINMHVAEKG+GPV+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MENILHRMVELNGINMHVAEKGEGPVVLFLHGFPELWYSWRHQILHLSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP+   ++YTC H+VGD+VAL+ SLGVDKVFLVAHDWGAI+GWY C+FRPD VK
Sbjct  61    GYGDTDAPA-PLTTYTCFHLVGDIVALIDSLGVDKVFLVAHDWGAILGWYLCLFRPDRVK  119

Query  968   AFVDISVPFRP---RHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
             A+V +SVPFRP   R+P  K ++   A +GDDYYICRFQE G++E+++    +  +++ +
Sbjct  120   AYVALSVPFRPFLGRNPQQKTLDIFHALYGDDYYICRFQEPGKMEAELGRVDTAYLMKNM  179

Query  797   FTDRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
             FT R+ GPP  PK E   G +   P  LPSWL++QDL YY +K +  GFTGGLNYYR++N
Sbjct  180   FTTRQTGPPIFPKGEYGTGFNPHTPDTLPSWLTQQDLDYYVTKVERSGFTGGLNYYRNLN  239

Query  623   LNWELTAAWTGIEVK-VPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             +NWELTA WTG+ ++ VPVKF+ G +D+VYT+PG+KEY+H GGFKKDVP LEE+VV EG 
Sbjct  240   INWELTAPWTGVGIENVPVKFITGSVDLVYTSPGMKEYIHNGGFKKDVPTLEEVVVQEGV  299

Query  446   GHFLNQERPEEV  411
             GHF NQE   +V
Sbjct  300   GHFNNQEAAHDV  311



>gb|ACU19450.1| unknown [Glycine max]
Length=315

 Score =   411 bits (1057),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 240/307 (78%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+W HQ+   + LGYRAVAPDLR
Sbjct  1     MEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWHHQILSLSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP    SSY C H+VGDLVAL+ SLGV +VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTEAPP-SISSYNCFHIVGDLVALIDSLGVQQVFLVAHDWGAIIGWYLCMFRPDKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVP   R P ++ V+ MRA +GDDYY+CRFQ+ G +E+ +A  G+E VL  I T 
Sbjct  120   AYVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILTT  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R  GPP LPK   F  + + P  LPSWL+E+DL YY SK++  GFTG LNYYR+ NLNWE
Sbjct  180   RNPGPPILPKGR-FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG ++KVPVK++ G++DMVY +  +KEY+HGGGFK+DVP LE+++V +G  HF N
Sbjct  239   LTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNN  298

Query  431   QERPEEV  411
             QE  EE+
Sbjct  299   QEAAEEI  305



>ref|XP_003556522.1| PREDICTED: bifunctional epoxide hydrolase 2 isoform X1 [Glycine 
max]
 ref|XP_006606541.1| PREDICTED: bifunctional epoxide hydrolase 2 isoform X2 [Glycine 
max]
Length=322

 Score =   412 bits (1058),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 246/312 (79%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH+TV+VNGI MHVAEKG+G V+LFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MESIEHRTVEVNGIKMHVAEKGEGAVVLFLHGFPELWYSWRHQILALSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+APS   +SYTC H+VGD++AL+ SLGVDKVFLVAHDWGAIIGWY C+FRPD +K
Sbjct  61    GYGDTEAPS-TVNSYTCFHLVGDIIALIDSLGVDKVFLVAHDWGAIIGWYLCLFRPDRIK  119

Query  968   AFVDISVPFRP---RHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
             A+V +SVPFRP   R+P  K V+   + +GDDYYICRFQE G++E+++A   +  +++ I
Sbjct  120   AYVCLSVPFRPFLGRNPKQKTVDFFHSLYGDDYYICRFQEPGKMEAEMAGVDTAYLMKNI  179

Query  797   FTDRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
              T RK GPP  PK E   G +   P  LPSW+S++DL YY +K++  GF+GGLNYYR++N
Sbjct  180   LTTRKTGPPTFPKGEYGTGFNPVTPDTLPSWISQEDLDYYVTKFNKTGFSGGLNYYRNLN  239

Query  623   LNWELTAAWTGIE-VKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             LNWELTA WTG   V VPVKF+ G +D+VYT+PG+KEY+H GGFKKDVP LEE+VV EG 
Sbjct  240   LNWELTAPWTGAGIVDVPVKFITGGVDLVYTSPGMKEYIHNGGFKKDVPTLEEVVVQEGV  299

Query  446   GHFLNQERPEEV  411
              HF NQE  E+V
Sbjct  300   AHFNNQEAAEDV  311



>ref|XP_010038230.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50053.1| hypothetical protein EUGRSUZ_K03494 [Eucalyptus grandis]
Length=319

 Score =   411 bits (1057),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 235/309 (76%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQ--GPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             ME IEH TV  NGINMHVA  G   G  +LFLHGFP+LWYTWR Q+   A LGYRAVAPD
Sbjct  1     METIEHATVPTNGINMHVASVGGAGGDTVLFLHGFPDLWYTWRRQMLSLAALGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYG+TDAP    +SYT  H+VGDLV L+ +LGV++VFLV HDWGA++ WYFC+ RPD 
Sbjct  61    LRGYGDTDAPP-SAASYTAFHIVGDLVGLLDALGVERVFLVGHDWGAVMAWYFCLLRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V+ SV F+PR+P  KP++++RA FGDDYYICRFQE G  E D A     K+++   
Sbjct  120   VKALVNTSVVFQPRNPKRKPIDSLRALFGDDYYICRFQEPGEAEEDFARADITKLMKLFL  179

Query  794   TDRKAGPPCLPKENPF-GISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R   PPC+PKE  + G++  + KLP WLSE+D+ YYASK+  KGFTGGLNYYR++NL 
Sbjct  180   TSRNPKPPCIPKEIGYSGLANSRDKLPPWLSEEDVNYYASKFSQKGFTGGLNYYRALNLT  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A WTG+++KVPVKF+VGD+D+ Y  PG+KEY+H GG KK VP L+E+VV+EG  HF
Sbjct  240   WELAAPWTGVQIKVPVKFIVGDLDITYHVPGVKEYIHNGGLKKLVPFLQEVVVMEGVAHF  299

Query  437   LNQERPEEV  411
             L QE+PEEV
Sbjct  300   LQQEKPEEV  308



>ref|XP_010911257.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   411 bits (1057),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 182/307 (59%), Positives = 242/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI H+TV VNGINMH+AEKG+GP++LF+HGFPELWY+WRHQ+   A  GYRAVAPDLR
Sbjct  1     MEGITHRTVAVNGINMHIAEKGEGPMVLFIHGFPELWYSWRHQMVALAARGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    + YT  H+VGDLVAL+ +L  D+VF V HDWGA++ W+ CM RPD V+
Sbjct  61    GYGDTDAPP-STTDYTIFHLVGDLVALLDALAQDQVFAVGHDWGAVVAWWLCMLRPDRVR  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PRHP  +PV++++A FGDD+YICRFQE G  E++ A   +  +L+K  T 
Sbjct  120   ALVNMSVAFSPRHPARRPVDSLKALFGDDHYICRFQEPGAAEAEFARINTALLLKKFLTY  179

Query  788   RKAGPPCLPKENPFGISTD-QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK  P  + KE  FG S + +  LPSWL+E+D+ YY SK++  GFTGGLNYYR +NLNWE
Sbjct  180   RKPAPLLISKEKGFGGSPNTEITLPSWLTEEDVNYYTSKFEKSGFTGGLNYYRCLNLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG+++KVPVKF+VGD+D+ Y TPGI++++H GGFK++VP L++++V++G GHF+N
Sbjct  240   LTAPWTGVQIKVPVKFIVGDLDLTYHTPGIQDHIHKGGFKREVPFLQDVIVMQGVGHFIN  299

Query  431   QERPEEV  411
             QERP E+
Sbjct  300   QERPHEI  306



>ref|XP_009335707.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
 ref|XP_009335715.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=316

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 232/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GP +LFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MENIEHTTVPTNGINMHVASIGTGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP   P+SYT +H+VGDL+ L+  LG+D+VFLVAHDWGA++ W+FC+FRPD VK
Sbjct  61    GFGDTDAPP-SPTSYTAMHIVGDLIGLLDHLGIDQVFLVAHDWGAVMAWWFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P  KP++  RA FGDDYYICRFQE G IE D     +  V+++  T 
Sbjct  120   ALVNMSVAFSPRNPKRKPIDTFRALFGDDYYICRFQEPGEIEQDFDSIDTAAVMKRFLTG  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK+           LP+WL+E+D+ Y+ASK+   GFTGGLNYYR++NL WEL
Sbjct  180   RSPKPPCIPKDQGLKSWAAPVTLPAWLTEEDVNYFASKFSKTGFTGGLNYYRALNLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             T  WTG+++KVPVKF+VGD+D+ Y  PGI+ Y+H GGFK+DV  L+E+VV+E   HF+NQ
Sbjct  240   TGPWTGLQIKVPVKFIVGDLDITYHIPGIQNYIHKGGFKRDVAFLQEVVVMEDAAHFINQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>ref|XP_010088294.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33519.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 186/308 (60%), Positives = 230/308 (75%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQ--GPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             ME IEH TV  NGINMHVA  G    P I+FLHGFPELWY+WRHQ+   + LGYR +APD
Sbjct  1     MEKIEHTTVPTNGINMHVASIGSTTAPAIIFLHGFPELWYSWRHQMISLSSLGYRCIAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYGETDAP   P SYT  H+VGDLV L+  LG+D++F+V HDWGA+I WY C+FRPD 
Sbjct  61    LRGYGETDAPP-SPESYTVFHIVGDLVGLLDHLGLDQIFVVGHDWGAVIAWYLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V++SV F PRHPT KP+E  RA  G+DYYICRFQE G  E D A   +  +L+K +
Sbjct  120   VKALVNMSVAFSPRHPTRKPIEGFRALLGNDYYICRFQEPGEAEKDFARDDTTNLLKKFY  179

Query  794   TDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
               R   PPC+PKE  F        +PSWL E+D+K+YA K+D KGFTGGLNYYR+++L W
Sbjct  180   LGRNPSPPCIPKEIGFSDLKAPQTMPSWLLEEDVKFYARKFDEKGFTGGLNYYRALDLTW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTAAW+G +VKVPVKF++GD+D+ Y  PG KEY+H GGFK+DVP L+E+VV+EG  H++
Sbjct  240   ELTAAWSGTQVKVPVKFIIGDLDVTYHVPGAKEYIHNGGFKRDVPYLQEVVVMEGVAHYI  299

Query  434   NQERPEEV  411
             NQE+ EE 
Sbjct  300   NQEKAEET  307



>ref|XP_002523107.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39292.1| epoxide hydrolase, putative [Ricinus communis]
Length=315

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 230/306 (75%), Gaps = 2/306 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMH+A  G+GPVILFLHGFP+LWYTWRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTTVYTNGINMHIASIGKGPVILFLHGFPDLWYTWRHQLLALSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP   P+ YT LH+VGDLV L+ SLGV++VFLV HDWGA + W+ C+FRPD +K
Sbjct  61    GFGDTDAPP-SPNEYTVLHIVGDLVGLLDSLGVEQVFLVGHDWGATVAWHLCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P  KPVE  R   GDD+YICRFQE G IE D A  G+ +++R+    
Sbjct  120   ALVNTSVAFSPRNPHKKPVERYRELLGDDFYICRFQEHGEIEEDFAKAGAARIIRRFLAS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F        LPSWLSE+D+ YY SKY  KGFTGGLNYYR ++LNWEL
Sbjct  180   RSTAPPCVPKATGFRSLPVPQNLPSWLSEEDINYYVSKYGQKGFTGGLNYYRCLDLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG ++KVPVKF+VGDMD+ Y  PG+KEY+H  G KK VP L+E+VV+EG  HFL+Q
Sbjct  240   TAPWTGSQIKVPVKFIVGDMDITYHFPGVKEYIH-HGMKKHVPFLQEVVVLEGVAHFLSQ  298

Query  428   ERPEEV  411
             E+P+EV
Sbjct  299   EKPDEV  304



>gb|AFK41660.1| unknown [Lotus japonicus]
Length=318

 Score =   410 bits (1053),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 244/308 (79%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TV+VNGI MH+AEKGQGPV+LFLHGFPELWY+WRHQ+   +  GY AVAPDLR
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGQGPVVLFLHGFPELWYSWRHQILTLSSRGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TD+P +  ++YTC H+VG +VAL+  LG  +VFLVAHDWG+IIGWY CM RP+ VK
Sbjct  61    GYGDTDSP-ISITTYTCFHIVGGIVALIDHLGAKQVFLVAHDWGSIIGWYLCMLRPERVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF PR+P ++ V+ MR  +GDDYYICRF+E G +E+ +A  G+E VL+ I T 
Sbjct  120   AYVCLSVPFLPRNPEIRTVDGMRHAYGDDYYICRFREPGEMEAQMAEVGTEYVLKNILTT  179

Query  788   RKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             RK GPP  PK E   G + D P  LPSWL+++DL Y+ SK++  GFTGGLNYYR++NLNW
Sbjct  180   RKPGPPIFPKGEYGTGFNPDTPNTLPSWLTQEDLAYFVSKFEKTGFTGGLNYYRNLNLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA W+G ++ VPVKF+ G++DMVYT+  +KEY+H GGFK+DVP LEE++V +G  HF 
Sbjct  240   ELTAPWSGGKINVPVKFITGELDMVYTSLNMKEYIHDGGFKEDVPNLEEVIVQKGVAHFN  299

Query  434   NQERPEEV  411
             NQE P+E+
Sbjct  300   NQETPDEI  307



>ref|XP_002320333.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|ABK93786.1| unknown [Populus trichocarpa]
 gb|EEE98648.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   409 bits (1051),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 228/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMH+A  G GP ILFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTTVATNGINMHIASIGTGPEILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP      YT  H++GDLV L+ SLG+DKVFLV HDWGA++ WYFC+ RPD VK
Sbjct  61    GYGDTDAPK-NYREYTVFHILGDLVGLIDSLGIDKVFLVGHDWGAMVAWYFCLLRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F+PR+P    V+  R  FGDDYYICRFQE G +E D A   + +++RK  T 
Sbjct  120   ALVNMSVVFQPRNPHKSFVQISRDLFGDDYYICRFQEPGEVEEDFAQMDTARIIRKFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PKE  F    D P LPSWLSE+D+ YYA K++  GFTGGLNYYR ++LNWEL
Sbjct  180   RNPKPPCIPKEVGFRGLPDNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYYRCLDLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              AAWTG+++KVPVKF+VGD+D+ Y  P  ++Y+  GG KK VP L+E+ ++EG  HFLNQ
Sbjct  240   MAAWTGLQIKVPVKFIVGDLDITYNMPEAQDYISKGGLKKYVPFLQEVAIMEGVAHFLNQ  299

Query  428   ERPEEV  411
             E+PEEV
Sbjct  300   EKPEEV  305



>ref|XP_002523108.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39293.1| epoxide hydrolase, putative [Ricinus communis]
Length=316

 Score =   409 bits (1050),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 233/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GP ILFLHGFPELWY+WRHQL   +  GYR +APDLR
Sbjct  1     MEKIEHTTVATNGINMHVAAIGTGPEILFLHGFPELWYSWRHQLLSLSSRGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    + YT LH+VGDL+ L+ S+G+++VFLV HDWGA++ WY CMFRPD +K
Sbjct  61    GYGDTDAPE-SLTGYTALHIVGDLIGLLDSMGIEQVFLVGHDWGAMMAWYLCMFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV +  R+P +K +E  R  +GDDYY+CRFQE G  E D A   + K++R +FT 
Sbjct  120   ALVNTSVAYMSRNPQLKSLELFRTVYGDDYYVCRFQEPGGAEEDFAQVDTAKLIRSVFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PP +PKE  F    D P LPSWLSE+D+ YYA K++ KGFTGGLNYYR+I+ NWEL
Sbjct  180   RDPNPPIVPKEIGFRSLPDPPSLPSWLSEEDVNYYADKFNKKGFTGGLNYYRNIDQNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF++GD+D+ Y  PGIK+Y+H GGFK+ VPLL+E+VV+EG  HF+NQ
Sbjct  240   TAPWDGLQIKVPVKFVIGDLDLTYHFPGIKDYIHNGGFKQVVPLLQEVVVMEGVAHFINQ  299

Query  428   ERPEEV  411
             E+PEE+
Sbjct  300   EKPEEI  305



>ref|XP_002302724.1| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE81997.1| epoxide hydrolase family protein [Populus trichocarpa]
Length=316

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 229/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEH+TV  NGINMH+A  G GPVILFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MDKIEHQTVATNGINMHIASIGTGPVILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP      YT  H+VGDLV L+ SLG+DKVFLV HDWG+ + WYFC+ RPD +K
Sbjct  61    GYGDTDAPK-NVREYTIFHIVGDLVGLIDSLGIDKVFLVGHDWGSTVAWYFCLLRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F+PR+P    V+  R  FGDD+YICR QE G +E D A   +  ++ +  T 
Sbjct  120   ALVNMSVVFQPRNPHKSSVQISRELFGDDFYICRIQEPGEVEEDFAQMDTASIITRFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PKE  F      P LPSWLSE+D+ YYA K++  GFTGGLNYYR ++LNWEL
Sbjct  180   RDPKPPCIPKEVGFRGIPYNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYYRCLDLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              AAWTG+++KVPVKF+VGD+D+ Y  PG+KEY+  GG KK VP L+E+VV+EG GHFLNQ
Sbjct  240   MAAWTGLQIKVPVKFIVGDVDLTYHIPGVKEYISKGGLKKYVPFLQEVVVMEGVGHFLNQ  299

Query  428   ERPEEV  411
             E+PEEV
Sbjct  300   EKPEEV  305



>ref|XP_010649574.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
 emb|CBI22972.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/307 (61%), Positives = 239/307 (78%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEG+EH+TVK NGIN+HVAEKG+GP+ILF+HGFPE WY+WRHQ+   A LGYRAVAPDLR
Sbjct  1     MEGVEHRTVKANGINIHVAEKGEGPIILFIHGFPESWYSWRHQIHALALLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAPS    SYTCLHVVGDL+ ++ ++G DKVF+V HDWGAII WY C+FRPD VK
Sbjct  61    GYGDSDAPS-DVGSYTCLHVVGDLIGVLDAMGADKVFVVGHDWGAIIAWYLCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV + PR+P  KP+E  R  +GDD+Y+CRFQE G+IE +IA  G+   L+ IF +
Sbjct  120   ALVNMSVAYFPRNPMHKPLEIYRHLYGDDFYVCRFQEPGQIEIEIAEVGTATALKSIFAN  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   PPCLPK   F   +  P  LP WL E+++ +Y +K++  GFTGG+NYYR+ + NWE
Sbjct  180   RDPSPPCLPKGKAFQDVSGAPIVLPPWLPEEEVNFYVTKFEETGFTGGINYYRNFDRNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG ++KVP KFMVGDMD+ Y   G KEY+H G FKK+VPLLEE+VV+EG GHFL+
Sbjct  240   LTAPWTGSQIKVPTKFMVGDMDLTYHFAGAKEYIHSGEFKKNVPLLEEVVVMEGVGHFLH  299

Query  431   QERPEEV  411
             +E+ +E+
Sbjct  300   EEKADEI  306



>ref|XP_008386679.1| PREDICTED: bifunctional epoxide hydrolase 2 [Malus domestica]
Length=316

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 230/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GP +LFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTTVPTNGINMHVASIGAGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP   P+SYT +H+VGDL+ L+  LG+D+VFLVAHDWGA+  W+FC+FRPD VK
Sbjct  61    GFGDTDAPP-SPTSYTAMHIVGDLIGLLDHLGIDQVFLVAHDWGAVXAWWFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++S+ F PR+P  KPV+  RA FGDDYYICRFQE   IE D    G+  V+++  T 
Sbjct  120   ALVNMSIAFSPRNPKRKPVDGFRALFGDDYYICRFQEPEEIERDFDSIGTAAVMKRFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK+           LP+WL+E+DL Y  SK+   GFTGGLNYYR++NL WEL
Sbjct  180   RSPKPPCIPKDQGLKSWAAPVTLPAWLTEEDLNYIVSKFSKSGFTGGLNYYRALNLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             T  WTG+++KVPVKF+VG++D+ Y  PG++ Y+H GGFK+DVP L+E+VV+EG  HF+ Q
Sbjct  240   TGPWTGLQIKVPVKFIVGELDVTYNIPGVQAYIHKGGFKRDVPFLQEVVVMEGAAHFIAQ  299

Query  428   ERPEEV  411
             E+P+EV
Sbjct  300   EKPDEV  305



>gb|KFK30821.1| hypothetical protein AALP_AA6G030400 [Arabis alpina]
Length=316

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 234/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGINMHVA  G GPVILFLHGFP+LWY+WRHQL  FA LGY+A+APDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFADLGYKAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP     SYT LH+VGDL+ L+ SLGVDKV LV HDWGAI+ W+ CM RPD VK
Sbjct  61    GYGDSDAPPSH-ESYTVLHIVGDLIGLLNSLGVDKVLLVGHDWGAIVAWWLCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV F PR+P +KP++  R+ FGDDYYICRFQE G IE D A   ++K++ + FT 
Sbjct  120   ALVNTSVVFNPRNPNVKPLDTFRSLFGDDYYICRFQEPGEIEEDFAQTDTKKLITRFFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PK   F      P LP+W +E+D+ +Y  K++ KGFTGGLNYYR++NL+WEL
Sbjct  180   RNPRPPCIPKTVGFRGLPAPPPLPAWFTEEDVSFYVDKFNQKGFTGGLNYYRAMNLSWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVKF+VGD+D+ Y  PG KEY+H GG KK VP L+E+V++EG GHFL Q
Sbjct  240   TAPWAGLQIKVPVKFIVGDLDITYHIPGTKEYIHDGGLKKHVPFLQEVVIMEGVGHFLQQ  299

Query  428   ERPEEV  411
             E+PEEV
Sbjct  300   EKPEEV  305



>ref|XP_010105137.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03945.1| Epoxide hydrolase 2 [Morus notabilis]
Length=319

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 242/309 (78%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+GIEH+TV+VNGI+MHVAEKG GPVILF+HGFPELWY+WRHQ+   + LG+RAVAPDLR
Sbjct  1     MDGIEHRTVEVNGIHMHVAEKGDGPVILFIHGFPELWYSWRHQIAALSSLGFRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             GYG++ AP   P+ YTCL +VGDL+AL+ ++  D  KVF+V HDWGA+I WY C+FRPD 
Sbjct  61    GYGDSAAPE-SPAVYTCLDIVGDLIALLDAIAADQDKVFVVGHDWGALIAWYLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V++SV F PR+P  +P+ +MRA  GD+YYICRFQE G IE+++   G ++VLR+  
Sbjct  120   VKALVNLSVAFNPRNPRRRPIHSMRAVCGDNYYICRFQEFGEIEAELEKIGIDRVLREFL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R  GP  LPK   F    D P  LP WLSE+DLKYY SK++  GFTGG+NYYR+I+ N
Sbjct  180   TYRHPGPLFLPKGKGFERPVDVPISLPDWLSEEDLKYYVSKFEKTGFTGGINYYRNIDRN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A WTG  +KVPVKF+VGD+D+ Y + G K+YVH GGFK+DVP L+E+V++EG GHF
Sbjct  240   WELVAPWTGTPIKVPVKFIVGDLDLTYNSFGAKDYVHKGGFKRDVPFLQEVVIMEGVGHF  299

Query  437   LNQERPEEV  411
             +NQERP+E+
Sbjct  300   INQERPQEI  308



>ref|XP_007147005.1| hypothetical protein PHAVU_006G088700g [Phaseolus vulgaris]
 gb|ESW18999.1| hypothetical protein PHAVU_006G088700g [Phaseolus vulgaris]
Length=318

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 193/308 (63%), Positives = 241/308 (78%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI H+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   +  GY AVAPDLR
Sbjct  1     MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP+   SSYTC  +VGDLVAL+  LGV++VFLVAHDWGA+IGWY CMFRP+ VK
Sbjct  61    GYGDTEAPASM-SSYTCFDIVGDLVALIDLLGVEQVFLVAHDWGAVIGWYLCMFRPEKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVP R R P +KPV+ MRA +GDDYYICRFQ+ G +E+ +A  G+E VL+ I T 
Sbjct  120   AYVCLSVPLRRRDPKVKPVDVMRAVYGDDYYICRFQKPGEMEAQMAEVGTEYVLKNILTT  179

Query  788   RKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             RK GPP  P  E   G + D    LPSWLS+ DL YY SK+   GFTG LNYYR++N NW
Sbjct  180   RKPGPPIFPMGEYGTGFNPDMTNSLPSWLSQHDLAYYVSKFQKTGFTGPLNYYRNLNPNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA W+G++++VPVKF+ G++DMVYT+  +KEY+HGGGFK+ VP LEE++V +G  HF 
Sbjct  240   ELTAPWSGVKIEVPVKFITGELDMVYTSLNMKEYIHGGGFKEHVPNLEEVIVQKGVAHFN  299

Query  434   NQERPEEV  411
             NQE  EE+
Sbjct  300   NQETAEEI  307



>ref|XP_010674075.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=317

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 242/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I HK V VNGINMH+AEKG+G V+L LHGFPELWY+WRHQ+   A  GY A+APDLR
Sbjct  1     MEEIVHKKVHVNGINMHIAEKGEGQVVLLLHGFPELWYSWRHQIIALASNGYHAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++D+PS    SYTC H+VGD++ L+  L VD+V LVAHD GA++GWY CMFRPD +K
Sbjct  61    GYGDSDSPSSS-LSYTCFHLVGDIIGLLDLLNVDQVLLVAHDMGAMVGWYLCMFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             AFV +SVPFRPR+P +KP + +RA FGD YYICRFQE G IE++I   G + VL+KI T 
Sbjct  120   AFVSLSVPFRPRNPKLKPTQTLRAIFGDAYYICRFQEAGDIEAEITECGIKHVLKKILTS  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R  G P LPK   F +S + P  LPSWLSE+D+ YYA+KY+ KGFTG LN+YR+++ NWE
Sbjct  180   RDPGAPMLPKGKSFDVSPESPIILPSWLSEEDIDYYAAKYEEKGFTGPLNHYRNLDWNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG+E+KVP K +VGD+DMVY   G+K+YVH GGFKKDVPLLE++VV+EG GHF+N
Sbjct  240   LTAPWTGVELKVPAKLVVGDLDMVYNMFGVKDYVHNGGFKKDVPLLEDVVVMEGVGHFIN  299

Query  431   QERPEEV  411
             QE+ EEV
Sbjct  300   QEKAEEV  306



>ref|XP_006444387.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 ref|XP_006479995.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR57627.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 gb|KDO87172.1| hypothetical protein CISIN_1g021184mg [Citrus sinensis]
Length=316

 Score =   407 bits (1046),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 231/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H TV  NGINMHVA  G GP +LFLHGFPELWY+WR QL + +  GYRA+APDLR
Sbjct  1     MEKIKHTTVATNGINMHVASIGTGPAVLFLHGFPELWYSWRKQLLYLSSRGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    +SYT LHVVGDLV L+   G+++VFLV HDWGA+I WYFC+ RPD VK
Sbjct  61    GYGDTDAPP-SITSYTALHVVGDLVGLLDEFGIEQVFLVGHDWGALIAWYFCLLRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FR R+P  KPV+  RA FGDD+YICRFQE G  E D A   + ++++K    
Sbjct  120   ALVNLSVVFRSRNPATKPVDQYRALFGDDFYICRFQEPGVAEEDFAQIDTARLIKKFLGG  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PKE  F    D   LPSWLSE+D+ YYASK+  KGFTGGLNYYR ++LNWEL
Sbjct  180   RSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              A WTG ++K+PVKFMVGD+D+ Y  PGI+EY+  GGFKKDVP L+E++V+EG  HF+NQ
Sbjct  240   LAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQ  299

Query  428   ERPEEV  411
             E+ +EV
Sbjct  300   EKADEV  305



>ref|XP_011041992.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   407 bits (1046),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 229/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMH+A  G GP ILFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTTVATNGINMHIASIGTGPEILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP      YT  H++GDLV L+ SLG+DKVFLV HDWGA++ WYFC+ RPD +K
Sbjct  61    GYGDTDAPK-DHREYTVFHILGDLVGLIDSLGIDKVFLVGHDWGAVVAWYFCLLRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F+PR+P    V+  R  FGDDYYICRFQE G +E D A   + +++RK  T 
Sbjct  120   ALVNMSVVFQPRNPDKSFVQISRDLFGDDYYICRFQEPGEVEEDFAQMDTARIIRKFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PP +PKE  F    D P LPSWLSE+D+ +YA K++  GFTGGLNYYR ++LNWEL
Sbjct  180   RNPKPPRIPKEVGFRGLPDNPNLPSWLSEKDINHYAGKFNKTGFTGGLNYYRCLDLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TAAWTG+++KVPVKF+VGD+D+ Y  PG ++Y+  GG KK VP L+E+ ++EG  HFLNQ
Sbjct  240   TAAWTGLQIKVPVKFIVGDLDITYNMPGAQDYISEGGLKKYVPFLQEVAIMEGVAHFLNQ  299

Query  428   ERPEEV  411
             E+PEEV
Sbjct  300   EKPEEV  305



>ref|XP_009111297.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=315

 Score =   406 bits (1044),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 234/306 (76%), Gaps = 2/306 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GPV+LFLHGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++D+P     SYT LH+VGDLV L+ SLGVD+VFLV HDWGAII W+ CM RPD VK
Sbjct  61    GYGDSDSPPSH-ESYTLLHIVGDLVGLLDSLGVDQVFLVGHDWGAIIAWWMCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P++K V+A +A FG+DYYICRFQE G IE D A   ++K++   FT 
Sbjct  120   ALVNMSVEFHPRNPSVKTVDAFKALFGEDYYICRFQEPGDIEEDFAQVDTKKLVNGFFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
                 PPC+PK + F    D P LP W +EQD+ +YA K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   HNTRPPCIPK-SVFRYLPDPPALPGWFTEQDVCFYADKFSQKGFTGGLNYYRAMNLSWEL  238

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVK++ GD+D  Y  PG KEY+H GG KK VP L+E+VV+EG GHFL Q
Sbjct  239   TAPWDGLQIKVPVKYITGDLDPTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQ  298

Query  428   ERPEEV  411
             E+P+E+
Sbjct  299   EKPKEI  304



>emb|CDY65635.1| BnaAnng20800D [Brassica napus]
Length=315

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 234/306 (76%), Gaps = 2/306 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GPV+LFLHGFP+LWY+WRHQL  FA LGYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++D+P     SYT LH+VGDLV L+ SLGVD+VFLV HDWGAII W+ CM RPD VK
Sbjct  61    GYGDSDSPPSH-ESYTLLHIVGDLVGLLDSLGVDQVFLVGHDWGAIIAWWMCMIRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P++K V+A +A FG+DYYICRFQE G IE D A   ++K++   FT 
Sbjct  120   ALVNMSVEFHPRNPSVKTVDAYKALFGEDYYICRFQEPGDIEEDFAQVDTKKLVNGFFTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
                 PPC+PK + F    D P LP W +EQD+ +YA K+  KGFTGGLNYYR++NL+WEL
Sbjct  180   HNTRPPCIPK-SVFRYLPDPPALPGWFTEQDVCFYADKFSQKGFTGGLNYYRAMNLSWEL  238

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA W G+++KVPVK++ GD+D  Y  PG KEY+H GG KK VP L+E+VV+EG GHFL Q
Sbjct  239   TAPWDGLQIKVPVKYITGDLDPTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQ  298

Query  428   ERPEEV  411
             E+P+E+
Sbjct  299   EKPKEI  304



>ref|XP_008340789.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 241/308 (78%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             +GIEH+TV VNGINMHVAEKG GP+ILF+HGFPELWY+WRHQ+   + LGYRAVAPDLRG
Sbjct  4     QGIEHRTVPVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDLRG  63

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+  PSSY CLHVVGDLVAL+ ++  D+  VF+VAHDWGA I WY C+ RPD V
Sbjct  64    YGDTDAPA-SPSSYNCLHVVGDLVALLDAIAPDQEQVFVVAHDWGAXIAWYLCLXRPDRV  122

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V +SV F PR+P  K +E+++A +GDDYYICRFQE G IE++ A  G+ +V+++  T
Sbjct  123   KALVSLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLT  182

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GP  LPK   FG  T+ P  LPSWLSE ++ YY +K+D  GFTGG+NYYR+ ++NW
Sbjct  183   YRNPGPLFLPKGKGFGHPTBTPIVLPSWLSEDEVNYYXAKFDKTGFTGGINYYRNXDINW  242

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG +VKVPVKF+VGD D+VY + G  +++  GGFKK VPLLEE+VV+EG  HFL
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSXGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFL  302

Query  434   NQERPEEV  411
              QE+P+E+
Sbjct  303   QQEKPDEI  310



>ref|XP_002271210.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 185/307 (60%), Positives = 241/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H+TV+ NGIN+H+AEKGQGP+ILFLHGFPELWY+WRHQ+   A LGYRAVAPDLR
Sbjct  1     MEEIQHRTVEANGINIHIAEKGQGPIILFLHGFPELWYSWRHQIHALASLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP+   +SYT LHVVGD++ ++ ++G D+VF+V HDWGA++ WY C++RPD VK
Sbjct  61    GFGDTDAPA-DGTSYTSLHVVGDIIGVLDAIGADRVFVVGHDWGAVMAWYLCLYRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SVPF PR+P  KP+E++RA  GDDYYICRFQE G IE++ A  G ++VL+   T 
Sbjct  120   ALVNMSVPFSPRNPMRKPLESLRAQLGDDYYICRFQEPGVIETEFAEIGVDRVLKHFLTY  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   P  LPK N FG     P  LPSWLSE+++ YY +KY   GFTGGLNYYRS+N NWE
Sbjct  180   RNPAPLFLPKGNAFGDDPATPIVLPSWLSEEEVHYYTTKYQKTGFTGGLNYYRSLNRNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA +TG + KVP KF+VGD DM Y  PG K+++HGGG KK VPLLE+++V+EG GHF++
Sbjct  240   LTAPFTGYQSKVPTKFIVGDHDMTYHAPGSKDFIHGGGLKKYVPLLEDVIVMEGVGHFIH  299

Query  431   QERPEEV  411
             +E+ +E+
Sbjct  300   EEKSDEI  306



>ref|XP_004494951.1| PREDICTED: uncharacterized protein LOC101500941 [Cicer arietinum]
Length=639

 Score =   417 bits (1072),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 246/309 (80%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+TDAP    +SYT  H+VGDLVAL+  LGV++VFLVAHDWGAIIGWYFCMFRP+ +
Sbjct  61    RGYGDTDAPG-SVNSYTGFHIVGDLVALIDLLGVEQVFLVAHDWGAIIGWYFCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVP   R+P +K V+AMRA +GDDYYICRFQE G++E+ +A  G+  VL+ I T
Sbjct  120   KAYVCLSVPLLHRNPKIKTVDAMRAAYGDDYYICRFQEPGKMEAQMAEVGTAYVLKNILT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              RK GPP LPK E   G + D P  LPSWL+E DL Y+ SK++  GFTGGLNYYR++NLN
Sbjct  180   TRKTGPPILPKGEYGTGFNPDTPDTLPSWLTEADLAYFVSKFEKTGFTGGLNYYRNLNLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G +V VPVKF+ G++DMVYT+  +KEY+HGGGFK+DVP LEE++V +G  HF
Sbjct  240   WELMAPWRGAKVYVPVKFITGELDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308


 Score =   404 bits (1038),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/311 (60%), Positives = 242/311 (78%), Gaps = 6/311 (2%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             ++EGIEH+T++ NGI +H+AEKG +GPV+LFLHGFPE WY+WRHQ+     LGYRAVAPD
Sbjct  320   ELEGIEHRTIEANGIKIHIAEKGKEGPVVLFLHGFPESWYSWRHQIAALGSLGYRAVAPD  379

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYG+T+ PS   S+YT   +VGD+V ++ +LGVDKVFLV HDWGA+IGW  C+F P+ 
Sbjct  380   LRGYGDTEVPS-SISNYTIFDLVGDIVGVIDALGVDKVFLVGHDWGAVIGWQVCLFHPER  438

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA+V +SVP+ PR+P +KPV AMR  +G+D+YICRFQE G+ E++ A  G+E V+R + 
Sbjct  439   VKAYVALSVPYAPRNPILKPVTAMRLLYGNDFYICRFQEPGKAEAEFAKVGAELVIRGML  498

Query  794   TDRKAGPPCLPKENPFGISTDQ---PKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
             T R  GPP LPK+  FG   D    P LPSWLS++DL YY SK+D  GFTG LNYYR+IN
Sbjct  499   TTRTPGPPILPKDG-FGSDLDPANPPPLPSWLSQEDLSYYVSKFDKSGFTGALNYYRNIN  557

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
             LNW+LTA+WTG  VKVPVKF+ G++DMVYT+  +KEY+HGGGFK+DVP LEE++V +G  
Sbjct  558   LNWKLTASWTGARVKVPVKFITGELDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVA  617

Query  443   HFLNQERPEEV  411
             HF NQ   EE+
Sbjct  618   HFNNQRAAEEI  628



>ref|XP_007035641.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY06567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=396

 Score =   409 bits (1050),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 241/310 (78%), Gaps = 4/310 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +ME IEH+ V VNGINMHVAEKG+GPVILFLHGFPELWY+WRHQ+  FA LGY+AVAPDL
Sbjct  73    EMEEIEHRIVNVNGINMHVAEKGKGPVILFLHGFPELWYSWRHQITAFASLGYQAVAPDL  132

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
              GYG+TDAP    SSYT L+VVGDLVAL+  +    DKVF+V HDWGA+I W+ C+ RPD
Sbjct  133   CGYGDTDAPDAA-SSYTVLNVVGDLVALLDVVAPEQDKVFVVGHDWGALIAWWLCLVRPD  191

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P  KP+E++RAF+GDDYYICRFQ  G IE++ A  G E+VL+  
Sbjct  192   RVKALVNMSVVFSPRNPKRKPLESLRAFYGDDYYICRFQAPGEIEAEFAELGFERVLKGF  251

Query  797   FTDRKAGPPCLPKENPFGISTDQPKLP-SWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R  GP  LPK   FG       LP +WLSE+D+KYY S+Y+ KGFTGGLNYYR+I+L
Sbjct  252   LTYRNPGPLLLPKGKYFGQPDTPISLPPNWLSEEDVKYYISQYEKKGFTGGLNYYRNIDL  311

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG +VKVPVKF+VGD D+ Y  PG K+Y+  GG K+DVP LE++VV+EG  H
Sbjct  312   NWELTAPWTGSQVKVPVKFIVGDQDLTYNAPGTKDYIQKGGLKRDVPFLEQVVVMEGVAH  371

Query  440   FLNQERPEEV  411
             FL++E+P+E+
Sbjct  372   FLHEEKPDEI  381



>ref|XP_006480000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=316

 Score =   405 bits (1040),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 234/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GPV+LF+HGFPELWY+WR+QL + +  GYRA+APDLR
Sbjct  1     MEKIEHTTVGTNGINMHVASIGTGPVVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    +SYT LH+VGDL+ L+  LG+ +VFLV HDWGA+I WYFC+FRPD VK
Sbjct  61    GYGDTDAPP-SVTSYTALHLVGDLIGLLDKLGIHQVFLVGHDWGALIAWYFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SVPF PR+P ++P+   RA +GDDYYICRFQE G IE + A   + ++++K    
Sbjct  120   ALVNMSVPFPPRNPAVRPLNNFRAVYGDDYYICRFQEPGEIEEEFAQIDTARLMKKFLCL  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R A P C+PK+       D   LPSWLSE+D+ YYASK++ KGFTG +NYYR  +LNWEL
Sbjct  180   RIAKPLCIPKDTGLSTVPDPSALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCSDLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              A WTG++++VPVKF+VGD D+VY   G+KEY+H GGFKK VP L+E+VV+EG  HF+NQ
Sbjct  240   MAPWTGVQIEVPVKFIVGDQDLVYNNKGMKEYIHDGGFKKYVPYLQEVVVMEGVAHFINQ  299

Query  428   ERPEEV  411
             E+ EEV
Sbjct  300   EKAEEV  305



>gb|KEH32298.1| epoxide hydrolase [Medicago truncatula]
Length=355

 Score =   406 bits (1043),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 242/310 (78%), Gaps = 4/310 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ++EGIEH+TV VNGINMH+AEKGQGP+ILF+HGFP+LWY+WRHQ+ + A  GYR VAPDL
Sbjct  36    ELEGIEHRTVTVNGINMHIAEKGQGPLILFIHGFPDLWYSWRHQITYLACHGYRCVAPDL  95

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             RGYG+TD PS  P+SYT LHVVGD++ L+ ++  D  KVF+V HDWGA+  WY  ++RP+
Sbjct  96    RGYGDTDIPS-SPTSYTSLHVVGDIIGLLDAIAGDQEKVFVVGHDWGALTAWYLSLYRPE  154

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              +KA V++SV F PR+P  KP++ +RA +G+DYYI RFQE G IE++ A  G+++VL++ 
Sbjct  155   RIKALVNLSVAFTPRNPKRKPLDTLRAVYGNDYYISRFQEPGDIEAEFAEIGTQRVLKEF  214

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R  GP  LPK   FG   D P  LP WLSEQ+  YYASK+D  GFTG LNYYR+I+L
Sbjct  215   LTYRNPGPLYLPKGKGFGHPIDSPILLPPWLSEQECNYYASKFDKTGFTGALNYYRNIDL  274

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWEL A WTG +VKVPVKF+VGD+D+ Y  PG K+Y+H GG K+DVPLLE++VVIEG GH
Sbjct  275   NWELNAPWTGAQVKVPVKFIVGDLDLTYNAPGAKDYIHKGGMKRDVPLLEDVVVIEGAGH  334

Query  440   FLNQERPEEV  411
             F++QER +++
Sbjct  335   FIHQERADKI  344



>ref|XP_010088295.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33520.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   404 bits (1039),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 185/307 (60%), Positives = 236/307 (77%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GP ILFLHGFPELWY+WRHQ+   + LGYR +APDLR
Sbjct  1     MEKIEHSTVHTNGINMHVASVGTGPAILFLHGFPELWYSWRHQMISLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP   P+SYT LH+VGDLV L+  L ++K+FLV HDWGA+I WYFC+FRPD +K
Sbjct  61    GYGDTDAPP-SPTSYTSLHIVGDLVGLIDHLVIEKLFLVGHDWGAMIAWYFCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SVPF PR+P +  V+  RA  GDD+YICRFQE G  E+D +   +  V R+I  +
Sbjct  120   ALVNLSVPFFPRNPKINFVDGFRAELGDDFYICRFQEPGESEADFS-SDTVAVFRRILAN  178

Query  788   RKAGPPCLPKENPF-GISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   PP +PKE  F G+  D   LPSWL+E D+ ++A+K++  GFTGGLNYYR++NL WE
Sbjct  179   RDPKPPLIPKEIGFRGVYEDPVALPSWLTEDDINHFANKFNETGFTGGLNYYRALNLTWE  238

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG  V+VP KF++GD+D+VY  PG+KEY+  GGFK+DVPLL+E+V+IEG  HF+N
Sbjct  239   LTAAWTGARVQVPTKFIMGDLDLVYYFPGMKEYILNGGFKRDVPLLQELVIIEGAAHFIN  298

Query  431   QERPEEV  411
             QE+P+E+
Sbjct  299   QEKPDEI  305



>ref|XP_011015179.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Populus 
euphratica]
Length=316

 Score =   404 bits (1038),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 226/306 (74%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEH+T+  NGINMH+A  G GPV+LFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MDKIEHQTIATNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP      YT  H+VGDLV L+ SLG+DKVFLV HDWGA + WYFC+ RPD +K
Sbjct  61    GYGDTDAPK-NAREYTIFHIVGDLVGLIDSLGIDKVFLVGHDWGATVAWYFCLLRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F+PR+P    V+  R  FGDD+YICRFQE G +E D A   +  ++ +  T 
Sbjct  120   ALVNMSVVFQPRNPHKSSVQISRELFGDDFYICRFQEPGEVEEDFAQMDTASIITRFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PPC+PKE  F    D P LPSWLSE+D+ YYA K++  GFTGGLNY R ++LNWEL
Sbjct  180   RDPKPPCIPKEVGFRGIPDNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYNRCLDLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              AAWTG+++KV  KF+VGD+D  Y  PG+KEY+  GG KK VP L+E+VV+EG  HFLNQ
Sbjct  240   MAAWTGLKIKVSAKFIVGDVDPTYHIPGVKEYISKGGLKKYVPFLQEVVVMEGVAHFLNQ  299

Query  428   ERPEEV  411
             E+PEEV
Sbjct  300   EKPEEV  305



>ref|XP_008341331.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   404 bits (1038),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 244/308 (79%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             +GIEH+TV+VNGINMHVAEKG GP+ILF+HGFPELWY+WRHQ+   + LGYR VAPDLRG
Sbjct  4     QGIEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSDLGYRXVAPDLRG  63

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+  PSSYTCLH+VGDLVAL+ ++  D+  VF+VAHDWGA+I WY  +FRPD V
Sbjct  64    YGDTDAPA-SPSSYTCLHMVGDLVALLDAIAPDQEQVFVVAHDWGAVIAWYLXLFRPDRV  122

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V +SV F PR+P  K +E+ +A +GDDYY+CRFQE G IE++ A  G+ +V+++  T
Sbjct  123   KALVSLSVQFIPRNPQRKFIESFQAAYGDDYYMCRFQEPGVIEAEFAQMGTTRVIKEFLT  182

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R   P  LPK   FG   D P  LPSWLSE ++ YYA+K+D  GFTGG+NYYR++++NW
Sbjct  183   YRNPXPLFLPKGKGFGHPXDTPIVLPSWLSEDEVNYYAAKFDKTGFTGGINYYRNLDINW  242

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG +VKVPVKF+VGD D+VY + G ++++H GGFKK VPLLEE++V+EG  HFL
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAQDFIHKGGFKKFVPLLEEVIVLEGVAHFL  302

Query  434   NQERPEEV  411
              QE+P+E+
Sbjct  303   QQEKPDEI  310



>ref|XP_008371325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   404 bits (1037),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 242/308 (79%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             +GIEH+TV+VNGINMHVAEKG GP+ILF+HGFPELWY+WRHQ+   + LGYRAVAPDLRG
Sbjct  4     QGIEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILTLSALGYRAVAPDLRG  63

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+  PSSY CL++VGDLVAL+ ++  D+  VF+VAHDWGA I WY C+ RPD V
Sbjct  64    YGDTDAPA-SPSSYNCLYMVGDLVALLDAIAPDQEQVFVVAHDWGATIAWYLCLLRPDRV  122

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V +SV F PR+P  K +E+++A +GDDYYICRFQE G IE++ A  G+ +V+++  T
Sbjct  123   KALVGLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLT  182

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GP  LPK   FG  TD P  LPSWLSE ++ YY +K+D  GFTGG+NYYR+ ++NW
Sbjct  183   YRNPGPLFLPKGKGFGHPTDTPIVLPSWLSEDEVNYYVAKFDKTGFTGGINYYRNXDINW  242

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG +VKVPVKF+VGD D+VY + G  +++  GGFKK VPLLEE+VV+EG  HFL
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFL  302

Query  434   NQERPEEV  411
              QE+P+E+
Sbjct  303   QQEKPDEI  310



>ref|XP_006419522.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
 gb|ESR32762.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
Length=324

 Score =   404 bits (1038),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 243/314 (77%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI+H+ VKVNGINMH+AEKGQGPVILFLHGFPELWY+WRHQ+   A LGYRAVAPDLR
Sbjct  1     MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALACLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+TDAP    +SYTC HV+GDLV L+ ++  +  KVF+V HDWGA + W+ C+FRPD 
Sbjct  61    GFGDTDAPP-DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGAFMAWFLCLFRPDR  119

Query  974   VKAFVDISVPFRP-----RHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKV  810
             VKA V++SV F P           P+EA+RA++GDDYY+CRFQE G IE++ A  G+E V
Sbjct  120   VKALVNLSVVFNPFGSNTSESNNNPIEALRAYYGDDYYMCRFQEPGEIEAEFAQIGTETV  179

Query  809   LRKIFTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             +++  T R  GP  LPK   FG   D P  LPSWLSE+D+KY+ +K+D KGFTGG+NYYR
Sbjct  180   IKEFLTFRTPGPIILPKGKGFGHPPDAPMALPSWLSEEDVKYFTAKFDKKGFTGGINYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +INL+ EL A W G  +++P KF++GD+D+VY  PG+KEY+H GGFK+DVPLLEE+V++E
Sbjct  240   NINLSQELLAPWAGSRLQIPTKFIIGDLDLVYHMPGVKEYIHKGGFKRDVPLLEEVVIME  299

Query  452   GGGHFLNQERPEEV  411
             G GHF+NQE+ +E+
Sbjct  300   GVGHFINQEKGDEI  313



>ref|XP_007015353.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32972.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 242/309 (78%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEG+EH+T+KVNGINMH+AEKGQGPVILFLHGFPELWY+WRHQ+   + LGYRAVAPDLR
Sbjct  1     MEGVEHRTLKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQINALSSLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+TDAP  + SSYTC HVVGDLV L+ ++    +KVF+V HDWGA + WY C+FRPD 
Sbjct  61    GFGDTDAPD-RVSSYTCFHVVGDLVQLLDAVAPPQEKVFVVGHDWGAFMAWYLCLFRPDK  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA +++SVP+      M P++  RAF+G+DYYICRFQE G IE++ A  G+E+V+++  
Sbjct  120   VKALLNLSVPYIQLGRQMNPIDGWRAFYGNDYYICRFQEPGEIEAEFAEIGTERVVKEFL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R  GP  LP+   FG S D P  LPSWL+++++ YY +++D KGFTGG+NYYR+ N N
Sbjct  180   TYRVPGPILLPEGKLFGHSADTPITLPSWLTQEEVNYYVTQFDKKGFTGGINYYRNFNRN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G E+KVP KF+VGD D+VY  PGIKEY+H GGFKKDVP L+++VV+EG GHF
Sbjct  240   WELLAPWGGCEIKVPAKFIVGDQDLVYHMPGIKEYIHNGGFKKDVPHLQQVVVMEGVGHF  299

Query  437   LNQERPEEV  411
             +N E+ +++
Sbjct  300   INMEKADDI  308



>ref|XP_009411662.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 241/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI H+ + VNGINMHVAEKG GPV+LF+HGFPELWY+WRHQ+   A  GYRAVAPDLR
Sbjct  3     MEGISHRKLHVNGINMHVAEKGDGPVVLFVHGFPELWYSWRHQIASLAARGYRAVAPDLR  62

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP    S+YT LH+VGDLVAL+ +LG D+VF+V HDWGA + W+ CM RPD VK
Sbjct  63    GYGDSDAPP-SASAYTILHLVGDLVALIHALGQDQVFVVGHDWGAAVAWWLCMLRPDKVK  121

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SVPF PR+P  + ++++RA FGDD+Y+CRFQE G  E++ A   +  +++K  T 
Sbjct  122   ALVNLSVPFSPRNPHRRTLDSLRAIFGDDHYMCRFQEHGATEAEFAQIETSLLIKKFLTY  181

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK  P  +PKE  F  + + P  LP+WLSE+D+ Y+ASK++  GFTGGLNYYR ++LNWE
Sbjct  182   RKPEPIIVPKEKGFDGTLETPIALPTWLSEEDINYFASKFEKSGFTGGLNYYRCLDLNWE  241

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG ++KVPVKF+VGD+D+ Y +PG+++Y+H GGFKK VP L+++VV+EG GHF+N
Sbjct  242   LTAPWTGAQIKVPVKFIVGDLDLTYHSPGVQDYIHKGGFKKLVPFLQDVVVMEGVGHFIN  301

Query  431   QERPEEV  411
             QER  ++
Sbjct  302   QERAHDI  308



>emb|CDO98838.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/310 (61%), Positives = 241/310 (78%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEHK V VNG+++H+AE GQGP++LF+HGFPELWY+WRHQ+ F A  GYRAVAPDLR
Sbjct  1     MDKIEHKNVNVNGLSIHIAELGQGPLVLFIHGFPELWYSWRHQILFLAAHGYRAVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP    S +TCLHVVGDLVAL+ ++  D  KVF+V HDWGA++ WY CMFRPD
Sbjct  61    GYGDTTGAPVNDSSEFTCLHVVGDLVALLHAIAPDEEKVFVVGHDWGAMVAWYLCMFRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P  KPVE +RA+ GDDYYICRFQE G IE+++A  G +  L+K+
Sbjct  121   KVKALVNMSVAFIPRNPLAKPVEMLRAYGGDDYYICRFQEPGDIEAELAQMGCKDFLKKM  180

Query  797   FTDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
                R  GP   PK   FG S D P  LPSWL+E+D+ YYASK+D  GFTGGLNYYR++NL
Sbjct  181   LAYRTPGPLFWPKGKGFGDSPDGPVVLPSWLTEEDVDYYASKFDKTGFTGGLNYYRAVNL  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             +WELTA WTG ++KVP KF+VG++D+ Y   G+++Y+H GGFK DVPLLE++VV++   H
Sbjct  241   HWELTAPWTGAKIKVPTKFVVGELDLTYYMRGVQDYIHKGGFKNDVPLLEDVVVVKDAAH  300

Query  440   FLNQERPEEV  411
             F+NQERP+E+
Sbjct  301   FINQERPDEI  310



>ref|XP_009386486.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/307 (59%), Positives = 239/307 (78%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI H+T+ VNG+N+HVAE G+GPV+L LHGFPELW++WRHQ+   A  GYRAVAPDLR
Sbjct  1     MEGISHRTLLVNGVNIHVAEMGEGPVVLLLHGFPELWFSWRHQIVSLAARGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G++DAP    S YT  HVVGDLVAL+Q+LG D+VF+V HDWGA + W+ C+ RPD+VK
Sbjct  61    GFGDSDAPP-SSSVYTAFHVVGDLVALIQALGPDQVFVVGHDWGAYMAWWLCILRPDMVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV + PR+P  +PV+A R  FGDD+YICRFQE G +E++IA  G+   ++K  T 
Sbjct  120   ALVNLSVAYAPRNPGRRPVDACRTIFGDDHYICRFQEHGAMEAEIAQIGTTLFMKKFLTY  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK     +PK+    +S + P  LPSWLSE+D+ Y+ASK++  GFTGGLNYYR +NLNWE
Sbjct  180   RKPAAINIPKDKGLEVSLETPVTLPSWLSEEDINYFASKFEKSGFTGGLNYYRCLNLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             L+A WT ++V VPVKF++GD+D+ Y TPGI++Y+H GGFK  VP LE++VV+EG GHF+N
Sbjct  240   LSAPWTEVQVDVPVKFIIGDLDLTYHTPGIQDYIHKGGFKSAVPFLEDVVVMEGVGHFIN  299

Query  431   QERPEEV  411
             QERP EV
Sbjct  300   QERPHEV  306



>ref|XP_003626202.1| Epoxide hydrolase [Medicago truncatula]
Length=697

 Score =   416 bits (1068),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/309 (63%), Positives = 245/309 (79%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEGIEH+ V+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPDL
Sbjct  1     MEGIEHRRVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+APS   SSYT  H+VGDLVAL+  LGVD+VFLVAHDWGAIIGWY CMFRP+ +
Sbjct  61    RGYGDTEAPS-SISSYTGFHIVGDLVALIDLLGVDQVFLVAHDWGAIIGWYLCMFRPERI  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA+V +SVPF  R+P ++ V+ MRA +GDDYYI RFQE G++E+ +A  G+  V++   T
Sbjct  120   KAYVCLSVPFTRRNPKIRTVDGMRAAYGDDYYISRFQEPGKMEAQMAEVGTAYVMKSTLT  179

Query  791   DRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
              RK GPP  PK E   G + D P KLPSWL+E DL Y+ SK++  GF GGLNYYR++NLN
Sbjct  180   TRKTGPPIFPKGEFGTGFNPDTPDKLPSWLTEDDLAYFVSKFEKTGFVGGLNYYRNLNLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W G+++KVPVKF+ GD+D+VYT+P +KEY+HGGGFK+DVP LEE++V +G  HF
Sbjct  240   WELMAPWNGVKIKVPVKFITGDLDIVYTSPKVKEYIHGGGFKEDVPNLEEVIVQKGVAHF  299

Query  437   LNQERPEEV  411
              NQE  EE+
Sbjct  300   NNQEAAEEI  308


 Score =   414 bits (1064),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 245/310 (79%), Gaps = 4/310 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             +ME IEH+TV+VNGI MH+AEKG +GPV+LFLHGFPELWY+WRHQ+     LGYRAVAPD
Sbjct  378   EMERIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPD  437

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYG+TD PS   SSYTC HVVGD+V+L+  LGV++VFLV HD GAIIGWY CMFRP+ 
Sbjct  438   LRGYGDTDVPS-SISSYTCFHVVGDIVSLIDLLGVEQVFLVGHDMGAIIGWYLCMFRPER  496

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             +KA+V +SVPF  R+P ++ V+ MRA +GDDYYICRFQE G +E+ +A  G+  V++ I 
Sbjct  497   IKAYVCLSVPFLHRNPKIRTVDGMRAVYGDDYYICRFQEPGEMEAQMAEVGTTYVMKNIL  556

Query  794   TDRKAGPPCLPK-ENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
             T RK GPP  PK E   G + D P  LPSWL+E DL Y+ SK++  GFTGGLNYYR+ NL
Sbjct  557   TTRKTGPPIFPKGEYGTGFNPDTPDNLPSWLTEDDLAYFVSKFEKTGFTGGLNYYRNFNL  616

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG+++KVPVKF+ G++DMVYT+  +KEY+HGGGFK+DVP LEE+++ +G  H
Sbjct  617   NWELTAPWTGVKIKVPVKFITGELDMVYTSFNLKEYIHGGGFKEDVPNLEEVIIQKGVAH  676

Query  440   FLNQERPEEV  411
             F NQE  EE+
Sbjct  677   FNNQEAEEEI  686



>ref|XP_006489041.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=319

 Score =   402 bits (1033),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 185/309 (60%), Positives = 242/309 (78%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI+H+ VKVNGINMH+AEKGQGPVILFLHGFPELWY+WRHQ+   A LGYRAVAPDLR
Sbjct  1     MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+TDAP    +SYTC HV+GDLV L+ ++  +  KVF+V HDWGA + W+ C+FRPD 
Sbjct  61    GFGDTDAPP-DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGAFMAWFLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V++SV F P       +EA+RA++GD+YY+CRFQE G IE++ A  G+E V+++  
Sbjct  120   VKALVNLSVVFNPFGSINNVIEALRAYYGDNYYMCRFQEPGEIEAEFAQIGTETVIKEFL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R  GP  LPK   FG   D P  LPSWLSE+D+K++ +K+D KGFTGG+NYYR+INL+
Sbjct  180   TFRTPGPIILPKGKGFGHPPDAPMALPSWLSEEDVKHFTAKFDKKGFTGGINYYRNINLS  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
              EL A W G  +++P KF++GD+D+VY  PG+KEY+H GGFK+DVPLLEE+V++EG GHF
Sbjct  240   QELLAPWAGSRLQIPTKFIIGDLDLVYHMPGVKEYIHKGGFKRDVPLLEEVVIMEGVGHF  299

Query  437   LNQERPEEV  411
             +NQE+ +E+
Sbjct  300   INQEKGDEI  308



>ref|XP_007154300.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
 gb|ESW26294.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
Length=319

 Score =   401 bits (1030),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 239/309 (77%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEG+ H+TV VNGINMH+AE G+GP ILF+HGFP+LW++WRHQ++  A LGYR VAPDLR
Sbjct  1     MEGVRHRTVNVNGINMHIAEMGEGPSILFIHGFPDLWFSWRHQMKALASLGYRCVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             GYG+TD P+  P++YT LHVVGD+V L+  +  D  KVF+V HDWGA+  W   +FRPD 
Sbjct  61    GYGDTDVPA-SPTAYTSLHVVGDIVGLLDEIAGDNEKVFVVGHDWGAMTAWVLSLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             ++A V++SV F PR+P  KP++ ++A +G+DYYICRFQE G IE++    G+E+VL++  
Sbjct  120   IRALVNLSVAFTPRNPKRKPLDTLKAVYGNDYYICRFQEPGNIEAEFEQIGTERVLKEFL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R   P  L +   FG   D P KLPSWLSE++  YYASKY+  GFTGGLNYYR+++LN
Sbjct  180   TYRNPAPIYLHEGKGFGHPIDSPLKLPSWLSEEECHYYASKYEKTGFTGGLNYYRNLDLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTA WTG +VKVPVKF+VGD+D+ Y  PG K+Y+H GG K+DVPLLE++VVI+G GHF
Sbjct  240   WELTAPWTGAKVKVPVKFIVGDLDLTYNAPGAKDYIHKGGLKRDVPLLEDVVVIQGAGHF  299

Query  437   LNQERPEEV  411
             L+QERP E+
Sbjct  300   LHQERPHEI  308



>ref|XP_004290809.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 227/306 (74%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GP ILFLHGFPELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTTVPTNGINMHVASIGSGPPILFLHGFPELWYSWRHQLLSLSALGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP    SSYT +H+VGDL+ L+  LG+++VFLVAHDWGA+I W+FC+FRPD VK
Sbjct  61    GFGDTDAPP-DASSYTAMHIVGDLIGLLDHLGIEQVFLVAHDWGAVIAWWFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
               V++SV F PR+P  KPV+  +A FGDDYYICRFQE G  E+      +  V++   T 
Sbjct  120   CLVNMSVAFNPRNPKRKPVDGFKALFGDDYYICRFQEPGEAEAYFGGLDTASVMKMFLTG  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PP + KE  F        +P+WLSE+D+ Y+A+K+   GFTGGLNYYR+INL WEL
Sbjct  180   RNPAPPKISKELGFASWKPVEPMPAWLSEEDVNYFATKFSKTGFTGGLNYYRAINLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG+++KVPVKF+VGD+D+ Y  PGIKEY+H GGFK  VP L+E++++EG  HF+NQ
Sbjct  240   TAPWTGVQIKVPVKFIVGDLDITYNIPGIKEYIHNGGFKSQVPFLQEVIIVEGAAHFINQ  299

Query  428   ERPEEV  411
             E+ EE 
Sbjct  300   EKAEEC  305



>ref|XP_006444386.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 ref|XP_006479994.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
 dbj|BAD13534.1| soluble epoxide hydrolase [Citrus jambhiri]
 gb|ESR57626.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 gb|KDO87173.1| hypothetical protein CISIN_1g021158mg [Citrus sinensis]
Length=316

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 231/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GP +LF+HGFPELWY+WR+QL + +  GYRA+APDLR
Sbjct  1     MEKIEHTTVATNGINMHVASIGTGPAVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    +SYT LH+VGDL+ L+  LG+ +VFLV HDWGA+I WYFC+FRPD VK
Sbjct  61    GYGDTDAPP-SVTSYTALHLVGDLIGLLDKLGIHQVFLVGHDWGALIAWYFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SVPF PR+P ++P+   RA +GDDYYICRFQE G IE + A   + ++++K    
Sbjct  120   ALVNMSVPFPPRNPAVRPLNNFRAVYGDDYYICRFQEPGEIEEEFAQIDTARLMKKFLCL  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   P C+PK+       D   LPSWLSE+D+ YYASK++ KGFTG +NYYR  +LNWEL
Sbjct  180   RIPKPLCIPKDTGLSTLPDPSALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCWDLNWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              A WTG+++KVPVK++VGD D+VY   G KEY+H GGFKK VP L+++VV+EG  HF+NQ
Sbjct  240   MAPWTGVQIKVPVKYIVGDQDLVYNNKGTKEYIHNGGFKKYVPYLQDVVVMEGVAHFINQ  299

Query  428   ERPEEV  411
             E+ EEV
Sbjct  300   EKAEEV  305



>ref|XP_008361962.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 239/308 (78%), Gaps = 4/308 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             +GIEH+TV VNGINMHVAEKG GP+ILF+HGFPELWY+WRHQ+   + LGYRAVAPDLRG
Sbjct  4     QGIEHRTVPVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDLRG  63

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPDLV  972
             YG+TDAP+  PSSY CL  VGDLVAL+ ++  D+  VF+VAHDWGA I WY C+ RPD V
Sbjct  64    YGDTDAPA-SPSSYNCLXXVGDLVALLDAIAPDQEQVFVVAHDWGAXIAWYLCLXRPDRV  122

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V +SV F PR+P  K +E+++A +GDDYYICRFQE G IE++ A  G+ +V+++  T
Sbjct  123   KALVSLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLT  182

Query  791   DRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
              R  GP  LPK   FG  T+ P  LPSWLSE ++ YY +K+D  GFTGG+NYYR+ ++NW
Sbjct  183   YRNPGPLFLPKGKGFGHPTBTPIVLPSWLSEDEVNYYXAKFDKTGFTGGINYYRNXDINW  242

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG +VKVPVKF+VGD D+VY + G  +++  GGFKK VPLLEE+VV+EG  HFL
Sbjct  243   ELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFL  302

Query  434   NQERPEEV  411
              QE+P+E+
Sbjct  303   QQEKPDEI  310



>gb|KEH24395.1| epoxide hydrolase [Medicago truncatula]
Length=317

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 236/307 (77%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV+ NGI MHVA  G GPVI+FLHGFPELWY+WRHQL   + LGYRAVAPDLR
Sbjct  1     MEKIEHTTVQTNGIKMHVASIGSGPVIIFLHGFPELWYSWRHQLLSLSALGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TD+PS   SSYT  H+VGDLV L+ +L VD+VFLV HDWGA + WYFC+ +PD VK
Sbjct  61    GYGDTDSPSSP-SSYTAHHIVGDLVGLLDALNVDRVFLVGHDWGAAMAWYFCLLKPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FR R+P  KPV+ MRA  GDDYY+CRFQ+ G  E + A  G+ ++++   T 
Sbjct  120   ALVNMSVVFRSRNPVRKPVQTMRALMGDDYYMCRFQKPGEAEEEFARAGATRIIKSFLTL  179

Query  788   RKAGPPCLPKENPFGISTD-QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R     C+PKE  FG S +    LP WLSE+D+ YYA+K++ KGFTGGLNYYR+++L WE
Sbjct  180   RDPRALCVPKEIGFGGSPNTHITLPKWLSEEDVNYYATKFEQKGFTGGLNYYRALDLTWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             L A WTG ++KVP KF+VGD+D+ Y TPG+KEY+H GGFK++VP L+E+VV+EG  HF+N
Sbjct  240   LMAPWTGEQIKVPAKFIVGDLDLTYNTPGVKEYIHNGGFKREVPYLQEMVVMEGVAHFIN  299

Query  431   QERPEEV  411
             QERPEE+
Sbjct  300   QERPEEI  306



>gb|KDP27825.1| hypothetical protein JCGZ_18905 [Jatropha curcas]
Length=321

 Score =   399 bits (1026),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 239/311 (77%), Gaps = 6/311 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             M+ +EH+ V VNGIN+HVAE G   GPVILF+HGFPELWY+WR+Q+   A LGYRA+APD
Sbjct  1     MDAVEHRFVHVNGINIHVAEAGPVNGPVILFIHGFPELWYSWRYQIVALASLGYRAIAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRP  981
             +RGYG+TDAP+  P SYTCLH+VGDL+ L+ ++    +KVF+V HDWGA I WY C+FRP
Sbjct  61    MRGYGDTDAPA-DPQSYTCLHIVGDLIGLLDAVAPQQEKVFVVGHDWGAYIAWYLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D VKA V++SV F PR+P  KP E MRA +GDDYY+CR QE G IE++ A  G+EK++++
Sbjct  120   DRVKALVNLSVAFAPRNPKRKPTEGMRAVYGDDYYVCRIQEPGDIEAEFAELGTEKIMKE  179

Query  800   IFTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
               T R  GP  LPK   F   ++ P  LPSW SE+D++YY +K++ KGFTGGLNYYR ++
Sbjct  180   FLTYRNPGPLLLPKGKAFSRPSETPLVLPSWFSEEDVQYYINKFEKKGFTGGLNYYRIVD  239

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
              NWELTA WTG EVKVPVKF+VGD D+ Y T G K+++  GGFKK VP LEE+V++EG G
Sbjct  240   RNWELTAPWTGAEVKVPVKFIVGDQDLTYNTFGTKDFIEKGGFKKAVPFLEEVVIMEGVG  299

Query  443   HFLNQERPEEV  411
             HFLN+E+PEE+
Sbjct  300   HFLNEEKPEEI  310



>gb|AAO27849.1|AF482450_1 soluble epoxide hydrolase [Euphorbia lagascae]
Length=321

 Score =   399 bits (1026),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 226/308 (73%), Gaps = 2/308 (1%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
              ME IEH  V  NGINMH+A  G QGPVILFLHGFP+LWY+WRHQL + + +GYR +APD
Sbjct  4     NMEKIEHSMVSTNGINMHIASIGTQGPVILFLHGFPDLWYSWRHQLLYLSSVGYRCIAPD  63

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYG+TDAP    + YT  H++GDLV L+ SLG+D+VFLV HDWGAII WYFC+  P  
Sbjct  64    LRGYGDTDAPP-AINQYTVFHILGDLVGLLDSLGIDQVFLVGHDWGAIISWYFCLLMPFR  122

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             +KA V+ SV F PR P  K VE  R   G+D+YICRFQE G IE D A  G+ K++ K  
Sbjct  123   IKALVNASVVFTPRDPRCKTVEKYRKELGEDFYICRFQEVGEIEDDFAQAGTAKIITKFL  182

Query  794   TDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             T R   PPC+PKE  +    +   +PSWLS+ D+ YY SKY+ KGF+GGLNYYR ++LNW
Sbjct  183   TSRHIRPPCIPKETGYRSLREPSHIPSWLSQDDINYYVSKYNKKGFSGGLNYYRCLDLNW  242

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG+++KVPVKF+VGD D  Y  PG+KE++H GG KK VP L+EIV++EG  HFL
Sbjct  243   ELTAPWTGVQIKVPVKFIVGDQDATYHLPGVKEFIHNGGLKKHVPFLQEIVILEGAAHFL  302

Query  434   NQERPEEV  411
              QE+PEE+
Sbjct  303   QQEKPEEI  310



>ref|XP_010429482.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=331

 Score =   400 bits (1027),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 237/314 (75%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGI+H+ V VNGI MH+AE G   GP++L LHGFP+ WYTWRHQ+   + L YR VAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAENGPKDGPLVLLLHGFPDFWYTWRHQISALSSLDYRTVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG++D+P    S YTCL+VVGDL+AL+ S+  D  KVFLV HDWGAIIGW+ C+FRP
Sbjct  61    LRGYGDSDSPE-SFSEYTCLNVVGDLIALLDSVAGDQEKVFLVGHDWGAIIGWFLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             + +K FV +SVP+ PR+P++KPV+  RA FGDDYY+CRFQE G+I+   A      +LR 
Sbjct  120   EKIKGFVCLSVPYIPRNPSVKPVQWFRAVFGDDYYVCRFQEPGKIDGQFARADLRSLLRN  179

Query  800   IFTDRKAGPPCLPKENPFG----ISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             IFT R  GP  LPK NPFG     + +  + P+W S++DL +YASK+D   FTGGLNYYR
Sbjct  180   IFTGRPLGPSILPKNNPFGENPNPTCENIEFPTWFSKKDLDFYASKFDKTRFTGGLNYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +I+L+WELTA WTG +++VP+KFM GD DMVYTTPGIKEY+HGGGF   VP L+EIVV E
Sbjct  240   AIDLSWELTAPWTGAKIQVPMKFMTGDFDMVYTTPGIKEYIHGGGFAAAVPNLQEIVVTE  299

Query  452   GGGHFLNQERPEEV  411
               GHF+NQE+ +EV
Sbjct  300   DAGHFVNQEKHQEV  313



>ref|XP_011010961.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   399 bits (1024),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 227/306 (74%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEH+TV  NGINMH+A  G GPVILFLHGFPELWY+WRHQL   + +GYR +APDLR
Sbjct  1     MDKIEHRTVATNGINMHIASTGTGPVILFLHGFPELWYSWRHQLLSLSSVGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    S YT LH+VGDL+ L+ SLG+D VFLV HDWGA+I WYFC FRPD VK
Sbjct  61    GYGDTDAPR-SVSEYTGLHLVGDLIGLLDSLGIDMVFLVGHDWGAMIAWYFCTFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SVPF PR+P    ++  RA FGD+YY  RFQE G  E D A   +++++ K FT+
Sbjct  120   ALVNTSVPFLPRNPQGNLLQWFRALFGDNYYFLRFQEPGEAEDDFAQVDTKRLMIKFFTN  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
                 PP +PK        D P LPSWLSE+D+ YYA K++L GFTGGLNYYR+  + WEL
Sbjct  180   FGPNPPLMPKGIGVKAFPDPPSLPSWLSEEDINYYAEKFNLTGFTGGLNYYRATAITWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              A WTG  + VP KF+VGD+D++Y  PG+K+++H GGFKKDVPLLEE+VV+EG  HFL Q
Sbjct  240   MAPWTGSPITVPAKFIVGDLDLLYNIPGLKDFIHNGGFKKDVPLLEEVVVMEGVAHFLQQ  299

Query  428   ERPEEV  411
             E+PEEV
Sbjct  300   EKPEEV  305



>ref|XP_009629123.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 237/308 (77%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+HK V +NGINMHVAE G+GP ++F+HGFPELWY+WRHQ+ + +  GYRA+APDLR
Sbjct  1     MEKIQHKNVSINGINMHVAEIGEGPAVVFVHGFPELWYSWRHQMLYLSNKGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TD+P    ++YT  H+VGDLVAL+  LG+D+V+LV HDWGA+I WYF +FRPD +K
Sbjct  61    GYGDTDSPP-DATNYTVFHIVGDLVALLDVLGLDQVYLVGHDWGALIAWYFSLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FRPRHP+ KPV+++R  FGDDYY+CRFQ+ G +E + A   +  V++   + 
Sbjct  120   ALVNLSVVFRPRHPSRKPVDSLRELFGDDYYMCRFQKPGEVEEEFASVDTATVIKGFLSS  179

Query  788   RKAGPPCLPKENPF--GISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             R   PPC+PKE  F   ++     LPSW++E+D+ Y+A K    GFTGGLNYYR+++ NW
Sbjct  180   RDPRPPCIPKEIGFHQALAKSPATLPSWITEEDVHYFAEKLKKTGFTGGLNYYRNLDKNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA ++G +++VP KF+VGD+D  Y  PG KEY+H GGFKK+VP L+E+VV+EG GHF+
Sbjct  240   ELTAPFSGCKIQVPTKFVVGDLDATYHVPGTKEYIHNGGFKKEVPNLQEVVVMEGAGHFI  299

Query  434   NQERPEEV  411
             NQE+P E+
Sbjct  300   NQEKPAEI  307



>ref|XP_006600362.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Glycine 
max]
 ref|XP_006600363.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Glycine 
max]
Length=354

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/344 (56%), Positives = 246/344 (72%), Gaps = 39/344 (11%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+T+ VNGINMH+AEKG+GP+ILF+HGFP+LWY+WRHQ+   A LGYR VAPDLR
Sbjct  1     MEGIEHQTLNVNGINMHIAEKGEGPLILFIHGFPDLWYSWRHQITALASLGYRCVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             GYG+TD P+  P++YT LHVVGDLV L+ ++  D  KVF+V HDWGA+  W   ++RP+ 
Sbjct  61    GYGDTDVPA-NPTAYTSLHVVGDLVGLLDAIVGDEEKVFVVGHDWGAMTAWSLSLYRPER  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRF-----------------------  864
             ++A V++SV F PR+P  KP++ +RA +G+DYYICRF                       
Sbjct  120   IRALVNLSVVFTPRNPKRKPLDTLRAVYGNDYYICRFQVSKHGLSRSDEKKMLFSRGKPW  179

Query  863   ------------QEEGRIESDIAIHGSEKVLRKIFTDRKAGPPCLPKENPFGISTDQP-K  723
                         QE G IE++ A  G+ +VL++  T R  GP  LPK   F   TD P  
Sbjct  180   FAKWLCCSSALLQEPGEIEAEFAQIGTARVLKEFLTYRNPGPLYLPKGKAFAHPTDSPIA  239

Query  722   LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELTAAWTGIEVKVPVKFMVGDMDM  543
             LPSWLSE++  YYASKYD  GFTGGLNYYR+++LNWELTA+WTG +VKVPVKF+VGD+D+
Sbjct  240   LPSWLSEEECDYYASKYDKTGFTGGLNYYRNLDLNWELTASWTGAQVKVPVKFIVGDLDL  299

Query  542   VYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQERPEEV  411
              Y  PG KEY+H GGFK+DVPLLE++VV+EG GHFL+QERP+E+
Sbjct  300   TYNAPGAKEYIHKGGFKRDVPLLEDVVVLEGAGHFLHQERPDEI  343



>ref|XP_011010960.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 226/306 (74%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEH+TV  NGINMH+A  G GPVILFLHGFPELWY+WRHQL   + +GYR +APDLR
Sbjct  1     MDKIEHRTVATNGINMHIASTGTGPVILFLHGFPELWYSWRHQLLSLSSVGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    S YT LH+VGDL+ L+ SLG+D VFLV HDWGA+I WYFC FRPD VK
Sbjct  61    GYGDTDAPR-SVSEYTGLHLVGDLIGLLDSLGIDMVFLVGHDWGAMIAWYFCTFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SVPF PR+P    ++  RA  GDDYY  RFQE G  E D A   +++++ K FT+
Sbjct  120   ALVNTSVPFLPRNPQGNLLQWFRALLGDDYYFLRFQEPGEAEDDFAQVDTKRLMIKFFTN  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
                 PP +PK        D P LPSWLSE+D+ YYA K++L GFTGGLNYYR+  + WEL
Sbjct  180   FGPNPPLMPKGIGVKAFPDPPSLPSWLSEEDINYYAEKFNLTGFTGGLNYYRATAITWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              A WTG  + VP KF+VGD+D++Y  PG+K+++H GGFKKDVPLLEE+VV+EG  HFL Q
Sbjct  240   MAPWTGSPITVPAKFIVGDLDLLYNIPGLKDFIHNGGFKKDVPLLEEVVVMEGVAHFLQQ  299

Query  428   ERPEEV  411
             E+PEEV
Sbjct  300   EKPEEV  305



>gb|KHN03961.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 238/310 (77%), Gaps = 7/310 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TV+VNGI MH+AEKG+GPV+LFLHGFPELW+ W +Q+     LGY AVAPDLR
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWHCWHNQIVALGSLGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP     SYTC H+V DLVAL+ SLG ++VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTDAPP-SIDSYTCFHIVADLVALIDSLGAEQVFLVAHDWGAIIGWYLCMFRPDKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF  R+P ++ V+ MRA +G+DYYICRFQ+ G +E+ +A  G+E VL+ I T 
Sbjct  120   AYVCLSVPFIRRNPNVRTVDGMRAMYGEDYYICRFQKPGEMEAQMAQVGTEYVLKNILTI  179

Query  788   RKAGPPCLPKENPFGI----STDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
             RK GPP  PK   FG     +     LPSWL++ DL YY SKY+  GFTG LNYYR++NL
Sbjct  180   RKPGPPIFPK-GEFGTGLNPNMSDDTLPSWLTDDDLAYYVSKYEKSGFTGPLNYYRNMNL  238

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG++++V VK++ G++DMVYT+ G+KEYVH GGFK+DVP L ++VV +G  H
Sbjct  239   NWELTAPWTGVQIQVAVKYITGELDMVYTSLGMKEYVHSGGFKQDVPNL-QVVVQKGVAH  297

Query  440   FLNQERPEEV  411
             F N E  EE+
Sbjct  298   FNNLEAAEEI  307



>gb|AFK46740.1| unknown [Lotus japonicus]
Length=323

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 242/313 (77%), Gaps = 8/313 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H+TV+VNGI MH+AEKG+GPV+LFLHGFPELWY+WRHQ+   +  GYRAVAPDLR
Sbjct  1     MESIKHRTVQVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILALSSQGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP    +SY C ++VGD+VAL+ SLGVD+VFLV HDWGAIIGWY C+FRPD +K
Sbjct  61    GYGDTEAPP-SVTSYNCFNIVGDIVALIDSLGVDQVFLVGHDWGAIIGWYVCLFRPDKIK  119

Query  968   AFVDISVPF----RPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             A+V +SV +    R     +K V+A RA +GDD+Y+CRFQE G++E++IA  G+E + + 
Sbjct  120   AYVCLSVAYRSFVRSADSQVKIVDAFRALYGDDFYVCRFQEPGKMEAEIAEVGTEYMHKN  179

Query  800   IFTDRKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
             I T RK GPP  PK E   G + D P+ LPSWLS+QDL YY S+++  GF+G LNYYR++
Sbjct  180   ILTMRKTGPPIFPKGEFGTGFNPDMPENLPSWLSQQDLDYYVSQFNKTGFSGALNYYRNL  239

Query  626   NLNWELTAAWTGIEV-KVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEG  450
             NLNWELTA WTG+ +  VPVKF+VGD+D+ Y   G+KEY+H GGFKKDVP LEE+VV EG
Sbjct  240   NLNWELTAPWTGVPITNVPVKFIVGDVDIAYNFSGMKEYIHNGGFKKDVPGLEEVVVQEG  299

Query  449   GGHFLNQERPEEV  411
               HF NQE  E+V
Sbjct  300   VAHFNNQEAAEDV  312



>ref|XP_010024724.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61194.1| hypothetical protein EUGRSUZ_H03958 [Eucalyptus grandis]
Length=323

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 185/312 (59%), Positives = 239/312 (77%), Gaps = 6/312 (2%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQ--GPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAP  1158
             +MEGIEH+TV VNGI MHVA KG   GP +L LHGFPELWY+WRHQ+   A LGYRAVAP
Sbjct  2     EMEGIEHRTVAVNGITMHVAIKGPSGGPTVLLLHGFPELWYSWRHQMAGLAALGYRAVAP  61

Query  1157  DLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSL--GVDKVFLVAHDWGAIIGWYFCMFR  984
             DLRG+G+TDAP+   + YT L V GDL +L+ ++  G +KVF+V HDWGAI  W+ C+FR
Sbjct  62    DLRGFGDTDAPA-SAAGYTGLSVAGDLASLLDAVAKGEEKVFVVGHDWGAIAAWHLCLFR  120

Query  983   PDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLR  804
             PD VKA V++SVPF PRHP  KP+E++RA +G+DYYICRFQE G +E++ A  G+ +VL 
Sbjct  121   PDRVKALVNLSVPFTPRHPARKPLESLRAAYGEDYYICRFQEPGEMEAEFAQIGTRRVLE  180

Query  803   KIFTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
             +  T R  GP  LPK   FG  TD P  LPSWL+E+D+ Y+ SKY+  GFTGG NYYR++
Sbjct  181   EFLTYRNPGPLFLPKGKGFGHPTDTPIVLPSWLTEEDVDYFTSKYETTGFTGGFNYYRAL  240

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             +LNWELTA WTG +++VP KFMVGD+D+ Y +PG K+++H GG KK VP LE++VV+EG 
Sbjct  241   DLNWELTAPWTGAQIRVPAKFMVGDLDLTYNSPGTKDFIHKGGLKKYVPFLEDVVVMEGV  300

Query  446   GHFLNQERPEEV  411
              HF+++ERP+EV
Sbjct  301   AHFIHEERPQEV  312



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   417 bits (1073),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 183/307 (60%), Positives = 240/307 (78%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I H  +  NGIN+HVAE G+GP +LFLHGFPELWY+WRHQ+ F +  GYRA+APDLR
Sbjct  1     MESIRHAMIPTNGINLHVAEVGEGPAVLFLHGFPELWYSWRHQMLFLSSRGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP    + YT  H+VGDL+ L+ +LG+D+V LVAHDWGA+I WY C+ RPD +K
Sbjct  61    GYGDSDAPP-SAAEYTAFHIVGDLIGLLDALGLDRVLLVAHDWGAVIAWYLCLMRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SV + PR+PT+KP+E+MR   GDDYYIC+FQE G  E + A  G+  +L+K++T 
Sbjct  120   ALVNTSVVYSPRNPTIKPIESMRKSLGDDYYICQFQEPGVAEREFAAMGAATLLKKLYTL  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R+A PP  PK   FG   ++P  LP WLSE+D+KYYA K+D KGFTGGLNYYR+++L WE
Sbjct  180   RQAKPPRHPKGVGFGPPPEKPIVLPPWLSEEDIKYYADKFDQKGFTGGLNYYRAVDLTWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA +TG+++KVP KF+VGD+D  Y TPG+KEY+HGGGFKK VP LEE+V++EG GHFL 
Sbjct  240   LTAPFTGLQIKVPAKFIVGDLDATYNTPGVKEYIHGGGFKKQVPFLEEVVILEGVGHFLI  299

Query  431   QERPEEV  411
             +E+P+E+
Sbjct  300   EEKPDEL  306



>ref|XP_009775353.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional epoxide hydrolase 
2-like [Nicotiana sylvestris]
Length=318

 Score =   396 bits (1018),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 237/308 (77%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+HK V VNGINMHVAE G+GP ++F+HGFPELWY+WRHQ+ + +  GYRA+APDLR
Sbjct  1     MEKIQHKYVSVNGINMHVAEIGEGPAVVFVHGFPELWYSWRHQMLYLSKKGYRAMAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TD+P    + YT  H+VGDLVAL+  LG+D+VFLV HDWGA+I WYF +FRPD +K
Sbjct  61    GYGDTDSPP-DATHYTAFHIVGDLVALLDVLGLDQVFLVGHDWGALIAWYFSLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV FRPRHP+ KPV+++R  FGDDYY+CRFQ+ G +E + A   +  V++   + 
Sbjct  120   ALVNLSVVFRPRHPSRKPVDSLRELFGDDYYVCRFQKPGEVEEEFASVDTATVVKGFLSS  179

Query  788   RKAGPPCLPKENPF--GISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             R   PPC+PKE  F   ++     LPSW++E+D+ Y+A K    GFTGGLNYYR+++ NW
Sbjct  180   RDPRPPCIPKEIGFHQALAKSPATLPSWITEEDVHYFAEKLKETGFTGGLNYYRNLDKNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA ++G +++VP KF+VGD+D  Y  PG KEY+H GGFKK+VP L+E+VV+EG GHF+
Sbjct  240   ELTAPFSGCKIQVPTKFVVGDLDXTYHVPGTKEYIHNGGFKKEVPNLQEVVVMEGVGHFI  299

Query  434   NQERPEEV  411
             NQE+P+E+
Sbjct  300   NQEKPDEI  307



>ref|XP_010693594.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=362

 Score =   398 bits (1022),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 187/308 (61%), Positives = 239/308 (78%), Gaps = 7/308 (2%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQ--GPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +GI+H+++ VNGINMHV EKG    PV+LF+HGFPELWY+WRHQ+   + LGYRAVAPD+
Sbjct  48    DGIKHRSLHVNGINMHVVEKGDEGSPVVLFIHGFPELWYSWRHQILSLSALGYRAVAPDM  107

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG+T+APS     YT +H+VGDLVAL+  LGVD+VF+V HDWGA+IGW+ C+FRPD V
Sbjct  108   RGYGDTEAPS-DARKYTYVHIVGDLVALIDELGVDQVFVVGHDWGAVIGWWLCLFRPDRV  166

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIA-IHGSEKVLRKIF  795
             KAFV +SV F PR+P MK ++ + A +G DYYICRFQ  G IES+IA   G++K+LRKIF
Sbjct  167   KAFVSMSVAFSPRNPNMKLLDMLCAAYGPDYYICRFQVPGEIESEIAEAGGADKLLRKIF  226

Query  794   TDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             + R  GP  LPK   F   TD    P+WLS+++  YY  K+   GFTGGLNYYR++NLNW
Sbjct  227   SFRDPGPLMLPKGKAF---TDMASYPNWLSQEESSYYVDKFTKSGFTGGLNYYRALNLNW  283

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA WTG +V+VPVKF+VGD+D+ Y  PG+KEY++ GG KKDVPLLEE+V++EG  HFL
Sbjct  284   ELTAPWTGAQVEVPVKFVVGDLDLAYHMPGVKEYINQGGMKKDVPLLEEVVILEGVAHFL  343

Query  434   NQERPEEV  411
              QE+P+ V
Sbjct  344   QQEKPDVV  351



>gb|AFK39700.1| unknown [Lotus japonicus]
Length=322

 Score =   396 bits (1017),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 242/312 (78%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I H+TV+VNGI MHVAEKG+GPV+LFLHGFPELWY+WRHQ+   +  GYRAVAPDLR
Sbjct  1     MESIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSRGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+APS   +SYTC H+VGD++AL+ SLGVDKV+LV HDWGA++GWY C+FRPD +K
Sbjct  61    GYGDTEAPS-SVTSYTCFHLVGDIIALIDSLGVDKVYLVGHDWGAVLGWYVCLFRPDRIK  119

Query  968   AFVDISVPFR---PRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
             A+V +SVP R        +K V+  RA +GDD+Y+CRFQE G++E++ A   +  + + I
Sbjct  120   AYVCLSVPIRGFLRIDSPVKTVDGFRAVYGDDFYVCRFQEPGKMEAEFAEVDTAYLFKNI  179

Query  797   FTDRKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
              T RK GPP  PK E   G + D P+ LPSWLSE+DL+Y+ASK+   GF+GGLNYYR++N
Sbjct  180   LTMRKTGPPIFPKGEYGTGFNPDAPETLPSWLSEEDLEYFASKFKKTGFSGGLNYYRNLN  239

Query  623   LNWELTAAWTGIEV-KVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             LNWELTA WTG+ +  VPVKF+VGD+D+ Y   G+K+Y+H GGFKKDVP LEE+VV EG 
Sbjct  240   LNWELTAPWTGVGITNVPVKFIVGDVDITYNFTGMKDYIHKGGFKKDVPTLEEVVVQEGV  299

Query  446   GHFLNQERPEEV  411
              HF+NQE  E+V
Sbjct  300   AHFINQEAAEDV  311



>ref|NP_001276233.1| bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|ACU18052.1| unknown [Glycine max]
Length=318

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 238/310 (77%), Gaps = 7/310 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH+TV+VNGI MH+AEKG+GPV+LFLHGFPELW+ W +Q+     LGY AVAPDLR
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWHCWHNQIVALGSLGYHAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP     SYTC H+V DLVAL+ SLG ++VFLVAHDWGAIIGWY CMFRPD VK
Sbjct  61    GYGDTDAPP-SIDSYTCFHIVADLVALIDSLGAEQVFLVAHDWGAIIGWYLCMFRPDKVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A+V +SVPF  R+P ++ V+ MRA +G+DYYICRFQ+ G +E+ +A  G+E VL+ I T 
Sbjct  120   AYVCLSVPFIRRNPNVRTVDGMRAMYGEDYYICRFQKPGEMEAQMAQVGTEYVLKNILTI  179

Query  788   RKAGPPCLPKENPFGI----STDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
             RK GPP  PK   FG     +     LPSWL++ DL YY SKY+  GFTG LNYYR++NL
Sbjct  180   RKPGPPIFPK-GEFGTGLNPNMSDDTLPSWLTDDDLAYYVSKYEKSGFTGPLNYYRNMNL  238

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG++++V VK++ G++DMVYT+ G+KEYVH GGFK+DVP L ++VV +G  H
Sbjct  239   NWELTAPWTGVQIQVVVKYITGELDMVYTSLGMKEYVHSGGFKQDVPNL-QVVVQKGVTH  297

Query  440   FLNQERPEEV  411
             F N E  EE+
Sbjct  298   FNNLEAAEEI  307



>gb|KDO87161.1| hypothetical protein CISIN_1g048209mg, partial [Citrus sinensis]
Length=349

 Score =   397 bits (1019),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 234/320 (73%), Gaps = 15/320 (5%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH TV  NGINMHVA  G GPV+LF+HGFPELWY+WR+QL + +  GYRA+APDLR
Sbjct  20    MEKIEHTTVGTNGINMHVASIGTGPVVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  79

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    +SYT LH+VGDL+ L+  LG+ +VFLV HDWGA+I WYFC+FRPD VK
Sbjct  80    GYGDTDAPP-SVTSYTALHLVGDLIGLLDKLGIHQVFLVGHDWGALIAWYFCLFRPDRVK  138

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SVPF PR+P ++P+   RA +GDDYYICRFQE G IE + A   + ++++K    
Sbjct  139   ALVNMSVPFPPRNPAVRPLNNFRAVYGDDYYICRFQEPGEIEEEFAQIDTARLMKKFLCL  198

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL----  621
             R A P C+PK+       D   LPSWLSE+D+ YYASK++ KGFTG +NYYR  +L    
Sbjct  199   RIAKPLCIPKDTGLSTVPDPSALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCSDLYVPK  258

Query  620   ----------NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLE  471
                       NWEL A WTG++++VPVKF+VGD D+VY   G+KEY+H GGFKK VP L+
Sbjct  259   TYTMAIIIKENWELMAPWTGVQIEVPVKFIVGDQDLVYNNKGMKEYIHDGGFKKYVPYLQ  318

Query  470   EIVVIEGGGHFLNQERPEEV  411
             E+VV+EG  HF+NQE+ EEV
Sbjct  319   EVVVMEGVAHFINQEKAEEV  338



>ref|XP_004508197.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=357

 Score =   395 bits (1016),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/312 (59%), Positives = 241/312 (77%), Gaps = 6/312 (2%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAP  1158
             + E ++HKTV VNGIN+H+AEKG  Q P+ILF+HGFP+LWY+WRHQ+   A LGYR +AP
Sbjct  36    EFEELQHKTVIVNGINIHIAEKGTSQSPLILFIHGFPDLWYSWRHQITALASLGYRCIAP  95

Query  1157  DLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFR  984
             DLRG+G+TD P+  P+SYT LHVVGDL+ ++ ++    DKVF+V HDWGA+I W  C++R
Sbjct  96    DLRGFGDTDVPA-SPTSYTSLHVVGDLIGVLDAVAGDEDKVFVVGHDWGAMIAWSLCLYR  154

Query  983   PDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLR  804
             P+ +KA V++SV F PR+P  KP+E +RA +G+DYYI RFQE G IE++ A  G+ +VL+
Sbjct  155   PERIKAVVNLSVSFTPRNPKRKPLETLRAVYGNDYYISRFQEPGDIEAEFAEIGTARVLK  214

Query  803   KIFTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
             +  T R  GP  LPK   FG   D P  LPSWLSE++  YYASKYD  GFTGGLNYYR++
Sbjct  215   EFLTYRNPGPLYLPKGKGFGHPIDSPIVLPSWLSEEECNYYASKYDKTGFTGGLNYYRNL  274

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             +LNWELTA W+G ++KVPVKF+VGD D+ Y  PG K+Y+  GG K+DVPLLE++VVIEG 
Sbjct  275   DLNWELTAPWSGAKIKVPVKFIVGDQDLTYNAPGAKDYILKGGMKRDVPLLEDVVVIEGA  334

Query  446   GHFLNQERPEEV  411
             GHF++QERP+E+
Sbjct  335   GHFIHQERPDEI  346



>ref|XP_004298141.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   394 bits (1012),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 240/311 (77%), Gaps = 6/311 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEG+EH+TV+VNGINMHVAEKGQG V+L +HGFPELWY+WRHQ+Q  A LGYRAVAPDLR
Sbjct  1     MEGVEHRTVRVNGINMHVAEKGQGQVVLLIHGFPELWYSWRHQIQSLASLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+TDAP+   SSYTC HVVGDL+AL+ ++  D  KVF+V HDWGA+I WY C+FRPD 
Sbjct  61    GFGDTDAPA-DASSYTCFHVVGDLIALLDTVAGDQKKVFVVGHDWGALIAWYLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQE--EGRIESDIAIHGSEKVLRK  801
             VKA V++SV + PR+P  K +E+M+A +G+DY+ C+F E   G IE++ A  G+ +V+R+
Sbjct  120   VKALVNLSVQYFPRNPQRKILESMKAAYGEDYHFCKFSEFLPGEIEAEFAQIGTARVIRE  179

Query  800   IFTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
               T R  GP  LPK   FG  +D P  LPSWLSE D+ YY  K++ KGFTGG+NYYR+ +
Sbjct  180   FLTYRHPGPLFLPKGKGFGHPSDSPIALPSWLSEADVNYYVGKFEKKGFTGGINYYRNSD  239

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
              NWEL A WTG +VKVPVK++VGD D+VY + G K+Y+H G FKK VP LEE+V++EG  
Sbjct  240   RNWELLAPWTGAQVKVPVKYIVGDQDLVYNSLGAKDYIHNGEFKKYVPFLEEVVIMEGVA  299

Query  443   HFLNQERPEEV  411
             HF+NQE+ +E+
Sbjct  300   HFINQEKGDEI  310



>ref|XP_007015342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32961.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   394 bits (1012),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 240/309 (78%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI+HKTV+VNGINMH+AEKG+GPVILFLHGFPELWY+WRHQ+   A LGYRA+APDLR
Sbjct  1     MEGIQHKTVRVNGINMHLAEKGEGPVILFLHGFPELWYSWRHQINGLASLGYRALAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPDL  975
             GYGETDAP+   +SYTCLHVVGDL+AL+ ++  D  KVF+V HDWGAII WY C+FRPD 
Sbjct  61    GYGETDAPA-SIASYTCLHVVGDLIALLDAVAPDQEKVFVVGHDWGAIIAWYMCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA  ++SVPF P +P  KPVE  +A+FG+D+YI RFQE G IE++    G  + + ++ 
Sbjct  120   VKALFNLSVPFIPYNPRFKPVETWKAYFGNDHYIVRFQEPGVIEAEFEEIGLGRAVLELL  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             + R   P  LPK N FG   D P  LP WLS QD  YYA++++  G T  LNYYR+ + N
Sbjct  180   SYRVPDPLYLPKGNLFGHPLDGPVDLPPWLSHQDANYYATQFEKTGITPALNYYRNFDRN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL+A W+G ++KVPVKF++GD+D+VYT PG+KEY+H GGFK+DVP LEE VV++G  H+
Sbjct  240   WELSAPWSGSQIKVPVKFVMGDLDLVYTMPGMKEYIHNGGFKRDVPFLEEAVVMKGVTHW  299

Query  437   LNQERPEEV  411
             +NQE+P+++
Sbjct  300   INQEKPDDI  308



>ref|XP_008789846.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   393 bits (1010),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/307 (60%), Positives = 243/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGI H+TV VNGINMH+AEKG+GP++LF+HGFPELWY+WRHQ+   AG GYRAVAPDLR
Sbjct  1     MEGITHRTVAVNGINMHIAEKGEGPMVLFVHGFPELWYSWRHQMVALAGRGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP    + YT  H+VGDLVAL+ +L +D+VF+V HDWGA++ W+ CM RPD V+
Sbjct  61    GYGDTDAPP-SATDYTIFHLVGDLVALLDALALDQVFVVGHDWGAVVAWWLCMLRPDRVR  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P  +PV+++RA FGDD+YICRFQE G +E++ A   +  +L+K    
Sbjct  120   ALVNMSVAFSPRNPARRPVDSLRALFGDDHYICRFQEPGAVEAEFARISTALLLKKFLAY  179

Query  788   RKAGPPCLPKENPFGISTD-QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             RK     + KE  FG S D +  LPSWL+E+D+ YY SK++  GFTGGLNYYR +NLNWE
Sbjct  180   RKPEALLVSKEKGFGGSPDTEITLPSWLTEEDVNYYTSKFEKSGFTGGLNYYRCLNLNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG+++KVPVKF+VGD+D+ Y TPGI++Y+H GGFK+DVP L ++VV++G GHFLN
Sbjct  240   LTAPWTGVQIKVPVKFIVGDLDLTYHTPGIQDYLHKGGFKRDVPFLHDVVVMQGVGHFLN  299

Query  431   QERPEEV  411
             QE+P E+
Sbjct  300   QEKPHEI  306



>gb|EYU43974.1| hypothetical protein MIMGU_mgv1a009814mg [Erythranthe guttata]
Length=331

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 236/313 (75%), Gaps = 9/313 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH+++ +NG+ MHVAE G+GP+ILFLHGFPE WYTWRHQ+ FFA  GYRAVAPDLR
Sbjct  1     MEEIEHRSLSINGLTMHVAEAGRGPIILFLHGFPECWYTWRHQMVFFASRGYRAVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD------KVFLVAHDWGAIIGWYFCM  990
             G+ +T  AP+  PS +T LHV GDLVAL+ ++         KVF+V HDWGA++ W  C+
Sbjct  61    GFADTTGAPASDPSKFTTLHVAGDLVALIDAVAAAPADDGGKVFVVGHDWGAVMAWALCL  120

Query  989   FRPDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKV  810
             +RPD VKA V++SVPF  R+P  KP+E +R+ +G++YYICRFQE G+IE + +  G++ V
Sbjct  121   YRPDKVKALVNLSVPFSRRNPNRKPIETLRSVYGNEYYICRFQEPGKIEQEFSQIGTKNV  180

Query  809   LRKIFTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRS  630
             L+   T R  GP  LPK   F  S  +  LP WLS++D+ YYASKYD  GFTG LNYYR+
Sbjct  181   LKNFLTYRNPGPLHLPKSKAF--SDTETSLPPWLSDEDVNYYASKYDATGFTGALNYYRA  238

Query  629   INLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEG  450
             +++NWELT AW+  E+KV VKFMVGD+D+ Y +PG KEY+H GGFKKDVPLL+E+VV++ 
Sbjct  239   LDINWELTGAWSRGEIKVAVKFMVGDLDLTYNSPGTKEYIHNGGFKKDVPLLKEVVVMKD  298

Query  449   GGHFLNQERPEEV  411
               HF++QE+P+EV
Sbjct  299   VAHFIHQEKPDEV  311



>ref|XP_011091000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=327

 Score =   392 bits (1008),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/311 (59%), Positives = 236/311 (76%), Gaps = 8/311 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M G+EHKT+ +NGI+MHVAE G GP+ILFLHGFP+ WYTWRHQ+ FFA  GYRA+APDLR
Sbjct  1     MVGVEHKTLSLNGISMHVAEMGHGPIILFLHGFPQCWYTWRHQITFFATHGYRALAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGV---DKVFLVAHDWGAIIGWYFCMFRP  981
             GY +T   P   P+ +T LHVVGD+VAL+ +L      KV +V HDWGA++ W  C++RP
Sbjct  61    GYADTTGVPPSDPAKFTTLHVVGDIVALIDALAPPNDQKVLVVGHDWGALVAWALCLYRP  120

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D VKA V++SV F  R+P+ KP+E +RA +GDDYYICRFQE G IE + A  G++ VL+ 
Sbjct  121   DKVKALVNMSVVFTRRNPSRKPLEMLRAVYGDDYYICRFQEPGAIEHEFAQIGTKTVLKH  180

Query  800   IFTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
               T R  GP  +PK  PF    D P  LP WLSE+D+ YY SKY+L GFT  LNYYR+++
Sbjct  181   FLTYRTPGPLNIPKGKPF---PDTPISLPPWLSEEDVDYYTSKYNLTGFTAALNYYRALD  237

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
             +NWELTAAWTG ++ VPVKF+VGD+D+ Y  PG KEY+H GGFK+DVPLL+E+VV+EG G
Sbjct  238   INWELTAAWTGAQITVPVKFIVGDVDLTYNAPGCKEYIHKGGFKRDVPLLKEVVVMEGVG  297

Query  443   HFLNQERPEEV  411
             HF+++E+P++V
Sbjct  298   HFIHEEKPDDV  308



>ref|XP_008454322.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Cucumis 
melo]
Length=316

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 229/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ I+H T+K NGI MH+A  G GPV+L LHGFPELWY+WRHQL + + +GYRA+APDLR
Sbjct  1     MDAIQHTTIKTNGIKMHIASVGNGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TD+P    +SYT LH+VGDLV  +  LG++KVFLV HDWGAII WYFC+FRP+ +K
Sbjct  61    GYGDTDSPESH-TSYTALHIVGDLVGALDELGIEKVFLVGHDWGAIIAWYFCLFRPERIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P +  ++  RA +GDD+Y+CRFQ  G  E+D A   + ++ +   ++
Sbjct  120   ALVNLSVQFFPRNPAISFIQRFRAAYGDDFYMCRFQVPGEAEADFACIDTAQLFKTTLSN  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R    PCLPKE  F        LPSWL+E+D+ YYA+K+   GFTG LNYYR+ +L WEL
Sbjct  180   RSTKAPCLPKEYGFRAIPPPENLPSWLTEEDINYYAAKFKETGFTGALNYYRAFDLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG++++VPVKF+VGD D+ Y   G KEY+H GGFK+DVPLLEE+V++E  GHF+++
Sbjct  240   TAPWTGVQIQVPVKFIVGDSDLTYHFKGAKEYIHEGGFKRDVPLLEEVVIVENAGHFVHE  299

Query  428   ERPEEV  411
             E+P E+
Sbjct  300   EKPHEI  305



>gb|EPS62395.1| hypothetical protein M569_12392 [Genlisea aurea]
Length=318

 Score =   391 bits (1005),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 184/308 (60%), Positives = 225/308 (73%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I H T+  NGIN+HVAE G GP +LFLHGFP LWYTWRHQ+ F +  GYRA+APDLR
Sbjct  1     MESIRHSTIPTNGINLHVAEIGDGPAVLFLHGFPGLWYTWRHQMLFLSSKGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG +D P   PSSYT  HVVGDLV L+  LGVDKVFLV HDWG+I+ WYF +FRPD VK
Sbjct  61    GYGGSDVPP-SPSSYTIFHVVGDLVGLLDGLGVDKVFLVGHDWGSIVAWYFSLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V  S+ F+PRHP ++ V+ +R   GDD+YI +FQE G  E++ A   + K+L KIFT 
Sbjct  120   ALVSTSIEFKPRHPAVRTVDFLRQKLGDDFYIVKFQEPGLAEAEFAAADTSKLLTKIFTS  179

Query  788   RKAGPPCLPKENP-FGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             R   PP   K +  FG   + P  LP WLSE D+KYYA  +D  GFTGGLN++R+++LNW
Sbjct  180   RDPNPPRRSKGSAGFGTLPEDPIPLPPWLSEDDVKYYADAFDKTGFTGGLNHFRALDLNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELT  WT  EV VP K +VGD+D+ Y TPG+KEYVHGGGFK+DVPLL E+VV++G  HFL
Sbjct  240   ELTGPWTAAEVGVPAKLIVGDLDISYNTPGVKEYVHGGGFKRDVPLLHEVVVLDGVAHFL  299

Query  434   NQERPEEV  411
             N+E P EV
Sbjct  300   NEESPHEV  307



>ref|XP_004239805.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   391 bits (1004),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 233/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK V VNG+NMH+AE GQGP ILF+HGFPELWY+WRHQ+ + A  GY AVAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYCAVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS +T  H+VGDLVAL++++    DKVF+VAHDWGA I W+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFTIFHLVGDLVALLEAIAPNEDKVFVVAHDWGAFIAWHLCLFRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV + PR+  M PVE ++A +G+DYYICRFQEEG IE++ A  G++ VL+K+
Sbjct  121   KVKALVNLSVHYLPRNSNMNPVEGLKALYGEDYYICRFQEEGDIEAEFAPIGAKSVLKKM  180

Query  797   FTDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P C PK        D P  L +WLSE++L YYA+K++  GFTG LNYYR++++
Sbjct  181   LTYRDPAPFCFPKGKGLEAIADAPSDLSTWLSEEELDYYANKFEHTGFTGALNYYRALSM  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             N ELTA WTG +V VP KF+VG+ D+VY   G KEY+H GGFKK VPLLEE+VV+EG  H
Sbjct  241   NAELTAPWTGAQVNVPTKFIVGEFDLVYHMRGAKEYIHNGGFKKYVPLLEEVVVLEGAAH  300

Query  440   FLNQERPEEV  411
             F+NQERP E+
Sbjct  301   FVNQERPHEI  310



>ref|XP_010038231.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50055.1| hypothetical protein EUGRSUZ_K03496 [Eucalyptus grandis]
Length=322

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/312 (59%), Positives = 229/312 (73%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAE-----KGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAV  1164
             ME IEH TV  NGINMHVA         G  +LFLHGFP+LWYTWR Q+   A LGYRAV
Sbjct  1     METIEHATVPTNGINMHVASVGGDGGAGGDTVLFLHGFPDLWYTWRRQMLSLAALGYRAV  60

Query  1163  APDLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFR  984
             APDLRGYG+TDAP    +SYT  H+VGDLV L+ +LGV++VFLV HDWGA++ WYFC+ R
Sbjct  61    APDLRGYGDTDAPP-SAASYTAFHIVGDLVGLLDALGVERVFLVGHDWGAVMAWYFCLLR  119

Query  983   PDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLR  804
             PD VKA V+ SV F P     KPV+++RA FGDDYYICRFQE G  E D A     K+++
Sbjct  120   PDRVKALVNTSVAFLPGSRKRKPVDSLRALFGDDYYICRFQEPGEAEEDFARADITKLMK  179

Query  803   KIFTDRKAGPPCLPKE-NPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
                T R   PPC+PKE    G+++ + KLP WLSE+D+ +YASK+  KGFTGGLNYYR++
Sbjct  180   LFLTCRSPKPPCIPKEIGCSGLASSRDKLPPWLSEEDINFYASKFSQKGFTGGLNYYRAM  239

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             NL W+L A WTG+++KVPVKF+VGD+D+ Y  PG K+++H GG KK VP L+E+VV+EG 
Sbjct  240   NLTWKLAAPWTGVQIKVPVKFIVGDLDITYHVPGAKQHIHNGGLKKLVPFLQEVVVMEGV  299

Query  446   GHFLNQERPEEV  411
              HFL QE+PEEV
Sbjct  300   AHFLQQEKPEEV  311



>ref|XP_006349824.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Solanum 
tuberosum]
Length=323

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 236/306 (77%), Gaps = 7/306 (2%)
 Frame = -3

Query  1316  EHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGYGE  1137
             +HK V+VNGINMHV EKGQGP +LF+HGFPELWY+WRHQ+ F A  GYRAVAPDLRGYG+
Sbjct  7     DHKIVEVNGINMHVVEKGQGPFVLFIHGFPELWYSWRHQIIFMAKHGYRAVAPDLRGYGD  66

Query  1136  TDA-PSLQPSSYTCLHVVGDLVALVQSL--GVDKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             T   P   PS ++ L VVGDLV L+ ++    DKVF+V HDWGA+I W  C+ RPD VKA
Sbjct  67    TTGVPKDDPSKFSSLRVVGDLVELLNTIVPEEDKVFVVGHDWGALIAWNLCLLRPDKVKA  126

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V++SVPF PR+P  KP+E+++A +GDDYYI RFQE G +E++ A  G++KVL    T R
Sbjct  127   LVNMSVPFSPRNPKRKPIESLKAIYGDDYYIVRFQEPGVMEAEFAKTGTKKVLENYLTYR  186

Query  785   KAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
               GP  LPK  PF    D P  LPSWLS++++ Y+ASKY+  GFTGG NYYR+++LNWEL
Sbjct  187   NPGPLYLPKGKPF---DDSPVILPSWLSQKEVDYFASKYEQTGFTGGFNYYRALDLNWEL  243

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TAAW+G +VKVPVKF+VGD+D+ Y TPG K+Y++ GG KKDVPLLE++V++E  GHFL Q
Sbjct  244   TAAWSGAKVKVPVKFIVGDLDLTYNTPGAKDYINKGGMKKDVPLLEKVVILENVGHFLQQ  303

Query  428   ERPEEV  411
             E+P+E+
Sbjct  304   EKPDEI  309



>ref|XP_004494577.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=347

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/311 (59%), Positives = 240/311 (77%), Gaps = 6/311 (2%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG-QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             ++EGIEH+T+K NGI +H+AEKG +GPV+LFLHGFPELWYTWRHQ+      GYRAVAPD
Sbjct  28    ELEGIEHRTIKANGIKIHIAEKGKEGPVVLFLHGFPELWYTWRHQIAALGSRGYRAVAPD  87

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDL  975
             LRGYG+TDAP    S+YT +H+V D+V ++ +LGVDKVFLV HDWGA +GW+ C+F P+ 
Sbjct  88    LRGYGDTDAPG-SISNYTIIHLVNDIVGVIDALGVDKVFLVGHDWGAGVGWHLCLFHPER  146

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA+V +SVP+ PR+P +KP++A RA +GDDYY+CRFQ+ G+ E++ A  G+E V++ + 
Sbjct  147   VKAYVALSVPYAPRNPKVKPLDAARALYGDDYYMCRFQQPGKAEAEFAKVGTEMVVKVLL  206

Query  794   TDRKAGPPCLPKENPFGISTDQ---PKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
             T R +GP  LPK    G + D    P LPSWLS++D+ YY SK    GFTGGLNYYR++N
Sbjct  207   TGRTSGPLILPKGG-LGSNVDPSHPPPLPSWLSQKDVSYYVSKLKKSGFTGGLNYYRNLN  265

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
              NWELTAAWTG +VKVPVKF+ GD+D++Y + G KEY+HGGGFK+ VP L+E+V+ +G  
Sbjct  266   TNWELTAAWTGAKVKVPVKFITGDLDVIYNSSGNKEYIHGGGFKRYVPNLKEVVIKKGVA  325

Query  443   HFLNQERPEEV  411
             HF+ QE  E V
Sbjct  326   HFIQQEAAEFV  336



>ref|XP_006419517.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
 gb|ESR32757.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
Length=319

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 239/309 (77%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+GI+H+ VKVNGINMH+AEKGQGPVILFLHGFPELWY+WRHQ+   A LGYRAVAPDLR
Sbjct  1     MDGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGV--DKVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+TDAP  + +SYTC HV+GDLV L+ ++    +KVF+V HDWGA++ W+ C+FRPD 
Sbjct  61    GFGDTDAPP-EVTSYTCFHVIGDLVGLIDTVAPSDEKVFVVGHDWGALMAWFLCLFRPDR  119

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             +KA V++SV F P       +EA+RA++GD+YY+CRFQ+ G IE++ A  G+E V+++ F
Sbjct  120   IKALVNLSVVFNPFGSNDNLIEALRAYYGDNYYMCRFQKPGEIEAEFAQIGTETVIKEFF  179

Query  794   TDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T        LPK   FG   + P  LPSWLSE+D+KY+ +K+D KGFTG +NYYR+INLN
Sbjct  180   TFWTGDRIFLPKGKGFGRPPNTPIALPSWLSEEDVKYFTTKFDKKGFTGAMNYYRNINLN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
              EL A W G ++++P KF++GD+DM Y  PG++EY+H GGFK+DVPLLE++V++EG GHF
Sbjct  240   HELLAPWAGSQIQIPTKFIIGDLDMTYHMPGVQEYIHKGGFKRDVPLLEKVVIMEGVGHF  299

Query  437   LNQERPEEV  411
             +NQ +  E+
Sbjct  300   INQGKSNEI  308



>ref|XP_010102979.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB94546.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   389 bits (1000),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 225/306 (74%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEH T+  NGIN+HVA  G GP ILFLHGFPELW++WRHQ+   + LGYR +APDLR
Sbjct  1     MDKIEHSTITTNGINIHVASIGTGPAILFLHGFPELWHSWRHQMLSLSALGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   P+SY+  H+VGDLV L+  L +DKVFLV HDWGA + W+FC+FRPD +K
Sbjct  61    GYGDSDAPP-SPASYSVHHIVGDLVGLLDHLSLDKVFLVGHDWGAYMAWFFCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P +  V+  RAFFGDD+Y CRFQE G IE D A   +  VL+K++T 
Sbjct  120   AVVNLSVAFMPRNPRINLVDGFRAFFGDDFYFCRFQEPGEIEKDFASDDTATVLKKLYTS  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
               A    +PKE  F        LPSWLSE+D+ Y ASK++ KGFTGGLNYYR+ NL WEL
Sbjct  180   FGATHLFIPKELGFKGLKAPDTLPSWLSEEDINYSASKFEQKGFTGGLNYYRAANLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
              A WTG +VKVP KF+VGD D  Y  PG+K+Y+  GGFKKDVP LEE+V++EG  HF+NQ
Sbjct  240   LAPWTGAQVKVPAKFIVGDEDTTYHFPGVKQYIESGGFKKDVPSLEEVVIVEGVAHFINQ  299

Query  428   ERPEEV  411
              +PEE+
Sbjct  300   AKPEEI  305



>ref|XP_011006451.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=322

 Score =   389 bits (1000),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/312 (60%), Positives = 238/312 (76%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             M+ IEH+T+  NGI MHVA KG    PVILFLHGFPE WY+WR+Q+   + LGYR+VAPD
Sbjct  1     MDSIEHRTIHANGITMHVAIKGSENAPVILFLHGFPESWYSWRYQILALSSLGYRSVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG+TDAP+ + +SYTC H+VGDL+ L+  +    DKVF+VAHDWGA+I WY C+FRP
Sbjct  61    LRGYGDTDAPA-EITSYTCFHLVGDLIGLLDVVAPNEDKVFVVAHDWGAVIAWYMCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D VKA V+ SV F PR+P  K VE +RA +GDDYY+CRFQE G IE++ A  G+E+VL++
Sbjct  120   DRVKALVNTSVLFIPRNPERKFVETLRALYGDDYYMCRFQEPGVIEAEYAERGTERVLKE  179

Query  800   IFTDRKAGPPCLPKENPF-GISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
             + T R AGP  LPK     G   D P  LPSWLSE+D KYY +K++ KGFTGGLNYYR++
Sbjct  180   LLTYRVAGPLFLPKGKGLNGTPLDAPIVLPSWLSEEDFKYYTNKFEQKGFTGGLNYYRNL  239

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             + NWELTA WTG +V VPVKF+VGD D+ Y + G K+Y+  GGFK+DVP LEE+VV+EG 
Sbjct  240   DRNWELTAPWTGAQVTVPVKFIVGDEDLTYNSLGGKDYIDSGGFKRDVPFLEELVVMEGV  299

Query  446   GHFLNQERPEEV  411
             GHFLNQE+ +E+
Sbjct  300   GHFLNQEKADEI  311



>ref|XP_006299523.1| hypothetical protein CARUB_v10015695mg [Capsella rubella]
 gb|EOA32421.1| hypothetical protein CARUB_v10015695mg [Capsella rubella]
Length=331

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 239/314 (76%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             MEGI+H+ V VNGI +H+AEKG  +GPV+L LHGFP+LWYTWRHQ+   + LGYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITLHIAEKGPKEGPVVLLLHGFPDLWYTWRHQITGLSSLGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             LRG G++D+P    S YT L VVGDL+AL+ S+  D  KVFLV HDWGAI+GW+ C+FRP
Sbjct  61    LRGCGDSDSPE-SFSDYTYLKVVGDLIALLDSVAGDQEKVFLVGHDWGAIMGWFLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             + +K FV +SVP+ PR+P++KPV+ ++A FGDDYY+CRFQE G+IE + A      +L  
Sbjct  120   EKIKGFVCLSVPYIPRNPSVKPVQWLKAMFGDDYYVCRFQEPGKIEQEFASSDLRILLGN  179

Query  800   IFTDRKAGPPCLPKENPFG----ISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             IFT R  GP  LPK NP G    +++   +LP W S++ L +YASK++  GF GGLNYYR
Sbjct  180   IFTGRPLGPAILPKNNPLGKNPNLNSKNIELPKWFSKEGLDFYASKFEKTGFLGGLNYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +++L+WE TA WTG +++VPVKFM GD D VYTTPG+KEY+HGGGF  +VP L+EIVVI+
Sbjct  240   ALDLSWEHTAPWTGAKIQVPVKFMTGDFDTVYTTPGVKEYIHGGGFAANVPNLQEIVVIQ  299

Query  452   GGGHFLNQERPEEV  411
               GH +NQE+P+EV
Sbjct  300   DAGHSVNQEKPQEV  313



>ref|XP_004239808.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=321

 Score =   389 bits (999),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 233/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK V VNG+NMH+AE GQG  ILF+HGFPELWY+WRHQ+ + A  GYRAVAPDLR
Sbjct  1     MEKIEHKMVNVNGLNMHIAELGQGSTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS ++  H+VGDLVAL++++    +KVF+VAHDWGAII W+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFSIFHLVGDLVALLEAIAPNEEKVFVVAHDWGAIIAWHLCLFRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F  R+P M  VE ++A +G+D+YI RFQ  G IE++ A  G++ VL+KI
Sbjct  121   KVKALVNLSVHFPRRNPKMNTVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  180

Query  797   FTDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK +      D P  L SWLSE++L YYA+KY+  GFTG +NYYR+  +
Sbjct  181   LTYRDTAPLYFPKGSGLDALPDAPAALSSWLSEEELDYYANKYEQTGFTGAVNYYRAFPI  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG +VKVP KF+VG+ D+VY  PG+KEY+H GGFKKDVPLLEE+VV+EG  H
Sbjct  241   NWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGVKEYIHNGGFKKDVPLLEEVVVLEGAAH  300

Query  440   FLNQERPEEV  411
             F+NQERP E+
Sbjct  301   FVNQERPHEI  310



>ref|XP_008784772.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Phoenix 
dactylifera]
Length=322

 Score =   389 bits (998),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 233/303 (77%), Gaps = 2/303 (1%)
 Frame = -3

Query  1319  IEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGYG  1140
             I H+TV VNGINMHVAEKG+GPV+L +HGFPELWYTWRHQ+   A  G+RAVAPDLRG+G
Sbjct  11    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  70

Query  1139  ETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKAFV  960
             +TDAP    SSY+  H+VGDLVAL+ SLG D+VF+V HDWGA++ W  CMFRP+ V+A V
Sbjct  71    DTDAPP-GVSSYSMFHLVGDLVALIDSLGQDQVFVVGHDWGAMVAWSLCMFRPEKVRAVV  129

Query  959   DISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDRKA  780
             ++SV F PR+P  K VE +R+ +GDD+Y+CRFQE G  E++ A  G+  VL K +T    
Sbjct  130   NLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSP  189

Query  779   GPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELTAA  600
              P  +PKE      T+ P LPSWLS+ D+KYYASK++  GFTGGLNYYR ++LNWELTA 
Sbjct  190   DPLFIPKEGWGSPDTEIP-LPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAP  248

Query  599   WTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQERP  420
             WTG  +KVP KF+VGD+D+ Y TPGI++Y+H  GFK  VPLLEE+VV++G GHF+N+E+P
Sbjct  249   WTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKP  308

Query  419   EEV  411
              E+
Sbjct  309   HEI  311



>ref|XP_008784771.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   389 bits (999),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 233/303 (77%), Gaps = 2/303 (1%)
 Frame = -3

Query  1319  IEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGYG  1140
             I H+TV VNGINMHVAEKG+GPV+L +HGFPELWYTWRHQ+   A  G+RAVAPDLRG+G
Sbjct  27    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  86

Query  1139  ETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKAFV  960
             +TDAP    SSY+  H+VGDLVAL+ SLG D+VF+V HDWGA++ W  CMFRP+ V+A V
Sbjct  87    DTDAPP-GVSSYSMFHLVGDLVALIDSLGQDQVFVVGHDWGAMVAWSLCMFRPEKVRAVV  145

Query  959   DISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDRKA  780
             ++SV F PR+P  K VE +R+ +GDD+Y+CRFQE G  E++ A  G+  VL K +T    
Sbjct  146   NLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSP  205

Query  779   GPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELTAA  600
              P  +PKE      T+ P LPSWLS+ D+KYYASK++  GFTGGLNYYR ++LNWELTA 
Sbjct  206   DPLFIPKEGWGSPDTEIP-LPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAP  264

Query  599   WTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQERP  420
             WTG  +KVP KF+VGD+D+ Y TPGI++Y+H  GFK  VPLLEE+VV++G GHF+N+E+P
Sbjct  265   WTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKP  324

Query  419   EEV  411
              E+
Sbjct  325   HEI  327



>ref|NP_001274962.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81889.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   388 bits (997),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 236/310 (76%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK V VNG+NMH+AE GQGP ILFLHGFPELWY+WRHQ+ + A  GYRAVAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFLHGFPELWYSWRHQMVYLAECGYRAVAPDLR  60

Query  1148  GYGETDAPSLQ-PSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T   SL  PS ++ LH+VGD+VAL++++  +  KVF+VAHDWGA+I W+ C+FRPD
Sbjct  61    GYGDTTGASLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P M  VE ++A +G+D+YI RFQ  G IE++ A  G++ +L+KI
Sbjct  121   KVKALVNLSVHFLPRNPKMNTVEWLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSILKKI  180

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK        D P  L SWLSE++L YYA+K++  GFTGG+NYYR++ +
Sbjct  181   LTYRDPAPFYFPKGKGLEALPDAPVALSSWLSEEELDYYANKFEQTGFTGGVNYYRALPI  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             +WELTA WTG +VKVP KF+VG+ D+VY  PG KEY+H GGFK+DVPLLEE+VV+EG  H
Sbjct  241   SWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKEDVPLLEEVVVLEGSAH  300

Query  440   FLNQERPEEV  411
             F+NQERP E+
Sbjct  301   FVNQERPHEI  310



>ref|XP_009622776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=323

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 231/306 (75%), Gaps = 7/306 (2%)
 Frame = -3

Query  1316  EHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGYGE  1137
             EHK V VNGINMHV E GQGPVILF+HGFPELWY+WRHQ+ F A  GYRAVAPDLRG+G+
Sbjct  6     EHKIVPVNGINMHVVEAGQGPVILFIHGFPELWYSWRHQISFVAKHGYRAVAPDLRGFGD  65

Query  1136  TDAP-SLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             T       PS +T L VVGDLV L+ ++    +KVF+V HDWGAII W  C+FRPD VKA
Sbjct  66    TTGVLKHDPSKFTSLQVVGDLVELLNTIAPKEEKVFVVGHDWGAIIAWALCLFRPDKVKA  125

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V++SV F PR+P  KP+E +RA +G+DYY+ RFQE G IE++ A  G++KVL    + R
Sbjct  126   LVNLSVAFSPRNPKRKPLETLRAVYGEDYYVVRFQEPGEIEAEFAKIGTKKVLENFLSYR  185

Query  785   KAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
               GP  LPK   F    D P  LPSWL E+++ Y ASKY+  GFTGG+NYYR+I+LNWEL
Sbjct  186   NPGPLYLPKSKLF---DDSPVILPSWLPEKEVDYVASKYEKAGFTGGVNYYRAIDLNWEL  242

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TAAWTG +VKVPVKF+VGD+D+ Y  PG+K+YVH GG KKDVPLLEE+V++E  GHFL Q
Sbjct  243   TAAWTGAKVKVPVKFIVGDLDLTYNAPGVKDYVHKGGMKKDVPLLEEVVILENVGHFLQQ  302

Query  428   ERPEEV  411
             E+P+E+
Sbjct  303   EKPDEI  308



>ref|XP_008454327.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=315

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 231/307 (75%), Gaps = 4/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ I+H T+  NGIN+H A  G GPV+LFLHGFPELWY+WRHQL F A  G+RA+APDLR
Sbjct  1     MDKIQHSTISTNGINIHFASIGSGPVVLFLHGFPELWYSWRHQLLFLASKGFRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G++DAP   PSSYT  H+VGDL+ L+  LG+D+VFLV HDWGA++ WYFC+FRPD VK
Sbjct  61    GFGDSDAPP-SPSSYTPHHIVGDLIGLLDHLGIDQVFLVGHDWGAMMAWYFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV + PR+P   P+   R + GDD+YIC+FQE G  E+D     +  +++K  T 
Sbjct  120   ALVNLSVHYTPRNPAGSPLAVTRRYLGDDFYICKFQEPGVAEADFGSVDTATMMKKFLTM  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   P  +P  N F    + P+ LPSWL+E+D++Y+ASK+   GFTGG NYYR++++ WE
Sbjct  180   RDPRPAIIP--NGFKTLLETPEILPSWLTEEDIEYFASKFSKTGFTGGFNYYRALDITWE  237

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LT  W+  ++KVP KF+VGD+D+VY  PG KEY+HGGGFKKDVPLLE++VVIEG  HF+N
Sbjct  238   LTGPWSRAQIKVPTKFIVGDLDLVYNFPGAKEYIHGGGFKKDVPLLEDVVVIEGAAHFIN  297

Query  431   QERPEEV  411
             QE+P+E+
Sbjct  298   QEKPDEI  304



>ref|XP_004152242.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156832.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52825.1| hypothetical protein Csa_4G001920 [Cucumis sativus]
Length=316

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 228/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ I+H T+  NGI MH+A  G GPV+L LHGFPELWY+WRHQL + + +GYRA+APDLR
Sbjct  1     MDAIQHTTINTNGIKMHIASIGNGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TD+P    +SYT LH+VGDL+  +  LG++KVFLV HDWGAII WYFC+FRP+ +K
Sbjct  61    GYGDTDSPGSH-TSYTALHIVGDLIGALDELGIEKVFLVGHDWGAIIAWYFCLFRPERIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P +  ++  RA +GDD+Y+CRFQ  G  E+D A   + ++ +   + 
Sbjct  120   ALVNLSVQFFPRNPAISFIQRFRAAYGDDFYMCRFQVPGEAEADFACIDTAQLFKTTLST  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R    PCLPKE  F        LPSWL+E+D+ YYA+K+   GFTG LNYYR+ +L WEL
Sbjct  180   RSTEAPCLPKEYGFRAIPPPENLPSWLTEEDINYYAAKFKETGFTGALNYYRAFDLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA WTG++++VPVKF+VGD+D+ Y   G KEY+H GGFK+DVPLLEE+V+++  GHF+++
Sbjct  240   TAPWTGVQIQVPVKFIVGDLDITYHFKGAKEYIHDGGFKRDVPLLEEVVIVKNAGHFVHE  299

Query  428   ERPEEV  411
             E+P E+
Sbjct  300   EKPHEI  305



>ref|XP_003604118.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES86315.1| epoxide hydrolase [Medicago truncatula]
Length=322

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/312 (60%), Positives = 237/312 (76%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME +EH+ V+VNGI MHVAEKG+GPV+L LHGFPELWY+WRHQ+   +  GYRAVAPDLR
Sbjct  1     MENVEHRIVEVNGIKMHVAEKGEGPVVLMLHGFPELWYSWRHQILDLSSKGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+AP    ++YTC H+VGD++AL+ SLGVDKV+LV HDWGAIIGWY CMFRP+ VK
Sbjct  61    GYGDTEAPE-SVTNYTCFHLVGDIIALIDSLGVDKVYLVGHDWGAIIGWYVCMFRPERVK  119

Query  968   AFVDISVPFRP---RHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
             A+V +SVPFRP   R P +   +A  A +GDDYY+CRFQE G+ E+++A  G    LR +
Sbjct  120   AYVCLSVPFRPFLGRDPKINNYDAFHAKYGDDYYVCRFQEPGKAEAELAEVGVAYFLRNM  179

Query  797   FTDRKAGPPCLPK-ENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
              T RK GPP  PK E   G + D P  LPSWLSE+DL YY +K++  GFTGGLNYYR+++
Sbjct  180   MTTRKPGPPIFPKGEYGTGFNPDMPDILPSWLSEEDLDYYVTKFNKTGFTGGLNYYRNLS  239

Query  623   LNWELTAAWTGIE-VKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             LNWELT+ W+ +  V VPVK++ GD  +VYTTP +KEY+  GGFKKDVP LEE+VV EG 
Sbjct  240   LNWELTSPWSEVGVVNVPVKYITGDCGLVYTTPSMKEYILDGGFKKDVPGLEEVVVQEGI  299

Query  446   GHFLNQERPEEV  411
              HF NQE  +++
Sbjct  300   AHFNNQEAAQDI  311



>ref|XP_009393200.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 232/305 (76%), Gaps = 5/305 (2%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             EG+ H+ V+ NGI+MHVAEKG+GP +L LHGFPELWY+WRHQ+   A  GYRA+APDLRG
Sbjct  4     EGVAHRMVEANGISMHVAEKGEGPAVLLLHGFPELWYSWRHQIAGLAARGYRAIAPDLRG  63

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             YG+T APS   +SYT  H+VGDL+AL+ +L + +V+LV HDWGA I W  C+FRPD VKA
Sbjct  64    YGDTSAPS-AAASYTVFHIVGDLIALLDALAIPQVYLVGHDWGAQIAWNLCLFRPDRVKA  122

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V++SVPF PR+P  KP +  R+F+GDD+Y+CRFQE G IE++ A  G+ K+LR +  +R
Sbjct  123   LVNLSVPFMPRNPAGKPTQHFRSFYGDDFYVCRFQEPGAIEAEFARIGTGKLLRIVLCNR  182

Query  785   KAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELT  606
              AGP  L + +       +  LPSWLSE+D+ Y+ASK D  GFTG +NYYR ++LNWEL 
Sbjct  183   NAGPLLLSEVD----FEAEVALPSWLSEEDIDYFASKLDKSGFTGPVNYYRCLDLNWELG  238

Query  605   AAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQE  426
             A W+G++++VPVKF++GD DM Y  PGIKEY+ GGGF++DVP+LEE VV+EG  HF+NQE
Sbjct  239   APWSGVQIQVPVKFIIGDQDMTYHFPGIKEYIQGGGFRRDVPMLEEAVVMEGVAHFINQE  298

Query  425   RPEEV  411
             +  E+
Sbjct  299   KAPEI  303



>ref|XP_008784770.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=359

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 233/303 (77%), Gaps = 2/303 (1%)
 Frame = -3

Query  1319  IEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGYG  1140
             I H+TV VNGINMHVAEKG+GPV+L +HGFPELWYTWRHQ+   A  G+RAVAPDLRG+G
Sbjct  48    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  107

Query  1139  ETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKAFV  960
             +TDAP    SSY+  H+VGDLVAL+ SLG D+VF+V HDWGA++ W  CMFRP+ V+A V
Sbjct  108   DTDAPP-GVSSYSMFHLVGDLVALIDSLGQDQVFVVGHDWGAMVAWSLCMFRPEKVRAVV  166

Query  959   DISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDRKA  780
             ++SV F PR+P  K VE +R+ +GDD+Y+CRFQE G  E++ A  G+  VL K +T    
Sbjct  167   NLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSP  226

Query  779   GPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELTAA  600
              P  +PKE      T+ P LPSWLS+ D+KYYASK++  GFTGGLNYYR ++LNWELTA 
Sbjct  227   DPLFIPKEGWGSPDTEIP-LPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAP  285

Query  599   WTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQERP  420
             WTG  +KVP KF+VGD+D+ Y TPGI++Y+H  GFK  VPLLEE+VV++G GHF+N+E+P
Sbjct  286   WTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKP  345

Query  419   EEV  411
              E+
Sbjct  346   HEI  348



>gb|EPS69185.1| hypothetical protein M569_05583, partial [Genlisea aurea]
Length=310

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/305 (59%), Positives = 226/305 (74%), Gaps = 7/305 (2%)
 Frame = -3

Query  1322  GIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGY  1143
              ++H TVKVNG+++H AE+G GP++LFLHGFPE WYTWRHQL   A  GYRAVAPDLRGY
Sbjct  1     AVKHSTVKVNGVDIHFAEEGDGPLVLFLHGFPEFWYTWRHQLPALAAEGYRAVAPDLRGY  60

Query  1142  GETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK-VFLVAHDWGAIIGWYFCMFRPDLVKA  966
             G +++P    SSY+CLHVVGD+V L+  LG     F+VAHDWGA+I WY C+FRPDLVKA
Sbjct  61    GLSESPP-DASSYSCLHVVGDIVGLINRLGGGGGAFVVAHDWGAMIAWYLCLFRPDLVKA  119

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
             +V +SVPFRPR+P  KPV  +RA FGDDYY+CRFQ     +      GS  V++ I ++R
Sbjct  120   YVALSVPFRPRNPAAKPVAVLRAVFGDDYYMCRFQNPKSSKV-----GSAAVIKSILSNR  174

Query  785   KAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELT  606
                PP LP ENPFG +  + +LP WL+E+DLK Y+  +D  GFTGGLNYYR+++LNWELT
Sbjct  175   SPDPPRLPAENPFGFNDSKLRLPDWLTEEDLKTYSENFDRSGFTGGLNYYRALDLNWELT  234

Query  605   AAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQE  426
                 G +V VPVK +VG++DMVY   G+KEYVHGGG K+DVPLLE+ VVI   GHF+NQE
Sbjct  235   GGLDGAKVTVPVKLIVGELDMVYNMVGVKEYVHGGGIKRDVPLLEDCVVIPNAGHFINQE  294

Query  425   RPEEV  411
              P  +
Sbjct  295   APHLI  299



>emb|CDO98837.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 233/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK V+VNGINMHVAE GQGPV+LFLHGFPE WYTWRHQ+ F A  G+RAVAPDLR
Sbjct  1     MEKIEHKNVEVNGINMHVAEIGQGPVVLFLHGFPECWYTWRHQMSFMASHGHRAVAPDLR  60

Query  1148  GYG-ETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
             G+G  T AP   PS +T LHVVGD++ L++ +    DKVFLV HDWGA++ W  C++RPD
Sbjct  61    GFGGTTGAPIDDPSKFTTLHVVGDIIELLKIVAPDEDKVFLVGHDWGAVMAWALCLYRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA  ++SV F PR+P  KP+E +RA  G DYY+CRFQE G IE + A  G+++VL   
Sbjct  121   KVKALFNMSVSFGPRNPKRKPIETLRAVCGPDYYVCRFQEPGEIEEEFAKVGTKRVLENF  180

Query  797   FTDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              + R  GP  LPK   FG S D P  LPSWLSE+D+ YY ++Y   GFTG LNYYR++++
Sbjct  181   LSYRAPGPLFLPKGILFGDSPDAPTTLPSWLSEEDVAYYVNQYAQSGFTGALNYYRALDI  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG +VKVPVKF+VGD+D+ Y  PG K+Y+H GG KKDVP L+++VV++  GH
Sbjct  241   NWELTAPWTGAQVKVPVKFVVGDLDLTYNAPGTKDYLHKGGLKKDVPFLDQVVVMKEVGH  300

Query  440   FLNQERPEEV  411
             FL++E+P+E+
Sbjct  301   FLHEEKPDEI  310



>ref|XP_004229258.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=325

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 239/309 (77%), Gaps = 6/309 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME +EHKT++VNGINMH+AE GQGP++LFLHGFPELWY+WRHQ+ F A  GY  VAPDLR
Sbjct  1     MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMLFMAAHGYHVVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD-KVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+T  AP    + +T LHVVGDLV L+  +  D KVFLV HDWGA+I W  C++RPD 
Sbjct  61    GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPDRKVFLVGHDWGAMIAWALCLYRPDK  120

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             + A V++SVP+ PR+P ++P+EA+RA +GD+YYI +FQE G+IE++ A  G++ VL KI 
Sbjct  121   INALVNMSVPYFPRNPIIRPIEALRAIYGDEYYIIKFQEPGKIEAEFAQIGTKTVLEKIL  180

Query  794   TDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R   P  +PK  PF    D P  LP WL+E+D+ YYA+KY+  GFTGGLNYYR+I+LN
Sbjct  181   TMRDPDPLKMPKGKPF---DDSPVILPPWLTEEDVDYYATKYEHTGFTGGLNYYRAIDLN  237

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTA WTG +++VPVKF+VGD+D+ Y   G+K+Y++ GGFKK+VPLLE++V+++G  HF
Sbjct  238   WELTAPWTGAKIEVPVKFIVGDLDLTYNLVGVKDYINKGGFKKNVPLLEDVVILKGVAHF  297

Query  437   LNQERPEEV  411
             L QE P+EV
Sbjct  298   LQQEEPDEV  306



>dbj|BAK07144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 232/306 (76%), Gaps = 3/306 (1%)
 Frame = -3

Query  1322  GIEHKTVKVNGINMHVAEKGQG--PVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
              I H++V VNG+ +HVAE G    PV+L LHGFPELWYTWRHQ++  A  GYRAVAPD+R
Sbjct  36    AITHRSVDVNGVRLHVAEAGPAGAPVVLLLHGFPELWYTWRHQMRALAAAGYRAVAPDMR  95

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG +DAPS  P  YT LHVVGDLVAL+ SLG  +VF+VAHDWGA+I W  C+FRPD VK
Sbjct  96    GYGGSDAPSGGPDEYTALHVVGDLVALIDSLGEKQVFVVAHDWGAMIAWSLCLFRPDRVK  155

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V +SVPF PR P  KPV+ ++A +GD+YYICR QE G IE++ A  G+E VLRK FT 
Sbjct  156   ALVALSVPFTPRSPARKPVDGLKALYGDEYYICRIQEPGVIEAEFARLGTELVLRKFFTY  215

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R  GP  +PK   +G   D+  LPSW++E+D+KYYA+++D  GFTGGLNYYR++N  WEL
Sbjct  216   RTPGPLFIPKSG-WGSPDDEVPLPSWITEEDIKYYAAQFDKSGFTGGLNYYRALNKTWEL  274

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             T+ WTG E+KVP KF+VGD+D+ Y   G  ++++ GG KK VPLLE++VV++  GHF+N+
Sbjct  275   TSPWTGAEIKVPTKFIVGDVDLSYHVAGAYDFINKGGLKKFVPLLEDVVVMKDVGHFINE  334

Query  428   ERPEEV  411
             E+PEE+
Sbjct  335   EKPEEI  340



>ref|XP_009757467.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=340

 Score =   388 bits (996),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 237/310 (76%), Gaps = 5/310 (2%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ++E I+HKT++VNG+NMH+AE GQGP++LFLHGFPELWY+WRHQ+ F A  GYRAVA DL
Sbjct  3     EVEEIQHKTLRVNGLNMHIAEMGQGPIVLFLHGFPELWYSWRHQMPFVAAHGYRAVALDL  62

Query  1151  RGYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             RG+G+T  AP    + +T LHVVGD+V L+  +  D  KVF+V HDWGA+I W  C +RP
Sbjct  63    RGFGDTTGAPEDDFTKFTTLHVVGDIVELLNIIAPDQEKVFVVGHDWGAMIAWALCFYRP  122

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D V A V+++VPF PR+P ++P+  +RA +GD+YYI RFQE G IE + A  G++ VL K
Sbjct  123   DKVNALVNMTVPFAPRNPIIRPIARLRATYGDEYYIIRFQEPGEIEEEFAKIGTKTVLEK  182

Query  800   IFTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
             + T+R   P  LPK  PF  S    KLP WL+E+D+ YYASKY   GFTGGLNYYR+++L
Sbjct  183   LLTNRNPEPLMLPKGKPFDESP--VKLPPWLTEKDVDYYASKYQQTGFTGGLNYYRALDL  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG +VKVPVKF+VGD+D+ Y+  G+K+Y+H GGFKKDVPLLE++V+ +G  H
Sbjct  241   NWELTAPWTGAKVKVPVKFIVGDLDITYSAAGVKDYIHKGGFKKDVPLLEDVVIFKGVAH  300

Query  440   FLNQERPEEV  411
             FL QE+P+EV
Sbjct  301   FLPQEKPDEV  310



>ref|XP_002270853.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 229/307 (75%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEGIEH TV+ NGIN+H+AEKGQGP+IL LHGFPE WY+WRHQ+   A LGYRAVAPDLR
Sbjct  1     MEGIEHTTVRANGINIHLAEKGQGPIILLLHGFPEFWYSWRHQIHALASLGYRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP+    SYT  H+VGDL+ ++ ++G DKVF+V HDWGA IGW  C+FRPD VK
Sbjct  61    GYGDSDAPA-DVDSYTYFHLVGDLIGVLDAIGADKVFVVGHDWGAFIGWNLCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+   KP++  RA +GDDYYICRFQE G IE++ A  G +KVL+   T 
Sbjct  120   ALVNLSVSFSPRNAMNKPLQTFRALYGDDYYICRFQEPGAIETEFAEIGIDKVLKYFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
               AGP  LPK          P  LPSWLSE++L YY +KY+  GFTGGLNYYR+++L+WE
Sbjct  180   LPAGPLFLPKGKALRDQLGIPITLPSWLSEEELNYYVTKYENTGFTGGLNYYRNLDLSWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTA WTG +V+VP KF+VGD+D+ Y TPG  E +     KK VPLLEE+VV++G GHFL 
Sbjct  240   LTAPWTGSQVEVPAKFIVGDLDLTYNTPGFNESMTFDELKKHVPLLEEVVVMKGVGHFLQ  299

Query  431   QERPEEV  411
             +E+ +E+
Sbjct  300   EEKADEI  306



>gb|KDP27824.1| hypothetical protein JCGZ_18904 [Jatropha curcas]
Length=321

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 183/311 (59%), Positives = 234/311 (75%), Gaps = 6/311 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             M+ IEH+ V+VNGIN+HVAE G   GPVILF+HGFPELWY+WRHQ+   A LGYRAVAPD
Sbjct  1     MDAIEHRFVQVNGINIHVAEAGPVNGPVILFIHGFPELWYSWRHQIVALASLGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRP  981
             +RGYG+TDAP     SYTC H+VGDL+ L+ ++    +KVF+V HDWGA I W+ C+FRP
Sbjct  61    MRGYGDTDAPD-DLQSYTCFHIVGDLIGLLDAVAPQQEKVFVVGHDWGAYIAWHLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D VKA V++SV F  R+P  K +E MRA +GDDYY+CRFQE G IE++ A  G+E++L++
Sbjct  120   DRVKALVNLSVVFALRNPNGKRIEVMRAVYGDDYYMCRFQEPGEIEAEFAELGTERILKE  179

Query  800   IFTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
              FT R  GP  LPK   F    + P  LPSW SE+D++YY +K++ KGFTGGLNYYR ++
Sbjct  180   FFTYRHPGPIFLPKGKAFSRLPETPLVLPSWFSEEDVQYYTNKFEKKGFTGGLNYYRILD  239

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
              NWELTA W G +VKVP KF+VGD D+ Y + G K+Y+  GGFKK VP LEE+V++EG  
Sbjct  240   RNWELTAPWNGAQVKVPAKFIVGDQDLTYNSFGAKDYIEKGGFKKAVPFLEEVVIMEGVA  299

Query  443   HFLNQERPEEV  411
             HFLNQE+PEE+
Sbjct  300   HFLNQEKPEEI  310



>ref|NP_001274907.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81891.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   386 bits (992),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 234/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK V VNG+NMH+AE GQGP ILFLHGFPELWY+WRHQ+ + A  GYRAVAP LR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFLHGFPELWYSWRHQMVYLAERGYRAVAPVLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS ++ L +VGD+VAL++++  +  KVF+VAHDWGA+I W+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFSILQLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V+ SV F PR+P M  VE ++A +G+D+YI RFQ  G IE++ A  G++ VL+KI
Sbjct  121   KVKALVNSSVHFLPRNPKMNTVEGLKAVYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  180

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK        D P  L SWLSE++L YYA+K++  GFTGG+NYYR++++
Sbjct  181   LTFRDPAPFYFPKGKGLEALPDAPVALSSWLSEEELDYYANKFEQTGFTGGVNYYRALSI  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG +VKVP KF+VG+ D+VY  PG KEY+H GGFKKDVPLLEE+VV+EG  H
Sbjct  241   NWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAH  300

Query  440   FLNQERPEEV  411
             F+NQERP E+
Sbjct  301   FVNQERPHEI  310



>ref|XP_010024723.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61193.1| hypothetical protein EUGRSUZ_H03957 [Eucalyptus grandis]
Length=323

 Score =   386 bits (991),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 239/312 (77%), Gaps = 6/312 (2%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAP  1158
             +++GIEH+TV VNGI MHVA KG  + P +L LHGFPELWY+WRHQ+   A LGYRAVAP
Sbjct  2     ELQGIEHRTVTVNGIAMHVAIKGSSRSPTVLLLHGFPELWYSWRHQMAGLAALGYRAVAP  61

Query  1157  DLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSL--GVDKVFLVAHDWGAIIGWYFCMFR  984
             DLRG+G+TD P+   S+YT L VVGDLVAL+ ++  G +KVF+V HDWGA++ W+  +FR
Sbjct  62    DLRGFGDTDTPA-SASAYTSLSVVGDLVALLDAVAKGEEKVFVVGHDWGAVVAWHLSLFR  120

Query  983   PDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLR  804
             PD VKA V++SVPF PR+P  KP+E++RA +G+DYYICRFQE G +E++ A  G+ +VL 
Sbjct  121   PDRVKALVNLSVPFTPRNPAQKPLESLRAGYGEDYYICRFQEPGEMEAEFAQIGTRRVLE  180

Query  803   KIFTDRKAGPPCLPKENPFGISTDQ-PKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
             +  T R      LPK   FG   D    LPSWL+E+D+ YYASKY+  GFTGG NYYR++
Sbjct  181   EFLTIRNPDQLFLPKGKAFGYPMDDLIILPSWLTEEDVDYYASKYEKTGFTGGFNYYRAL  240

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             +LNWELTA WTG +++VP KF+VGD+D+ YT+PG K+Y+H GG KK VP LE++VV++G 
Sbjct  241   DLNWELTAPWTGAQIRVPAKFIVGDLDLTYTSPGAKDYIHRGGLKKYVPFLEDVVVMQGV  300

Query  446   GHFLNQERPEEV  411
              HF+++ERP+EV
Sbjct  301   AHFIHEERPQEV  312



>ref|XP_006342824.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=325

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/309 (59%), Positives = 237/309 (77%), Gaps = 6/309 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME +EHKT++VNGINMH+AE GQGP++LFLHGFPELWY+WRHQ+ F A  GYR VAPDLR
Sbjct  1     MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMPFMAAHGYRVVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD-KVFLVAHDWGAIIGWYFCMFRPDL  975
             G+G+T  AP    + +T LHVVGDLV L+  +  D KVFLV HDWGA+I W  C++RPD 
Sbjct  61    GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPDQKVFLVGHDWGAMIAWDMCLYRPDK  120

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             +KA V++SVPF PR+P ++P+ A+RA +GD+YYI RFQE G IE + A  G++ VL K+ 
Sbjct  121   IKALVNMSVPFFPRNPIIRPIVALRAIYGDEYYIIRFQEPGEIEEEFAQIGTKTVLEKML  180

Query  794   TDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             T R   P  LPK  PF    D P  LP WL+E D+ YYA+KY+  GFTGGLNYYR+++LN
Sbjct  181   TIRDPEPLKLPKGKPFD---DSPVILPPWLTETDVDYYATKYEHTGFTGGLNYYRALDLN  237

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTA WTG +++VPVKF+VGD+D+ Y + G+K Y++ GG KK+VPLLE++V+++G  HF
Sbjct  238   WELTAPWTGAKIEVPVKFIVGDLDLTYNSAGVKFYINKGGLKKNVPLLEDVVILKGVAHF  297

Query  437   LNQERPEEV  411
             L QE+P+EV
Sbjct  298   LQQEKPDEV  306



>ref|XP_002516953.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF45567.1| epoxide hydrolase, putative [Ricinus communis]
Length=321

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/311 (59%), Positives = 235/311 (76%), Gaps = 6/311 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             M+ IEH+ +KVNGINMHVAE G   GPVILF+HGFPELWY+WRHQ+   A LGYRAVAPD
Sbjct  1     MDAIEHRVIKVNGINMHVAEMGPVNGPVILFIHGFPELWYSWRHQIVALASLGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRP  981
             LRG+G+TDAP  Q  SYT +H VGDL+ ++  +    +KVF+V HDWGA + W+ C+FRP
Sbjct  61    LRGFGDTDAPPEQ-RSYTVMHSVGDLIGVLDVVAPLQEKVFVVGHDWGAYMAWFLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D VKA V++SV F PR+P  K VE +RA +GDDYY+CRFQE G IE++ A  G+E+V+++
Sbjct  120   DRVKALVNLSVSFSPRNPHKKIVEMLRAVYGDDYYMCRFQEVGDIEAEFAELGTERVIKE  179

Query  800   IFTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
               T R  GP  LPK   F  S + P  LPSWLSE+D +YY  K++ KGFTGGLN YR+++
Sbjct  180   FLTYRYPGPLFLPKGKAFNRSPENPLVLPSWLSEEDAQYYVGKFEEKGFTGGLNLYRNLD  239

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
             LNWELTA WTG +VKVP+KF+VGD D+ Y + G K Y+  GGFK+DVP LEE+V++EG  
Sbjct  240   LNWELTAPWTGAKVKVPIKFIVGDQDLTYNSLGNKAYIEKGGFKRDVPFLEEVVIMEGVA  299

Query  443   HFLNQERPEEV  411
             HF+NQE+ EE+
Sbjct  300   HFINQEKAEEI  310



>gb|EYU46742.1| hypothetical protein MIMGU_mgv1a010264mg [Erythranthe guttata]
Length=317

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 229/307 (75%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H  + VNGINMHVAE G GP +LFLHGFPELWYTWRHQ+ + +  GYRA+APDLR
Sbjct  1     MEKIKHSNMSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLYLSARGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP   P+ YT  H+VGDLVAL+ +LG+++VFLVAHDWGAI+ W+FC+FRP+ +K
Sbjct  61    GYGDTDAPP-SPADYTAFHLVGDLVALLDALGLEQVFLVAHDWGAIVAWWFCLFRPERIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
               V++SV F PRHP +KP+E  +   GDD+Y+CRFQ+ G  E       + +V++ +F+ 
Sbjct  120   GLVNMSVQFHPRHPEIKPIEMYKNLLGDDFYMCRFQKAGEAEKAFESVEASQVIKSLFSF  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   P  +P+E         P + P WL+E+DL Y+A K+   G+TGGLNYYR+++L WE
Sbjct  180   RGGKPIIVPREIGLEALFQAPAESPPWLTEEDLDYFAGKFKKTGYTGGLNYYRAMDLTWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             L A W G +VKVPVKF++G+ D+ Y  PGIKEY+H GGFKKDVP LE++VV+EG  HF+N
Sbjct  240   LAAPWVGAQVKVPVKFIIGEQDITYYVPGIKEYIHDGGFKKDVPNLEQVVVMEGVAHFIN  299

Query  431   QERPEEV  411
             QE+PEEV
Sbjct  300   QEKPEEV  306



>ref|XP_009757465.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=331

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/309 (58%), Positives = 236/309 (76%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             MEG+EHKTV VNGINMH AE GQGP++LF+HGFPELWY++RHQ+ F A  GYRAVAPDLR
Sbjct  1     MEGVEHKTVSVNGINMHYAEIGQGPLVLFIHGFPELWYSFRHQMSFMANHGYRAVAPDLR  60

Query  1148  GYGETDA-PSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T   P   PS++T L +VGDLV L+ S+    +KVF++ HDWGA++ W  C++RPD
Sbjct  61    GYGDTTGVPKDDPSNFTTLSIVGDLVELLNSIAPQEEKVFVIGHDWGAVVSWALCLYRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VK F  +SV F PR+P  KP++ +RA +GDDYY+ RFQE G IE++    G + VL+K 
Sbjct  121   KVKGFFCLSVAFNPRNPIKKPLDTLRAVYGDDYYVVRFQEAGVIEAEFEEMGVKNVLKKF  180

Query  797   FTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             FT R+  P  L K  PFG    Q +LP WLSE++L +YA K++  GFTG LN+YR+I+ N
Sbjct  181   FTYREPAPLYLKKGKPFG-DNPQVELPCWLSEEELDFYAIKFEQTGFTGPLNFYRAIHRN  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WELTAAWTG +++VPVKF+VGD+D+ Y  PG K+Y+H GGFKK VPLLEE+VV+EG GHF
Sbjct  240   WELTAAWTGAKIQVPVKFIVGDLDLTYNAPGTKDYLHKGGFKKQVPLLEEVVVLEGVGHF  299

Query  437   LNQERPEEV  411
             +++E+P+E+
Sbjct  300   IHEEKPKEI  308



>gb|KFK41013.1| hypothetical protein AALP_AA2G073900 [Arabis alpina]
Length=325

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 237/314 (75%), Gaps = 9/314 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEK-GQG----PVILFLHGFPELWYTWRHQLQFFAGLGYRAV  1164
             M+GIEHKT+KVNGINMHVAEK G G    P+ILF+HGFPELWYTWRHQ+   + LGYR +
Sbjct  1     MDGIEHKTLKVNGINMHVAEKPGSGSEGDPIILFIHGFPELWYTWRHQMVALSSLGYRTI  60

Query  1163  APDLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSL--GVDKVFLVAHDWGAIIGWYFCM  990
             APDLRGYG+TDAP  +   YT L+VVGDLVAL+ ++  G +KVF+V HDWGA+I W  CM
Sbjct  61    APDLRGYGDTDAPE-KVEEYTYLNVVGDLVALINTVTSGDEKVFVVGHDWGAMIAWQLCM  119

Query  989   FRPDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKV  810
             +RP+ VKA V++SV F PR+P   PV  +R  FGDDYYICRFQ+ G IE++    G+EKV
Sbjct  120   YRPEKVKALVNMSVVFTPRNPDRVPVPTLRRVFGDDYYICRFQKPGEIEAEFKKLGTEKV  179

Query  809   LRKIFTDRKAGPPCLPKENPF-GISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             L++  T +   P  +PK   F G       LP WL+++DL YY +KY+ +GFTG +NYYR
Sbjct  180   LKEFLTYKTPKPLFIPKGELFKGSENAAAALPHWLTQEDLDYYTTKYEKRGFTGAINYYR  239

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +++ +WELTA WTG ++ VPVKF+VGD D+ Y +PG KEY+HGGGFKKDVPLL+E VV+E
Sbjct  240   NLDRSWELTAPWTGAKIAVPVKFIVGDQDLTYNSPGAKEYIHGGGFKKDVPLLDETVVLE  299

Query  452   GGGHFLNQERPEEV  411
             G GHFL++E PEE+
Sbjct  300   GLGHFLHEENPEEI  313



>ref|XP_009414133.1| PREDICTED: bifunctional epoxide hydrolase 2 [Musa acuminata subsp. 
malaccensis]
Length=349

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 232/305 (76%), Gaps = 1/305 (0%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             EGI H+ V VNGINMHVAEKG+GP +L LHGFPELWYTWRHQ+   A  G+RAVAPDLRG
Sbjct  35    EGISHRMVSVNGINMHVAEKGEGPTVLLLHGFPELWYTWRHQMHGLAACGFRAVAPDLRG  94

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             +G+TDAP    ++Y+ LH+VGDL+AL+ SLG DKVF+V HDWG+++ W   MFRPD V A
Sbjct  95    FGDTDAPPAA-AAYSILHIVGDLIALLDSLGQDKVFVVGHDWGSMVAWNLSMFRPDKVNA  153

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V++S  F PR+PT K +E +R  FGDDYY+CRFQE G+IE++ A  G+  VL+K  T R
Sbjct  154   MVNLSQAFTPRNPTRKSLEYLRTVFGDDYYMCRFQEPGKIEAEFARLGTAWVLKKFLTYR  213

Query  785   KAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELT  606
               GP  + ++  +G S  +  LPSWLSE D+ YY SKY+  GFTGGLNYYRS++LNWELT
Sbjct  214   NPGPLYITEDQGWGSSDSKILLPSWLSEVDINYYTSKYEKAGFTGGLNYYRSLDLNWELT  273

Query  605   AAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQE  426
             A WTG  +KVP KF+VGD+D+ Y +PG ++++H GG K  VPLL+E+VV++  GHF+N+E
Sbjct  274   APWTGARIKVPAKFIVGDLDLTYHSPGAQDFIHKGGLKNYVPLLDEVVVMKEVGHFINEE  333

Query  425   RPEEV  411
             +P E+
Sbjct  334   KPTEI  338



>emb|CDP17110.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 233/310 (75%), Gaps = 5/310 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H++V VNGINMHVAE G+GP +L LHGFPELWY+WRHQ+ + A  GYRA+APDLR
Sbjct  1     MENIKHQSVVVNGINMHVAEVGEGPAVLLLHGFPELWYSWRHQMLYLASKGYRALAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP   PSSYT  HVVGDLVAL+ SLG+DKVFLV HDWG++I W+ C+FRPD +K
Sbjct  61    GYGDSDAPP-SPSSYTAFHVVGDLVALLNSLGLDKVFLVGHDWGSLIAWHLCLFRPDRIK  119

Query  968   AFVDISVP---FRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
             A V++S     F P++P+ KP+E MR  FGDDYY+CRFQ  G +E + A   + ++++  
Sbjct  120   ALVNMSCVYHYFDPKNPSKKPLEEMRETFGDDYYVCRFQATGEVEEEFAGVDTAELVKAF  179

Query  797   FTDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              ++R   PPC+P+      +   P  LP WL+++DL YYA+K+   GF+GG N+YR I+L
Sbjct  180   LSNRDTRPPCIPRGGFQYFAHQNPNPLPEWLTQEDLNYYATKFKKTGFSGGFNFYRCIDL  239

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWEL+A W   +++VPVKF+VGD+D+ Y  PGI++Y+H GGFKKDVP L+E++VI G  H
Sbjct  240   NWELSAPWREAQIQVPVKFVVGDLDLTYHIPGIQDYIHNGGFKKDVPDLQEVIVIPGAAH  299

Query  440   FLNQERPEEV  411
             F+NQE+ +E 
Sbjct  300   FINQEKADEC  309



>ref|XP_010038234.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50059.1| hypothetical protein EUGRSUZ_K03500 [Eucalyptus grandis]
Length=325

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/312 (58%), Positives = 225/312 (72%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGP-VILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME IEH TV+ NGINMHVA  G GP  +LF+HGFPELWY+WRHQ+   A LGYR V PDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGNGPDTVLFIHGFPELWYSWRHQMVSLAALGYRTVGPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RG+G+TDAP     SYT  HVVGDLV ++  LG+ +VF+V HDWGAII WY C+ RPD V
Sbjct  61    RGFGDTDAPP-SVESYTAFHVVGDLVGMLDVLGIGRVFVVGHDWGAIIAWYLCLLRPDRV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V+ SV + PR+P  KPVE +RA FGDDYY+CRFQE G  E+D A     K+ +    
Sbjct  120   KALVNTSVAWFPRNPERKPVEKLRATFGDDYYVCRFQEPGEAEADFAKADPAKLFKLFLV  179

Query  791   DRKAGPPCLPKENPFGISTD-----QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
              R   PP LPK+  F   T      Q  LPSWLSE D+ +YA+++   GFTGGLNYYR  
Sbjct  180   SRDPSPPILPKDVGFSGMTKIFEDHQVDLPSWLSEDDINFYAAQFSRTGFTGGLNYYRCS  239

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             +LNWEL+A+WTG+ ++VPVKF+VGD+D+ Y  PG+KEY++GGGFK+ VP LEE+VV+EG 
Sbjct  240   DLNWELSASWTGVPIEVPVKFIVGDLDLTYHIPGVKEYINGGGFKRAVPNLEEVVVMEGV  299

Query  446   GHFLNQERPEEV  411
              HFL QE+P +V
Sbjct  300   AHFLQQEKPRDV  311



>ref|XP_010039296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/312 (58%), Positives = 224/312 (72%), Gaps = 7/312 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGP-VILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME IEH TV+ NGINMHVA  G GP  +LF+HGFPELWY+WRHQ+   A LGYR VAPDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMVSLAALGYRTVAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG TDAP     SYT  HVVGDLV ++ +LG+ +VF+V HDWGA+I WY C+ RPD V
Sbjct  61    RGYGNTDAPP-SVDSYTAFHVVGDLVGMLDALGIGRVFVVGHDWGAMIAWYLCLLRPDRV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V+ SV + PR P  KPVE MRA FGDDYY+CRFQE G  E D A     K+ +    
Sbjct  120   KALVNTSVAWFPRDPERKPVEKMRAMFGDDYYVCRFQEPGEAEEDFAKADPAKLFKLFLA  179

Query  791   DRKAGPPCLPKENPFGISTD-----QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSI  627
              R   PP + K+  F   T      Q  LPSWLSE D+ +YA+++   GFTGGLNYYR  
Sbjct  180   GRDPSPPIVTKDVGFSGMTKLFEDHQVDLPSWLSEDDINFYAAQFSRTGFTGGLNYYRCW  239

Query  626   NLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGG  447
             +LNWEL+A+WTG+ ++VP+KF+VGD+D+ Y  PG+KEY+HGGGFK+ VP LEE+VV+EG 
Sbjct  240   DLNWELSASWTGVPIEVPMKFIVGDLDLTYHIPGVKEYIHGGGFKQAVPNLEEVVVMEGV  299

Query  446   GHFLNQERPEEV  411
              HFL QE+P+EV
Sbjct  300   AHFLMQEKPQEV  311



>ref|XP_009622179.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=325

 Score =   384 bits (987),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 240/310 (77%), Gaps = 5/310 (2%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             +M+ I+HK ++VNGINMH+AE GQGP++LFLHGFPELWY+WR+Q+ F AG GYRAVAPDL
Sbjct  3     EMKEIQHKLLRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRYQMPFMAGHGYRAVAPDL  62

Query  1151  RGYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRP  981
             RG+G+T  A +   + +T LHVVGD+V L+  +  D  KVF+V HDWGA+I W  C++RP
Sbjct  63    RGFGDTTGALNDDFTKFTTLHVVGDIVELLNIISPDQEKVFVVGHDWGAMIAWALCLYRP  122

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D VKA V++SVPF P++P ++P+  +RA +GD+YYI RFQE G IE + A  G++ VL K
Sbjct  123   DKVKALVNMSVPFTPQNPIIRPIARLRATYGDEYYIIRFQEPGEIEEEFAQIGTKTVLEK  182

Query  800   IFTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
             + T+R   P  +PK  PF  S    KLP WL+E+++ YYA+KY+  GFTGGLNYYR+++L
Sbjct  183   LLTNRNPEPLKVPKGKPFDKSP--VKLPPWLTEKEVDYYATKYEQTGFTGGLNYYRALDL  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG ++KVPVKF+VGD+D+ Y   G+K+Y+H GG KKDVPLLE++V+++G  H
Sbjct  241   NWELTAPWTGAKIKVPVKFIVGDLDITYNAAGVKDYIHKGGLKKDVPLLEDVVILKGVAH  300

Query  440   FLNQERPEEV  411
             FL QE+P+EV
Sbjct  301   FLQQEKPDEV  310



>ref|XP_008454330.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=316

 Score =   384 bits (986),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 226/308 (73%), Gaps = 5/308 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGINMH+A  G GPV+L LHGFPELWY+WRHQL + + +GYRA+APDLR
Sbjct  1     MEAIEHTTINTNGINMHIASIGTGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP    + YT  H+VGDLV  +  LG++KVF+V HDWGAII WY C+FRPD VK
Sbjct  61    GFGDTDAPESH-TVYTPFHIVGDLVGALDELGIEKVFVVGHDWGAIIAWYLCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F  R+PT+  V+  R  FGDD+YICRFQ  G  E D     + ++ +K    
Sbjct  120   ALVNLSVHFLRRNPTISFVQGFRIAFGDDFYICRFQVPGEAEKDFGSIDTAELFKKFLCG  179

Query  788   RKAGPPCLPKENPFGI-STDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             R   PP LPKE  FGI S   P+ LPSWLS++D+ Y+A+K++  GFTGG NYYR+++L W
Sbjct  180   RSPDPPILPKE--FGIRSIPSPQNLPSWLSQEDINYFATKFNRTGFTGGFNYYRALDLTW  237

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA+W   +V+VPVKF+VGD+D+ Y  PG KEY+H GGFK DVP LEE+VV+E   HF+
Sbjct  238   ELTASWNKAQVQVPVKFIVGDLDLTYHFPGAKEYIHNGGFKTDVPFLEEVVVMEDTAHFI  297

Query  434   NQERPEEV  411
             NQERP E+
Sbjct  298   NQERPHEI  305



>ref|XP_010038235.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   384 bits (986),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 230/314 (73%), Gaps = 11/314 (4%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGP-VILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME IEH TV+ NGINMHVA  G GP  +LF+HGFPELWY+WRHQ+   A LGYRA+APDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMLSLAALGYRAIAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG TDAP  +  SYT  HVVGDLV ++ +LG+ +VF+V HDWGAI+ W+ C+ RPD V
Sbjct  61    RGYGGTDAPP-RVESYTAFHVVGDLVGMLDALGIGRVFVVGHDWGAIMAWHLCLVRPDRV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V+ SV + PR+P  KPVE+MRA FGDDYY+CRFQE G  E D A     K+++   T
Sbjct  120   KALVNTSVAWFPRNPERKPVESMRATFGDDYYVCRFQEPGVAEEDFAKADIAKLIQLFLT  179

Query  791   DRKAGPPCLPKENPFGIS-------TDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
              R   PP +PK+   GIS         Q +LPSWL++ D+ YYA+++   GFTGG NYYR
Sbjct  180   GRDPSPPIVPKD--VGISGLIKLLDQQQVELPSWLTDDDISYYATQFSRTGFTGGFNYYR  237

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
              ++LNWEL+A WTG  ++VPVKF+VGD+D+ Y  PG+KEY+H GGFKK VP LE++VV+E
Sbjct  238   CLDLNWELSAPWTGARIEVPVKFIVGDLDLTYHFPGVKEYIHDGGFKKAVPNLEDVVVME  297

Query  452   GGGHFLNQERPEEV  411
             G  HFL QE+P+EV
Sbjct  298   GVAHFLQQEKPQEV  311



>ref|XP_004247402.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=318

 Score =   384 bits (985),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 236/308 (77%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+HKTV  NGI MHVAE G+GP +LFLHGFPELWY+WRHQL +F+  GYRA+APDLR
Sbjct  1     MEKIQHKTVSANGIKMHVAEIGEGPAVLFLHGFPELWYSWRHQLLYFSNKGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+ PS + SSYT  H+VGDL++L+  L ++KVFL+ HDWGA+I W+FC+FRPD +K
Sbjct  61    GYGDTEIPS-EISSYTAFHIVGDLISLLDILDLEKVFLIGHDWGALIAWFFCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++S   RPR+P  KP++ +R   GDDYY+CRFQ+ G +E + A   + K++    + 
Sbjct  120   ALVNLSCELRPRNPLRKPIDCLRELLGDDYYMCRFQKPGEVEEEFASIDTAKLIIGFLSS  179

Query  788   RKAGPPCLPKENPFGISTDQ--PKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             R   PPC+PKE  F  +  Q    LPSWL+++D+ YYA K +  GFTGGLNYYR+++ NW
Sbjct  180   RDTRPPCIPKEIGFHQAFAQLPAALPSWLTQEDVNYYAEKLNKTGFTGGLNYYRNMDKNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA ++G +++VP KF+VG++D+ Y  PGIKEY+H GGFKK+VP LEE+VV+EG  HF+
Sbjct  240   ELTALFSGCKIQVPTKFVVGELDLTYNIPGIKEYIHNGGFKKEVPSLEEVVVMEGAAHFI  299

Query  434   NQERPEEV  411
             NQE+P+E+
Sbjct  300   NQEKPDEI  307



>ref|XP_004239806.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   384 bits (985),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 233/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEHK V VNG+NMH+AE GQGP ILF+HGFPELWY+WRHQ+ + A  GYRAVAPDLR
Sbjct  1     MDKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS ++  H+VGD+VAL++++  +  KVF+VAHDWGA+I W+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFSIFHLVGDVVALLEAISPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V+ SV F PR+P M  VE ++A +G+D+YI RFQ  G IE++ A  G++ VL+KI
Sbjct  121   KVKALVNSSVHFFPRNPNMNTVEGLKAVYGEDHYISRFQVPGDIEAEFAPIGAKSVLKKI  180

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK        D P  L SWLSE++L YYA+K++  GFTGG+NYYR++ +
Sbjct  181   LTFRDTAPFYFPKGKGLEALPDAPVALSSWLSEEELDYYANKFEKTGFTGGVNYYRALPI  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG ++KVP KF+VG+ D+VY  PG KEY+H GGFK DVPLLEE+VV+EG  H
Sbjct  241   NWELTAPWTGAQLKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKNDVPLLEEVVVLEGAAH  300

Query  440   FLNQERPEEV  411
             F+NQERP E+
Sbjct  301   FVNQERPHEI  310



>ref|XP_004252913.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=323

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 234/306 (76%), Gaps = 7/306 (2%)
 Frame = -3

Query  1316  EHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGYGE  1137
             +HK V+VNGINMHV EKG GP +LF+HGFPELWY+WRHQ+ F A  GYRA+APDLRGYG+
Sbjct  7     DHKIVEVNGINMHVVEKGHGPFVLFIHGFPELWYSWRHQIIFMAKHGYRAMAPDLRGYGD  66

Query  1136  TDA-PSLQPSSYTCLHVVGDLVALVQSLGV--DKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             T   P   PS ++ L VVGDLV L+ ++    DKVF+V HDWGA I W  C+ RPD VKA
Sbjct  67    TTGVPKDDPSKFSSLRVVGDLVELLNTIVSEEDKVFVVGHDWGAKIAWELCLLRPDKVKA  126

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V++SVPF PR+P  KP+E+++A +GDDYY+ RFQE G +E++ A  G++KVL K  T R
Sbjct  127   LVNMSVPFSPRNPKRKPIESLKAIYGDDYYVVRFQEPGVMEAEFAKIGTKKVLGKFLTYR  186

Query  785   KAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
               GP  +PK  PF    D P  LPSWLS++++ Y+ASKY+  GFTGG NYYR+++LNWEL
Sbjct  187   NPGPLYMPKGKPF---DDSPVILPSWLSQKEVDYFASKYEQTGFTGGFNYYRALDLNWEL  243

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TAAW+G +VKVPVKF+VGD+D+ Y  PG K+Y++ GG KKDVPLLE++V++E  GHFL Q
Sbjct  244   TAAWSGAKVKVPVKFIVGDLDLTYNAPGAKDYINKGGMKKDVPLLEKVVILENVGHFLQQ  303

Query  428   ERPEEV  411
             E+P+E+
Sbjct  304   EKPDEI  309



>ref|NP_001275417.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81892.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 234/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK V VNG+NMH+AE G+GP ILF+HGFPELWY+WRHQ+ + A  GYRAVAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS ++ LH+VGD+VAL++++    +KVF+VAHDWGA+I W+ C+FRPD
Sbjct  61    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F  R+P M  VE ++A +G+D+YI RFQ  G IE++ A  G++ VL+KI
Sbjct  121   KVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  180

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK        D P  L SWLSE++L YYA+K++  GFTG +NYYR++ +
Sbjct  181   LTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPI  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG +VKVP KF+VG+ D+VY  PG KEY+H GGFKKDVPLLEE+VV+EG  H
Sbjct  241   NWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAH  300

Query  440   FLNQERPEEV  411
             F++QERP E+
Sbjct  301   FVSQERPHEI  310



>ref|XP_009788447.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=323

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 231/306 (75%), Gaps = 7/306 (2%)
 Frame = -3

Query  1316  EHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGYGE  1137
             EHKTV VNGINMHV E GQGPVILF+HGFPELWY+WRHQ+ F +  GYRAVAPDLRG+G+
Sbjct  6     EHKTVVVNGINMHVVEAGQGPVILFIHGFPELWYSWRHQISFASKHGYRAVAPDLRGFGD  65

Query  1136  TDAPSLQ-PSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             T   S   PS +T L VVGDLV L+ ++    +KVF+V HDWGAII W  C+FRPD VKA
Sbjct  66    TTEVSKDDPSKFTSLQVVGDLVELLNTIAPKEEKVFVVGHDWGAIIAWALCLFRPDKVKA  125

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V++SV F  R+P  KP+E + A +G+DYYI RFQE G IE++ A  G++KVL K  + R
Sbjct  126   LVNLSVAFSLRNPKRKPLETLCAVYGEDYYIVRFQEPGEIEAEFAKIGTKKVLEKFLSYR  185

Query  785   KAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
               GP  LPK  PF    D P  LPSWL E+D+ Y ASKY+  GFTGG+NYYR+I+LNWEL
Sbjct  186   NPGPLYLPKGKPF---DDNPVILPSWLPEKDVDYIASKYEKSGFTGGVNYYRAIDLNWEL  242

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TAAWTG +VKVPVKF+VGD+D+ Y  PG+K+YVH G  KKDVPLLEE+V++E  GHFL Q
Sbjct  243   TAAWTGGKVKVPVKFIVGDLDLTYNAPGVKDYVHKGRMKKDVPLLEEVVILENVGHFLQQ  302

Query  428   ERPEEV  411
             E+P+ +
Sbjct  303   EKPDVI  308



>ref|XP_010684348.1| PREDICTED: bifunctional epoxide hydrolase 2 [Beta vulgaris subsp. 
vulgaris]
Length=319

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 226/309 (73%), Gaps = 4/309 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVN-GINMHVAEKGQGP--VILFLHGFPELWYTWRHQLQFFAGLGYRAVAP  1158
             M+ IEH+ + +N GINMH+AE G+     IL LHGFPELWYTWRHQL   +  GYRA+AP
Sbjct  1     MDKIEHRNILLNNGINMHIAEIGEAKKGTILLLHGFPELWYTWRHQLLSLSAAGYRALAP  60

Query  1157  DLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPD  978
             DLRGYG+TDAP     SYT  HVVGDL++L+    +D++FLV HDWGAII W+F +FRPD
Sbjct  61    DLRGYGDTDAPPCA-ESYTSFHVVGDLISLIDHFHIDQIFLVGHDWGAIIAWHFSLFRPD  119

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              +KA V++SVPF PR+PT+KPVE +R   GDD+YICRFQE G +E ++    + K+++K 
Sbjct  120   RIKALVNLSVPFTPRNPTLKPVERLRNSLGDDFYICRFQEPGEMEKELDSIDTAKLMKKF  179

Query  797   FTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
                R   PPC PK      +     LPSWLSE+D+ Y+A K+   GFTGGLNYYRS++L 
Sbjct  180   LVSRDPEPPCFPKGKLAAAAEKPVTLPSWLSEEDINYFADKFKQTGFTGGLNYYRSMDLT  239

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A WTG++VKVP KF++G++D+ Y  P  K Y+H GG K+DVPLL+++V++EG  HF
Sbjct  240   WELMAPWTGMQVKVPTKFILGELDITYRFPLTKNYIHNGGMKRDVPLLDDVVIMEGAAHF  299

Query  437   LNQERPEEV  411
             +NQERPEE+
Sbjct  300   INQERPEEI  308



>pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
 pdb|3CXU|B Chain B, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
Length=328

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 234/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEHK V VNG+NMH+AE G+GP ILF+HGFPELWY+WRHQ+ + A  GYRAVAPDLR
Sbjct  8     MKKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  67

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS ++ LH+VGD+VAL++++  +  KVF+VAHDWGA+I W+ C+FRPD
Sbjct  68    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  127

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F  R+P M  VE ++A FG+D+YI RFQ  G IE++ A  G++ VL+KI
Sbjct  128   KVKALVNLSVHFSKRNPKMNVVEGLKAIFGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  187

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK        D P  L SWLSE++L YYA+K++  GFTG +NYYR++ +
Sbjct  188   LTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPI  247

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG +VKVP KF+VG+ D+VY  PG KEY+H GGFKKDVPLLEE+VV+EG  H
Sbjct  248   NWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAH  307

Query  440   FLNQERPEEV  411
             F++QERP E+
Sbjct  308   FVSQERPHEI  317



>gb|KCW50060.1| hypothetical protein EUGRSUZ_K03501 [Eucalyptus grandis]
Length=332

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/313 (58%), Positives = 229/313 (73%), Gaps = 11/313 (4%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGP-VILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             ME IEH TV+ NGINMHVA  G GP  +LF+HGFPELWY+WRHQ+   A LGYRA+APDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMLSLAALGYRAIAPDL  60

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLV  972
             RGYG TDAP  +  SYT  HVVGDLV ++ +LG+ +VF+V HDWGAI+ W+ C+ RPD V
Sbjct  61    RGYGGTDAPP-RVESYTAFHVVGDLVGMLDALGIGRVFVVGHDWGAIMAWHLCLVRPDRV  119

Query  971   KAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             KA V+ SV + PR+P  KPVE+MRA FGDDYY+CRFQE G  E D A     K+++   T
Sbjct  120   KALVNTSVAWFPRNPERKPVESMRATFGDDYYVCRFQEPGVAEEDFAKADIAKLIQLFLT  179

Query  791   DRKAGPPCLPKENPFGIS-------TDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
              R   PP +PK+   GIS         Q +LPSWL++ D+ YYA+++   GFTGG NYYR
Sbjct  180   GRDPSPPIVPKD--VGISGLIKLLDQQQVELPSWLTDDDISYYATQFSRTGFTGGFNYYR  237

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
              ++LNWEL+A WTG  ++VPVKF+VGD+D+ Y  PG+KEY+H GGFKK VP LE++VV+E
Sbjct  238   CLDLNWELSAPWTGARIEVPVKFIVGDLDLTYHFPGVKEYIHDGGFKKAVPNLEDVVVME  297

Query  452   GGGHFLNQERPEE  414
             G  HFL QE+P+E
Sbjct  298   GVAHFLQQEKPQE  310



>ref|XP_011079630.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=316

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 232/307 (76%), Gaps = 3/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I HK + VNGINMHVAE G GP +LFLHGFPELWY+WRHQ+ + +  GYRA+APDLR
Sbjct  1     MERIVHKNLNVNGINMHVAEIGDGPAVLFLHGFPELWYSWRHQMLYLSARGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP   PSSYT  H+VGDLVAL+ +LG+D+VFLVAHDWGA+I W FC+FRPD +K
Sbjct  61    GYGDTDAPP-SPSSYTTFHIVGDLVALLDALGLDQVFLVAHDWGALIAWCFCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PRHP +K ++  R   GDD+Y+CRFQ+ G  E   A     +V++ +F+ 
Sbjct  120   ALVNMSVQFHPRHPEIKTLQRYRDLLGDDFYMCRFQKPGEAEEAFACEEITQVIKSLFSF  179

Query  788   RKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   P  +PKE    +    P +LP WL+E+D+ Y+A+K+   GFTGGLNYYR+++L+WE
Sbjct  180   RGGRPIVVPKELGLEVLFQAPAELPPWLTEEDINYFATKFKKTGFTGGLNYYRAMDLSWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             L   WTG+EVKVPVKF++GD D+ Y  PG++EY+H GGFKKDVP L E+VV+EG  HF+N
Sbjct  240   LMGPWTGVEVKVPVKFIIGDADITYHVPGVEEYIHKGGFKKDVPDL-EVVVMEGVAHFIN  298

Query  431   QERPEEV  411
             QE+ EEV
Sbjct  299   QEKAEEV  305



>ref|XP_006359858.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 235/308 (76%), Gaps = 3/308 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+HK V VNGI MHVAE G+GP +LFLHGFPELWY+WRHQL +F+  GYRA+APDLR
Sbjct  1     MEKIQHKNVTVNGIKMHVAEIGEGPAVLFLHGFPELWYSWRHQLLYFSNKGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+T+ PS + SSYT  H+VGDL+AL+  L ++KVFLV HDWGA+I W+FC+FRPD +K
Sbjct  61    GYGDTEIPS-EISSYTAFHIVGDLIALLDILDLEKVFLVGHDWGALIAWFFCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++S   RPR+P  KP++ +R   GDDYY+CRFQ+ G +E + A   + K++    T 
Sbjct  120   ALVNLSCELRPRNPLRKPIDCLRELLGDDYYMCRFQKPGEVEEEFASIDTAKLMIGFLTS  179

Query  788   RKAGPPCLPKENPFGISTDQ--PKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNW  615
             R   PPC+PKE  F  +  Q    LPSWL+++D+ YY  K +  GFTGGLNYYR+++ NW
Sbjct  180   RDTRPPCIPKEIGFHQAFAQLPATLPSWLTQEDVNYYVEKLNKTGFTGGLNYYRNMDKNW  239

Query  614   ELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFL  435
             ELTA ++G +++VP KF+VG++D+ Y  PGIKEY+H GGFKK+VP LEE+VV+EG  HF+
Sbjct  240   ELTAPFSGCKIQVPTKFVVGELDLTYHIPGIKEYIHNGGFKKEVPSLEEVVVMEGAAHFI  299

Query  434   NQERPEEV  411
             NQE+P+E+
Sbjct  300   NQEKPDEI  307



>ref|XP_010649601.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Vitis vinifera]
Length=336

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/305 (60%), Positives = 233/305 (76%), Gaps = 5/305 (2%)
 Frame = -3

Query  1322  GIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGY  1143
             G   +T K NGIN+HVAEKGQGP+ILFLHGFPELWY+WRHQ+  FA LGYRA+APDLRGY
Sbjct  25    GGNEQTFKANGINIHVAEKGQGPIILFLHGFPELWYSWRHQIHAFASLGYRALAPDLRGY  84

Query  1142  GETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKAF  963
             G++DAP+    SYTCLHVVGDL+ ++ ++G +KVF+V HDWGAII WY C+FRPD VKA 
Sbjct  85    GDSDAPA-DVGSYTCLHVVGDLIGVLDAMGANKVFVVGHDWGAIIAWYLCLFRPDRVKAL  143

Query  962   VDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDRK  783
             V++SVP    +P  KP++  RA  GDD+YICRFQE G +E+ +A  G  +VL+   T RK
Sbjct  144   VNMSVPSFLVNPLQKPIQIFRALNGDDFYICRFQEPG-MEAALAEIGPARVLKSALTSRK  202

Query  782   AGPPCLPK-ENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELT  606
              GPP LP+ +  F  + D   LPSWLSE+++ YY SKY+  GFTGGLNYYR+++LNWELT
Sbjct  203   TGPPRLPEGQQAFAGTPDV--LPSWLSEEEVNYYVSKYERTGFTGGLNYYRNMDLNWELT  260

Query  605   AAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQE  426
             AAW G ++KVP KF+VG +D+ Y T G KE++    F+K VP L EIVV+EG GHFL++E
Sbjct  261   AAWAGSQIKVPSKFVVGHLDLTYNTMGFKEFMKNDEFRKHVPFLGEIVVMEGVGHFLHEE  320

Query  425   RPEEV  411
             +P+EV
Sbjct  321   KPDEV  325



>ref|NP_001275381.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81890.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 231/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK V VNG+NMH+AE GQGP ILF+HGFPELWY+WRHQ+ + A  GYRAVAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS ++  H+VGD+VAL++++    DKVF+VAHDWGA+I W+ C+FRPD
Sbjct  61    GYGDTTGAPINDPSKFSIFHLVGDVVALLEAIAPNEDKVFVVAHDWGALIAWHLCLFRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV + PR+  M P+E ++A +G+DYYICRFQ  G IE++ A  G++ VL+K+
Sbjct  121   KVKALVNLSVHYHPRNSNMNPIEGLKALYGEDYYICRFQVPGEIEAEFAPIGAKSVLKKM  180

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK        D P  L +WLSE++L YYA+K++  GFTG LNYYR++++
Sbjct  181   LTYRDPAPFYFPKGKGLEAIADAPIVLSTWLSEEELDYYANKFEQTGFTGALNYYRALSI  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             N ELTA WTG +V VP KF+VG+ D+ Y   G KEY+H GGFKK VPLLEE+VV+EG  H
Sbjct  241   NSELTAPWTGAQVNVPTKFIVGEFDLAYHMRGAKEYIHNGGFKKYVPLLEEVVVLEGAAH  300

Query  440   FLNQERPEEV  411
             F+NQERP E+
Sbjct  301   FVNQERPHEI  310



>ref|XP_010105136.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03944.1| Epoxide hydrolase 2 [Morus notabilis]
Length=347

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 226/294 (77%), Gaps = 4/294 (1%)
 Frame = -3

Query  1283  MHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGYGETDAPSLQPSSY  1104
             MHVAEKG GPVIL +HGFPELWYTWRHQ+   A LGYRA+APDLRGYG+TDAP    + Y
Sbjct  1     MHVAEKGNGPVILLVHGFPELWYTWRHQIMALASLGYRAIAPDLRGYGDTDAPD-SAAKY  59

Query  1103  TCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPDLVKAFVDISVPFRPRH  930
             TC  VVGDL+AL+ ++    +KVF+V HDWGA+I WY C+FRPD VKA V++SV F PR+
Sbjct  60    TCFDVVGDLIALLDAVAGEEEKVFVVGHDWGALISWYLCLFRPDRVKALVNLSVAFNPRN  119

Query  929   PTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDRKAGPPCLPKENP  750
             P  KP E +RA +GDDYY+CRFQE G IE++ A  G+  V+++ +T R   P  +PK   
Sbjct  120   PNRKPYETLRALYGDDYYVCRFQEPGEIEAEFAEIGAATVIKEFYTYRSPKPLFMPKGKC  179

Query  749   FGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELTAAWTGIEVKVP  573
             FG   D P  LPSW+SE+D+ YYASK++  GFTGG+NYYR+I+ NWELTA WTG +++VP
Sbjct  180   FGHPKDTPIALPSWVSEEDMDYYASKFEKTGFTGGINYYRNIDRNWELTAPWTGAKMQVP  239

Query  572   VKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQERPEEV  411
             VKF+VGD D+VY   G K+Y+H GGFK+DVP L+E+VV+EG GHF+N+E+ +EV
Sbjct  240   VKFIVGDQDLVYNLYGTKDYIHKGGFKRDVPFLQEVVVMEGVGHFVNEEKADEV  293



>ref|XP_004152245.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156836.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52816.1| hypothetical protein Csa_4G001830 [Cucumis sativus]
Length=316

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 221/306 (72%), Gaps = 1/306 (0%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH T+  NGI MH+A  G GPV+L LHGFPELWY+WRHQL + + +GYRA+APDLR
Sbjct  1     METIEHTTINTNGIKMHIASIGTGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             G+G+TDAP    ++YT  H+VGDLV  +  LG++KVF+V HDWGAII WYFC+FRPD VK
Sbjct  61    GFGDTDAPESH-TAYTAFHIVGDLVGALDELGIEKVFVVGHDWGAIIAWYFCLFRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V++SV F PR+P +  V+  R  FGDD+YICRFQ  G  E D     + ++ +KI   
Sbjct  120   ALVNLSVHFLPRNPAISFVQGFRFAFGDDFYICRFQVPGEAEKDFGSIDTTELFKKILCG  179

Query  788   RKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWEL  609
             R   PP LPK            LPSWLS++D+ Y+A+K++  GFTGG NYYR+++L WEL
Sbjct  180   RTPDPPILPKGLGIRSIPSPHDLPSWLSQEDINYFATKFNHTGFTGGFNYYRALDLTWEL  239

Query  608   TAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQ  429
             TA+W   +V+VPVKF+VGD+D+ Y  PG KEY+H GGFK DVP LEE+VV+E   HF+NQ
Sbjct  240   TASWNKAQVQVPVKFIVGDLDLTYYFPGAKEYIHNGGFKTDVPFLEEVVVMEDTAHFINQ  299

Query  428   ERPEEV  411
             ERP E+
Sbjct  300   ERPHEI  305



>gb|EMT04118.1| hypothetical protein F775_13984 [Aegilops tauschii]
Length=322

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 228/305 (75%), Gaps = 3/305 (1%)
 Frame = -3

Query  1319  IEHKTVKVNGINMHVAEKGQG--PVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             I H++V+VNG+ +HVAE G    PV+L LHGFPELWYTWRHQ+   A  GYRAVAPD+ G
Sbjct  7     ITHRSVEVNGVRLHVAEAGPAGAPVVLLLHGFPELWYTWRHQMPALAAAGYRAVAPDMPG  66

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             YG+++APS  P  YT LH+VGD VAL+ SLG ++VF+V HDWGAII W  C+FRPD VKA
Sbjct  67    YGDSEAPSAGPDQYTALHIVGDFVALIDSLGQERVFVVGHDWGAIIAWSLCLFRPDRVKA  126

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V +SVPF PR P +KPV+A+RA +GDD+YIC FQE G IE++    G+E VLRK F DR
Sbjct  127   LVPLSVPFIPRSPAVKPVDAVRALYGDDFYICSFQEPGAIEAEFKRLGTELVLRKFFADR  186

Query  785   KAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELT  606
               GP  +PK   +G   D+  LPSW++E+D+KYY ++ D  GFTGGLNYYR++N  WELT
Sbjct  187   TPGPLFIPKSG-WGSPDDEVPLPSWITEEDVKYYTTQLDKSGFTGGLNYYRALNKTWELT  245

Query  605   AAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQE  426
             + WTG E+ VP KF VGD+D+ Y   G K +++ GG KK VPLL+++V+++  GHF+N++
Sbjct  246   SPWTGAEIMVPTKFTVGDLDLTYNIAGAKVFINKGGLKKFVPLLDDVVIMKDVGHFINEQ  305

Query  425   RPEEV  411
             +PEE+
Sbjct  306   KPEEI  310



>pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
 pdb|2CJP|B Chain B, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
Length=328

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 234/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             M+ IEHK V VNG+NMH+AE G+GP ILF+HGFPELWY+WRHQ+ + A  GYRAVAPDLR
Sbjct  8     MKKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  67

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS ++ LH+VGD+VAL++++  +  KVF+VAHDWGA+I W+ C+FRPD
Sbjct  68    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  127

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F  R+P M  VE ++A +G+D+YI RFQ  G IE++ A  G++ VL+KI
Sbjct  128   KVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKI  187

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK        D P  L SWLSE++L YYA+K++  GFTG +NYYR++ +
Sbjct  188   LTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPI  247

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG +VKVP KF+VG+ D+VY  PG KEY+H GGFKKDVPLLEE+VV+EG  H
Sbjct  248   NWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAH  307

Query  440   FLNQERPEEV  411
             F++QERP E+
Sbjct  308   FVSQERPHEI  317



>gb|AFZ93648.1| epoxide hydrolase [Euphorbia lathyris]
 gb|AFZ93653.1| epoxide hydrolase [Euphorbia lathyris]
Length=315

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 224/307 (73%), Gaps = 4/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEH  V  NGINMHVA  G+G  ILFLHG+PELWY+WRHQL   + LGYR +APDLR
Sbjct  1     MEKIEHTKVATNGINMHVASIGEGRPILFLHGYPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG+TDAP      YT LH+VGDLV L+ +L +D+VFLV HDWGAII WY C+FRPD +K
Sbjct  61    GYGDTDAPH-SVEKYTVLHIVGDLVGLLDALQIDQVFLVGHDWGAIIAWYVCLFRPDRIK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V+ SVPF PR PT   VE  R  +G+DYYI R+Q+ G  E++ A   S K+ R I T+
Sbjct  120   ALVNTSVPFLPRDPTTPFVEFYRNLYGEDYYIVRYQKPGVAEAEYAKINSAKLFRIILTN  179

Query  788   RKAGP-PCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R   P   LPK+   G   D   LP WL+E+D+ YYA K+   GFTGG+NYYR+ +  WE
Sbjct  180   RDPNPEATLPKD--IGKQPDPSTLPCWLTEKDVDYYARKFHKTGFTGGINYYRNFDRTWE  237

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             LTAAWTG +VKVPVKF+VGD+D+VY  PG+KEY+H GGFK+DVP LEE+V++EG  HFLN
Sbjct  238   LTAAWTGAQVKVPVKFIVGDLDLVYNIPGMKEYIHNGGFKRDVPFLEEVVIMEGVAHFLN  297

Query  431   QERPEEV  411
             QE+ +E+
Sbjct  298   QEKADEI  304



>gb|KDP27828.1| hypothetical protein JCGZ_18908 [Jatropha curcas]
Length=321

 Score =   381 bits (979),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 232/311 (75%), Gaps = 6/311 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPD  1155
             ME IEHKTV VNGINMHVAE G  QGPVILF+HGFPELWY WR ++   A  GYRAVAPD
Sbjct  1     MEAIEHKTVNVNGINMHVAELGPVQGPVILFIHGFPELWYCWRREILALASQGYRAVAPD  60

Query  1154  LRGYGETDAPSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRP  981
             LRGYG+TDAP+  P SY C H+VGDL+ L+ ++    +KVF V HDWGA I W  C+FRP
Sbjct  61    LRGYGDTDAPA-DPQSYPCFHIVGDLIGLLDAVAPQQEKVFGVGHDWGAPIAWDLCLFRP  119

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D VKA V++SVPF  R+P MK V+A RA +GDD+Y+CRFQE G IE++ A  G+E+V+++
Sbjct  120   DRVKALVNLSVPFFRRNPEMKFVDAFRAAYGDDFYMCRFQEYGDIEAEFAELGTERVMKE  179

Query  800   IFTDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
               T R  GP   PK   F      P  LPSWLSE+++ YY +K+D  G TGG+NYYR+I+
Sbjct  180   FLTYRNPGPFIFPKGKVFSQPAGDPIILPSWLSEEEVHYYTTKFDKTGLTGGVNYYRNID  239

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
              NWELTA WT  +VKVP KF+VGD D+VY   G+K+Y+  GGFK+DVPLLEE+VV+EG  
Sbjct  240   RNWELTAPWTEAQVKVPSKFIVGDEDLVYRFVGMKDYIEKGGFKRDVPLLEEVVVMEGVA  299

Query  443   HFLNQERPEEV  411
             HFLNQERP+E+
Sbjct  300   HFLNQERPDEI  310



>ref|XP_009393199.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   381 bits (979),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 233/307 (76%), Gaps = 5/307 (2%)
 Frame = -3

Query  1322  GIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRGY  1143
             GI H+TV+VNGI++HVAEKG+GPV+L +HGFPELWY+WRHQ+   A  GYRA+APDLRGY
Sbjct  5     GITHRTVEVNGISIHVAEKGEGPVVLLVHGFPELWYSWRHQILGLAARGYRALAPDLRGY  64

Query  1142  GETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKAF  963
             G++ AP    +SY+  H+VGDLVAL+ +L + +VFLV HDWGA++ WY C+FRPD VKA 
Sbjct  65    GDSSAPP-SVASYSVFHIVGDLVALLDALAIPQVFLVGHDWGALVAWYMCLFRPDRVKAL  123

Query  962   VDISV---PFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFT  792
             V++SV   PF PR+P  K VE  R+ +GDDYY+CRFQE G +E+D    G+E +LR +F 
Sbjct  124   VNLSVALVPFIPRNPAGKLVEYFRSLYGDDYYVCRFQEPGAVEADFDRLGTESLLRMVFA  183

Query  791   DRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
              R  GP  LPKE    +    P LP WLSE+D+ Y+ SK+D  GFTG +NYYR ++LN E
Sbjct  184   SRNPGPLLLPKEAFVPLDRQIP-LPDWLSEEDISYFTSKFDESGFTGPVNYYRCLDLNRE  242

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             L A W G++++VPVKF+VGD D+ Y  PGI++Y+HGGGFK+DVP+LEE+VV+EG  HF+N
Sbjct  243   LGAPWCGVKIQVPVKFIVGDQDLTYHYPGIQDYLHGGGFKEDVPMLEEVVVMEGVAHFIN  302

Query  431   QERPEEV  411
             QE+  E+
Sbjct  303   QEKAHEI  309



>ref|XP_006414412.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
 gb|ESQ55865.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
Length=374

 Score =   383 bits (983),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 233/314 (74%), Gaps = 8/314 (3%)
 Frame = -3

Query  1331  KMEGIEHKTVKVNGINMHVAE---KGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVA  1161
             K++G+EHKT+ VNGINMH AE    G+ P+ILF+HGFPELWYTWRHQ+   + LGYR +A
Sbjct  48    KLDGVEHKTLNVNGINMHYAEISGSGRDPIILFIHGFPELWYTWRHQMAALSSLGYRTIA  107

Query  1160  PDLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSL---GVDKVFLVAHDWGAIIGWYFCM  990
             PDLRGYG+TDAP  +   YT L+VVGDLVAL+ ++   G + VF+V HDWGA+I W  C 
Sbjct  108   PDLRGYGDTDAPE-KVEDYTYLNVVGDLVALIDAVTTSGDEAVFVVGHDWGAMIAWQLCQ  166

Query  989   FRPDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKV  810
             +RP+ VKA V++SV F PR+P   PV  +R  FGDDYYICRFQ+ G IE++    G+E V
Sbjct  167   YRPEKVKALVNMSVVFSPRYPDRVPVPTLRHVFGDDYYICRFQKPGEIEAEFKKLGTENV  226

Query  809   LRKIFTDRKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYR  633
             L+K  T +  GP  LPK   F  S +    LP WL+++DL YY +KYD KGFTG +NYYR
Sbjct  227   LKKFLTYKTPGPLYLPKPKLFKRSENAASALPPWLTQEDLDYYVNKYDKKGFTGPINYYR  286

Query  632   SINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIE  453
             +I+ NWELTA WTG ++ VPVKF+VGD D+ Y +PG KEY+HGGGFK+DVPLL+E VV+ 
Sbjct  287   NIDRNWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYIHGGGFKRDVPLLDETVVLN  346

Query  452   GGGHFLNQERPEEV  411
             G GHFL++E P+E+
Sbjct  347   GLGHFLHEESPDEI  360



>ref|XP_006342825.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=334

 Score =   381 bits (979),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 234/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEG-IEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
             MEG +EHKTV VNGINMH  E G+GP++LF+HGFPE WY+WRHQ+ F A  GYRAVAPDL
Sbjct  1     MEGQVEHKTVAVNGINMHFVEIGEGPIVLFIHGFPECWYSWRHQMSFMAKQGYRAVAPDL  60

Query  1151  RGYGETD-APSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRP  981
             RGYG+T  AP+  PS +T L +VGDLV L+ ++    +KVF+V HDWGA++ W  C++RP
Sbjct  61    RGYGDTTGAPNDDPSKFTTLDIVGDLVELLNNIAPQEEKVFVVGHDWGAVVSWALCLYRP  120

Query  980   DLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRK  801
             D VKAFV +SV F PR+P  KP+E +R  +GDDYY+ RFQE G IE +    G + V++K
Sbjct  121   DKVKAFVCLSVAFNPRNPVKKPLETLRKVYGDDYYVVRFQEPGVIEGEFEELGIKNVVKK  180

Query  800   IFTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
               T R  GP  L K  PF  ++   +LP WLS++D+ +YA+KY   GFTG LNYYRSI+ 
Sbjct  181   FLTYRTPGPLYLKKGKPFEDASSTDELPGWLSDEDIDFYANKYKQIGFTGALNYYRSIDR  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWE+TAAWTG +++VPVKF+VGD+D+ Y  PG K+Y+H GGFKK VPLLE++VV++G GH
Sbjct  241   NWEVTAAWTGAKIQVPVKFIVGDLDITYNAPGAKDYLHKGGFKKLVPLLEDVVVLQGVGH  300

Query  440   FLNQERPEEV  411
             F++QE+P+E+
Sbjct  301   FIHQEKPKEI  310



>emb|CDY09722.1| BnaC07g33390D [Brassica napus]
Length=329

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 235/315 (75%), Gaps = 10/315 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAE-----KGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAV  1164
             ++G+EHKT+KVNGINMHVAE      G  P+ILF+HGFPELWYTWRHQ+   + LGYR +
Sbjct  4     LDGVEHKTLKVNGINMHVAELPGSGSGGDPIILFIHGFPELWYTWRHQMTALSSLGYRTI  63

Query  1163  APDLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSL--GVDKVFLVAHDWGAIIGWYFCM  990
             APDLRGYG+TDAP  +   YT  ++VGDLVAL+ ++  G + VF+V HDWGA+I W  CM
Sbjct  64    APDLRGYGDTDAPE-KVEDYTYFNIVGDLVALIDAVTGGDEAVFVVGHDWGAMIAWQLCM  122

Query  989   FRPDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKV  810
             +RP+ VKA V++SV F PR+P   P+  +R FFGDDYYICRFQ+ G IE++    G+EKV
Sbjct  123   YRPEKVKALVNMSVLFSPRNPDRVPIPTLRRFFGDDYYICRFQKPGEIEAEFKKLGTEKV  182

Query  809   LRKIFTDRKAGPPCLPKENPFGISTD--QPKLPSWLSEQDLKYYASKYDLKGFTGGLNYY  636
             L++  T +  GP  LPK   F  S +     LP WL+++DL YY + Y+ KGFTG +NYY
Sbjct  183   LKEFLTYKTPGPLYLPKGKLFKSSENGASSALPPWLTQEDLDYYVTNYNNKGFTGPINYY  242

Query  635   RSINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVI  456
             R+I+ NWELTA WTG ++ VPVKF+VGD D+ Y +PG KEY++GGGFKKDVPLL+E VV+
Sbjct  243   RNIDRNWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETVVL  302

Query  455   EGGGHFLNQERPEEV  411
             +G GHFL++E PEE+
Sbjct  303   KGVGHFLHEESPEEI  317



>ref|XP_009136735.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=362

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 235/316 (74%), Gaps = 11/316 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAE-----KGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAV  1164
             ++G+EHKT+KVNGINMHVAE      G  P+ILF+HGFPELWYTWRHQ+   + LGYR +
Sbjct  36    LDGVEHKTLKVNGINMHVAELPGSGSGGEPIILFIHGFPELWYTWRHQMTALSSLGYRTI  95

Query  1163  APDLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSL--GVDKVFLVAHDWGAIIGWYFCM  990
             APDLRGYG+TDAP  +   YT  ++VGDLVAL+ ++  G + VF+V HDWGA+I W  CM
Sbjct  96    APDLRGYGDTDAPE-KMEDYTYFNIVGDLVALIDAVTGGDEAVFVVGHDWGAMIAWQLCM  154

Query  989   FRPDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKV  810
             +RP+ VKA V++SV F PR P   P+  +R FFGDDYYICRFQ+ G IE +    G+EKV
Sbjct  155   YRPEKVKALVNMSVLFSPRSPDRVPIPTLRRFFGDDYYICRFQKPGEIELEFKKLGTEKV  214

Query  809   LRKIFTDRKAGPPCLPKENPFGISTD---QPKLPSWLSEQDLKYYASKYDLKGFTGGLNY  639
             L++  T +  GP  LPK   F  S +      LP WL+++DL YY +KYD KGFTG +NY
Sbjct  215   LKEFLTYKTPGPLYLPKGKLFKSSENGGASSALPPWLTQEDLDYYVTKYDNKGFTGPINY  274

Query  638   YRSINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVV  459
             YR+I+ NWELTA WTG +++VPVKF+VGD D+ Y +PG KEY++GGGFKKDVPLL+E VV
Sbjct  275   YRNIDRNWELTAPWTGAKIRVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETVV  334

Query  458   IEGGGHFLNQERPEEV  411
             ++G GHFL++E PEE+
Sbjct  335   LKGVGHFLHEESPEEI  350



>ref|XP_002314368.1| hypothetical protein POPTR_0010s01430g [Populus trichocarpa]
 gb|EEF00539.1| hypothetical protein POPTR_0010s01430g [Populus trichocarpa]
Length=335

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 239/311 (77%), Gaps = 7/311 (2%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
               IEH+T+ VNGIN+HVA KG    PVILF+HGFP+LWY+WRHQ++  + LGYRAVAPDL
Sbjct  3     SSIEHRTINVNGINIHVAIKGPENAPVILFIHGFPQLWYSWRHQIEALSSLGYRAVAPDL  62

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPD  978
             RGYG+TDAP+ + +SYT LHVVGDL+ L+  +  ++  VF+V HDWGA+I W+  +FRPD
Sbjct  63    RGYGDTDAPA-EVTSYTVLHVVGDLIGLLDVVAPNQESVFVVGHDWGALIAWHLSLFRPD  121

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P+ K +  ++A +GDDYYI RFQE G IE++ A  G+EKVL++ 
Sbjct  122   RVKALVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEF  181

Query  797   FTDRKAGPPCLPKENPF-GISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
              T R   P  LPK   F G   D P  LPSWLSE+D+KYY SK++ KGFTGGLNYYR+++
Sbjct  182   LTYRTPAPIFLPKGQGFNGKPLDTPVVLPSWLSEEDVKYYTSKFEQKGFTGGLNYYRNLD  241

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
              NWELTA WTG ++KVPVKF+VGD D+ Y + G K+Y+  GGFK+DVP L+++VV+EG G
Sbjct  242   RNWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDYIAKGGFKRDVPFLQDLVVMEGVG  301

Query  443   HFLNQERPEEV  411
             HF+N+E+PEE+
Sbjct  302   HFINEEKPEEI  312



>ref|XP_011006450.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=323

 Score =   379 bits (974),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 239/311 (77%), Gaps = 7/311 (2%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDL  1152
               IEH+T+ VNGIN+HVA KG    PVILF+HGFP+LWY+WRHQ++  + LGYRAVAPDL
Sbjct  3     SSIEHRTINVNGINIHVAIKGPENAPVILFIHGFPQLWYSWRHQIEALSSLGYRAVAPDL  62

Query  1151  RGYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPD  978
             RGYG+TDAP+ + +SYT LHVVGDL+ L+  +  ++  VF+V HDWGA+I W+  +FRPD
Sbjct  63    RGYGDTDAPA-EVTSYTVLHVVGDLIGLLDVVAPNQEGVFVVGHDWGALIAWHLSLFRPD  121

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P+ K +  ++A +GDDYYI RFQE G IE++ A  G+EKVL++ 
Sbjct  122   RVKAMVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEF  181

Query  797   FTDRKAGPPCLPKENPF-GISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSIN  624
              T R   P  LPK   F G   D P  LPSWL+E+D+KYY SK++ KGFTGGLNYYR+++
Sbjct  182   LTYRTPAPIFLPKGQGFNGKPLDTPVVLPSWLAEEDVKYYTSKFEQKGFTGGLNYYRNLD  241

Query  623   LNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGG  444
              NWELTA WTG ++KVPVKF+VGD D+ Y + G K+Y+  GGFK+DVP L+++VV+EG G
Sbjct  242   RNWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDYLAKGGFKRDVPFLQDLVVMEGVG  301

Query  443   HFLNQERPEEV  411
             HF+N+E+PEE+
Sbjct  302   HFINEEKPEEI  312



>ref|XP_008807392.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/305 (60%), Positives = 232/305 (76%), Gaps = 3/305 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
              GI H+TV+VNGI MHV EKG+GP +L LHGFPELWY+WRHQ+   A  GYRA+APDLRG
Sbjct  5     SGISHRTVEVNGIRMHVVEKGEGPAVLLLHGFPELWYSWRHQIAGLAARGYRAIAPDLRG  64

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             YG+TDAP    +SY+ LH+VGDLVAL+ +L +  VF+V HDWGA+I WY CMFRPD VKA
Sbjct  65    YGDTDAPP-DVASYSALHIVGDLVALLDALALPHVFVVGHDWGALIAWYLCMFRPDKVKA  123

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V++SV F PR+P MK V+  R  +GDDYYICRFQE G IE+  A  G+  + R I   R
Sbjct  124   LVNLSVAFMPRNPAMKTVDYFRKLYGDDYYICRFQEPGAIEARFAQIGTASIFRTILQSR  183

Query  785   KAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELT  606
               GP  +PKE  + +    P L SWLSE+D+ YYASK+D  GFTG +NYYR +NLNWELT
Sbjct  184   DPGPFLIPKEG-WDLPEKSP-LCSWLSEEDINYYASKFDKSGFTGPVNYYRCMNLNWELT  241

Query  605   AAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQE  426
             A WTG+++KVP KF+VGD+D+ Y  PGI++Y+H GGFK++VPLL+E+VV+EG GHF+NQE
Sbjct  242   APWTGVQIKVPAKFIVGDLDLTYHYPGIQDYIHNGGFKQNVPLLQEVVVMEGVGHFINQE  301

Query  425   RPEEV  411
             +  E+
Sbjct  302   KGHEI  306



>ref|XP_002314371.1| hypothetical protein POPTR_0010s01440g [Populus trichocarpa]
 gb|ABK94011.1| unknown [Populus trichocarpa]
 gb|EEF00542.1| hypothetical protein POPTR_0010s01440g [Populus trichocarpa]
Length=323

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 238/310 (77%), Gaps = 7/310 (2%)
 Frame = -3

Query  1322  GIEHKTVKVNGINMHVAEKG--QGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
              IEH+T+ VNGIN+HVA KG    PVILF+HGFP+LWY+WRHQ++  + LGYRAVAPDLR
Sbjct  4     SIEHRTINVNGINIHVAIKGPENAPVILFIHGFPQLWYSWRHQIEALSSLGYRAVAPDLR  63

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDK--VFLVAHDWGAIIGWYFCMFRPDL  975
             GYG+TDAP+ + +SYT LHVVGDL+ L+  +  ++  VF+V HDWGA++ W+  +FRPD 
Sbjct  64    GYGDTDAPA-EVTSYTVLHVVGDLIGLLDVVAPNQESVFVVGHDWGALMAWHLALFRPDR  122

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKA V++SV F PR+P+ K +  ++A +GDDYYI RFQE G IE++ A  G+EKVL++  
Sbjct  123   VKALVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEFL  182

Query  794   TDRKAGPPCLPKENPF-GISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
             T R   P  LPK   F G   D P  LPSWLSE+D+KYY SKY+ KGFTGGLNYYR+++ 
Sbjct  183   TYRTPAPLFLPKGQGFNGKPLDTPVVLPSWLSEEDVKYYTSKYEQKGFTGGLNYYRNLDR  242

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWELTA WTG ++KVPVKF+VGD D+ Y + G K+++  GGFK+DVP L ++VV+EG GH
Sbjct  243   NWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDHIDKGGFKRDVPFLHDLVVMEGVGH  302

Query  440   FLNQERPEEV  411
             F+N+E+PEE+
Sbjct  303   FINEEKPEEI  312



>ref|XP_011090999.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 231/309 (75%), Gaps = 6/309 (2%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK + VNGI MHVAE G+GP++LF+HGFPELWY+WRHQ+ F A  GYRAVAPD+R
Sbjct  1     MENIEHKIIPVNGIKMHVAELGKGPLVLFVHGFPELWYSWRHQMVFLAAHGYRAVAPDMR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSL--GVDKVFLVAHDWGAIIGWYFCMFRPD  978
             GYGET  AP   PS +T LH+VGDL+ L+ ++  G +KVF+V HDWGA++ W+ C++RPD
Sbjct  61    GYGETTGAPLDDPSKFTVLHLVGDLILLLDAIAPGEEKVFVVGHDWGALVAWHLCLYRPD  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV F PR+P + PVE  R  +GDD+YICRFQE G IE++ A  G ++V++ I
Sbjct  121   RVKALVNLSVAFYPRNPEVNPVEMFRGLYGDDHYICRFQEPGDIEAEFANIGVKEVVKNI  180

Query  797   FTDRKAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLN  618
             F  R  GP   PK   FG S ++     WL+E+DL YY S ++  GFTGG+NYYR+  LN
Sbjct  181   FAFRTPGPFYFPKGKGFGYSLERA---PWLTEEDLDYYVSTFEQTGFTGGVNYYRAFGLN  237

Query  617   WELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHF  438
             WEL A W+G +VKVP KF+VG+ D+ Y  PG K+++H GGFKK VPLL+E+VV+EG  HF
Sbjct  238   WELNAPWSGAQVKVPAKFIVGEFDITYHVPGTKDHIHKGGFKKFVPLLQEVVVLEGAAHF  297

Query  437   LNQERPEEV  411
             +NQERP+E+
Sbjct  298   INQERPDEI  306



>emb|CAJ19276.1| putative epoxide hydrolase [Solanum commersonii]
Length=321

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 231/310 (75%), Gaps = 4/310 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME IEHK V VNG+NMH+AE GQGP ILF+HGFPELWY+WRHQ+ + A  GYR VAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRTVAPDLR  60

Query  1148  GYGETD-APSLQPSSYTCLHVVGDLVALVQSLGVD--KVFLVAHDWGAIIGWYFCMFRPD  978
             GYG+T  AP   PS ++  H+VGD+VAL++++  +  KVF+VAHDWGA I W+ C+FRP+
Sbjct  61    GYGDTTGAPINDPSKFSIFHIVGDVVALLEAIAPNEGKVFVVAHDWGAFIAWHLCLFRPE  120

Query  977   LVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKI  798
              VKA V++SV + P++  M P+E ++A +G+DYYICRFQ  G IE++ A  G++ VL+K+
Sbjct  121   KVKALVNLSVHYPPKNSNMNPIEGLKALYGEDYYICRFQVPGDIEAEFAPIGAKSVLKKM  180

Query  797   FTDRKAGPPCLPKENPFGISTDQP-KLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
              T R   P   PK        D P  L +WLSE++L YYASK++  GFTG LNYYR++++
Sbjct  181   LTYRDPAPFYFPKGKGLEAIADAPIALSTWLSEEELDYYASKFEQTGFTGALNYYRALSI  240

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             + ELTA WTG EVKVP KF+VG+ D+VY   G KEY+H GGFKK VPLLEE+VV+EG  H
Sbjct  241   SSELTAPWTGAEVKVPTKFIVGEFDLVYHMQGAKEYIHNGGFKKYVPLLEEVVVLEGAAH  300

Query  440   FLNQERPEEV  411
             F+NQERP E+
Sbjct  301   FINQERPHEI  310



>ref|XP_008775993.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=318

 Score =   378 bits (971),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 227/305 (74%), Gaps = 2/305 (1%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
              GI H+TV+VNGI MHVAEKG+GP +L LHGFPEL Y+WRHQ+   A  GYRA+APDLRG
Sbjct  5     SGISHRTVEVNGIRMHVAEKGEGPAVLLLHGFPELGYSWRHQIAGLAARGYRAIAPDLRG  64

Query  1145  YGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVKA  966
             YG+TDAP    +SYT  H+VGDLVAL+ +L + +VF+V HDWGA + W+ C+FRPD VKA
Sbjct  65    YGDTDAPP-DVASYTICHLVGDLVALLDALSLSQVFVVGHDWGAFVAWHLCLFRPDRVKA  123

Query  965   FVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTDR  786
              V++SV F PR P  KP++  RA +GDD YI RFQE G  E++ A  G+  VLRK FT R
Sbjct  124   LVNLSVAFMPRKPAAKPLDDFRALYGDDSYISRFQEPGAAEAEFARLGTATVLRKFFTYR  183

Query  785   KAGPPCLPKENPFGISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWELT  606
               GP  +PK+  +G   +   LPSWLSE+D+ Y+ SK++  GFTG +NYYR  +LNWEL 
Sbjct  184   NPGPIFIPKDG-WGSPNEHITLPSWLSEEDINYFKSKFEKSGFTGPINYYRCFDLNWELA  242

Query  605   AAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLNQE  426
             A WTG ++KVP KF++GD+D+ Y  P +++Y+H GGFKKDVP L+E+VV+EG  HF+NQE
Sbjct  243   APWTGAQIKVPAKFIIGDLDLTYHFPRMQDYIHKGGFKKDVPFLQEVVVMEGVAHFINQE  302

Query  425   RPEEV  411
             + +E+
Sbjct  303   KAQEI  307



>emb|CDX90550.1| BnaA03g42310D [Brassica napus]
Length=330

 Score =   379 bits (972),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 234/316 (74%), Gaps = 11/316 (3%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAE-----KGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAV  1164
             ++G+EHKT+KVNGINMHVAE      G  P+ILF+HGFPELWYTWRHQ+   + LGYR +
Sbjct  4     LDGVEHKTLKVNGINMHVAELPGSGSGGEPIILFIHGFPELWYTWRHQMTALSSLGYRTI  63

Query  1163  APDLRGYGETDAPSLQPSSYTCLHVVGDLVALVQSL--GVDKVFLVAHDWGAIIGWYFCM  990
             APDLRGYG+T+AP  +   Y   ++VGDLVAL+ ++  G + VF+V HDWGA+I W  CM
Sbjct  64    APDLRGYGDTNAPE-KMEDYAYFNIVGDLVALIDAVTGGDEAVFVVGHDWGAMIAWQLCM  122

Query  989   FRPDLVKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKV  810
             +RP+ VKA V++SV F PR P   P+  +R FFGDDYYICRFQ+ G IE +    G+EKV
Sbjct  123   YRPEKVKALVNMSVLFSPRSPDRVPIPTLRRFFGDDYYICRFQKPGEIELEFKKLGTEKV  182

Query  809   LRKIFTDRKAGPPCLPKENPFGISTD---QPKLPSWLSEQDLKYYASKYDLKGFTGGLNY  639
             L++  T +  GP  LPK   F  S +      LP WL+++DL YY +KYD KGFTG +NY
Sbjct  183   LKEFLTYKTPGPLYLPKGKLFKSSENGGASSALPPWLTQEDLDYYVTKYDNKGFTGPINY  242

Query  638   YRSINLNWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVV  459
             YR+I+ NWELTA WTG +++VPVKF+VGD D+ Y +PG KEY++GGGFKKDVPLL+E VV
Sbjct  243   YRNIDRNWELTAPWTGAKIRVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETVV  302

Query  458   IEGGGHFLNQERPEEV  411
             ++G GHFL++E PEE+
Sbjct  303   LKGVGHFLHEESPEEI  318



>ref|XP_004229259.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=335

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/310 (57%), Positives = 233/310 (75%), Gaps = 5/310 (2%)
 Frame = -3

Query  1325  EGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLRG  1146
             + +EHKTV VNGINMH  E GQGP++LF+HGFPE WY+WRHQ+ F A  GYRAVAPDLRG
Sbjct  3     DQVEHKTVAVNGINMHFVEIGQGPLVLFIHGFPECWYSWRHQMSFMAKQGYRAVAPDLRG  62

Query  1145  YGETD-APSLQPSSYTCLHVVGDLVALVQSLG--VDKVFLVAHDWGAIIGWYFCMFRPDL  975
             YG+T  AP+  P+ +T L +VGDLV L+ ++    +KVF+V HDWGA++ W  C++RPD 
Sbjct  63    YGDTTGAPNDDPNKFTTLDIVGDLVELLNNIAPQEEKVFVVGHDWGAVVSWALCLYRPDK  122

Query  974   VKAFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIF  795
             VKAFV +SV F PR+P  KP++ +R  +GDDYY+ RFQE G IE +    G + VL+K  
Sbjct  123   VKAFVCLSVAFNPRNPLNKPLDTLRKVYGDDYYVVRFQEAGVIEGEFEELGIKNVLKKFL  182

Query  794   TDRKAGPPCLPKENPF--GISTDQPKLPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINL  621
             T R  GP  L K  PF    ST+  +LP+WLS +D+ +YA+KY   GFTG LNYYRSI+ 
Sbjct  183   TYRTPGPLYLKKGKPFEDTSSTNDDELPAWLSHEDIDFYANKYKQIGFTGALNYYRSIDR  242

Query  620   NWELTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGH  441
             NWE+TAAWTG +++VPVKF+VGD+D+ Y  PG K+Y+H GGFKK VPLLE++VV++G GH
Sbjct  243   NWEVTAAWTGAKIQVPVKFIVGDLDITYNAPGAKDYLHKGGFKKLVPLLEDVVVLQGVGH  302

Query  440   FLNQERPEEV  411
             F++QE+P+E+
Sbjct  303   FIHQEKPKEI  312



>ref|XP_010039619.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW84772.1| hypothetical protein EUGRSUZ_B015792 [Eucalyptus grandis]
Length=317

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 236/307 (77%), Gaps = 2/307 (1%)
 Frame = -3

Query  1328  MEGIEHKTVKVNGINMHVAEKGQGPVILFLHGFPELWYTWRHQLQFFAGLGYRAVAPDLR  1149
             ME I+H+TVKVNG+N+HVAE G+GP++L +HGFPELWYTWRHQ+   A LG+RAVAPDLR
Sbjct  1     METIKHRTVKVNGVNLHVAESGEGPLVLLIHGFPELWYTWRHQILGLAALGFRAVAPDLR  60

Query  1148  GYGETDAPSLQPSSYTCLHVVGDLVALVQSLGVDKVFLVAHDWGAIIGWYFCMFRPDLVK  969
             GYG++DAP+    +YT LHVVGDLV L+ + G +K F+VAHDWGA++ WY C+ RPD VK
Sbjct  61    GYGDSDAPAAA-DAYTALHVVGDLVGLLDAEGEEKAFVVAHDWGALMAWYLCLLRPDRVK  119

Query  968   AFVDISVPFRPRHPTMKPVEAMRAFFGDDYYICRFQEEGRIESDIAIHGSEKVLRKIFTD  789
             A V +SVP+ PR+P MKP++  RA +GDDYY+CRFQE G IE+  A  G+ +V+    T 
Sbjct  120   AMVSLSVPWMPRNPGMKPLDGYRAAYGDDYYMCRFQEPGEIEAQFAEMGTRRVIEGFLTY  179

Query  788   RKAGPPCLPKENPFGISTDQPK-LPSWLSEQDLKYYASKYDLKGFTGGLNYYRSINLNWE  612
             R  GP    K   FG   D P  LPSWL+++D+ YY  K++ KGFTGG+NYYR++N NWE
Sbjct  180   RIPGPLFFVKGKGFGHPVDDPVVLPSWLTQEDIDYYVDKFEEKGFTGGINYYRNLNRNWE  239

Query  611   LTAAWTGIEVKVPVKFMVGDMDMVYTTPGIKEYVHGGGFKKDVPLLEEIVVIEGGGHFLN  432
             L A W G++VKVPVKF+VG++D+VY  PG+K+++H GG KK VPLLEE+VV+EG  HFLN
Sbjct  240   LMAPWDGVQVKVPVKFIVGELDLVYHMPGVKDFIHKGGLKKTVPLLEEVVVMEGVAHFLN  299

Query  431   QERPEEV  411
             QERP++ 
Sbjct  300   QERPQDT  306



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3828192580548