BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c69117_g1_i1 len=142 path=[1:0-141]

Length=142
                                                                      Score     E

gb|EFX72744.1|  hypothetical protein DAPPUDRAFT_325909                57.0    9e-08   
gb|EPZ36991.1|  P-type trefoil domain-containing protein              55.8    3e-07   
ref|XP_002422874.1|  sucrase-isomaltase, intestinal, putative         54.3    9e-07   Pediculus humanus corporis [human body lice]
gb|KFD54573.1|  hypothetical protein M513_04518                       54.3    9e-07   
sp|O00906.1|AGLU_TETPY  RecName: Full=Lysosomal acid alpha-glucos...  53.5    1e-06   Tetrahymena pyriformis
ref|XP_001454850.1|  hypothetical protein                             53.5    1e-06   Paramecium tetraurelia strain d4-2
gb|KFM79974.1|  Maltase-glucoamylase, intestinal                      53.1    2e-06   
ref|XP_008821778.1|  PREDICTED: maltase-glucoamylase, intestinal      53.1    2e-06   
ref|XP_007505334.1|  PREDICTED: maltase-glucoamylase, intestinal      53.1    2e-06   
ref|XP_004932972.1|  PREDICTED: uncharacterized protein LOC101736905  53.1    2e-06   
emb|CCD75070.1|  putative alpha-glucosidase                           52.8    3e-06   
emb|CCD75069.1|  putative alpha-glucosidase                           52.8    3e-06   
ref|XP_003584906.3|  PREDICTED: maltase-glucoamylase, intestinal ...  52.8    3e-06   
ref|XP_004030900.1|  hypothetical protein IMG5_151340                 52.8    3e-06   
ref|XP_001457767.1|  hypothetical protein                             52.8    3e-06   Paramecium tetraurelia strain d4-2
ref|XP_007466695.1|  PREDICTED: maltase-glucoamylase, intestinal      52.8    3e-06   
ref|XP_006635566.1|  PREDICTED: coiled-coil domain-containing pro...  52.8    3e-06   
ref|XP_001427455.1|  hypothetical protein                             52.4    4e-06   Paramecium tetraurelia strain d4-2
ref|XP_001461378.1|  hypothetical protein                             52.4    4e-06   Paramecium tetraurelia strain d4-2
ref|XP_008482665.1|  PREDICTED: lysosomal alpha-glucosidase-like      52.4    4e-06   
ref|XP_009202266.1|  PREDICTED: maltase-glucoamylase, intestinal      52.8    4e-06   
ref|XP_001454030.1|  hypothetical protein                             52.4    4e-06   Paramecium tetraurelia strain d4-2
ref|XP_009241591.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  52.4    4e-06   
ref|XP_008556280.1|  PREDICTED: lysosomal alpha-glucosidase-like      52.4    4e-06   
ref|XP_001083672.2|  PREDICTED: maltase-glucoamylase, intestinal      52.4    4e-06   Macaca mulatta [rhesus macaque]
ref|XP_006777139.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.4    5e-06   
ref|XP_005679600.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.4    5e-06   
gb|EPQ13198.1|  Maltase-glucoamylase, intestinal                      52.4    5e-06   
ref|XP_001083998.2|  PREDICTED: maltase-glucoamylase, intestinal      52.0    5e-06   Macaca mulatta [rhesus macaque]
ref|XP_005551050.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.4    5e-06   
gb|EHH17757.1|  hypothetical protein EGK_14221                        52.4    5e-06   
ref|XP_001952631.1|  PREDICTED: lysosomal alpha-glucosidase-like      52.0    5e-06   Acyrthosiphon pisum
ref|XP_005551054.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.4    5e-06   
ref|XP_006777138.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.0    5e-06   
ref|XP_005875094.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.0    5e-06   
gb|KHJ49579.1|  hormone receptor domain protein                       52.0    6e-06   
ref|XP_008148744.1|  PREDICTED: maltase-glucoamylase, intestinal      52.0    6e-06   
ref|XP_006094792.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.0    6e-06   
ref|XP_004318035.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.0    6e-06   
ref|XP_005551058.1|  PREDICTED: maltase-glucoamylase, intestinal-...  52.0    6e-06   
ref|XP_005551057.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.6    8e-06   
ref|XP_005551056.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.6    8e-06   
ref|XP_004272292.1|  PREDICTED: maltase-glucoamylase, intestinal      51.6    8e-06   
gb|AFW76025.1|  hypothetical protein ZEAMMB73_615454                  51.2    8e-06   
ref|XP_008207689.1|  PREDICTED: lysosomal alpha-glucosidase-like      51.6    8e-06   
ref|XP_009297618.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  51.6    8e-06   
ref|XP_007103396.1|  PREDICTED: maltase-glucoamylase, intestinal      51.6    8e-06   
ref|XP_001921957.2|  PREDICTED: lysosomal alpha-glucosidase isofo...  51.2    9e-06   Danio rerio [leopard danio]
ref|XP_006746626.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.6    9e-06   
ref|XP_002438844.1|  hypothetical protein SORBIDRAFT_10g027110        51.2    9e-06   Sorghum bicolor [broomcorn]
ref|XP_007177076.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.6    9e-06   
ref|XP_010352776.1|  PREDICTED: probable maltase-glucoamylase-lik...  51.6    9e-06   
ref|XP_004046399.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    9e-06   
ref|XP_007981906.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.6    1e-05   
ref|XP_006052157.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    1e-05   
emb|CDW53293.1|  Gal mutarotas 2 and Glyco hydro 31 domain contai...  51.2    1e-05   
ref|XP_004416609.1|  PREDICTED: maltase-glucoamylase, intestinal      51.2    1e-05   
ref|XP_009860843.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...  51.2    1e-05   
ref|XP_010629940.1|  PREDICTED: maltase-glucoamylase, intestinal      51.2    1e-05   
ref|XP_010853283.1|  PREDICTED: maltase-glucoamylase, intestinal      51.2    1e-05   
ref|XP_002687127.1|  PREDICTED: maltase-glucoamylase, intestinal ...  51.2    1e-05   
ref|XP_004851417.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    1e-05   
ref|XP_003738884.1|  PREDICTED: lysosomal alpha-glucosidase-like      51.2    1e-05   
ref|XP_006038303.1|  PREDICTED: lysosomal alpha-glucosidase           50.8    1e-05   
ref|XP_004008356.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    1e-05   
ref|XP_008148743.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  51.2    1e-05   
ref|XP_003370205.1|  alpha-glucosidase                                50.4    1e-05   
ref|XP_005981933.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    1e-05   
ref|XP_008695547.1|  PREDICTED: maltase-glucoamylase, intestinal      51.2    1e-05   
pdb|2QLY|A  Chain A, Crystral Structure Of The N-Terminal Subunit...  50.8    1e-05   
ref|XP_004742040.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    1e-05   
ref|XP_003983204.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    1e-05   
pdb|3L4T|A  Chain A, Crystal Complex Of N-Terminal Human Maltase-...  50.8    1e-05   
ref|XP_008648952.1|  PREDICTED: probable alpha-glucosidase Os06g0...  50.8    1e-05   
ref|XP_007090948.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    1e-05   
ref|XP_005629599.1|  PREDICTED: maltase-glucoamylase, intestinal      51.2    1e-05   
ref|XP_001024217.1|  Glycosyl hydrolases family 31 protein            51.2    1e-05   Tetrahymena thermophila
ref|XP_005365951.1|  PREDICTED: maltase-glucoamylase, intestinal-...  51.2    1e-05   
ref|XP_008648951.1|  PREDICTED: probable alpha-glucosidase Os06g0...  50.8    1e-05   
ref|XP_004629182.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.8    1e-05   
ref|XP_003744654.1|  PREDICTED: lysosomal alpha-glucosidase-like      50.8    1e-05   
gb|AFW76026.1|  hypothetical protein ZEAMMB73_615454                  50.4    1e-05   
ref|XP_004814638.1|  PREDICTED: maltase-glucoamylase, intestinal      50.8    1e-05   
ref|XP_010598091.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  50.8    1e-05   
ref|XP_004906914.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  50.8    1e-05   
ref|XP_002752029.1|  PREDICTED: maltase-glucoamylase, intestinal      50.8    1e-05   Callithrix jacchus [common marmoset]
ref|XP_006997155.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.8    1e-05   
ref|XP_007981388.1|  PREDICTED: maltase-glucoamylase, intestinal ...  50.8    1e-05   
ref|XP_007981387.1|  PREDICTED: maltase-glucoamylase, intestinal ...  50.8    1e-05   
dbj|GAA30540.2|  lysosomal alpha-glucosidase                          50.8    2e-05   
gb|AIG55952.1|  secreted protein                                      50.8    2e-05   
gb|EEC81169.1|  hypothetical protein OsI_24141                        50.4    2e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010945738.1|  PREDICTED: maltase-glucoamylase, intestinal      50.8    2e-05   
ref|XP_010988162.1|  PREDICTED: maltase-glucoamylase, intestinal      50.8    2e-05   
ref|XP_006185457.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.8    2e-05   
ref|XP_003475379.2|  PREDICTED: maltase-glucoamylase, intestinal-...  50.8    2e-05   
ref|XP_006210146.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.8    2e-05   
gb|EDM15421.1|  rCG27911                                              50.4    2e-05   
emb|CDP12608.1|  unnamed protein product                              50.4    2e-05   
ref|XP_007981389.1|  PREDICTED: maltase-glucoamylase, intestinal ...  50.8    2e-05   
ref|XP_005332519.1|  PREDICTED: maltase-glucoamylase, intestinal      50.4    2e-05   
gb|EWS71987.1|  family 31 glycoside hydrolase                         50.4    2e-05   
ref|XP_004661140.1|  PREDICTED: maltase-glucoamylase, intestinal      50.4    2e-05   
gb|EAW83988.1|  maltase-glucoamylase (alpha-glucosidase), isoform...  50.4    2e-05   
ref|XP_004608407.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.4    2e-05   
ref|XP_004382497.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.4    2e-05   
gb|EDL13569.1|  mCG142195                                             50.4    2e-05   
ref|NP_001164474.1|  maltase-glucoamylase                             50.4    2e-05   Mus musculus [mouse]
gb|EHB16913.1|  Maltase-glucoamylase, intestinal                      50.4    2e-05   
ref|XP_003270999.2|  PREDICTED: maltase-glucoamylase, intestinal-...  50.4    2e-05   
ref|XP_003813563.1|  PREDICTED: maltase-glucoamylase, intestinal      50.4    2e-05   
ref|XP_005085831.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.4    2e-05   
ref|XP_010358137.1|  PREDICTED: maltase-glucoamylase, intestinal      50.4    2e-05   
gb|ACZ37245.1|  alpha-glucosidase                                     50.1    2e-05   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_006224950.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.4    2e-05   
ref|XP_004851418.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.4    2e-05   
ref|XP_008761089.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  50.4    2e-05   
ref|XP_006506111.1|  PREDICTED: maltase-glucoamylase isoform X7       50.4    2e-05   
ref|NP_001058353.1|  Os06g0676700                                     50.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566018.1|  PREDICTED: probable alpha-glucosidase Os06g0...  50.1    2e-05   
ref|XP_008492921.1|  PREDICTED: uncharacterized protein LOC103529278  50.4    2e-05   
gb|EAZ02070.1|  hypothetical protein OsI_24149                        50.1    2e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_005405585.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.4    2e-05   
ref|XP_006506105.1|  PREDICTED: maltase-glucoamylase isoform X1       50.4    2e-05   
ref|XP_006716231.1|  PREDICTED: maltase-glucoamylase, intestinal ...  50.4    2e-05   
ref|XP_006506109.1|  PREDICTED: maltase-glucoamylase isoform X5       50.4    2e-05   
ref|XP_006506108.1|  PREDICTED: maltase-glucoamylase isoform X4       50.4    2e-05   
ref|XP_004774471.1|  PREDICTED: sucrase-isomaltase, intestinal        50.1    2e-05   
gb|EMP39291.1|  Lysosomal alpha-glucosidase                           50.1    2e-05   
gb|EAZ38007.1|  hypothetical protein OsJ_22352                        50.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002529880.1|  alpha-glucosidase, putative                      50.1    2e-05   Ricinus communis
ref|XP_002921728.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.1    3e-05   
ref|XP_003270883.2|  PREDICTED: maltase-glucoamylase, intestinal-...  50.1    3e-05   
ref|XP_005495943.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.1    3e-05   
ref|XP_008153219.1|  PREDICTED: lysosomal alpha-glucosidase           50.1    3e-05   
ref|XP_006506110.1|  PREDICTED: maltase-glucoamylase isoform X6       50.1    3e-05   
ref|XP_008581187.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  50.1    3e-05   
gb|ERE90166.1|  maltase-glucoamylase, intestinal-like protein         50.1    3e-05   
ref|XP_001952639.2|  PREDICTED: lysosomal alpha-glucosidase-like      50.1    3e-05   Acyrthosiphon pisum
ref|XP_004594520.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.1    3e-05   
gb|KDP34894.1|  hypothetical protein JCGZ_09182                       49.7    3e-05   
gb|KDP34895.1|  hypothetical protein JCGZ_09183                       49.7    3e-05   
ref|XP_001023473.2|  Glycosyl hydrolases family 31 protein            49.7    3e-05   Tetrahymena thermophila
gb|ERE90167.1|  maltase-glucoamylase, intestinal-like protein         50.1    3e-05   
gb|ERE90168.1|  maltase-glucoamylase, intestinal-like protein         50.1    3e-05   
ref|XP_002921729.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.1    3e-05   
ref|XP_002740247.2|  PREDICTED: lysosomal alpha-glucosidase-like      49.7    3e-05   Saccoglossus kowalevskii
gb|KFO30104.1|  Maltase-glucoamylase, intestinal                      50.1    3e-05   
ref|XP_007090949.1|  PREDICTED: maltase-glucoamylase, intestinal-...  50.1    3e-05   
ref|XP_005880343.1|  PREDICTED: lysosomal alpha-glucosidase           49.7    3e-05   
ref|XP_004677280.1|  PREDICTED: maltase-glucoamylase, intestinal-...  49.7    3e-05   
gb|EFB29547.1|  hypothetical protein PANDA_010628                     49.7    3e-05   Ailuropoda melanoleuca
gb|EPQ16443.1|  Lysosomal alpha-glucosidase                           49.7    3e-05   
ref|XP_003744653.1|  PREDICTED: lysosomal alpha-glucosidase-like      49.7    3e-05   
ref|XP_009001288.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  49.7    4e-05   
ref|XP_010098489.1|  hypothetical protein L484_025925                 49.3    4e-05   
gb|ELK38296.1|  Lysosomal alpha-glucosidase                           49.3    4e-05   
gb|ACZ37249.1|  alpha-glucosidase                                     49.3    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHJ41463.1|  hypothetical protein D918_08426                       49.7    4e-05   
gb|ACZ37246.1|  alpha-glucosidase                                     49.3    4e-05   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_006753108.1|  PREDICTED: lysosomal alpha-glucosidase           49.3    4e-05   
ref|XP_006108616.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...  49.3    4e-05   
ref|XP_006842266.1|  hypothetical protein AMTR_s00079p00035080        49.3    4e-05   
gb|AAF76254.1|  high pI alpha-glucosidase                             49.3    4e-05   Hordeum vulgare [barley]
gb|ACZ37244.1|  alpha-glucosidase                                     49.3    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004814668.1|  PREDICTED: maltase-glucoamylase, intestinal-...  49.7    4e-05   
ref|XP_005496981.1|  PREDICTED: lysosomal alpha-glucosidase           49.3    4e-05   
ref|XP_009092784.1|  PREDICTED: lysosomal alpha-glucosidase-like      49.3    4e-05   
ref|XP_004236960.1|  PREDICTED: alpha-xylosidase 1-like               49.3    4e-05   
ref|XP_008056838.1|  PREDICTED: maltase-glucoamylase, intestinal      49.3    5e-05   
gb|KDP34887.1|  hypothetical protein JCGZ_09175                       49.3    5e-05   
ref|XP_004594519.1|  PREDICTED: maltase-glucoamylase, intestinal-...  49.3    5e-05   
dbj|BAJ91993.1|  predicted protein                                    49.3    5e-05   
ref|XP_004881759.1|  PREDICTED: maltase-glucoamylase, intestinal      49.3    5e-05   
gb|ABR16166.1|  unknown                                               49.3    5e-05   Picea sitchensis
ref|XP_008690524.1|  PREDICTED: sucrase-isomaltase, intestinal        49.3    5e-05   
gb|AAP21875.1|  unknown                                               48.5    5e-05   Homo sapiens [man]
ref|XP_005629793.1|  PREDICTED: maltase-glucoamylase, intestinal-...  49.3    5e-05   
ref|XP_008476670.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.1    5e-05   
gb|EPY80709.1|  hypothetical protein CB1_000804034                    49.3    5e-05   
ref|XP_006210147.1|  PREDICTED: maltase-glucoamylase, intestinal-...  49.3    5e-05   
ref|XP_006419186.1|  hypothetical protein CICLE_v100304492mg          47.4    5e-05   
gb|AAL40352.1|AF448201_1  putative alpha-xylosidase                   48.9    6e-05   Pinus pinaster [cluster pine]
ref|XP_003707619.1|  PREDICTED: lysosomal alpha-glucosidase-like      48.9    6e-05   
ref|XP_008247087.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  49.3    6e-05   
ref|XP_005679673.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.9    6e-05   
ref|XP_006185458.1|  PREDICTED: maltase-glucoamylase, intestinal-...  49.3    6e-05   
ref|XP_004714074.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.9    6e-05   
ref|XP_006908332.1|  PREDICTED: sucrase-isomaltase, intestinal        48.9    6e-05   
gb|ELK15857.1|  Sucrase-isomaltase, intestinal                        48.9    6e-05   
ref|XP_007504528.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.9    6e-05   
ref|XP_004742039.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.9    6e-05   
ref|XP_008695637.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.9    6e-05   
ref|XP_003744719.1|  PREDICTED: lysosomal alpha-glucosidase-like      48.9    6e-05   
ref|XP_011052775.1|  PREDICTED: lysosomal alpha-glucosidase-like ...  48.9    7e-05   
ref|XP_003374761.1|  glycosyl hydrolase, family 31                    48.9    7e-05   
ref|XP_011052776.1|  PREDICTED: lysosomal alpha-glucosidase-like ...  48.9    7e-05   
ref|XP_008892702.1|  hypothetical protein PPTG_01217                  47.0    7e-05   
gb|AAL83560.1|  maltase-glucoamylase                                  48.9    7e-05   Homo sapiens [man]
ref|XP_006367038.1|  PREDICTED: alpha-xylosidase 1-like               48.5    7e-05   
gb|EPQ13199.1|  Maltase-glucoamylase, intestinal                      48.9    7e-05   
gb|AAI20873.1|  Maltase-glucoamylase (alpha-glucosidase)              48.9    7e-05   Homo sapiens [man]
gb|AAC39568.2|  maltase-glucoamylase                                  48.9    8e-05   Homo sapiens [man]
ref|XP_003741230.1|  PREDICTED: lysosomal alpha-glucosidase-like      48.5    8e-05   
ref|XP_001496710.1|  PREDICTED: maltase-glucoamylase, intestinal ...  48.9    8e-05   Equus caballus [domestic horse]
ref|XP_005609519.1|  PREDICTED: maltase-glucoamylase, intestinal ...  48.9    8e-05   
ref|XP_007389717.1|  glycoside hydrolase family 31 protein            48.5    8e-05   
ref|NP_004659.2|  maltase-glucoamylase, intestinal                    48.9    8e-05   Homo sapiens [man]
ref|XP_006733960.1|  PREDICTED: coiled-coil domain-containing pro...  48.5    8e-05   
ref|XP_002932561.2|  PREDICTED: lysosomal alpha-glucosidase-like      48.5    8e-05   
ref|XP_007950967.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.5    8e-05   
ref|XP_010598090.1|  PREDICTED: LOW QUALITY PROTEIN: probable mal...  48.9    8e-05   
sp|O62653.3|SUIS_SUNMU  RecName: Full=Sucrase-isomaltase, intesti...  48.5    8e-05   Suncus murinus [Asian house shrew]
ref|XP_009452648.1|  PREDICTED: maltase-glucoamylase, intestinal      48.9    8e-05   
ref|XP_010338819.1|  PREDICTED: LOW QUALITY PROTEIN: probable mal...  48.9    8e-05   
ref|XP_008529406.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  48.5    8e-05   
gb|KDO31383.1|  hypothetical protein SPRG_04000                       48.5    8e-05   
ref|XP_008820152.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.5    8e-05   
ref|XP_010606012.1|  PREDICTED: probable maltase-glucoamylase-lik...  48.9    8e-05   
gb|EPB85834.1|  hypothetical protein HMPREF1544_07416                 48.5    8e-05   
ref|XP_006727668.1|  PREDICTED: sucrase-isomaltase, intestinal        48.5    8e-05   
ref|XP_007522399.1|  PREDICTED: maltase-glucoamylase, intestinal      48.5    8e-05   
ref|XP_004629180.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.5    8e-05   
ref|XP_008247096.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.5    9e-05   
ref|NP_001058347.1|  Os06g0675700                                     48.5    9e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ERL92906.1|  hypothetical protein D910_10211                       48.5    9e-05   
gb|ENN77102.1|  hypothetical protein YQE_06437                        48.5    9e-05   
ref|XP_004966197.1|  PREDICTED: probable alpha-glucosidase Os06g0...  48.5    9e-05   
ref|XP_008328113.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  48.5    9e-05   
ref|XP_007056107.1|  PREDICTED: lysosomal alpha-glucosidase           48.5    9e-05   
gb|EAW51983.1|  hCG2001479, isoform CRA_a                             48.5    9e-05   
ref|XP_010103777.1|  hypothetical protein L484_014667                 48.5    9e-05   
gb|EEC81171.1|  hypothetical protein OsI_24144                        48.5    9e-05   Oryza sativa Indica Group [Indian rice]
gb|EYU40890.1|  hypothetical protein MIMGU_mgv1a003100mg              48.1    9e-05   
emb|CDS29680.1|  lysosomal alpha glucosidase                          48.5    9e-05   
ref|XP_002401316.1|  alpha-glucosidase, putative                      47.8    9e-05   Ixodes scapularis [blacklegged tick]
ref|XP_008328114.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  48.5    9e-05   
ref|XP_005405586.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.5    9e-05   
ref|XP_009241598.1|  PREDICTED: probable maltase-glucoamylase-lik...  48.5    1e-04   
ref|XP_008581186.1|  PREDICTED: maltase-glucoamylase, intestinal      48.5    1e-04   
ref|XP_008619584.1|  hypothetical protein SDRG_15197                  48.1    1e-04   
ref|NP_001280555.1|  putative maltase-glucoamylase-like protein F...  48.5    1e-04   
gb|EGI66515.1|  Lysosomal alpha-glucosidase                           48.1    1e-04   
ref|XP_006891565.1|  PREDICTED: sucrase-isomaltase, intestinal-like   48.5    1e-04   
ref|XP_008963064.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.5    1e-04   
ref|XP_005925471.1|  PREDICTED: lysosomal alpha-glucosidase-like      48.1    1e-04   
ref|XP_006791555.1|  PREDICTED: lysosomal alpha-glucosidase-like ...  48.1    1e-04   
ref|XP_004558392.1|  PREDICTED: lysosomal alpha-glucosidase-like      48.1    1e-04   
ref|XP_009452649.1|  PREDICTED: probable maltase-glucoamylase-lik...  48.5    1e-04   
ref|XP_005734693.1|  PREDICTED: lysosomal alpha-glucosidase-like      48.1    1e-04   
ref|XP_006910526.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.5    1e-04   
gb|ELK13786.1|  Maltase-glucoamylase, intestinal                      48.5    1e-04   
ref|XP_007557420.1|  PREDICTED: lysosomal alpha-glucosidase           48.1    1e-04   
ref|XP_545265.3|  PREDICTED: sucrase-isomaltase, intestinal isofo...  48.5    1e-04   Canis lupus familiaris [dogs]
ref|XP_007886783.1|  PREDICTED: lysosomal alpha-glucosidase           48.1    1e-04   
ref|XP_003772623.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.1    1e-04   
ref|XP_005639937.1|  PREDICTED: sucrase-isomaltase, intestinal is...  48.1    1e-04   
ref|XP_007446500.1|  PREDICTED: sucrase-isomaltase, intestinal        48.1    1e-04   
ref|XP_009602756.1|  PREDICTED: alpha-glucosidase-like                48.1    1e-04   
ref|XP_003791688.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.1    1e-04   
ref|XP_010725362.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.0    1e-04   
dbj|BAK06574.1|  predicted protein                                    48.1    1e-04   
ref|XP_006791556.1|  PREDICTED: lysosomal alpha-glucosidase-like ...  48.1    1e-04   
ref|XP_003475377.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.1    1e-04   
ref|XP_005808948.1|  PREDICTED: lysosomal alpha-glucosidase-like      48.1    1e-04   
ref|XP_002918605.1|  PREDICTED: sucrase-isomaltase, intestinal-like   48.1    1e-04   
ref|XP_007197618.1|  PREDICTED: sucrase-isomaltase, intestinal        48.1    1e-04   
ref|XP_004283484.1|  PREDICTED: sucrase-isomaltase, intestinal        48.1    1e-04   
ref|XP_007108049.1|  PREDICTED: sucrase-isomaltase, intestinal        48.1    1e-04   
ref|XP_004424837.1|  PREDICTED: sucrase-isomaltase, intestinal-li...  48.1    1e-04   
ref|XP_004393254.1|  PREDICTED: sucrase-isomaltase, intestinal        48.1    1e-04   
gb|EMT25211.1|  Putative alpha-glucosidase                            48.1    1e-04   
ref|XP_004424838.1|  PREDICTED: sucrase-isomaltase, intestinal-li...  48.1    1e-04   
ref|XP_009029450.1|  hypothetical protein HELRODRAFT_186140           48.1    1e-04   
ref|XP_006391126.1|  hypothetical protein EUTSA_v10018090mg           47.8    1e-04   
ref|XP_007055582.1|  PREDICTED: LOW QUALITY PROTEIN: sucrase-isom...  48.1    1e-04   
gb|EFB13366.1|  hypothetical protein PANDA_007093                     48.1    1e-04   Ailuropoda melanoleuca
gb|EMT10670.1|  Putative alpha-glucosidase                            47.8    1e-04   
ref|XP_011040581.1|  PREDICTED: alpha-glucosidase-like                47.8    1e-04   
ref|XP_007618016.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.1    1e-04   
ref|XP_001451356.1|  hypothetical protein                             47.8    1e-04   
ref|XP_001008369.2|  Glycosyl hydrolases family 31 protein            47.8    1e-04   
dbj|BAK05419.1|  predicted protein                                    47.8    1e-04   
gb|EGW08982.1|  Maltase-glucoamylase, intestinal                      48.1    1e-04   
ref|XP_004008357.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.1    1e-04   
ref|XP_969694.1|  PREDICTED: lysosomal alpha-glucosidase-like         47.8    1e-04   
ref|XP_003791606.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.1    1e-04   
ref|XP_002412387.1|  glycosyl hydralase, sucrase-isomaltase, puta...  47.8    1e-04   
ref|XP_007645680.1|  PREDICTED: maltase-glucoamylase, intestinal-...  48.1    1e-04   
ref|XP_787183.2|  PREDICTED: lysosomal alpha-glucosidase-like         47.8    1e-04   
emb|CDW53609.1|  glycosyl hydrolase family 31 protein                 47.8    1e-04   
gb|EEZ99945.1|  hypothetical protein TcasGA2_TC002741                 47.8    1e-04   
ref|XP_006054442.1|  PREDICTED: sucrase-isomaltase, intestinal-li...  47.8    2e-04   
ref|XP_009908538.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.8    2e-04   
gb|EAR88124.3|  glycosyl hydrolase family 31 protein                  47.8    2e-04   
ref|XP_006054441.1|  PREDICTED: sucrase-isomaltase, intestinal-li...  47.8    2e-04   
ref|XP_005984867.1|  PREDICTED: sucrase-isomaltase, intestinal-like   47.8    2e-04   
ref|XP_005675423.1|  PREDICTED: sucrase-isomaltase, intestinal-like   47.8    2e-04   
ref|XP_004003244.1|  PREDICTED: sucrase-isomaltase, intestinal        47.8    2e-04   
emb|CDJ84826.1|  Glycoside hydrolase domain containing protein        47.8    2e-04   
ref|XP_007645681.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  47.8    2e-04   
ref|XP_005657783.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.8    2e-04   
gb|KFD51735.1|  hypothetical protein M513_07432                       47.8    2e-04   
gb|KFV62731.1|  Maltase-glucoamylase, intestinal                      47.8    2e-04   
ref|XP_008866683.1|  hypothetical protein H310_04214                  47.8    2e-04   
gb|EOA94723.1|  Lysosomal alpha-glucosidase                           46.6    2e-04   
ref|XP_008866682.1|  hypothetical protein, variant                    47.8    2e-04   
ref|XP_006468478.1|  PREDICTED: alpha-glucosidase-like                47.8    2e-04   
ref|XP_003464837.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  47.8    2e-04   
gb|ETE73596.1|  Lysosomal alpha-glucosidase                           47.8    2e-04   
ref|XP_006448710.1|  hypothetical protein CICLE_v10014196mg           47.8    2e-04   
ref|XP_006353086.1|  PREDICTED: alpha-glucosidase-like                47.8    2e-04   
ref|NP_001107661.1|  sucrase-isomaltase, intestinal                   47.8    2e-04   
ref|XP_004661137.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.8    2e-04   
ref|XP_010950368.1|  PREDICTED: sucrase-isomaltase, intestinal        47.8    2e-04   
ref|XP_005283057.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  47.4    2e-04   
ref|XP_006183887.1|  PREDICTED: sucrase-isomaltase, intestinal        47.8    2e-04   
ref|XP_003786123.1|  PREDICTED: lysosomal alpha-glucosidase           47.4    2e-04   
ref|XP_006200909.1|  PREDICTED: sucrase-isomaltase, intestinal        47.8    2e-04   
ref|XP_005519565.1|  PREDICTED: sucrase-isomaltase, intestinal-like   47.4    2e-04   
gb|KFO59169.1|  Sucrase-isomaltase, intestinal                        46.2    2e-04   
ref|XP_008165908.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  47.4    2e-04   
gb|EMT31022.1|  Putative alpha-glucosidase                            47.4    2e-04   
emb|CAN60336.1|  hypothetical protein VITISV_043773                   47.4    2e-04   
emb|CDJ81175.1|  Glycoside hydrolase domain containing protein        47.4    2e-04   
ref|XP_002123542.1|  PREDICTED: maltase-glucoamylase, intestinal      47.8    2e-04   
ref|XP_003560452.2|  PREDICTED: probable alpha-glucosidase Os06g0...  47.4    2e-04   
ref|XP_005342216.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.8    2e-04   
ref|XP_005895399.1|  PREDICTED: sucrase-isomaltase, intestinal-like   47.8    2e-04   
ref|XP_005145360.1|  PREDICTED: LOW QUALITY PROTEIN: integrator c...  47.8    2e-04   
emb|CDY44885.1|  BnaA02g13970D                                        47.4    2e-04   
ref|XP_010839226.1|  PREDICTED: sucrase-isomaltase, intestinal        47.8    2e-04   
ref|XP_008996115.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...  47.4    2e-04   
emb|CDX81531.1|  BnaC02g18350D                                        47.4    2e-04   
ref|XP_005001486.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  47.4    2e-04   
ref|XP_006054444.1|  PREDICTED: sucrase-isomaltase, intestinal-li...  47.8    2e-04   
gb|ELR56685.1|  Sucrase-isomaltase, intestinal                        47.8    2e-04   
gb|EEE53808.1|  hypothetical protein OsJ_00241                        47.4    2e-04   
emb|CAN66951.1|  hypothetical protein VITISV_009466                   47.4    2e-04   
gb|KFP81113.1|  Sucrase-isomaltase, intestinal                        45.4    2e-04   
ref|XP_003931717.1|  PREDICTED: lysosomal alpha-glucosidase           47.4    2e-04   
emb|CAG11433.1|  unnamed protein product                              47.4    2e-04   
ref|XP_005020203.1|  PREDICTED: LOW QUALITY PROTEIN: integrator c...  47.8    2e-04   
ref|XP_010655876.1|  PREDICTED: alpha-glucosidase-like                47.4    2e-04   
ref|XP_006052165.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.4    2e-04   
ref|XP_009832096.1|  hypothetical protein H257_08031                  47.4    2e-04   
gb|ERE69027.1|  lysosomal alpha-glucosidase-like protein              47.4    2e-04   
ref|XP_010655865.1|  PREDICTED: alpha-glucosidase-like                47.4    2e-04   
ref|XP_006842269.1|  hypothetical protein AMTR_s00079p00038550        47.4    2e-04   
ref|XP_009792787.1|  PREDICTED: alpha-glucosidase-like                47.4    2e-04   
ref|XP_008541083.1|  PREDICTED: sucrase-isomaltase, intestinal        47.4    2e-04   
ref|XP_007970401.1|  PREDICTED: sucrase-isomaltase, intestinal is...  47.4    2e-04   
gb|EMP30621.1|  Integrator complex subunit 1                          47.4    2e-04   
emb|CBI39013.3|  unnamed protein product                              47.4    2e-04   
ref|XP_001504613.1|  PREDICTED: sucrase-isomaltase, intestinal is...  47.4    2e-04   
ref|XP_002802979.1|  PREDICTED: sucrase-isomaltase, intestinal-like   47.4    2e-04   
ref|XP_009784328.1|  PREDICTED: alpha-xylosidase 1-like               47.4    2e-04   
ref|XP_004233180.1|  PREDICTED: alpha-glucosidase-like                47.4    2e-04   
ref|XP_002413757.1|  lysosomal alpha-glucosidase, putative            47.0    2e-04   
gb|ETL39243.1|  hypothetical protein L916_09385                       46.6    2e-04   
ref|XP_006448712.1|  hypothetical protein CICLE_v10014274mg           47.4    2e-04   
ref|XP_001008773.1|  Glycosyl hydrolases family 31 protein            47.4    2e-04   
ref|XP_010453220.1|  PREDICTED: alpha-glucosidase-like                47.4    2e-04   
ref|NP_593216.2|  alpha-glucosidase (predicted)                       47.4    2e-04   
ref|XP_011010437.1|  PREDICTED: alpha-glucosidase-like                47.4    2e-04   
ref|XP_004338781.1|  acid alphaglucosidase                            47.4    2e-04   
ref|XP_006887298.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.4    2e-04   
ref|XP_008163216.1|  PREDICTED: sucrase-isomaltase, intestinal        47.4    2e-04   
ref|XP_005546349.1|  PREDICTED: sucrase-isomaltase, intestinal        47.4    2e-04   
ref|XP_004038007.1|  PREDICTED: sucrase-isomaltase, intestinal        47.4    2e-04   
ref|XP_009043720.1|  hypothetical protein LOTGIDRAFT_227855           47.4    2e-04   
ref|XP_003817749.1|  PREDICTED: sucrase-isomaltase, intestinal        47.4    2e-04   
emb|CAA45140.1|  prosucrose-isomaltase                                47.4    2e-04   
ref|NP_001032.2|  sucrase-isomaltase, intestinal                      47.4    2e-04   
ref|XP_004950247.1|  PREDICTED: sucrase-isomaltase, intestinal-like   46.6    2e-04   
gb|EWS76217.1|  glycoside hydrolase family 31 protein                 47.0    2e-04   
gb|AAI16453.1|  Sucrase-isomaltase (alpha-glucosidase)                47.4    2e-04   
emb|CDY04236.1|  BnaC06g25790D                                        47.0    2e-04   
ref|XP_006608614.1|  PREDICTED: lysosomal alpha-glucosidase-like      47.0    2e-04   
ref|XP_010209761.1|  PREDICTED: integrator complex subunit 1          47.4    2e-04   
ref|XP_001159286.2|  PREDICTED: sucrase-isomaltase, intestinal        47.4    2e-04   
ref|XP_007970400.1|  PREDICTED: sucrase-isomaltase, intestinal is...  47.4    2e-04   
gb|AAI32835.1|  Sucrase-isomaltase (alpha-glucosidase)                47.4    2e-04   
ref|XP_003594586.1|  Alpha-glucosidase                                47.4    2e-04   
ref|XP_011013376.1|  PREDICTED: alpha-glucosidase-like                47.0    2e-04   
ref|XP_010356947.1|  PREDICTED: sucrase-isomaltase, intestinal        47.4    2e-04   
ref|XP_002759467.1|  PREDICTED: sucrase-isomaltase, intestinal        47.4    2e-04   
dbj|BAJ98993.1|  predicted protein                                    47.0    2e-04   
emb|CDY07378.1|  BnaA07g24570D                                        47.0    3e-04   
ref|XP_005085830.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.4    3e-04   
ref|XP_007023612.1|  Glycosyl hydrolases family 31 protein isoform 1  47.0    3e-04   
ref|XP_010602495.1|  PREDICTED: sucrase-isomaltase, intestinal        47.4    3e-04   
ref|XP_005694139.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  47.0    3e-04   
gb|ETM45659.1|  hypothetical protein L914_09350                       46.2    3e-04   
ref|XP_009105036.1|  PREDICTED: alpha-xylosidase 1-like               47.0    3e-04   
gb|KFO23452.1|  Sucrase-isomaltase, intestinal                        47.4    3e-04   
gb|EYU29972.1|  hypothetical protein MIMGU_mgv1a000940mg              47.0    3e-04   
ref|XP_007023615.1|  Glycosyl hydrolases family 31 protein isoform 4  47.0    3e-04   
ref|XP_010853334.1|  PREDICTED: probable maltase-glucoamylase-lik...  47.4    3e-04   
ref|XP_005958676.1|  PREDICTED: lysosomal alpha-glucosidase           47.0    3e-04   
gb|EAW78601.1|  sucrase-isomaltase (alpha-glucosidase)                47.0    3e-04   
ref|XP_003506744.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  47.0    3e-04   
ref|XP_007023616.1|  Glycosyl hydrolases family 31 protein isoform 5  47.0    3e-04   
ref|XP_011085177.1|  PREDICTED: alpha-glucosidase                     47.0    3e-04   
emb|CDP00611.1|  unnamed protein product                              47.0    3e-04   
ref|XP_009559964.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.0    3e-04   
gb|KHG12090.1|  Alpha-xylosidase -like protein                        47.0    3e-04   
ref|XP_010671591.1|  PREDICTED: alpha-glucosidase-like                47.0    3e-04   
ref|XP_005694138.1|  PREDICTED: lysosomal alpha-glucosidase isofo...  47.0    3e-04   
ref|XP_003531929.1|  PREDICTED: alpha-xylosidase 1-like               47.0    3e-04   
ref|XP_009526754.1|  family 31 glycoside hydrolase                    47.0    3e-04   
ref|XP_010791964.1|  PREDICTED: lysosomal alpha-glucosidase           47.0    3e-04   
ref|XP_004013141.1|  PREDICTED: lysosomal alpha-glucosidase           47.0    3e-04   
ref|XP_003516826.1|  PREDICTED: alpha-xylosidase 1-like               47.0    3e-04   
ref|XP_007023614.1|  Glycosyl hydrolases family 31 protein isoform 3  47.0    3e-04   
ref|XP_007618015.1|  PREDICTED: LOW QUALITY PROTEIN: maltase-gluc...  47.0    3e-04   
ref|XP_003387648.1|  PREDICTED: lysosomal alpha-glucosidase-like      47.0    3e-04   
emb|CDI97620.1|  lysosomal alpha glucosidase                          47.0    3e-04   
ref|XP_003397502.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...  47.0    3e-04   
ref|XP_006861322.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.0    3e-04   
gb|KFP53252.1|  Lysosomal alpha-glucosidase                           45.4    3e-04   
gb|KFK41275.1|  hypothetical protein AALP_AA2G109000                  47.0    3e-04   
gb|KEH44225.1|  alpha-glucosidase                                     47.0    3e-04   
ref|XP_007086299.1|  PREDICTED: sucrase-isomaltase, intestinal        47.0    3e-04   
ref|NP_001116804.1|  sucrase-isomaltase, intestinal                   47.0    3e-04   
gb|KHN13348.1|  Alpha-xylosidase                                      47.0    3e-04   
ref|XP_009090078.1|  PREDICTED: lysosomal alpha-glucosidase-like      47.0    3e-04   
ref|XP_006861859.1|  PREDICTED: LOW QUALITY PROTEIN: sucrase-isom...  47.0    3e-04   
ref|XP_008632008.1|  PREDICTED: sucrase-isomaltase, intestinal        47.0    3e-04   
gb|EUB56638.1|  Lysosomal alpha-glucosidase                           47.0    3e-04   
ref|XP_004238937.1|  PREDICTED: alpha-xylosidase 1                    47.0    3e-04   
ref|XP_007023613.1|  Glycosyl hydrolases family 31 protein isoform 2  46.6    3e-04   
ref|XP_005487444.1|  PREDICTED: lysosomal alpha-glucosidase-like      47.0    3e-04   
ref|NP_190180.1|  putative alpha-xylosidase 2                         47.0    3e-04   
ref|XP_008285762.1|  PREDICTED: lysosomal alpha-glucosidase           47.0    3e-04   
ref|XP_003536686.1|  PREDICTED: alpha-xylosidase 1-like               47.0    3e-04   
ref|XP_006391125.1|  hypothetical protein EUTSA_v10018090mg           47.0    3e-04   
ref|XP_003614705.1|  Alpha-D-xylosidase                               47.0    3e-04   
ref|XP_005365952.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.0    3e-04   
ref|XP_004416611.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.0    3e-04   
ref|XP_009559438.1|  PREDICTED: lysosomal alpha-glucosidase           46.6    3e-04   
ref|XP_010514918.1|  PREDICTED: putative alpha-xylosidase 2 isofo...  47.0    3e-04   
emb|CAB82818.1|  putative protein                                     46.6    3e-04   
ref|XP_007142906.1|  hypothetical protein PHAVU_007G026900g           46.6    3e-04   
gb|ELW64814.1|  Sucrase-isomaltase, intestinal                        47.0    3e-04   
gb|AAD05539.1|  alpha-xylosidase precursor                            46.6    3e-04   
ref|NP_177023.1|  bifunctional alpha-l-arabinofuranosidase/beta-d...  46.6    3e-04   
ref|XP_420085.4|  PREDICTED: lysosomal alpha-glucosidase-like         46.6    3e-04   
ref|XP_010511858.1|  PREDICTED: alpha-xylosidase 1-like               46.6    3e-04   
ref|XP_006300600.1|  hypothetical protein CARUB_v10019747mg           46.6    3e-04   
ref|XP_005031775.1|  PREDICTED: LOW QUALITY PROTEIN: glucosidase,...  46.6    3e-04   
gb|EYU19076.1|  hypothetical protein MIMGU_mgv1a001054mg              46.6    3e-04   
gb|KHN75915.1|  Maltase-glucoamylase, intestinal                      46.6    3e-04   
ref|XP_006886395.1|  PREDICTED: lysosomal alpha-glucosidase           46.6    3e-04   
gb|ACH86012.1|  sucrase-isomaltase                                    47.0    3e-04   
ref|XP_010415479.1|  PREDICTED: alpha-xylosidase 1-like               46.6    3e-04   
ref|XP_003582182.2|  PREDICTED: probable maltase-glucoamylase-lik...  47.0    3e-04   
ref|XP_008140475.1|  PREDICTED: LOW QUALITY PROTEIN: sucrase-isom...  47.0    3e-04   
gb|KHG18597.1|  Alpha-xylosidase -like protein                        46.6    3e-04   
gb|KFP71576.1|  Sucrase-isomaltase, intestinal                        45.4    3e-04   
ref|XP_010470809.1|  PREDICTED: alpha-xylosidase 1                    46.6    3e-04   
gb|ETI45849.1|  hypothetical protein F443_09689                       46.6    3e-04   
ref|XP_009597805.1|  PREDICTED: alpha-xylosidase 1-like               46.6    4e-04   
ref|XP_002877443.1|  hypothetical protein ARALYDRAFT_484972           46.6    4e-04   
gb|KFK33960.1|  hypothetical protein AALP_AA5G084000                  46.6    4e-04   
ref|XP_006910692.1|  PREDICTED: maltase-glucoamylase, intestinal-...  47.0    4e-04   
ref|XP_002877244.1|  predicted protein                                46.6    4e-04   
ref|XP_006869708.1|  PREDICTED: lysosomal alpha-glucosidase           46.6    4e-04   
gb|EPS67425.1|  hypothetical protein M569_07348                       46.6    4e-04   
ref|XP_004382498.1|  PREDICTED: maltase-glucoamylase, intestinal-...  46.6    4e-04   
gb|EDL15487.1|  mCG120052                                             46.6    4e-04   
ref|NP_001074606.1|  sucrase-isomaltase, intestinal                   46.6    4e-04   
sp|Q43763.1|AGLU_HORVU  RecName: Full=Alpha-glucosidase; AltName:...  46.6    4e-04   
ref|XP_008389295.1|  PREDICTED: alpha-xylosidase 1                    46.6    4e-04   
gb|KFK33959.1|  hypothetical protein AALP_AA5G084000                  46.6    4e-04   
ref|XP_005076185.1|  PREDICTED: sucrase-isomaltase, intestinal-like   46.6    4e-04   
ref|XP_009799141.1|  PREDICTED: alpha-xylosidase 1-like               46.6    4e-04   
gb|ETP15670.1|  hypothetical protein F441_09623                       46.6    4e-04   
ref|XP_008892701.1|  hypothetical protein PPTG_01216                  46.6    4e-04   
ref|XP_002194472.2|  PREDICTED: maltase-glucoamylase, intestinal      46.6    4e-04   
emb|CDP12606.1|  unnamed protein product                              46.6    4e-04   
ref|XP_002592854.1|  hypothetical protein BRAFLDRAFT_201634           46.6    4e-04   
ref|XP_010671601.1|  PREDICTED: alpha-glucosidase-like                46.6    4e-04   
ref|XP_010802921.1|  PREDICTED: probable maltase-glucoamylase-lik...  46.6    4e-04   
ref|XP_010719733.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal al...  46.6    4e-04   
gb|ETP43729.1|  hypothetical protein F442_09595                       46.6    4e-04   
ref|XP_009526755.1|  hypothetical protein PHYSODRAFT_545197           46.6    4e-04   
gb|ETK85816.1|  hypothetical protein L915_09482                       46.2    4e-04   
ref|XP_008070613.1|  PREDICTED: sucrase-isomaltase, intestinal        46.6    4e-04   
gb|ETO74538.1|  hypothetical protein F444_09752                       46.6    4e-04   
ref|XP_009356277.1|  PREDICTED: alpha-xylosidase 1-like               46.6    4e-04   
gb|ELK13785.1|  Maltase-glucoamylase, intestinal                      46.6    4e-04   
ref|XP_009267666.1|  Alpha-glucosidase                                46.6    4e-04   
ref|XP_010681561.1|  PREDICTED: alpha-xylosidase 1-like               46.6    4e-04   
ref|XP_010378021.1|  PREDICTED: lysosomal alpha-glucosidase           46.6    4e-04   
ref|XP_005407393.1|  PREDICTED: lysosomal alpha-glucosidase           46.6    4e-04   
ref|XP_009189667.1|  PREDICTED: lysosomal alpha-glucosidase           46.6    4e-04   
ref|XP_010729028.1|  PREDICTED: lysosomal alpha-glucosidase           46.6    4e-04   
ref|XP_004486491.1|  PREDICTED: alpha-glucosidase-like isoform X1     46.6    4e-04   
ref|XP_005419213.1|  PREDICTED: maltase-glucoamylase, intestinal-...  46.6    4e-04   



>gb|EFX72744.1| hypothetical protein DAPPUDRAFT_325909 [Daphnia pulex]
Length=964

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G +  H+  D+VS WT LR S+   L Y MFGIP++GADICGF 
Sbjct  633  GQGHYGGHWSGDVVSDWTNLRRSITSILNYNMFGIPLVGADICGFN  678



>gb|EPZ36991.1| P-type trefoil domain-containing protein [Rozella allomycis CSF55]
Length=1259

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G++SYH+  D  S+W  +  S+   L + MFGIPM+GADICGF
Sbjct  928  GSGKYSYHWTGDNWSTWRQMHLSIPAILNFNMFGIPMVGADICGF  972



>ref|XP_002422874.1| sucrase-isomaltase, intestinal, putative [Pediculus humanus corporis]
 gb|EEB10136.1| sucrase-isomaltase, intestinal, putative [Pediculus humanus corporis]
Length=882

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQF  H+  D+VS W  ++ ++   L++ +FGIPM+GADICGF
Sbjct  564  GSGQFGGHWSGDVVSDWQSMKETIPKLLSFSLFGIPMMGADICGF  608



>gb|KFD54573.1| hypothetical protein M513_04518 [Trichuris suis]
 gb|KFD64909.1| hypothetical protein M514_04518 [Trichuris suis]
Length=2261

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G++++H++ D  ++W  ++ S+   L Y MFGIPM+GADICGF
Sbjct  454  GTGRYAFHWLGDNEATWEQMKWSIVGMLEYNMFGIPMVGADICGF  498



>sp|O00906.1|AGLU_TETPY RecName: Full=Lysosomal acid alpha-glucosidase; AltName: Full=Acid 
maltase; Flags: Precursor [Tetrahymena pyriformis]
 dbj|BAA20462.1| acid alpha-glucosidase [Tetrahymena pyriformis]
Length=923

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQF  H+  D  S W  L+ SLG    + M+GIPM GADICGF
Sbjct  574  GSGQFVQHWTGDNGSQWDFLQYSLGEIFNFNMYGIPMTGADICGF  618



>ref|XP_001454850.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87453.1| unnamed protein product [Paramecium tetraurelia]
Length=825

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H+  D  +SW  L  SLG   ++ ++GIPM+GAD+CGF
Sbjct  505  GSGQYAQHWTGDNGASWDFLYLSLGQIFSFQIYGIPMVGADVCGF  549



>gb|KFM79974.1| Maltase-glucoamylase, intestinal, partial [Stegodyphus mimosarum]
Length=540

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ HF+ D +S+W  L+ S+   L + +FGIP +GADICGF
Sbjct  203  GSGRFTSHFLGDNLSTWEQLQSSIPGILKFNLFGIPFVGADICGF  247



>ref|XP_008821778.1| PREDICTED: maltase-glucoamylase, intestinal, partial [Nannospalax 
galili]
Length=1029

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGFT
Sbjct  592  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFT  637



>ref|XP_007505334.1| PREDICTED: maltase-glucoamylase, intestinal [Monodelphis domestica]
Length=3632

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR SL   L + +FGIPM+G DICGFT
Sbjct  597  GSGKFAAHWLGDNAATWNDLRWSLPGMLEFNLFGIPMVGPDICGFT  642



>ref|XP_004932972.1| PREDICTED: uncharacterized protein LOC101736905 [Bombyx mori]
Length=1860

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+++ H+  DI S W  ++ S+   L++ +FG+PM+GADICGF
Sbjct  769  GLGRYAGHWSGDISSQWHDMKMSIPELLSFSLFGVPMMGADICGF  813



>emb|CCD75070.1| putative alpha-glucosidase [Schistosoma mansoni]
Length=903

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G ++ H+  D++S+W  L+ S+   + + MFGIPM+GADICGFT
Sbjct  558  GSGLYAAHWTGDVLSNWDSLKTSVVQIINFNMFGIPMVGADICGFT  603



>emb|CCD75069.1| putative alpha-glucosidase [Schistosoma mansoni]
Length=899

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G ++ H+  D++S+W  L+ S+   + + MFGIPM+GADICGFT
Sbjct  555  GSGLYAAHWTGDVLSNWDSLKTSVVQIINFNMFGIPMVGADICGFT  600



>ref|XP_003584906.3| PREDICTED: maltase-glucoamylase, intestinal isoform X1, partial 
[Bos taurus]
Length=881

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W+ LR S+   L + +FGIPM+GADICGF
Sbjct  303  GSGKFAAHWLGDNAATWSDLRWSIPGMLEFNLFGIPMVGADICGF  347



>ref|XP_004030900.1| hypothetical protein IMG5_151340 [Ichthyophthirius multifiliis]
 gb|EGR29664.1| hypothetical protein IMG5_151340 [Ichthyophthirius multifiliis]
Length=701

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F  H+  D  + W+ LR SL     + +FG+PM+G DICGF
Sbjct  361  GSGKFVQHWTGDNGADWSFLRSSLAEIFNFNLFGMPMVGVDICGF  405



>ref|XP_001457767.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK90370.1| unnamed protein product [Paramecium tetraurelia]
Length=826

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  +SW  L  SLG    + +FGIPM+GAD+CGF
Sbjct  506  GTGKYAQHWTGDNGASWDFLYLSLGQVFQFQIFGIPMVGADVCGF  550



>ref|XP_007466695.1| PREDICTED: maltase-glucoamylase, intestinal [Lipotes vexillifer]
Length=1828

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G+DICGFT
Sbjct  590  GSGKFAAHWLGDNAATWNDLRWSIAGMLEFSLFGIPMVGSDICGFT  635



>ref|XP_006635566.1| PREDICTED: coiled-coil domain-containing protein 40-like [Lepisosteus 
oculatus]
Length=1472

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5     GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
             G+G+F+ H+  D+ S W  LR S+   L + ++G+P++GAD+CGF
Sbjct  1140  GLGRFAGHWTGDVRSDWEQLRLSVPAILLFGLYGVPLVGADVCGF  1184



>ref|XP_001427455.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60057.1| unnamed protein product [Paramecium tetraurelia]
Length=859

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G F+ H+  D  +S+T L  S+G T+ + +FGIPM+GAD+CGF
Sbjct  504  GSGHFTQHWEGDNEASYTFLYLSVGSTMQFNIFGIPMVGADVCGF  548



>ref|XP_001461378.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK94005.1| unnamed protein product [Paramecium tetraurelia]
Length=834

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G F+ H+  D  +S+T L  S+G T+ + +FGIPM+GAD+CGF
Sbjct  479  GSGHFTQHWEGDNEASYTFLYLSVGSTMQFNIFGIPMVGADVCGF  523



>ref|XP_008482665.1| PREDICTED: lysosomal alpha-glucosidase-like, partial [Diaphorina 
citri]
Length=1252

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5     GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
             G G++  H+  D+ S++  ++ S+   +++ MFGIPM+GADICGF
Sbjct  1030  GQGKYGGHWTGDVFSTYDDMKHSVADIMSFSMFGIPMVGADICGF  1074



>ref|XP_009202266.1| PREDICTED: maltase-glucoamylase, intestinal [Papio anubis]
Length=1907

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  625  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  669



>ref|XP_001454030.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK86633.1| unnamed protein product [Paramecium tetraurelia]
Length=815

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  +SW  L  SLG    + +FGIPM+GAD+CGF
Sbjct  495  GTGKYAQHWTGDNGASWDFLYLSLGQVFQFQIFGIPMVGADVCGF  539



>ref|XP_009241591.1| PREDICTED: LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal, 
partial [Pongo abelii]
Length=1248

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  625  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  669



>ref|XP_008556280.1| PREDICTED: lysosomal alpha-glucosidase-like [Microplitis demolitor]
Length=888

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  DI SSW  L+ S+   L Y +F IPM+GADICGF
Sbjct  559  GHGSYAAHWTGDIYSSWYDLKMSVPEILMYSLFQIPMVGADICGF  603



>ref|XP_001083672.2| PREDICTED: maltase-glucoamylase, intestinal, partial [Macaca 
mulatta]
Length=2104

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  609  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  653



>ref|XP_006777139.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X2 [Myotis 
davidii]
Length=1818

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  579  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGF  623



>ref|XP_005679600.1| PREDICTED: maltase-glucoamylase, intestinal-like [Capra hircus]
Length=1836

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  +SW  LR S+   L + +FGIPM+GADICGF
Sbjct  590  GSGKFAAHWLGDNAASWNDLRWSIPGILEFNLFGIPMVGADICGF  634



>gb|EPQ13198.1| Maltase-glucoamylase, intestinal [Myotis brandtii]
Length=1899

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  660  GSGKFAAHWLGDNAATWDDLRWSIPGMLEFNLFGIPMVGADICGF  704



>ref|XP_001083998.2| PREDICTED: maltase-glucoamylase, intestinal, partial [Macaca 
mulatta]
Length=1304

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G GQF+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  21   GSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGYT  66



>ref|XP_005551050.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X1 [Macaca 
fascicularis]
 ref|XP_005551051.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X2 [Macaca 
fascicularis]
 ref|XP_005551052.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X3 [Macaca 
fascicularis]
 ref|XP_005551053.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X4 [Macaca 
fascicularis]
Length=3641

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  609  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  653



>gb|EHH17757.1| hypothetical protein EGK_14221 [Macaca mulatta]
Length=2681

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  606  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  650



>ref|XP_001952631.1| PREDICTED: lysosomal alpha-glucosidase-like [Acyrthosiphon pisum]
Length=941

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G F+ H+  D+ S+W  ++ S+   + + MFG+P++GADICGF
Sbjct  610  GLGHFAGHWTGDVFSTWDDMKQSITDIVLFNMFGVPLVGADICGF  654



>ref|XP_005551054.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X5 [Macaca 
fascicularis]
Length=2745

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  609  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  653



>ref|XP_006777138.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X1 [Myotis 
davidii]
Length=1470

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  579  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGF  623



>ref|XP_005875094.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X1 [Myotis 
brandtii]
 ref|XP_005875095.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X2 [Myotis 
brandtii]
Length=1818

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  579  GSGKFAAHWLGDNAATWDDLRWSIPGMLEFNLFGIPMVGADICGF  623



>gb|KHJ49579.1| hormone receptor domain protein [Trichuris suis]
Length=1356

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5     GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
             G G++++H++ D  ++W  ++ S+   L Y MFGIPM+GADICGF 
Sbjct  1011  GTGRYAFHWLGDNEATWEQMKWSIVGMLEYNMFGIPMVGADICGFA  1056



>ref|XP_008148744.1| PREDICTED: maltase-glucoamylase, intestinal [Eptesicus fuscus]
Length=1817

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  579  GSGKFAAHWLGDNAATWDDLRWSIPGMLEFNLFGIPMVGADICGF  623



>ref|XP_006094792.1| PREDICTED: maltase-glucoamylase, intestinal-like [Myotis lucifugus]
Length=1818

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  579  GSGKFAAHWLGDNAATWDDLRWSIPGMLEFNLFGIPMVGADICGF  623



>ref|XP_004318035.1| PREDICTED: maltase-glucoamylase, intestinal-like, partial [Tursiops 
truncatus]
Length=1214

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G+DICGFT
Sbjct  27   GSGKFAAHWLGDNAATWNDLRWSIPGMLEFSLFGIPMVGSDICGFT  72



>ref|XP_005551058.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X3 [Macaca 
fascicularis]
Length=1863

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G GQF+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  566  GSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGYT  611



>ref|XP_005551057.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X2 [Macaca 
fascicularis]
Length=2392

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G GQF+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  566  GSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGYT  611



>ref|XP_005551056.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X1 [Macaca 
fascicularis]
Length=2472

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G GQF+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  566  GSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGYT  611



>ref|XP_004272292.1| PREDICTED: maltase-glucoamylase, intestinal [Orcinus orca]
Length=1836

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G+DICGFT
Sbjct  598  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFSLFGIPMVGSDICGFT  643



>gb|AFW76025.1| hypothetical protein ZEAMMB73_615454, partial [Zea mays]
Length=675

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPM+GADICGF
Sbjct  528  GSGRYTAHWTGDNAATWDDLRYSINTMLSFGLFGIPMVGADICGF  572



>ref|XP_008207689.1| PREDICTED: lysosomal alpha-glucosidase-like [Nasonia vitripennis]
Length=1065

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D+ S+W  LR S+   L Y +F IPM+GADICGF
Sbjct  673  GHGFYAGHWTGDVYSAWHDLRMSIPEILAYSLFQIPMVGADICGF  717



>ref|XP_009297618.1| PREDICTED: lysosomal alpha-glucosidase isoform X2 [Danio rerio]
Length=910

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+FS H+  D+ S W  LR S+   L + ++GIP++GAD+CGF
Sbjct  579  GLGRFSAHWTGDVRSDWEQLRFSIPAVLLFGLYGIPLVGADVCGF  623



>ref|XP_007103396.1| PREDICTED: maltase-glucoamylase, intestinal [Physeter catodon]
Length=1872

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H+  D  ++W  LR S+   L + +FGIPM+G+DICGFT
Sbjct  634  GSGKFAAHWSGDNAATWNDLRWSIPSMLEFNLFGIPMVGSDICGFT  679



>ref|XP_001921957.2| PREDICTED: lysosomal alpha-glucosidase isoform X1 [Danio rerio]
Length=918

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+FS H+  D+ S W  LR S+   L + ++GIP++GAD+CGF
Sbjct  587  GLGRFSAHWTGDVRSDWEQLRFSIPAVLLFGLYGIPLVGADVCGF  631



>ref|XP_006746626.1| PREDICTED: maltase-glucoamylase, intestinal-like [Leptonychotes 
weddellii]
Length=1673

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF 
Sbjct  547  GSGKFAAHWLGDNAATWNDLRWSIPGVLEFNLFGIPMVGADICGFA  592



>ref|XP_002438844.1| hypothetical protein SORBIDRAFT_10g027110 [Sorghum bicolor]
 gb|EER90211.1| hypothetical protein SORBIDRAFT_10g027110 [Sorghum bicolor]
Length=896

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPM+GADICGF
Sbjct  544  GSGRYTAHWTGDNAATWDDLRYSINTMLSFGLFGIPMVGADICGF  588



>ref|XP_007177076.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007177077.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=1829

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G+DICGFT
Sbjct  590  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGSDICGFT  635



>ref|XP_010352776.1| PREDICTED: probable maltase-glucoamylase-like protein [Rhinopithecus 
roxellana]
Length=2516

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G GQF+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  566  GSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGYT  611



>ref|XP_004046399.1| PREDICTED: maltase-glucoamylase, intestinal-like, partial [Gorilla 
gorilla gorilla]
Length=824

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+FS H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  609  GSGKFSAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  653



>ref|XP_007981906.1| PREDICTED: maltase-glucoamylase, intestinal-like [Chlorocebus 
sabaeus]
Length=2581

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G GQF+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  608  GSGQFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGYT  653



>ref|XP_006052157.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X1 [Bubalus 
bubalis]
 ref|XP_006052158.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X2 [Bubalus 
bubalis]
 ref|XP_006052159.1| PREDICTED: maltase-glucoamylase, intestinal-like isoform X3 [Bubalus 
bubalis]
Length=1832

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W+ LR S+   L + +FGIPM+GADICGF
Sbjct  590  GSGKFAAHWLGDNAATWSDLRWSIPGMLEFNLFGIPMVGADICGF  634



>emb|CDW53293.1| Gal mutarotas 2 and Glyco hydro 31 domain contain ing protein 
[Trichuris trichiura]
Length=915

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G +++H++ D  ++W  L+ S+   + Y MFGIPM+GADICGF 
Sbjct  570  GTGSYAFHWLGDNEATWEQLKWSIVGIMEYNMFGIPMVGADICGFA  615



>ref|XP_004416609.1| PREDICTED: maltase-glucoamylase, intestinal [Odobenus rosmarus 
divergens]
Length=1846

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  606  GSGKFAAHWLGDNAATWNDLRWSIPGVLEFNLFGIPMVGADICGF  650



>ref|XP_009860843.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal alpha-glucosidase-like 
[Ciona intestinalis]
Length=880

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G +  H+  DI S+W  LR S+   + + MFGIPM+GADICGF+
Sbjct  549  GMYGGHWSGDITSTWPDLRQSIASVINFNMFGIPMVGADICGFS  592



>ref|XP_010629940.1| PREDICTED: maltase-glucoamylase, intestinal [Fukomys damarensis]
Length=2136

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF+
Sbjct  579  GSGKFAAHWLGDNAATWNDLQWSITGMLEFNLFGIPMVGADICGFS  624



>ref|XP_010853283.1| PREDICTED: maltase-glucoamylase, intestinal [Bison bison bison]
 ref|XP_010853284.1| PREDICTED: maltase-glucoamylase, intestinal [Bison bison bison]
 ref|XP_010853285.1| PREDICTED: maltase-glucoamylase, intestinal [Bison bison bison]
Length=1831

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W+ LR S+   L + +FGIPM+GADICGF
Sbjct  589  GSGKFAAHWLGDNAATWSDLRWSIPGMLEFNLFGIPMVGADICGF  633



>ref|XP_002687127.1| PREDICTED: maltase-glucoamylase, intestinal isoform X4 [Bos taurus]
 ref|XP_005205978.1| PREDICTED: maltase-glucoamylase, intestinal isoform X4 [Bos taurus]
 ref|XP_010802920.1| PREDICTED: maltase-glucoamylase, intestinal isoform X4 [Bos taurus]
 tpg|DAA30211.1| TPA: maltase-glucoamylase-like [Bos taurus]
Length=1831

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W+ LR S+   L + +FGIPM+GADICGF
Sbjct  589  GSGKFAAHWLGDNAATWSDLRWSIPGMLEFNLFGIPMVGADICGF  633



>ref|XP_004851417.1| PREDICTED: maltase-glucoamylase, intestinal-like [Heterocephalus 
glaber]
Length=3020

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF+
Sbjct  591  GSGKFAAHWLGDNTATWNDLQWSIPGMLEFNLFGIPMVGADICGFS  636



>ref|XP_003738884.1| PREDICTED: lysosomal alpha-glucosidase-like [Metaseiulus occidentalis]
Length=985

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G +S H+  DI SSW  ++ S+   + + MFG+PM+GADICGF
Sbjct  646  GQGLWSGHWTGDIDSSWIDMQQSVTDIMNFAMFGMPMLGADICGF  690



>ref|XP_006038303.1| PREDICTED: lysosomal alpha-glucosidase [Alligator sinensis]
Length=857

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D+ SSW  L  S+   L + ++G+P++GADICGFT
Sbjct  527  GHGRYAGHWTGDVFSSWEQLSSSIAEVLLFNLYGVPLVGADICGFT  572



>ref|XP_004008356.1| PREDICTED: maltase-glucoamylase, intestinal-like [Ovis aries]
Length=1832

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  590  GSGKFAAHWLGDNAATWNDLRWSIPGILEFNLFGIPMVGADICGF  634



>ref|XP_008148743.1| PREDICTED: LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal-like 
[Eptesicus fuscus]
Length=1991

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  498  GSGKFAAHWLGDNAAAWDDLRWSIPSILEFNLFGIPMVGANICGYT  543



>ref|XP_003370205.1| alpha-glucosidase [Trichinella spiralis]
 gb|EFV50293.1| alpha-glucosidase [Trichinella spiralis]
Length=468

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            GQFS H++ D  S W  L  S+   L + MFGIP +GADICGF
Sbjct  111  GQFSGHWLGDNFSKWADLAASIIGILEFNMFGIPYVGADICGF  153



>ref|XP_005981933.1| PREDICTED: maltase-glucoamylase, intestinal-like [Pantholops 
hodgsonii]
Length=1832

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  590  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGF  634



>ref|XP_008695547.1| PREDICTED: maltase-glucoamylase, intestinal [Ursus maritimus]
Length=2035

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  795  GSGKFAAHWLGDNAATWDDLRWSIPGVLEFSLFGIPMVGADICGF  839



>pdb|2QLY|A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human 
Maltase- Glucoamylase
 pdb|2QMJ|A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human 
Maltase- Glucoamylase In Complex With Acarbose
 pdb|3CTT|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase 
With Casuarine
Length=870

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  531  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  575



>ref|XP_004742040.1| PREDICTED: maltase-glucoamylase, intestinal-like [Mustela putorius 
furo]
Length=1811

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF 
Sbjct  572  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGFA  617



>ref|XP_003983204.1| PREDICTED: maltase-glucoamylase, intestinal-like [Felis catus]
Length=1794

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF 
Sbjct  582  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGFA  627



>pdb|3L4T|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase 
With Bj2661
 pdb|3L4U|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase 
With De-O-Sulfonated Kotalanol
 pdb|3L4V|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase 
With Kotalanol
 pdb|3L4W|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase 
With Miglitol
 pdb|3L4X|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase 
With Nr4-8
 pdb|3L4Y|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase 
With Nr4-8ii
 pdb|3L4Z|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase 
With Salacinol
Length=875

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  531  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  575



>ref|XP_008648952.1| PREDICTED: probable alpha-glucosidase Os06g0675700 isoform X2 
[Zea mays]
 gb|AFW76024.1| hypothetical protein ZEAMMB73_615454 [Zea mays]
Length=880

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPM+GADICGF
Sbjct  528  GSGRYTAHWTGDNAATWDDLRYSINTMLSFGLFGIPMVGADICGF  572



>ref|XP_007090948.1| PREDICTED: maltase-glucoamylase, intestinal-like [Panthera tigris 
altaica]
Length=1825

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF 
Sbjct  583  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGFA  628



>ref|XP_005629599.1| PREDICTED: maltase-glucoamylase, intestinal [Canis lupus familiaris]
Length=1833

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  591  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGF  635



>ref|XP_001024217.1| Glycosyl hydrolases family 31 protein [Tetrahymena thermophila]
Length=2109

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  2     FGMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
             FG G++  H+  D +S+W  ++ S+    T+ MF IP++G DICGF
Sbjct  1762  FGSGRYVQHWTGDNMSTWEYMKLSIAHIFTFQMFSIPLVGDDICGF  1807



>ref|XP_005365951.1| PREDICTED: maltase-glucoamylase, intestinal-like [Microtus ochrogaster]
Length=1817

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  599  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFSLFGIPMVGADICGF  643



>ref|XP_008648951.1| PREDICTED: probable alpha-glucosidase Os06g0675700 isoform X1 
[Zea mays]
Length=885

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPM+GADICGF
Sbjct  533  GSGRYTAHWTGDNAATWDDLRYSINTMLSFGLFGIPMVGADICGF  577



>ref|XP_004629182.1| PREDICTED: maltase-glucoamylase, intestinal-like [Octodon degus]
Length=1708

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  592  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGF  636



>ref|XP_003744654.1| PREDICTED: lysosomal alpha-glucosidase-like [Metaseiulus occidentalis]
Length=888

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  DI S+W  L+ S+   L +  +GIPMIGADICGF
Sbjct  552  GHGFYAGHWTGDIFSTWVDLKDSIPGILEFSFYGIPMIGADICGF  596



>gb|AFW76026.1| hypothetical protein ZEAMMB73_615454 [Zea mays]
Length=591

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPM+GADICGF
Sbjct  239  GSGRYTAHWTGDNAATWDDLRYSINTMLSFGLFGIPMVGADICGF  283



>ref|XP_004814638.1| PREDICTED: maltase-glucoamylase, intestinal [Mustela putorius 
furo]
Length=1827

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  588  GSGKFAAHWLGDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGF  632



>ref|XP_010598091.1| PREDICTED: LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal-like 
[Loxodonta africana]
Length=1760

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  579  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  623



>ref|XP_004906914.1| PREDICTED: LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal-like 
[Heterocephalus glaber]
Length=2128

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPMIGA+ICG+T
Sbjct  706  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMIGANICGYT  751



>ref|XP_002752029.1| PREDICTED: maltase-glucoamylase, intestinal [Callithrix jacchus]
Length=1865

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  625  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  669



>ref|XP_006997155.1| PREDICTED: maltase-glucoamylase, intestinal-like [Peromyscus 
maniculatus bairdii]
Length=1801

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  591  GSGKFASHWLGDNAATWKDLQWSIPGMLEFNLFGIPMVGADICGF  635



>ref|XP_007981388.1| PREDICTED: maltase-glucoamylase, intestinal isoform X2 [Chlorocebus 
sabaeus]
Length=1870

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  657  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  701



>ref|XP_007981387.1| PREDICTED: maltase-glucoamylase, intestinal isoform X1 [Chlorocebus 
sabaeus]
Length=1897

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  657  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  701



>dbj|GAA30540.2| lysosomal alpha-glucosidase [Clonorchis sinensis]
Length=904

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D +SSW  +R S+   + + +FGIPM+GADICGF
Sbjct  561  GSGLYTIHWTGDNLSSWPDMRASIAQIINFNLFGIPMVGADICGF  605



>gb|AIG55952.1| secreted protein [Achlya hypogyna]
Length=1029

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H++ D  ++WT +R S+   L   +FGIPM+G D+CGF
Sbjct  637  GDGQYTAHWLGDNAATWTDMRQSIAGVLASNLFGIPMVGPDVCGF  681



>gb|EEC81169.1| hypothetical protein OsI_24141 [Oryza sativa Indica Group]
Length=484

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPMIGADICGF
Sbjct  162  GSGRYTAHWTGDNFATWDDLRYSINTMLSFGLFGIPMIGADICGF  206



>ref|XP_010945738.1| PREDICTED: maltase-glucoamylase, intestinal [Camelus bactrianus]
Length=1841

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W+ L+ S+   L + +FGIPM+G+DICGFT
Sbjct  598  GSGKFAAHWLGDNAATWSDLQWSIPAMLEFNLFGIPMVGSDICGFT  643



>ref|XP_010988162.1| PREDICTED: maltase-glucoamylase, intestinal [Camelus dromedarius]
Length=1841

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W+ L+ S+   L + +FGIPM+G+DICGFT
Sbjct  598  GSGKFAAHWLGDNAATWSDLQWSIPAMLEFNLFGIPMVGSDICGFT  643



>ref|XP_006185457.1| PREDICTED: maltase-glucoamylase, intestinal-like [Camelus ferus]
Length=1841

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W+ L+ S+   L + +FGIPM+G+DICGFT
Sbjct  598  GSGKFAAHWLGDNAATWSDLQWSIPAMLEFNLFGIPMVGSDICGFT  643



>ref|XP_003475379.2| PREDICTED: maltase-glucoamylase, intestinal-like [Cavia porcellus]
Length=2194

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGFT
Sbjct  620  GSGKFAAHWLGDNAATWNDLQWSIPGMLEFNLFGIPMVGADICGFT  665



>ref|XP_006210146.1| PREDICTED: maltase-glucoamylase, intestinal-like [Vicugna pacos]
Length=1841

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W+ L+ S+   L + +FGIPM+G+DICGFT
Sbjct  598  GSGKFAAHWLGDNAATWSDLQWSIPAMLEFNLFGIPMVGSDICGFT  643



>gb|EDM15421.1| rCG27911 [Rattus norvegicus]
Length=653

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  477  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  521



>emb|CDP12608.1| unnamed protein product [Coffea canephora]
Length=905

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H+  D  ++W  L  S+   L++ +FGIPM+GADICGF+
Sbjct  552  GSGKFTAHWTGDNAATWDDLAYSIPTILSFGLFGIPMVGADICGFS  597



>ref|XP_007981389.1| PREDICTED: maltase-glucoamylase, intestinal isoform X3 [Chlorocebus 
sabaeus]
Length=1535

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  657  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGF  701



>ref|XP_005332519.1| PREDICTED: maltase-glucoamylase, intestinal [Ictidomys tridecemlineatus]
Length=1357

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  585  GSGKFAAHWLGDNAATWNDLQWSIPGMLEFNLFGIPMVGADICGF  629



>gb|EWS71987.1| family 31 glycoside hydrolase [Tetrahymena thermophila SB210]
Length=916

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    FGMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            FG G++  H+  D +S+W  ++ S+    T+ MF IP++G DICGF
Sbjct  569  FGSGRYVQHWTGDNMSTWEYMKLSIAHIFTFQMFSIPLVGDDICGF  614



>ref|XP_004661140.1| PREDICTED: maltase-glucoamylase, intestinal [Jaculus jaculus]
Length=1935

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  592  GSGKFAAHWLGDNAATWRDLQWSIPGMLEFNLFGIPMVGADICGF  636



>gb|EAW83988.1| maltase-glucoamylase (alpha-glucosidase), isoform CRA_a, partial 
[Homo sapiens]
 gb|EAW83989.1| maltase-glucoamylase (alpha-glucosidase), isoform CRA_a, partial 
[Homo sapiens]
Length=1273

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  617  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  661



>ref|XP_004608407.1| PREDICTED: maltase-glucoamylase, intestinal-like [Sorex araneus]
Length=3139

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  373  GSGKFAGHWLGDNAATWDDLRWSIAGMLEFNLFGIPMVGADICGF  417


 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5     GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
             G GQF+ H++ D  ++W  +R S+   L + +FGIP++GA+ICG+
Sbjct  1571  GSGQFAGHWLGDNAATWDDMRWSIPSILEFNLFGIPLVGANICGY  1615



>ref|XP_004382497.1| PREDICTED: maltase-glucoamylase, intestinal-like [Trichechus 
manatus latirostris]
Length=1630

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  +SW  LR S+   L + +FGIPM+GA+ICG+
Sbjct  431  GSGKFAGHWLGDNTASWNDLRWSISSILEFNLFGIPMVGANICGY  475



>gb|EDL13569.1| mCG142195 [Mus musculus]
Length=1247

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  517  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  561



>ref|NP_001164474.1| maltase-glucoamylase [Mus musculus]
 gb|ACH86011.1| maltase-glucoamylase [Mus musculus]
Length=1827

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  591  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  635



>gb|EHB16913.1| Maltase-glucoamylase, intestinal [Heterocephalus glaber]
Length=2171

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPMIGA+ICG+T
Sbjct  512  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMIGANICGYT  557



>ref|XP_003270999.2| PREDICTED: maltase-glucoamylase, intestinal-like [Nomascus leucogenys]
Length=1950

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  577  GSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGYT  622



>ref|XP_003813563.1| PREDICTED: maltase-glucoamylase, intestinal, partial [Pan paniscus]
Length=2270

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  617  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  661



>ref|XP_005085831.1| PREDICTED: maltase-glucoamylase, intestinal-like [Mesocricetus 
auratus]
Length=2257

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  591  GSGKFAAHWLGDNTATWEDLQWSIPGMLEFNLFGIPMVGADICGF  635



>ref|XP_010358137.1| PREDICTED: maltase-glucoamylase, intestinal, partial [Rhinopithecus 
roxellana]
Length=1321

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  609  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  653



>gb|ACZ37245.1| alpha-glucosidase [Hordeum vulgare subsp. spontaneum]
Length=881

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D  ++W  LR S+   L++ +FG+PMIGADICGF 
Sbjct  528  GSGRYTAHWTGDNAATWDDLRYSINTMLSFGLFGMPMIGADICGFN  573



>ref|XP_006224950.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103690059 
isoform X1 [Rattus norvegicus]
Length=4511

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  590  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  634



>ref|XP_004851418.1| PREDICTED: maltase-glucoamylase, intestinal-like [Heterocephalus 
glaber]
Length=2352

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPMIGA+ICG+T
Sbjct  668  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMIGANICGYT  713



>ref|XP_008761089.1| PREDICTED: LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal-like 
isoform X2 [Rattus norvegicus]
Length=3560

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  590  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  634



>ref|XP_006506111.1| PREDICTED: maltase-glucoamylase isoform X7 [Mus musculus]
Length=2722

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  591  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  635



>ref|NP_001058353.1| Os06g0676700 [Oryza sativa Japonica Group]
 dbj|BAD45516.1| putative alpha-glucosidase [Oryza sativa Japonica Group]
 dbj|BAD45913.1| putative alpha-glucosidase [Oryza sativa Japonica Group]
 dbj|BAF20267.1| Os06g0676700 [Oryza sativa Japonica Group]
Length=886

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPMIGADICGF
Sbjct  529  GSGRYTAHWTGDNFATWDDLRYSINTMLSFGLFGIPMIGADICGF  573



>ref|XP_003566018.1| PREDICTED: probable alpha-glucosidase Os06g0675700 [Brachypodium 
distachyon]
Length=882

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D +++W  LR S+   L++ +FG+PM+GADICGF
Sbjct  527  GSGRYAAHWTGDNLATWDDLRYSINTMLSFGLFGVPMVGADICGF  571



>ref|XP_008492921.1| PREDICTED: uncharacterized protein LOC103529278 [Calypte anna]
Length=1541

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5     GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
             G+G+++ H+  D+ S W  L  S+   L + +FG+P++GADICGF
Sbjct  1211  GLGRYAGHWTGDVGSDWEQLYYSVPEILLFNLFGVPLVGADICGF  1255



>gb|EAZ02070.1| hypothetical protein OsI_24149 [Oryza sativa Indica Group]
Length=886

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPMIGADICGF
Sbjct  529  GSGRYTAHWTGDNFATWDDLRYSINTMLSFGLFGIPMIGADICGF  573



>ref|XP_005405585.1| PREDICTED: maltase-glucoamylase, intestinal-like [Chinchilla 
lanigera]
Length=2315

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  635  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGYT  680



>ref|XP_006506105.1| PREDICTED: maltase-glucoamylase isoform X1 [Mus musculus]
 ref|XP_006506106.1| PREDICTED: maltase-glucoamylase isoform X2 [Mus musculus]
 ref|XP_006506107.1| PREDICTED: maltase-glucoamylase isoform X3 [Mus musculus]
Length=3616

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  591  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  635



>ref|XP_006716231.1| PREDICTED: maltase-glucoamylase, intestinal isoform X1 [Homo 
sapiens]
 ref|XP_006716232.1| PREDICTED: maltase-glucoamylase, intestinal isoform X2 [Homo 
sapiens]
Length=2753

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  617  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  661



>ref|XP_006506109.1| PREDICTED: maltase-glucoamylase isoform X5 [Mus musculus]
Length=3586

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  561  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  605



>ref|XP_006506108.1| PREDICTED: maltase-glucoamylase isoform X4 [Mus musculus]
Length=3593

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  568  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  612



>ref|XP_004774471.1| PREDICTED: sucrase-isomaltase, intestinal [Mustela putorius furo]
 ref|XP_004787836.1| PREDICTED: sucrase-isomaltase, intestinal [Mustela putorius furo]
Length=1829

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H++ D  +SW  ++ S+   L + +FGIP++GADICGF
Sbjct  595  GSGRYAAHWLGDNTASWEQMKWSIAGMLEFNLFGIPLVGADICGF  639



>gb|EMP39291.1| Lysosomal alpha-glucosidase [Chelonia mydas]
Length=1596

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H+  D++SSW  L  S+   L + ++G+P++GADICGF
Sbjct  620  GHGRFAGHWTGDVLSSWEQLYYSIPEVLLFNLYGVPLVGADICGF  664



>gb|EAZ38007.1| hypothetical protein OsJ_22352 [Oryza sativa Japonica Group]
Length=873

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  LR S+   L++ +FGIPMIGADICGF
Sbjct  516  GSGRYTAHWTGDNFATWDDLRYSINTMLSFGLFGIPMIGADICGF  560



>ref|XP_002529880.1| alpha-glucosidase, putative [Ricinus communis]
 gb|EEF32483.1| alpha-glucosidase, putative [Ricinus communis]
Length=895

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G ++ H+  D+ S+W  L  S+   L + +FGIPM+GADICGFT
Sbjct  545  GMYAAHWTGDVASTWDDLANSIPSILNFGLFGIPMVGADICGFT  588



>ref|XP_002921728.1| PREDICTED: maltase-glucoamylase, intestinal-like [Ailuropoda 
melanoleuca]
Length=1806

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  533  GSGKYAAHWLGDNAATWNDLRWSIPSILEFNLFGIPMVGANICGYT  578



>ref|XP_003270883.2| PREDICTED: maltase-glucoamylase, intestinal-like isoform 1 [Nomascus 
leucogenys]
Length=1873

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  633  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  677



>ref|XP_005495943.1| PREDICTED: maltase-glucoamylase, intestinal-like, partial [Zonotrichia 
albicollis]
Length=1704

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F  H++ D  +SW  LR S+   L + +FGIP +GADICGF
Sbjct  523  GSGKFGGHWLGDNAASWDQLRWSIPGMLEFNLFGIPYVGADICGF  567



>ref|XP_008153219.1| PREDICTED: lysosomal alpha-glucosidase [Eptesicus fuscus]
Length=945

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H+  D+ SSW  L  S+  TL + + G+P++GAD+CGF
Sbjct  598  GHGQYAGHWTGDVRSSWEQLSSSVPETLLFNLLGVPLVGADVCGF  642



>ref|XP_006506110.1| PREDICTED: maltase-glucoamylase isoform X6 [Mus musculus]
Length=3503

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  478  GSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGF  522



>ref|XP_008581187.1| PREDICTED: LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal-like 
[Galeopterus variegatus]
Length=2467

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  564  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGYT  609



>gb|ERE90166.1| maltase-glucoamylase, intestinal-like protein [Cricetulus griseus]
Length=2351

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  588  GSGKFAAHWLGDNSATWEDLQWSVPGMLEFNLFGIPMVGADICGF  632



>ref|XP_001952639.2| PREDICTED: lysosomal alpha-glucosidase-like [Acyrthosiphon pisum]
Length=865

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  DI SSW  ++ S+   + + +FGIP++GADICGF
Sbjct  536  GFGHYAGHWTGDINSSWDDMKQSITDIINFNLFGIPLVGADICGF  580



>ref|XP_004594520.1| PREDICTED: maltase-glucoamylase, intestinal-like [Ochotona princeps]
Length=1773

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  +SW  LR S+   L + +FGIPM+G DICG+
Sbjct  574  GSGKFAGHWLGDNTASWNDLRWSIPGVLEFNLFGIPMVGPDICGY  618



>gb|KDP34894.1| hypothetical protein JCGZ_09182 [Jatropha curcas]
Length=908

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G+++ H+  DI S+W  L  ++   L++ +FGIPM+GADICGF+
Sbjct  556  GKYAAHWTGDIASTWEDLANTIPTMLSFGLFGIPMVGADICGFS  599



>gb|KDP34895.1| hypothetical protein JCGZ_09183 [Jatropha curcas]
Length=882

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+++ H+  D  S W  L  S+   L++ +FGIPMIGADICGF
Sbjct  534  GKYTAHWTGDTASRWDDLANSIPTILSFGLFGIPMIGADICGF  576



>ref|XP_001023473.2| Glycosyl hydrolases family 31 protein [Tetrahymena thermophila]
 gb|EAS03228.2| glycoside hydrolase family 31 protein [Tetrahymena thermophila 
SB210]
Length=927

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQF  H+  D  ++W  L+ SL     Y ++GIPM G DICGF
Sbjct  578  GSGQFVQHWTGDNGANWDFLKYSLSEIFNYNLYGIPMTGVDICGF  622



>gb|ERE90167.1| maltase-glucoamylase, intestinal-like protein [Cricetulus griseus]
Length=2400

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  606  GSGKFAAHWLGDNSATWEDLQWSVPGMLEFNLFGIPMVGADICGF  650



>gb|ERE90168.1| maltase-glucoamylase, intestinal-like protein [Cricetulus griseus]
Length=2384

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  606  GSGKFAAHWLGDNSATWEDLQWSVPGMLEFNLFGIPMVGADICGF  650



>ref|XP_002921729.1| PREDICTED: maltase-glucoamylase, intestinal-like [Ailuropoda 
melanoleuca]
Length=1822

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  582  GSGKFAAHWLGDNSATWDDLRWSIPGMLEFNLFGIPMVGADICGF  626



>ref|XP_002740247.2| PREDICTED: lysosomal alpha-glucosidase-like, partial [Saccoglossus 
kowalevskii]
Length=642

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ + H+  DI S+W  +  ++   L + MFGIP++GADICGF
Sbjct  320  GSGQHTAHWTGDITSTWDQMYHTIPAMLNFNMFGIPLVGADICGF  364



>gb|KFO30104.1| Maltase-glucoamylase, intestinal [Fukomys damarensis]
Length=2209

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF+
Sbjct  601  GSGKFAAHWLGDNAATWNDLQWSITGMLEFNLFGIPMVGADICGFS  646



>ref|XP_007090949.1| PREDICTED: maltase-glucoamylase, intestinal-like [Panthera tigris 
altaica]
Length=2225

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  498  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGYT  543



>ref|XP_005880343.1| PREDICTED: lysosomal alpha-glucosidase, partial [Myotis brandtii]
Length=690

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H+  D+ SSW  L  S+  TL + + G+P++GAD+CGF
Sbjct  345  GHGQYAGHWTGDVWSSWEQLSSSVPETLLFNLLGVPLVGADVCGF  389



>ref|XP_004677280.1| PREDICTED: maltase-glucoamylase, intestinal-like [Condylura cristata]
Length=1848

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  + W  LR S+   L + +FGIPM+GADICGF
Sbjct  671  GSGKFAAHWLGDNSAKWEDLRWSIPGMLEFNLFGIPMVGADICGF  715



>gb|EFB29547.1| hypothetical protein PANDA_010628 [Ailuropoda melanoleuca]
Length=1652

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  541  GSGKFAAHWLGDNSATWDDLRWSIPGMLEFNLFGIPMVGADICGF  585



>gb|EPQ16443.1| Lysosomal alpha-glucosidase [Myotis brandtii]
Length=726

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H+  D+ SSW  L  S+  TL + + G+P++GAD+CGF
Sbjct  367  GHGQYAGHWTGDVWSSWEQLSSSVPETLLFNLLGVPLVGADVCGF  411



>ref|XP_003744653.1| PREDICTED: lysosomal alpha-glucosidase-like [Metaseiulus occidentalis]
Length=885

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D+ S+WT L+ S+   L +  +GIPM+G DICGF
Sbjct  552  GFGFYAGHWTGDVFSTWTDLKDSVPGFLEFSFYGIPMVGVDICGF  596



>ref|XP_009001288.1| PREDICTED: LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal-like 
[Callithrix jacchus]
Length=1901

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+ 
Sbjct  566  GSGKFAAHWLGDNAATWDDLRWSISSILEFNVFGIPMVGANICGYN  611



>ref|XP_010098489.1| hypothetical protein L484_025925 [Morus notabilis]
 gb|EXB75149.1| hypothetical protein L484_025925 [Morus notabilis]
Length=839

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  L  S+  TL   +FGIPM+GADICGF
Sbjct  559  GSGKYTAHWTGDNAATWDDLAYSISSTLNSGLFGIPMVGADICGF  603



>gb|ELK38296.1| Lysosomal alpha-glucosidase [Myotis davidii]
Length=922

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H+  D+ SSW  L  S+  TL + + G+P++GAD+CGF
Sbjct  555  GHGQYAGHWTGDVWSSWEQLSSSVPETLLFNLLGVPLVGADVCGF  599



>gb|ACZ37249.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
Length=879

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D  ++W  LR S+   L++ +FG+PMIGADICGF 
Sbjct  526  GSGRYTAHWTGDNAATWGDLRYSINTMLSFGLFGMPMIGADICGFN  571



>gb|KHJ41463.1| hypothetical protein D918_08426 [Trichuris suis]
Length=2004

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+++ H++ D  S W  +R S+   L + MFGIP +GADICGF
Sbjct  624  GRYTGHWLGDNFSEWPDMRASIIGMLEFNMFGIPFVGADICGF  666



>gb|ACZ37246.1| alpha-glucosidase [Hordeum vulgare subsp. spontaneum]
Length=880

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D  ++W  LR S+   L++ +FG+PMIGADICGF 
Sbjct  527  GSGRYTAHWTGDNAATWGDLRYSINTMLSFGLFGMPMIGADICGFN  572



>ref|XP_006753108.1| PREDICTED: lysosomal alpha-glucosidase, partial [Myotis davidii]
Length=751

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H+  D+ SSW  L  S+  TL + + G+P++GAD+CGF
Sbjct  425  GHGQYAGHWTGDVWSSWEQLSSSVPETLLFNLLGVPLVGADVCGF  469



>ref|XP_006108616.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal alpha-glucosidase [Myotis 
lucifugus]
Length=945

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H+  D+ SSW  L  S+  TL + + G+P++GAD+CGF
Sbjct  598  GHGQYAGHWTGDVWSSWEQLSSSVPETLLFNLLGVPLVGADVCGF  642



>ref|XP_006842266.1| hypothetical protein AMTR_s00079p00035080 [Amborella trichopoda]
 gb|ERN03941.1| hypothetical protein AMTR_s00079p00035080 [Amborella trichopoda]
Length=641

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D   +W  LR S+   L + MFG+PM+GADICGF
Sbjct  265  GSGKYAAHWTGDNQGTWENLRYSISTMLNFGMFGMPMVGADICGF  309



>gb|AAF76254.1| high pI alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37234.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37235.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37236.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37237.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37238.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37239.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37240.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37241.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37242.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37243.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37247.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37248.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37250.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
 gb|ACZ37251.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
Length=879

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D  ++W  LR S+   L++ +FG+PMIGADICGF 
Sbjct  526  GSGRYTAHWTGDNAATWGDLRYSINTMLSFGLFGMPMIGADICGFN  571



>gb|ACZ37244.1| alpha-glucosidase [Hordeum vulgare subsp. vulgare]
Length=879

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D  ++W  LR S+   L++ +FG+PMIGADICGF 
Sbjct  526  GSGRYTAHWTGDNAATWGDLRYSINTMLSFGLFGMPMIGADICGFN  571



>ref|XP_004814668.1| PREDICTED: maltase-glucoamylase, intestinal-like [Mustela putorius 
furo]
Length=2073

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  614  GSGKYAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGYT  659



>ref|XP_005496981.1| PREDICTED: lysosomal alpha-glucosidase [Zonotrichia albicollis]
Length=1167

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D+ S W  L  S+   L + +FG+P++GADICGF
Sbjct  837  GHGRYAGHWTGDVGSDWQQLYYSIPEVLLFNLFGVPLVGADICGF  881



>ref|XP_009092784.1| PREDICTED: lysosomal alpha-glucosidase-like [Serinus canaria]
Length=1376

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5     GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
             G G+++ H+  D+ S W  L  S+   L + +FG+P++GADICGF
Sbjct  1046  GHGRYAGHWTGDVGSDWQQLYYSIPEVLLFNLFGVPLVGADICGF  1090



>ref|XP_004236960.1| PREDICTED: alpha-xylosidase 1-like [Solanum lycopersicum]
Length=932

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D   +W  LR S+   L + +FG+PM+GADICGF
Sbjct  569  GSGHYAAHWTGDNKGTWDDLRYSISTVLNFGLFGVPMVGADICGF  613



>ref|XP_008056838.1| PREDICTED: maltase-glucoamylase, intestinal [Tarsius syrichta]
Length=1849

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  609  GSGKFAAHWLGDNAATWNDLRWSIPGVLEFNLFGIPMVGPDICGF  653



>gb|KDP34887.1| hypothetical protein JCGZ_09175 [Jatropha curcas]
Length=892

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  +SW  L  S+   L + +FGIPM+GADICGF
Sbjct  541  GSGKYTAHWTGDNAASWDDLAYSIPTILNFGLFGIPMVGADICGF  585



>ref|XP_004594519.1| PREDICTED: maltase-glucoamylase, intestinal-like [Ochotona princeps]
Length=2366

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  565  GSGKFAAHWLGDNAATWNDLRWSITSILEFNLFGIPMVGANICGY  609



>dbj|BAJ91993.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96596.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=888

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D  ++W  LR S+   L++ +FG+PMIGADICGF 
Sbjct  535  GSGRYTAHWTGDNAATWGDLRYSINTMLSFGLFGMPMIGADICGFN  580



>ref|XP_004881759.1| PREDICTED: maltase-glucoamylase, intestinal, partial [Heterocephalus 
glaber]
Length=2147

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF+
Sbjct  591  GSGKFAAHWLGDNTATWNDLQWSIPGMLEFNLFGIPMVGADICGFS  636



>gb|ABR16166.1| unknown [Picea sitchensis]
Length=908

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D  ++W  LR S+   L + MFG+PM+GADICGF
Sbjct  546  GSGSYAAHWTGDNKATWEDLRYSISTILNFGMFGMPMVGADICGF  590



>ref|XP_008690524.1| PREDICTED: sucrase-isomaltase, intestinal [Ursus maritimus]
Length=1827

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H++ D  +SW  +  S+   L + +FGIP++GADICGF
Sbjct  593  GSGHYAAHWLGDNTASWEQMEWSIAGMLEFSLFGIPLVGADICGF  637



>gb|AAP21875.1| unknown [Homo sapiens]
Length=415

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF 
Sbjct  289  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFA  334



>ref|XP_005629793.1| PREDICTED: maltase-glucoamylase, intestinal-like [Canis lupus 
familiaris]
Length=2157

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  567  GSGKFAGHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGYT  612



>ref|XP_008476670.1| PREDICTED: maltase-glucoamylase, intestinal-like, partial [Diaphorina 
citri]
Length=291

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G++  H+  D+ S++  ++ S+   +++ MFGIPM+GADICGF 
Sbjct  216  GQGKYGGHWTGDVFSTYDDMKHSVADIMSFSMFGIPMVGADICGFN  261



>gb|EPY80709.1| hypothetical protein CB1_000804034, partial [Camelus ferus]
Length=2073

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5     GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
             G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  1917  GSGKFAGHWLGDNAATWNDLRWSIPGILEFSLFGIPMVGANICGYT  1962



>ref|XP_006210147.1| PREDICTED: maltase-glucoamylase, intestinal-like [Vicugna pacos]
Length=1797

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQF+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  551  GSGQFAGHWLGDNAATWNDLRWSIPGILEFSLFGIPMVGANICGY  595



>ref|XP_006419186.1| hypothetical protein CICLE_v100304492mg, partial [Citrus clementina]
 gb|ESR32426.1| hypothetical protein CICLE_v100304492mg, partial [Citrus clementina]
Length=226

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D  ++W  L  S+   L + +FGIPM+GADICGF+
Sbjct  11   GSGKYTAHWTGDNAATWNDLAYSIPSILNFGLFGIPMVGADICGFS  56



>gb|AAL40352.1|AF448201_1 putative alpha-xylosidase [Pinus pinaster]
Length=910

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D  ++W  LR S+   L + MFG+PM+GADICGF
Sbjct  549  GSGSYAAHWTGDNKATWEDLRYSISTILNFGMFGMPMVGADICGF  593



>ref|XP_003707619.1| PREDICTED: lysosomal alpha-glucosidase-like [Megachile rotundata]
Length=953

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G +S H+  D+ S W  LR S+   L+   + IPM+GADICGF
Sbjct  622  GQGHYSGHWTGDVYSCWHDLRMSISAILSSNFYQIPMVGADICGF  666



>ref|XP_008247087.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100358478 
[Oryctolagus cuniculus]
Length=5407

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICG+
Sbjct  574  GSGKFAAHWLGDNTATWNDLRWSIPGVLEFNLFGIPMVGPDICGY  618



>ref|XP_005679673.1| PREDICTED: maltase-glucoamylase, intestinal-like [Capra hircus]
Length=1413

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  + W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  555  GSGKFAAHWLGDNAARWDDLRWSIPGILEFNLFGIPMVGANICGYT  600



>ref|XP_006185458.1| PREDICTED: maltase-glucoamylase, intestinal-like [Camelus ferus]
Length=2344

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  612  GSGKFAGHWLGDNAATWNDLRWSIPGILEFSLFGIPMVGANICGYT  657



>ref|XP_004714074.1| PREDICTED: maltase-glucoamylase, intestinal-like [Echinops telfairi]
Length=1737

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  480  GSGKFAAHWLGDNAATWNDLRWSIPSILEFNLFGIPMVGANICGY  524



>ref|XP_006908332.1| PREDICTED: sucrase-isomaltase, intestinal [Pteropus alecto]
Length=1809

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H++ D  +SW  +  S+   L + +FGIP++GADICGF
Sbjct  593  GSGHYAAHWLGDNTASWEQMEWSIAVMLEFNLFGIPLVGADICGF  637



>gb|ELK15857.1| Sucrase-isomaltase, intestinal [Pteropus alecto]
Length=1578

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H++ D  +SW  +  S+   L + +FGIP++GADICGF
Sbjct  445  GSGHYAAHWLGDNTASWEQMEWSIAVMLEFNLFGIPLVGADICGF  489



>ref|XP_007504528.1| PREDICTED: maltase-glucoamylase, intestinal-like [Monodelphis 
domestica]
Length=1079

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  +SW  L+ S+   L + +FGIPM+GA+ICGF
Sbjct  563  GSGKFAAHWLGDNEASWNDLQWSIPGILEFNLFGIPMVGANICGF  607



>ref|XP_004742039.1| PREDICTED: maltase-glucoamylase, intestinal-like [Mustela putorius 
furo]
Length=2517

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  576  GSGKYAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGYT  621



>ref|XP_008695637.1| PREDICTED: maltase-glucoamylase, intestinal-like [Ursus maritimus]
Length=2582

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  566  GSGKYAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGYT  611



>ref|XP_003744719.1| PREDICTED: lysosomal alpha-glucosidase-like [Metaseiulus occidentalis]
Length=883

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D+ S+WT L+ S+   L +  +GIPM+G DICGF
Sbjct  550  GHGFYAGHWTGDVFSTWTDLKDSVPGFLEFSFYGIPMVGVDICGF  594



>ref|XP_011052775.1| PREDICTED: lysosomal alpha-glucosidase-like isoform X1 [Acromyrmex 
echinatior]
Length=1038

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D+ SSW  L+ S+   L++  + IPM+GADICGF
Sbjct  699  GHGHYAGHWTGDVYSSWHDLKMSIPAILSFNFYQIPMVGADICGF  743



>ref|XP_003374761.1| glycosyl hydrolase, family 31 [Trichinella spiralis]
 gb|EFV55680.1| glycosyl hydrolase, family 31 [Trichinella spiralis]
Length=856

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G GQF+ H+  D  S W+ +R S+   L + +FGIPM G+DICGF 
Sbjct  566  GSGQFANHWSGDNWSQWSHMRWSIINMLEFQLFGIPMTGSDICGFN  611



>ref|XP_011052776.1| PREDICTED: lysosomal alpha-glucosidase-like isoform X2 [Acromyrmex 
echinatior]
Length=1037

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D+ SSW  L+ S+   L++  + IPM+GADICGF
Sbjct  698  GHGHYAGHWTGDVYSSWHDLKMSIPAILSFNFYQIPMVGADICGF  742



>ref|XP_008892702.1| hypothetical protein PPTG_01217 [Phytophthora parasitica INRA-310]
 gb|ETN20838.1| hypothetical protein PPTG_01217 [Phytophthora parasitica INRA-310]
Length=198

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G    H+  D  ++W  LR S+   L + +FGIPM+GADICGF
Sbjct  127  GSGVHVAHWTGDNAATWNDLRWSIPAILKFGLFGIPMVGADICGF  171



>gb|AAL83560.1| maltase-glucoamylase, partial [Homo sapiens]
Length=1734

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  494  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  538



>ref|XP_006367038.1| PREDICTED: alpha-xylosidase 1-like [Solanum tuberosum]
Length=930

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D   +W  LR S+   L + +FG+PM+GADICGF
Sbjct  567  GSGHYAAHWTGDNRGTWDDLRYSITTVLNFGLFGVPMVGADICGF  611



>gb|EPQ13199.1| Maltase-glucoamylase, intestinal, partial [Myotis brandtii]
Length=2440

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  495  GSGKFAAHWLGDNAAAWDDLRWSIPSILEFNLFGIPMVGANICGY  539



>gb|AAI20873.1| Maltase-glucoamylase (alpha-glucosidase) [Homo sapiens]
Length=1857

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  617  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  661



>gb|AAC39568.2| maltase-glucoamylase [Homo sapiens]
Length=1857

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  617  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  661



>ref|XP_003741230.1| PREDICTED: lysosomal alpha-glucosidase-like [Metaseiulus occidentalis]
Length=878

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G +S H+  DI S+W  L+ S+   L +  +GIPM+GADICGF
Sbjct  547  GQGFYSGHWTGDIYSNWGNLKDSISGILDFSFYGIPMVGADICGF  591



>ref|XP_001496710.1| PREDICTED: maltase-glucoamylase, intestinal isoform X1 [Equus 
caballus]
 ref|XP_005609518.1| PREDICTED: maltase-glucoamylase, intestinal isoform X2 [Equus 
caballus]
Length=1866

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  626  GSGKFAAHWLGDNTATWNDLRWSIPGILEFNLFGIPMVGPDICGF  670



>ref|XP_005609519.1| PREDICTED: maltase-glucoamylase, intestinal isoform X3 [Equus 
caballus]
Length=1847

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  607  GSGKFAAHWLGDNTATWNDLRWSIPGILEFNLFGIPMVGPDICGF  651



>ref|XP_007389717.1| glycoside hydrolase family 31 protein [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM60245.1| glycoside hydrolase family 31 protein [Phanerochaete carnosa 
HHB-10118-sp]
Length=973

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+++ H++ D  S W  +R SL   L + +FGIPM+GAD+CGF
Sbjct  644  GKWTGHWLGDNYSKWAYMRASLPGVLQFQLFGIPMVGADVCGF  686



>ref|NP_004659.2| maltase-glucoamylase, intestinal [Homo sapiens]
 sp|O43451.5|MGA_HUMAN RecName: Full=Maltase-glucoamylase, intestinal; Includes: RecName: 
Full=Maltase; AltName: Full=Alpha-glucosidase; Includes: 
RecName: Full=Glucoamylase; AltName: Full=Glucan 1,4-alpha-glucosidase 
[Homo sapiens]
Length=1857

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  617  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  661



>ref|XP_006733960.1| PREDICTED: coiled-coil domain-containing protein 40 [Leptonychotes 
weddellii]
Length=1218

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D+ SSW  L  S+   L + + G+P++GADICGF
Sbjct  871  GHGRYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADICGF  915



>ref|XP_002932561.2| PREDICTED: lysosomal alpha-glucosidase-like [Xenopus (Silurana) 
tropicalis]
Length=896

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G ++ H+  D+VSSW  +  S+   L + MFG+PM+GADICGF
Sbjct  566  GHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPMVGADICGF  608



>ref|XP_007950967.1| PREDICTED: maltase-glucoamylase, intestinal-like [Orycteropus 
afer afer]
Length=1715

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  579  GSGKFAAHWLGDNAATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  623



>ref|XP_010598090.1| PREDICTED: LOW QUALITY PROTEIN: probable maltase-glucoamylase-like 
protein [Loxodonta africana]
Length=2305

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ +  +SW  LR S+   L + +FGIPM+GA+ICG+
Sbjct  564  GSGKFAAHWLGENTASWNDLRWSIPSILEFNLFGIPMVGANICGY  608



>sp|O62653.3|SUIS_SUNMU RecName: Full=Sucrase-isomaltase, intestinal; Contains: RecName: 
Full=Sucrase; Contains: RecName: Full=Isomaltase [Suncus 
murinus]
 dbj|BAA25370.1| sucrase-isomaltase [Suncus murinus]
Length=1813

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+ + H++ D   SW  +  S+ P L + +FG+P IGADICGF
Sbjct  579  GTGKHATHWLGDNTPSWEHMEWSITPMLEFGLFGMPFIGADICGF  623



>ref|XP_009452648.1| PREDICTED: maltase-glucoamylase, intestinal [Pan troglodytes]
Length=2753

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  617  GSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGF  661



>ref|XP_010338819.1| PREDICTED: LOW QUALITY PROTEIN: probable maltase-glucoamylase-like 
protein [Saimiri boliviensis boliviensis]
Length=2459

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  565  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGY  609



>ref|XP_008529406.1| PREDICTED: LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal 
[Equus przewalskii]
Length=1797

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+G DICGF
Sbjct  616  GSGKFAAHWLGDNTATWNDLRWSIPGILEFNLFGIPMVGPDICGF  660



>gb|KDO31383.1| hypothetical protein SPRG_04000, partial [Saprolegnia parasitica 
CBS 223.65]
Length=1019

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H++ D  ++WT +R S+   L   +FG+PM+G D+CGF
Sbjct  637  GDGQYAAHWLGDNAATWTDMRQSIAGVLAANVFGMPMVGPDVCGF  681



>ref|XP_008820152.1| PREDICTED: maltase-glucoamylase, intestinal-like [Nannospalax 
galili]
Length=2072

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  565  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGY  609



>ref|XP_010606012.1| PREDICTED: probable maltase-glucoamylase-like protein [Fukomys 
damarensis]
Length=3710

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5     GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
             G G+F+ H++ D  + W  LR S+   L + +FGIPM+GA+ICG+T
Sbjct  1878  GSGKFAAHWLGDNAAMWDDLRWSIPSILEFNLFGIPMVGANICGYT  1923



>gb|EPB85834.1| hypothetical protein HMPREF1544_07416 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=903

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ+  H+  DI+SSW  L+ S+   L++ M+GI   GADICGF
Sbjct  569  GSGQYMGHWTGDIMSSWDDLKTSVADVLSFQMYGISYSGADICGF  613



>ref|XP_006727668.1| PREDICTED: sucrase-isomaltase, intestinal [Leptonychotes weddellii]
Length=1827

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H++ D  +SW  +  S+   L + +FGIP++GADICGF
Sbjct  593  GSGRYAAHWLGDNTASWEQMEQSITGMLEFNLFGIPLVGADICGF  637



>ref|XP_007522399.1| PREDICTED: maltase-glucoamylase, intestinal [Erinaceus europaeus]
Length=1710

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIP++GADICGF
Sbjct  470  GSGKFAAHWLGDNAATWNDLKWSIPGMLEFNLFGIPLVGADICGF  514



>ref|XP_004629180.1| PREDICTED: maltase-glucoamylase, intestinal-like [Octodon degus]
Length=2538

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  601  GSGKFAAHWLGDNEATWNDLRWSIPSVLEFNLFGIPMVGANICGY  645



>ref|XP_008247096.1| PREDICTED: maltase-glucoamylase, intestinal-like [Oryctolagus 
cuniculus]
Length=2145

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  568  GSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGY  612



>ref|NP_001058347.1| Os06g0675700 [Oryza sativa Japonica Group]
 sp|Q653V7.1|AGLU_ORYSJ RecName: Full=Probable alpha-glucosidase Os06g0675700; AltName: 
Full=Maltase; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD45910.1| putative high pI alpha-glucosidase [Oryza sativa Japonica Group]
 dbj|BAF20261.1| Os06g0675700 [Oryza sativa Japonica Group]
 gb|EEE66212.1| hypothetical protein OsJ_22347 [Oryza sativa Japonica Group]
Length=885

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  L  S+   L++ +FGIPMIGADICGF
Sbjct  529  GSGRYTAHWTGDNAATWEDLHYSINTMLSFGLFGIPMIGADICGF  573



>gb|ERL92906.1| hypothetical protein D910_10211 [Dendroctonus ponderosae]
Length=1015

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G+G ++ H+  D+ S+W  L+ S+   L++ +FGIP++GADICGF 
Sbjct  686  GLGHYTGHWSGDVFSTWDGLKQSIPHLLSFSLFGIPLMGADICGFN  731



>gb|ENN77102.1| hypothetical protein YQE_06437, partial [Dendroctonus ponderosae]
Length=1015

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G+G ++ H+  D+ S+W  L+ S+   L++ +FGIP++GADICGF 
Sbjct  686  GLGHYTGHWSGDVFSTWDGLKQSIPHLLSFSLFGIPLMGADICGFN  731



>ref|XP_004966197.1| PREDICTED: probable alpha-glucosidase Os06g0675700-like [Setaria 
italica]
Length=886

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+++ H+  D  ++W  L  S+   L++ +FGIPM+GADICGF+
Sbjct  535  GSGRYTAHWTGDNAATWDDLHYSINTMLSFGLFGIPMVGADICGFS  580



>ref|XP_008328113.1| PREDICTED: lysosomal alpha-glucosidase isoform X1 [Cynoglossus 
semilaevis]
Length=928

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+FS  +  D+ S W  LR S+   L + +FG+P++GADICGF
Sbjct  596  GIGRFSAVWTGDVRSDWEQLRFSIPAVLQFGLFGVPLVGADICGF  640



>ref|XP_007056107.1| PREDICTED: lysosomal alpha-glucosidase [Chelonia mydas]
Length=949

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H+  D++SSW  L  S+   L + ++G+P++GADICGF
Sbjct  619  GHGRFAGHWTGDVLSSWEQLYYSIPEVLLFNLYGVPLVGADICGF  663



>gb|EAW51983.1| hCG2001479, isoform CRA_a [Homo sapiens]
Length=2537

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+ 
Sbjct  566  GSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGYN  611



>ref|XP_010103777.1| hypothetical protein L484_014667 [Morus notabilis]
 gb|EXB97055.1| hypothetical protein L484_014667 [Morus notabilis]
Length=932

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G++S H+  D   +W  L+ S+   L + +FG+PM+GADICGF
Sbjct  565  GSGKYSAHWTGDNKGTWEDLKYSISTMLNFGIFGVPMVGADICGF  609



>gb|EEC81171.1| hypothetical protein OsI_24144 [Oryza sativa Indica Group]
Length=897

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D  ++W  L  S+   L++ +FGIPMIGADICGF
Sbjct  541  GSGRYTAHWTGDNAATWEDLHYSINTMLSFGLFGIPMIGADICGF  585



>gb|EYU40890.1| hypothetical protein MIMGU_mgv1a003100mg [Erythranthe guttata]
Length=608

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+++ H+  D   +W  LR S+   L + +FG+PM+G+DICGF
Sbjct  242  GSGRYAAHWTGDNKGTWDDLRYSISTMLNFGIFGVPMVGSDICGF  286



>emb|CDS29680.1| lysosomal alpha glucosidase [Hymenolepis microstoma]
Length=896

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  11   GQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+++ H+  D++SSW  +  S+   + + M+GIP +GADICGF
Sbjct  568  GRYTTHWTGDVISSWQEMAASIPQIINFNMYGIPFVGADICGF  610



>ref|XP_002401316.1| alpha-glucosidase, putative [Ixodes scapularis]
 gb|EEC13934.1| alpha-glucosidase, putative [Ixodes scapularis]
Length=335

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGFT  142
            G   +S H+  DI SSW  +R S+   L++ M+G+P++GADICGF 
Sbjct  256  GQAAWSGHWSGDIASSWEDMRLSIPNMLSFGMYGMPLVGADICGFN  301



>ref|XP_008328114.1| PREDICTED: lysosomal alpha-glucosidase isoform X2 [Cynoglossus 
semilaevis]
Length=911

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+FS  +  D+ S W  LR S+   L + +FG+P++GADICGF
Sbjct  596  GIGRFSAVWTGDVRSDWEQLRFSIPAVLQFGLFGVPLVGADICGF  640



>ref|XP_005405586.1| PREDICTED: maltase-glucoamylase, intestinal-like [Chinchilla 
lanigera]
Length=3651

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+GADICGF
Sbjct  639  GSGKFAAHWLGDNAATWDDLQWSIPGMLEFNLFGIPMVGADICGF  683



>ref|XP_009241598.1| PREDICTED: probable maltase-glucoamylase-like protein, partial 
[Pongo abelii]
Length=1911

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  36   GSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGY  80



>ref|XP_008581186.1| PREDICTED: maltase-glucoamylase, intestinal [Galeopterus variegatus]
Length=1783

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  L+ S+   L + +FGIPM+G DICGF
Sbjct  593  GSGKFAAHWLGDNAATWDDLQWSIPGILEFNLFGIPMVGPDICGF  637



>ref|XP_008619584.1| hypothetical protein SDRG_15197 [Saprolegnia diclina VS20]
 gb|EQC26982.1| hypothetical protein SDRG_15197 [Saprolegnia diclina VS20]
Length=1024

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G GQ++ H++ D  ++WT +R S+   L   +FG+PM+G D+CGF
Sbjct  637  GDGQYAAHWLGDNAATWTDMRQSIAGVLAANVFGMPMVGPDVCGF  681



>ref|NP_001280555.1| putative maltase-glucoamylase-like protein FLJ16351 [Homo sapiens]
 sp|Q2M2H8.3|MGAL_HUMAN RecName: Full=Probable maltase-glucoamylase-like protein LOC93432; 
AltName: Full=Maltase-glucoamylase (alpha-glucosidase) 
pseudogene; Includes: RecName: Full=Glucoamylase; AltName: 
Full=Glucan 1,4-alpha-glucosidase [Homo sapiens]
Length=2515

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  566  GSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGY  610



>gb|EGI66515.1| Lysosomal alpha-glucosidase [Acromyrmex echinatior]
Length=929

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G ++ H+  D+ SSW  L+ S+   L++  + IPM+GADICGF
Sbjct  590  GHGHYAGHWTGDVYSSWHDLKMSIPAILSFNFYQIPMVGADICGF  634



>ref|XP_006891565.1| PREDICTED: sucrase-isomaltase, intestinal-like [Elephantulus 
edwardii]
Length=1769

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+ + H++ D  +SW  +  S+   L Y +FGIP++GADICGF
Sbjct  580  GTGKHAAHWLGDNTASWEQMEWSITGMLEYSLFGIPLVGADICGF  624



>ref|XP_008963064.1| PREDICTED: maltase-glucoamylase, intestinal-like [Pan paniscus]
Length=2515

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  566  GSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGY  610



>ref|XP_005925471.1| PREDICTED: lysosomal alpha-glucosidase-like [Haplochromis burtoni]
Length=733

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+FS  +  D+ S W  LR S+   L + +FG+P++GADICGF
Sbjct  603  GIGRFSGVWTGDVRSDWEQLRFSIPAVLQFSLFGVPLVGADICGF  647



>ref|XP_006791555.1| PREDICTED: lysosomal alpha-glucosidase-like isoform X1 [Neolamprologus 
brichardi]
Length=935

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+FS  +  D+ S W  LR S+   L + +FG+P++GADICGF
Sbjct  603  GIGRFSGVWTGDVRSDWEQLRFSIPAVLQFSLFGVPLVGADICGF  647



>ref|XP_004558392.1| PREDICTED: lysosomal alpha-glucosidase-like [Maylandia zebra]
Length=935

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+FS  +  D+ S W  LR S+   L + +FG+P++GADICGF
Sbjct  603  GIGRFSGVWTGDVRSDWEQLRFSIPAVLQFSLFGVPLVGADICGF  647



>ref|XP_009452649.1| PREDICTED: probable maltase-glucoamylase-like protein [Pan troglodytes]
Length=2515

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G G+F+ H++ D  ++W  LR S+   L + +FGIPM+GA+ICG+
Sbjct  566  GSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGIPMVGANICGY  610



>ref|XP_005734693.1| PREDICTED: lysosomal alpha-glucosidase-like [Pundamilia nyererei]
Length=935

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  5    GMGQFSYHFVPDIVSSWTLLRGSLGPTLTYPMFGIPMIGADICGF  139
            G+G+FS  +  D+ S W  LR S+   L + +FG+P++GADICGF
Sbjct  603  GIGRFSGVWTGDVRSDWEQLRFSIPAVLQFSLFGVPLVGADICGF  647



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507653521284