BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6905_g1_i1 len=1758 path=[1:0-1757]

Length=1758
                                                                      Score     E

ref|XP_009796485.1|  PREDICTED: polygalacturonase At1g48100             642   0.0      
ref|XP_009616734.1|  PREDICTED: polygalacturonase At1g48100             640   0.0      
ref|XP_002266099.1|  PREDICTED: polygalacturonase At1g48100             612   0.0      Vitis vinifera
ref|XP_006356444.1|  PREDICTED: polygalacturonase At1g48100-like        607   0.0      
ref|XP_004239337.1|  PREDICTED: polygalacturonase At1g48100             604   0.0      
ref|XP_011071123.1|  PREDICTED: polygalacturonase At1g48100             603   0.0      
ref|XP_006483913.1|  PREDICTED: polygalacturonase At1g48100-like        594   0.0      
ref|XP_010248557.1|  PREDICTED: polygalacturonase At1g48100             589   0.0      
gb|EYU22514.1|  hypothetical protein MIMGU_mgv1a017703mg                588   0.0      
ref|XP_006438313.1|  hypothetical protein CICLE_v10033716mg             588   0.0      
ref|XP_002527898.1|  Polygalacturonase precursor, putative              586   0.0      Ricinus communis
ref|XP_007157357.1|  hypothetical protein PHAVU_002G063500g             582   0.0      
ref|XP_004489794.1|  PREDICTED: polygalacturonase At1g48100-like        580   0.0      
ref|XP_003517718.1|  PREDICTED: polygalacturonase At1g48100-like        578   0.0      
ref|XP_004300928.1|  PREDICTED: polygalacturonase At1g48100-like        578   0.0      
gb|KHN14552.1|  Polygalacturonase                                       577   0.0      
ref|XP_003519827.1|  PREDICTED: polygalacturonase At1g48100-like        574   0.0      
gb|AES96137.2|  polygalacturonase                                       573   0.0      
ref|XP_010100420.1|  Polygalacturonase                                  565   0.0      
gb|KHN00378.1|  Polygalacturonase                                       562   0.0      
ref|XP_007044724.1|  Pectin lyase-like superfamily protein              562   0.0      
ref|XP_011034109.1|  PREDICTED: polygalacturonase At1g48100-like        556   0.0      
ref|XP_004135482.1|  PREDICTED: polygalacturonase At1g48100-like        555   0.0      
ref|XP_002312682.2|  polygalacturonase family protein                   550   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008446184.1|  PREDICTED: polygalacturonase At1g48100             550   0.0      
emb|CDP13196.1|  unnamed protein product                                548   0.0      
ref|XP_010023494.1|  PREDICTED: polygalacturonase At1g48100             544   0.0      
ref|XP_003613179.1|  Polygalacturonase                                  543   0.0      
ref|XP_011045279.1|  PREDICTED: polygalacturonase At1g48100-like        531   0.0      
ref|XP_010695816.1|  PREDICTED: polygalacturonase At1g48100             530   1e-180   
ref|XP_002315680.2|  hypothetical protein POPTR_0010s05390g             528   1e-179   Populus trichocarpa [western balsam poplar]
ref|XP_006841022.1|  hypothetical protein AMTR_s00085p00112760          527   8e-179   
ref|XP_010502593.1|  PREDICTED: polygalacturonase At1g48100-like        522   2e-177   
ref|XP_006395541.1|  hypothetical protein EUTSA_v10004137mg             522   4e-177   
ref|XP_010556330.1|  PREDICTED: polygalacturonase At1g48100             521   1e-176   
ref|NP_189293.1|  putative polygalacturonase / pectinase                518   2e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875326.1|  hypothetical protein ARALYDRAFT_484425             516   8e-175   
ref|XP_010425372.1|  PREDICTED: polygalacturonase At1g48100-like        514   4e-174   
gb|KFK33587.1|  hypothetical protein AALP_AA5G033100                    509   6e-172   
emb|CDX83631.1|  BnaC07g23710D                                          507   2e-171   
ref|XP_009152042.1|  PREDICTED: polygalacturonase At1g48100             507   3e-171   
emb|CDY13645.1|  BnaA06g32780D                                          505   1e-170   
ref|XP_007224576.1|  hypothetical protein PRUPE_ppa1027214mg            505   2e-170   
ref|XP_008221862.1|  PREDICTED: polygalacturonase At1g48100             504   2e-170   
ref|XP_010924245.1|  PREDICTED: polygalacturonase At1g48100             490   5e-165   
gb|KGN51783.1|  hypothetical protein Csa_5G599870                       478   1e-161   
gb|KDO82321.1|  hypothetical protein CISIN_1g046362mg                   466   2e-157   
ref|XP_008361805.1|  PREDICTED: polygalacturonase At1g48100-like        456   1e-151   
emb|CAN63436.1|  hypothetical protein VITISV_021123                     449   1e-149   Vitis vinifera
ref|XP_002270821.2|  PREDICTED: polygalacturonase At1g48100-like ...    450   5e-149   Vitis vinifera
ref|XP_006840430.1|  hypothetical protein AMTR_s00045p00161910          447   1e-147   
ref|XP_008792872.1|  PREDICTED: polygalacturonase At1g48100             442   4e-147   
emb|CAA66407.1|  polygalacturonase precursor homologue                  427   2e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403999.1|  PREDICTED: polygalacturonase At1g48100             427   5e-140   
gb|KEH20046.1|  polygalacturonase plant-like protein                    409   3e-132   
ref|XP_008657773.1|  PREDICTED: polygalacturonase At1g48100             404   1e-131   
gb|AFW83000.1|  hypothetical protein ZEAMMB73_048385                    403   4e-131   
ref|XP_007044684.1|  Pectin lyase-like superfamily protein              402   1e-129   
ref|XP_010652248.1|  PREDICTED: polygalacturonase At1g48100-like ...    397   1e-128   
ref|XP_010925884.1|  PREDICTED: polygalacturonase At1g48100-like        396   8e-128   
gb|ABV24999.1|  polygalacturonase 2                                     395   1e-127   
gb|ABV25002.1|  polygalacturonase 5                                     395   2e-127   
ref|XP_007153746.1|  hypothetical protein PHAVU_003G061600g             396   3e-127   
emb|CDM83489.1|  unnamed protein product                                396   3e-127   
gb|ABV25001.1|  polygalacturonase 4                                     394   5e-127   
ref|XP_010108791.1|  Polygalacturonase                                  393   6e-127   
gb|ABV25000.1|  polygalacturonase 3                                     394   6e-127   
gb|ABV25003.1|  polygalacturonase 6                                     393   1e-126   
ref|XP_009769209.1|  PREDICTED: polygalacturonase At1g48100 isofo...    390   3e-126   
ref|XP_008444333.1|  PREDICTED: polygalacturonase At1g48100-like        393   3e-126   
gb|KHN26888.1|  Polygalacturonase                                       394   3e-126   
ref|XP_004509758.1|  PREDICTED: polygalacturonase At1g48100-like        393   4e-126   
ref|XP_004297473.1|  PREDICTED: polygalacturonase At1g48100-like        393   6e-126   
gb|ABV24998.1|  polygalacturonase 1                                     391   6e-126   
ref|XP_011013806.1|  PREDICTED: polygalacturonase At1g48100-like        392   6e-126   
ref|XP_006350314.1|  PREDICTED: polygalacturonase At1g48100-like        390   1e-125   
gb|KHG05280.1|  hypothetical protein F383_31181                         391   2e-125   
ref|XP_003552026.1|  PREDICTED: polygalacturonase At1g48100-like ...    392   2e-125   
ref|XP_002266600.1|  PREDICTED: polygalacturonase At1g48100             390   3e-125   Vitis vinifera
tpg|DAA58413.1|  TPA: polygalacturonase                                 391   3e-125   
ref|XP_010100443.1|  Polygalacturonase                                  390   4e-125   
ref|XP_003531999.2|  PREDICTED: polygalacturonase At1g48100 isofo...    393   4e-125   
ref|XP_008800720.1|  PREDICTED: polygalacturonase At1g48100-like        389   4e-125   
ref|XP_004142980.1|  PREDICTED: polygalacturonase At1g48100-like        389   5e-125   
gb|KGN62292.1|  hypothetical protein Csa_2G348790                       390   6e-125   
ref|XP_002456022.1|  hypothetical protein SORBIDRAFT_03g029030          390   8e-125   Sorghum bicolor [broomcorn]
ref|XP_008812598.1|  PREDICTED: polygalacturonase At1g48100-like        388   1e-124   
ref|XP_010924274.1|  PREDICTED: polygalacturonase At1g48100-like ...    387   3e-124   
ref|XP_009629756.1|  PREDICTED: polygalacturonase At1g48100-like        388   3e-124   
emb|CDY20962.1|  BnaA08g25630D                                          389   3e-124   
ref|XP_002314612.2|  hypothetical protein POPTR_0010s05180g             388   3e-124   Populus trichocarpa [western balsam poplar]
ref|XP_009774333.1|  PREDICTED: polygalacturonase At1g48100-like        387   4e-124   
ref|XP_009144427.1|  PREDICTED: polygalacturonase At1g48100-like        388   4e-124   
ref|XP_010533949.1|  PREDICTED: polygalacturonase At1g48100-like        388   6e-124   
emb|CDY47212.1|  BnaC09g14610D                                          387   7e-124   
ref|NP_001148771.1|  polygalacturonase precursor                        388   8e-124   Zea mays [maize]
ref|XP_006392146.1|  hypothetical protein EUTSA_v10023404mg             387   9e-124   
emb|CDY50367.1|  BnaA09g13160D                                          387   9e-124   
ref|NP_001150912.1|  polygalacturonase precursor                        387   1e-123   Zea mays [maize]
ref|XP_010417992.1|  PREDICTED: polygalacturonase At1g48100-like        387   1e-123   
gb|ACN35722.1|  unknown                                                 387   1e-123   Zea mays [maize]
ref|XP_004969270.1|  PREDICTED: polygalacturonase At1g48100-like        387   1e-123   
gb|ABK95830.1|  unknown                                                 386   1e-123   Populus trichocarpa [western balsam poplar]
ref|XP_009394799.1|  PREDICTED: polygalacturonase At1g48100-like        384   2e-123   
ref|XP_010510936.1|  PREDICTED: polygalacturonase At1g48100-like        386   2e-123   
ref|XP_002457998.1|  hypothetical protein SORBIDRAFT_03g025260          382   2e-123   Sorghum bicolor [broomcorn]
ref|XP_006307174.1|  hypothetical protein CARUB_v10008765mg             387   3e-123   
ref|XP_008446197.1|  PREDICTED: polygalacturonase At1g48100-like        386   3e-123   
ref|XP_002521450.1|  Polygalacturonase precursor, putative              383   4e-123   Ricinus communis
ref|XP_004135250.1|  PREDICTED: polygalacturonase At1g48100-like        385   4e-123   
ref|XP_010473235.1|  PREDICTED: polygalacturonase At1g48100-like        386   4e-123   
ref|XP_006302097.1|  hypothetical protein CARUB_v10020088mg             386   5e-123   
ref|XP_006470302.1|  PREDICTED: polygalacturonase At1g48100-like        383   5e-123   
ref|XP_008230581.1|  PREDICTED: polygalacturonase At1g48100             384   8e-123   
ref|XP_009419849.1|  PREDICTED: polygalacturonase At1g48100-like        382   9e-123   
ref|XP_010044612.1|  PREDICTED: polygalacturonase At1g48100-like        384   1e-122   
ref|XP_010682533.1|  PREDICTED: polygalacturonase At1g48100             384   2e-122   
ref|XP_009113198.1|  PREDICTED: polygalacturonase At1g48100             384   2e-122   
ref|XP_006841584.1|  hypothetical protein AMTR_s00003p00197480          381   3e-122   
ref|XP_010475939.1|  PREDICTED: polygalacturonase At1g48100-like        383   4e-122   
gb|EPS67779.1|  polygalacturonase                                       381   4e-122   
gb|EYU44763.1|  hypothetical protein MIMGU_mgv1a018728mg                379   8e-122   
dbj|BAH56488.1|  polygalacturonase 1                                    381   8e-122   Prunus persica
ref|XP_007217288.1|  hypothetical protein PRUPE_ppa018113mg             381   1e-121   
ref|XP_004489829.1|  PREDICTED: polygalacturonase At1g48100-like        382   1e-121   
ref|XP_010491600.1|  PREDICTED: polygalacturonase At1g48100-like        381   2e-121   
ref|XP_006417442.1|  hypothetical protein EUTSA_v10007255mg             382   2e-121   
gb|KDP26605.1|  hypothetical protein JCGZ_17763                         380   2e-121   
gb|AAL31197.1|  At1g60590/F8A5_12                                       379   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458422.1|  PREDICTED: polygalacturonase At1g48100-like        380   3e-121   
gb|EEE64806.1|  hypothetical protein OsJ_19662                          380   4e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002886607.1|  hypothetical protein ARALYDRAFT_893483             380   4e-121   
gb|EEC79746.1|  hypothetical protein OsI_21117                          380   5e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_011086585.1|  PREDICTED: polygalacturonase At1g48100             380   5e-121   
ref|XP_010551910.1|  PREDICTED: polygalacturonase At1g48100 isofo...    377   6e-121   
ref|NP_564758.2|  pectin lyase-like protein                             380   7e-121   Arabidopsis thaliana [mouse-ear cress]
gb|EMT20816.1|  Polygalacturonase                                       380   7e-121   
ref|XP_010551909.1|  PREDICTED: polygalacturonase At1g48100 isofo...    377   9e-121   
gb|EYU28445.1|  hypothetical protein MIMGU_mgv1a004469mg                379   1e-120   
ref|XP_003569422.1|  PREDICTED: polygalacturonase At1g48100-like ...    379   3e-120   
ref|XP_010232068.1|  PREDICTED: polygalacturonase At1g48100-like ...    379   3e-120   
gb|KFK40772.1|  hypothetical protein AALP_AA2G039100                    377   4e-120   
gb|ACF79104.1|  unknown                                                 376   6e-120   Zea mays [maize]
ref|XP_002525361.1|  polygalacturonase, putative                        376   1e-119   Ricinus communis
ref|NP_001141617.1|  hypothetical protein                               377   1e-119   Zea mays [maize]
ref|XP_007227459.1|  hypothetical protein PRUPE_ppa004002mg             376   2e-119   
ref|NP_001043666.1|  Os01g0636500                                       376   2e-119   Oryza sativa Japonica Group [Japonica rice]
emb|CDP13178.1|  unnamed protein product                                375   2e-119   
ref|XP_010547772.1|  PREDICTED: polygalacturonase At1g48100             375   3e-119   
ref|XP_008221838.1|  PREDICTED: polygalacturonase At1g48100             375   3e-119   
ref|XP_006359737.1|  PREDICTED: polygalacturonase At1g48100-like        372   4e-119   
ref|XP_011098761.1|  PREDICTED: polygalacturonase At1g48100             372   5e-119   
ref|XP_003618193.1|  Polygalacturonase                                  371   6e-119   
gb|AFK47772.1|  unknown                                                 371   8e-119   
ref|XP_009405655.1|  PREDICTED: polygalacturonase At1g48100-like        372   1e-118   
ref|XP_002311773.1|  hypothetical protein POPTR_0008s19350g             373   2e-118   Populus trichocarpa [western balsam poplar]
emb|CDY54228.1|  BnaC08g49850D                                          373   2e-118   
gb|AES96173.2|  polygalacturonase                                       373   3e-118   
ref|XP_008340054.1|  PREDICTED: polygalacturonase At1g48100-like        372   3e-118   
ref|NP_563875.6|  pectin lyase-like protein                             372   4e-118   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20612.1|  BnaC08g14460D                                          372   4e-118   
ref|XP_009118238.1|  PREDICTED: polygalacturonase At1g48100-like        372   6e-118   
ref|XP_011071095.1|  PREDICTED: polygalacturonase At1g48100             371   8e-118   
gb|KFK43344.1|  hypothetical protein AALP_AA1G112800                    371   1e-117   
ref|XP_006644412.1|  PREDICTED: polygalacturonase At1g48100-like ...    371   2e-117   
ref|XP_008389668.1|  PREDICTED: polygalacturonase At1g48100             370   3e-117   
ref|XP_008443532.1|  PREDICTED: polygalacturonase At1g48100             368   4e-117   
ref|XP_006644413.1|  PREDICTED: polygalacturonase At1g48100-like ...    370   4e-117   
dbj|BAJ96167.1|  predicted protein                                      370   4e-117   
emb|CBI34901.3|  unnamed protein product                                368   5e-117   
emb|CDY37962.1|  BnaC05g08120D                                          369   7e-117   
ref|XP_002298533.2|  hypothetical protein POPTR_0001s35180g             366   7e-117   Populus trichocarpa [western balsam poplar]
ref|XP_009148407.1|  PREDICTED: polygalacturonase At1g48100             369   9e-117   
ref|XP_006356424.1|  PREDICTED: polygalacturonase At1g48100-like        368   2e-116   
ref|XP_004489256.1|  PREDICTED: polygalacturonase At1g48100-like        364   2e-116   
ref|XP_010420111.1|  PREDICTED: polygalacturonase At1g48100-like        365   3e-116   
ref|XP_006399978.1|  hypothetical protein EUTSA_v10013501mg             365   3e-116   
gb|KHG15884.1|  hypothetical protein F383_10630                         369   3e-116   
gb|KDP26627.1|  hypothetical protein JCGZ_17785                         363   5e-116   
ref|NP_001267980.1|  polygalacturonase precursor                        365   5e-116   
ref|XP_004238649.1|  PREDICTED: polygalacturonase At1g48100-like        366   6e-116   
ref|XP_004141101.1|  PREDICTED: polygalacturonase At1g48100-like        365   8e-116   
ref|XP_010492279.1|  PREDICTED: polygalacturonase At1g48100-like        364   9e-116   
ref|XP_002441571.1|  hypothetical protein SORBIDRAFT_09g029500          367   9e-116   Sorghum bicolor [broomcorn]
ref|XP_009769210.1|  PREDICTED: polygalacturonase At1g48100 isofo...    362   1e-115   
emb|CDX69569.1|  BnaA10g19180D                                          363   1e-115   
ref|XP_004242881.1|  PREDICTED: polygalacturonase At1g48100-like        363   1e-115   
ref|NP_001238091.1|  polygalacturonase PG1 precursor                    363   1e-115   
gb|KHN23520.1|  Polygalacturonase                                       363   2e-115   
ref|XP_010453593.1|  PREDICTED: polygalacturonase At1g48100-like        363   2e-115   
gb|ACU24545.1|  unknown                                                 362   2e-115   Glycine max [soybeans]
gb|KDO66116.1|  hypothetical protein CISIN_1g040454mg                   363   3e-115   
ref|XP_004961120.1|  PREDICTED: polygalacturonase At1g48100-like        365   4e-115   
ref|XP_003613215.1|  Polygalacturonase                                  365   5e-115   
gb|KHN27445.1|  Polygalacturonase                                       361   5e-115   
ref|XP_009121648.1|  PREDICTED: polygalacturonase At1g48100 isofo...    361   5e-115   
dbj|BAB20805.2|  polygalacturonase                                      361   6e-115   Zinnia violacea [garden zinnia]
gb|AAF17670.1|AC009398_19  F20B24.8                                     364   7e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006446532.1|  hypothetical protein CICLE_v10015111mg             362   7e-115   
emb|CDY09873.1|  BnaC09g42880D                                          360   1e-114   
ref|XP_007031503.1|  Pectin lyase-like superfamily protein              363   1e-114   
ref|NP_196969.1|  pectin lyase-like superfamily protein                 360   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034123.1|  PREDICTED: polygalacturonase At1g48100 isofo...    362   2e-114   
gb|AAT39158.1|  putative polygalacturonase                              364   3e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121649.1|  PREDICTED: polygalacturonase At1g48100 isofo...    358   1e-113   
gb|EMT04942.1|  Polygalacturonase                                       357   1e-113   
ref|XP_010924275.1|  PREDICTED: polygalacturonase At1g48100-like ...    355   3e-113   
ref|XP_010936703.1|  PREDICTED: polygalacturonase At1g48100-like        358   5e-113   
ref|XP_009398937.1|  PREDICTED: polygalacturonase At1g48100-like        357   5e-113   
ref|XP_006483884.1|  PREDICTED: polygalacturonase At1g48100-like        359   5e-113   
gb|KDO82378.1|  hypothetical protein CISIN_1g009748mg                   359   6e-113   
gb|AAO24262.1|  putative style polygalacturonase                        357   7e-113   Turnera subulata [white alder]
ref|XP_006290192.1|  hypothetical protein CARUB_v10003877mg             356   8e-113   
ref|NP_001238104.1|  polygalacturonase PG2 precursor                    355   1e-112   
ref|XP_008782487.1|  PREDICTED: polygalacturonase At1g48100             357   1e-112   
ref|XP_007151017.1|  hypothetical protein PHAVU_004G011800g             355   1e-112   
ref|XP_006438345.1|  hypothetical protein CICLE_v10031220mg             358   1e-112   
ref|XP_009375163.1|  PREDICTED: polygalacturonase At1g48100-like        357   2e-112   
ref|XP_009334144.1|  PREDICTED: polygalacturonase At1g48100-like        356   3e-112   
gb|ABD62081.1|  putative style polygalacturonase                        355   5e-112   Turnera subulata [white alder]
ref|XP_010033292.1|  PREDICTED: polygalacturonase At1g48100-like        355   9e-112   
ref|XP_006293340.1|  hypothetical protein CARUB_v100189191mg            346   1e-110   
ref|XP_010251154.1|  PREDICTED: polygalacturonase At1g48100-like        344   5e-110   
ref|XP_010029152.1|  PREDICTED: polygalacturonase At1g48100-like        350   9e-110   
gb|KCW55998.1|  hypothetical protein EUGRSUZ_I01777                     351   1e-109   
gb|ACN27989.1|  unknown                                                 346   3e-109   Zea mays [maize]
ref|XP_002871625.1|  hypothetical protein ARALYDRAFT_488306             345   4e-109   
ref|XP_010248489.1|  PREDICTED: polygalacturonase At1g48100             348   8e-109   
ref|XP_011034122.1|  PREDICTED: polygalacturonase At1g48100 isofo...    348   1e-108   
ref|XP_010251222.1|  PREDICTED: polygalacturonase At1g48100             347   3e-108   
emb|CAN65317.1|  hypothetical protein VITISV_006410                     341   7e-108   Vitis vinifera
ref|XP_009388828.1|  PREDICTED: polygalacturonase At1g48100-like        342   2e-107   
ref|XP_008379788.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    342   4e-107   
ref|XP_004971921.1|  PREDICTED: polygalacturonase At1g48100-like        336   4e-106   
ref|XP_002892586.1|  hypothetical protein ARALYDRAFT_471186             336   7e-106   
ref|XP_010046047.1|  PREDICTED: polygalacturonase At1g48100-like        337   2e-105   
gb|EAY74476.1|  hypothetical protein OsI_02367                          333   5e-105   Oryza sativa Indica Group [Indian rice]
gb|KCW86703.1|  hypothetical protein EUGRSUZ_B03312                     333   5e-105   
gb|ACR36869.1|  unknown                                                 334   9e-105   Zea mays [maize]
ref|XP_004306351.1|  PREDICTED: polygalacturonase At1g48100-like        334   4e-104   
ref|XP_006645987.1|  PREDICTED: polygalacturonase At1g48100-like        330   2e-103   
dbj|BAD88046.1|  putative polygalacturonase PG1                         325   7e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008353865.1|  PREDICTED: polygalacturonase At1g48100-like        328   8e-102   
gb|KEH24801.1|  polygalacturonase                                       326   8e-102   
ref|XP_006602385.1|  PREDICTED: polygalacturonase At1g48100-like ...    328   2e-101   
ref|XP_010544140.1|  PREDICTED: polygalacturonase At1g48100             327   2e-101   
gb|AAK63956.1|  At1g10640/F20B24_8                                      324   2e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KCW59788.1|  hypothetical protein EUGRSUZ_H025371                    318   3e-101   
ref|XP_009363098.1|  PREDICTED: polygalacturonase At1g48100-like        326   5e-101   
ref|XP_010276514.1|  PREDICTED: polygalacturonase At1g48100-like ...    325   8e-101   
ref|XP_009367183.1|  PREDICTED: polygalacturonase At1g48100             324   3e-100   
ref|XP_004965388.1|  PREDICTED: polygalacturonase At1g48100-like        323   4e-100   
ref|XP_002963148.1|  hypothetical protein SELMODRAFT_78038              323   4e-100   
gb|KCW84844.1|  hypothetical protein EUGRSUZ_B01667                     328   1e-99    
ref|XP_010046077.1|  PREDICTED: polygalacturonase At1g48100-like        328   2e-99    
emb|CDP15213.1|  unnamed protein product                                321   5e-99    
ref|XP_007221570.1|  hypothetical protein PRUPE_ppa024649mg             320   6e-99    
ref|XP_008346737.1|  PREDICTED: polygalacturonase At1g48100-like        320   1e-98    
ref|XP_010674532.1|  PREDICTED: polygalacturonase At1g48100-like        320   2e-98    
ref|XP_004161089.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    318   2e-98    
ref|XP_008659542.1|  PREDICTED: polygalacturonase At1g48100-like        316   3e-98    
gb|KDP46434.1|  hypothetical protein JCGZ_10274                         318   3e-98    
ref|XP_004289429.1|  PREDICTED: polygalacturonase At1g48100-like        319   3e-98    
ref|XP_010046090.1|  PREDICTED: polygalacturonase At1g48100-like        318   4e-98    
ref|XP_011039005.1|  PREDICTED: polygalacturonase At1g48100-like        319   5e-98    
ref|XP_002512560.1|  Polygalacturonase precursor, putative              318   6e-98    Ricinus communis
ref|XP_002894668.1|  glycoside hydrolase family 28 protein              317   6e-98    
ref|XP_006841586.1|  hypothetical protein AMTR_s00003p00198650          320   7e-98    
ref|XP_008227812.1|  PREDICTED: polygalacturonase At1g48100             318   9e-98    
ref|XP_002276945.1|  PREDICTED: polygalacturonase At1g48100             317   1e-97    Vitis vinifera
dbj|BAD68575.1|  polygalacturonase PG1-like                             315   1e-97    Oryza sativa Japonica Group [Japonica rice]
gb|EAY75104.1|  hypothetical protein OsI_03000                          313   2e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_006344807.1|  PREDICTED: polygalacturonase At1g48100-like ...    317   2e-97    
ref|XP_002307031.2|  hypothetical protein POPTR_0005s00720g             317   2e-97    Populus trichocarpa [western balsam poplar]
ref|XP_002980174.1|  hypothetical protein SELMODRAFT_112735             316   3e-97    
ref|XP_010313757.1|  PREDICTED: polygalacturonase At1g48100 isofo...    317   3e-97    
ref|XP_009382473.1|  PREDICTED: polygalacturonase At1g48100             316   4e-97    
ref|XP_010418948.1|  PREDICTED: polygalacturonase At1g48100-like        314   8e-97    
ref|XP_006301910.1|  hypothetical protein CARUB_v10022386mg             314   1e-96    
ref|XP_011003167.1|  PREDICTED: polygalacturonase At1g48100 isofo...    315   1e-96    
ref|XP_010480279.1|  PREDICTED: polygalacturonase At1g48100-like        313   2e-96    
ref|XP_004230341.1|  PREDICTED: polygalacturonase At1g48100 isofo...    314   3e-96    
gb|ABD62085.1|  polygalacturonase precursor                             309   4e-96    
ref|XP_006344808.1|  PREDICTED: polygalacturonase At1g48100-like ...    313   4e-96    
ref|XP_010511313.1|  PREDICTED: polygalacturonase At1g48100-like        312   4e-96    
ref|XP_011023841.1|  PREDICTED: polygalacturonase At1g48100-like        313   5e-96    
ref|XP_010024841.1|  PREDICTED: polygalacturonase At1g48100             313   5e-96    
ref|XP_011011219.1|  PREDICTED: polygalacturonase At1g48100-like        311   2e-95    
gb|AFW86585.1|  hypothetical protein ZEAMMB73_740672                    310   2e-95    
ref|NP_176064.1|  pectin lyase-like protein                             310   4e-95    
ref|XP_009615869.1|  PREDICTED: polygalacturonase At1g48100-like        310   4e-95    
ref|XP_007206198.1|  hypothetical protein PRUPE_ppa014719mg             309   5e-95    
ref|XP_010070078.1|  PREDICTED: polygalacturonase At1g48100-like        310   5e-95    
ref|XP_006645792.1|  PREDICTED: polygalacturonase At1g48100-like        308   7e-95    
gb|KDP23351.1|  hypothetical protein JCGZ_23184                         310   7e-95    
ref|XP_008246384.1|  PREDICTED: polygalacturonase At1g48100-like        307   2e-94    
ref|XP_009414160.1|  PREDICTED: polygalacturonase At1g48100-like ...    308   3e-94    
ref|XP_007147401.1|  hypothetical protein PHAVU_006G121300g             308   3e-94    
ref|XP_006378559.1|  hypothetical protein POPTR_0010s16180g             308   4e-94    
ref|XP_010921359.1|  PREDICTED: polygalacturonase At1g48100-like        310   5e-94    
ref|XP_010276513.1|  PREDICTED: polygalacturonase At1g48100-like ...    308   5e-94    
ref|XP_010914688.1|  PREDICTED: polygalacturonase At1g48100-like        308   5e-94    
ref|XP_002318932.2|  hypothetical protein POPTR_0013s00640g             308   5e-94    
ref|XP_010092141.1|  Polygalacturonase                                  308   5e-94    
gb|EYU38393.1|  hypothetical protein MIMGU_mgv1a021443mg                307   6e-94    
ref|XP_011100707.1|  PREDICTED: polygalacturonase At1g48100             308   6e-94    
ref|XP_004495880.1|  PREDICTED: polygalacturonase At1g48100-like        308   7e-94    
ref|XP_002272733.2|  PREDICTED: polygalacturonase At1g48100-like        307   7e-94    
ref|XP_007051225.1|  Pectin lyase-like superfamily protein              307   8e-94    
gb|KDP27979.1|  hypothetical protein JCGZ_19059                         308   8e-94    
ref|XP_010270902.1|  PREDICTED: polygalacturonase At1g48100             306   9e-94    
ref|XP_008781323.1|  PREDICTED: polygalacturonase At1g48100-like        308   9e-94    
emb|CBI37004.3|  unnamed protein product                                307   1e-93    
ref|XP_002263668.1|  PREDICTED: polygalacturonase At1g48100             307   1e-93    
ref|XP_007035922.1|  Pectin lyase-like superfamily protein isoform 1    308   1e-93    
ref|XP_010322288.1|  PREDICTED: polygalacturonase At1g48100 isofo...    306   2e-93    
gb|KFK22235.1|  hypothetical protein AALP_AAs42893U000500               305   2e-93    
ref|XP_009147998.1|  PREDICTED: polygalacturonase At1g48100             306   3e-93    
gb|KHG11151.1|  hypothetical protein F383_15050                         306   3e-93    
ref|XP_010921358.1|  PREDICTED: polygalacturonase At1g48100-like        306   3e-93    
ref|XP_003567574.1|  PREDICTED: polygalacturonase At1g48100             306   4e-93    
ref|XP_009777456.1|  PREDICTED: polygalacturonase At1g48100-like        305   5e-93    
gb|KHG07147.1|  hypothetical protein F383_34413                         305   6e-93    
ref|XP_008655818.1|  PREDICTED: polygalacturonase At1g48100-like        306   6e-93    
gb|EPS62496.1|  hypothetical protein M569_12294                         305   7e-93    
ref|XP_009760660.1|  PREDICTED: polygalacturonase At1g48100-like        305   8e-93    
ref|XP_011019224.1|  PREDICTED: polygalacturonase At1g48100             305   1e-92    
dbj|BAD86981.1|  putative polygalacturonase PG1                         302   1e-92    
ref|XP_009366057.1|  PREDICTED: polygalacturonase At1g48100-like ...    305   1e-92    
gb|EAY73623.1|  hypothetical protein OsI_01510                          305   1e-92    
ref|XP_002320271.2|  hypothetical protein POPTR_0014s11110g             306   1e-92    
ref|XP_011079507.1|  PREDICTED: polygalacturonase At1g48100             304   1e-92    
ref|XP_002519290.1|  Polygalacturonase precursor, putative              305   1e-92    
ref|XP_006605259.1|  PREDICTED: polygalacturonase At1g48100-like        306   1e-92    
ref|XP_002455500.1|  hypothetical protein SORBIDRAFT_03g012280          305   2e-92    
ref|XP_011092683.1|  PREDICTED: polygalacturonase At1g48100-like        303   3e-92    
ref|XP_007145117.1|  hypothetical protein PHAVU_007G211400g             303   3e-92    
gb|KHN14270.1|  Polygalacturonase                                       303   3e-92    
ref|XP_011040652.1|  PREDICTED: polygalacturonase At1g48100-like        303   4e-92    
ref|XP_004494454.1|  PREDICTED: polygalacturonase At1g48100-like        303   4e-92    
ref|XP_010672584.1|  PREDICTED: polygalacturonase At1g48100             303   4e-92    
ref|XP_010500319.1|  PREDICTED: polygalacturonase At1g48100             303   4e-92    
tpg|DAA54311.1|  TPA: polygalacturonase                                 304   4e-92    
ref|XP_009366058.1|  PREDICTED: polygalacturonase At1g48100-like ...    302   6e-92    
ref|XP_009592547.1|  PREDICTED: polygalacturonase At1g48100-like        303   6e-92    
ref|XP_003534803.1|  PREDICTED: polygalacturonase At1g48100-like        303   6e-92    
ref|XP_009414161.1|  PREDICTED: polygalacturonase At1g48100-like ...    301   7e-92    
ref|XP_008781188.1|  PREDICTED: polygalacturonase At1g48100-like        302   7e-92    
ref|XP_003546297.1|  PREDICTED: polygalacturonase At1g48100-like ...    303   7e-92    
ref|NP_001042805.1|  Os01g0296200                                       303   8e-92    
ref|XP_002312305.1|  hypothetical protein POPTR_0008s09990g             303   8e-92    
gb|AAK95305.1|AF410319_1  At1g48100/F21D18_17                           302   9e-92    
gb|AAK50769.1|AF361321_1  polygalacturonase                             298   1e-91    
gb|KEH31410.1|  pectin lyase superfamily protein                        301   1e-91    
ref|NP_001150436.1|  polygalacturonase precursor                        303   1e-91    
ref|XP_008356595.1|  PREDICTED: polygalacturonase At1g48100-like        301   1e-91    
ref|NP_175244.1|  polygalacturonase                                     301   1e-91    
gb|EPS63155.1|  hypothetical protein M569_11631                         300   2e-91    
gb|KHN14155.1|  Polygalacturonase                                       301   2e-91    
ref|XP_003553676.1|  PREDICTED: polygalacturonase At1g48100-like ...    301   2e-91    
gb|AES61595.2|  polygalacturonase/glycoside hydrolase family protein    301   4e-91    
ref|XP_006604753.1|  PREDICTED: polygalacturonase At1g48100-like ...    300   4e-91    
ref|XP_004504655.1|  PREDICTED: polygalacturonase At1g48100-like ...    300   4e-91    
ref|XP_010479218.1|  PREDICTED: polygalacturonase At1g48100-like ...    301   4e-91    
ref|XP_007158878.1|  hypothetical protein PHAVU_002G189400g             300   5e-91    
ref|XP_006349249.1|  PREDICTED: polygalacturonase At1g48100-like        300   5e-91    
ref|XP_003536857.1|  PREDICTED: polygalacturonase At1g48100-like        300   5e-91    
ref|XP_003520763.1|  PREDICTED: polygalacturonase At1g48100-like ...    300   6e-91    
ref|XP_006577178.1|  PREDICTED: polygalacturonase At1g48100-like ...    299   6e-91    
ref|XP_003518665.1|  PREDICTED: polygalacturonase At1g48100-like        300   7e-91    
ref|XP_006392401.1|  hypothetical protein EUTSA_v10023906mg             298   9e-91    
ref|XP_006355087.1|  PREDICTED: polygalacturonase At1g48100-like        300   1e-90    
gb|KHN00324.1|  Polygalacturonase                                       300   1e-90    
ref|XP_003626018.1|  Polygalacturonase                                  299   1e-90    
ref|XP_010094423.1|  Polygalacturonase                                  307   1e-90    
ref|XP_002515219.1|  Polygalacturonase precursor, putative              301   1e-90    
ref|XP_004236918.1|  PREDICTED: polygalacturonase At1g48100             300   1e-90    
ref|XP_008461394.1|  PREDICTED: polygalacturonase At1g48100-like        299   1e-90    
emb|CDY41695.1|  BnaA09g15230D                                          298   1e-90    
ref|XP_010461609.1|  PREDICTED: polygalacturonase At1g48100             299   1e-90    
ref|XP_004304915.1|  PREDICTED: polygalacturonase At1g48100-like        298   1e-90    
ref|XP_008361575.1|  PREDICTED: polygalacturonase At1g48100-like        299   2e-90    
gb|EYU43882.1|  hypothetical protein MIMGU_mgv1a005582mg                299   2e-90    
ref|XP_006492459.1|  PREDICTED: polygalacturonase At1g48100-like        302   2e-90    
ref|XP_007163216.1|  hypothetical protein PHAVU_001G215900g             298   2e-90    
ref|XP_007223106.1|  hypothetical protein PRUPE_ppa005391mg             298   2e-90    
ref|XP_004486518.1|  PREDICTED: polygalacturonase At1g48100-like        298   2e-90    
ref|XP_004967589.1|  PREDICTED: polygalacturonase At1g48100-like        299   2e-90    
ref|XP_010522843.1|  PREDICTED: polygalacturonase At1g48100-like        298   3e-90    
gb|KDO86869.1|  hypothetical protein CISIN_1g040748mg                   301   3e-90    
ref|XP_010102205.1|  Polygalacturonase                                  298   4e-90    
ref|XP_006444572.1|  hypothetical protein CICLE_v10024556mg             301   4e-90    
ref|XP_002302793.1|  glycoside hydrolase family 28 family protein       297   6e-90    
ref|XP_004135975.1|  PREDICTED: polygalacturonase At1g48100-like        296   1e-89    
ref|XP_009366069.1|  PREDICTED: polygalacturonase At1g48100-like        296   1e-89    
ref|XP_006307365.1|  hypothetical protein CARUB_v10008991mg             296   2e-89    
ref|XP_003591344.1|  Polygalacturonase                                  296   2e-89    
ref|XP_008345662.1|  PREDICTED: polygalacturonase At1g48100-like        297   2e-89    
gb|KCW61351.1|  hypothetical protein EUGRSUZ_H04092                     296   2e-89    
gb|AAF79535.1|AC023673_23  F21D18.18                                    296   3e-89    
ref|XP_002891410.1|  glycoside hydrolase family 28 protein              295   3e-89    
ref|XP_009113378.1|  PREDICTED: polygalacturonase At1g48100             294   3e-89    
emb|CDY34877.1|  BnaA09g48030D                                          296   3e-89    
ref|XP_008223441.1|  PREDICTED: polygalacturonase At1g48100             295   4e-89    
ref|XP_010098760.1|  Polygalacturonase                                  296   4e-89    
emb|CDP07996.1|  unnamed protein product                                295   5e-89    
ref|XP_003524819.1|  PREDICTED: polygalacturonase At1g48100             295   6e-89    
gb|KHN25928.1|  Polygalacturonase                                       295   6e-89    
ref|XP_003594633.1|  Polygalacturonase                                  294   7e-89    
ref|XP_003531109.1|  PREDICTED: polygalacturonase At1g48100-like        295   7e-89    
ref|XP_010270903.1|  PREDICTED: polygalacturonase At1g48100-like ...    294   1e-88    
gb|KDP28310.1|  hypothetical protein JCGZ_14081                         297   1e-88    
ref|NP_001056414.1|  Os05g0578600                                       289   1e-88    
ref|XP_004297108.1|  PREDICTED: polygalacturonase At1g48100-like        294   1e-88    
ref|NP_001055086.1|  Os05g0279900                                       293   4e-88    
gb|KFK36111.1|  hypothetical protein AALP_AA4G079500                    292   6e-88    
gb|AAS98503.1|  unknown protein                                         293   7e-88    
ref|XP_010679447.1|  PREDICTED: polygalacturonase At1g48100             292   7e-88    
ref|XP_008390405.1|  PREDICTED: polygalacturonase At1g48100             295   1e-87    
ref|XP_006654203.1|  PREDICTED: polygalacturonase At1g48100-like        291   1e-87    
ref|XP_009412152.1|  PREDICTED: polygalacturonase At1g48100-like        290   2e-87    
ref|XP_010231630.1|  PREDICTED: polygalacturonase At1g48100             291   2e-87    
ref|XP_008447667.1|  PREDICTED: polygalacturonase At1g48100             290   4e-87    
ref|XP_009773723.1|  PREDICTED: polygalacturonase At1g48100             290   4e-87    
ref|XP_006419286.1|  hypothetical protein CICLE_v10004899mg             290   5e-87    
ref|XP_006418338.1|  hypothetical protein EUTSA_v10007481mg             290   5e-87    
gb|KDO72101.1|  hypothetical protein CISIN_1g012057mg                   290   6e-87    
dbj|BAJ86227.1|  predicted protein                                      290   7e-87    
ref|XP_009607016.1|  PREDICTED: polygalacturonase At1g48100             290   7e-87    
ref|NP_001132604.2|  uncharacterized protein LOC100194076               290   1e-86    
tpg|DAA54465.1|  TPA: polygalacturonase                                 290   1e-86    
emb|CDY43307.1|  BnaC06g01610D                                          288   1e-86    
ref|XP_001755315.1|  predicted protein                                  287   1e-86    
ref|XP_009391520.1|  PREDICTED: polygalacturonase At1g48100-like        290   2e-86    
ref|XP_004148582.1|  PREDICTED: polygalacturonase At1g48100-like        288   2e-86    
ref|XP_009372060.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    292   3e-86    
ref|XP_004163976.1|  PREDICTED: polygalacturonase At1g48100-like        288   3e-86    
gb|KGN58536.1|  hypothetical protein Csa_3G664600                       288   3e-86    
ref|XP_009417842.1|  PREDICTED: polygalacturonase At1g48100-like        288   7e-86    
ref|XP_004971779.1|  PREDICTED: polygalacturonase At1g48100-like        288   7e-86    
ref|XP_006393479.1|  hypothetical protein EUTSA_v10011452mg             286   1e-85    
ref|XP_010276517.1|  PREDICTED: polygalacturonase At1g48100-like        285   3e-85    
dbj|BAG98413.1|  unnamed protein product                                278   3e-85    
gb|EAZ37024.1|  hypothetical protein OsJ_21369                          283   4e-85    
ref|XP_006840721.1|  hypothetical protein AMTR_s00096p00105250          278   5e-85    
gb|EAZ00960.1|  hypothetical protein OsI_22993                          283   7e-85    
ref|XP_004504654.1|  PREDICTED: polygalacturonase At1g48100-like ...    285   1e-84    
ref|XP_009118766.1|  PREDICTED: polygalacturonase At1g48100-like        284   1e-84    
ref|XP_006389764.1|  hypothetical protein EUTSA_v10018548mg             283   1e-84    
emb|CDX77909.1|  BnaC03g53100D                                          284   1e-84    
emb|CDY15246.1|  BnaC05g01250D                                          284   2e-84    
emb|CBI25976.3|  unnamed protein product                                280   2e-84    
gb|KFK42419.1|  hypothetical protein AALP_AA2G253800                    281   3e-84    
ref|XP_010428904.1|  PREDICTED: polygalacturonase At1g48100-like        283   3e-84    
ref|NP_192098.2|  glycoside hydrolase family 28 protein / polygal...    282   3e-84    
gb|KFK42608.1|  hypothetical protein AALP_AA1G017600                    281   3e-84    
ref|XP_010474661.1|  PREDICTED: polygalacturonase At1g48100-like        283   4e-84    
ref|XP_003565732.1|  PREDICTED: polygalacturonase At1g48100-like        287   4e-84    
ref|XP_010457225.1|  PREDICTED: polygalacturonase At1g48100-like ...    283   4e-84    
ref|XP_006286811.1|  hypothetical protein CARUB_v10003570mg             282   5e-84    
emb|CDY57689.1|  BnaA07g38300D                                          281   7e-84    
emb|CBI36959.3|  unnamed protein product                                276   8e-84    
ref|XP_010480981.1|  PREDICTED: polygalacturonase At1g48100-like        282   9e-84    
ref|XP_010417741.1|  PREDICTED: probable polygalacturonase At1g80170    280   1e-83    
ref|XP_004962547.1|  PREDICTED: polygalacturonase At1g48100-like        281   1e-83    
ref|NP_563654.1|  pectin lyase-like superfamily protein                 281   1e-83    
ref|XP_002892109.1|  glycoside hydrolase family 28 protein              281   1e-83    
ref|XP_009104448.1|  PREDICTED: probable polygalacturonase At1g80170    280   1e-83    
ref|XP_010024842.1|  PREDICTED: polygalacturonase At1g48100-like        281   2e-83    
ref|XP_004138524.1|  PREDICTED: polygalacturonase At1g48100-like        280   2e-83    
ref|XP_006303966.1|  hypothetical protein CARUB_v10008847mg             282   2e-83    
ref|XP_008458305.1|  PREDICTED: polygalacturonase At1g48100             280   2e-83    
emb|CDX89966.1|  BnaA10g01160D                                          281   2e-83    
ref|XP_010551104.1|  PREDICTED: polygalacturonase At1g48100             280   2e-83    
ref|XP_008655877.1|  PREDICTED: polygalacturonase At1g48100-like        288   3e-83    
gb|EYU44762.1|  hypothetical protein MIMGU_mgv1a021591mg                278   4e-83    
ref|XP_010429999.1|  PREDICTED: probable polygalacturonase At1g80170    278   5e-83    
ref|XP_009119629.1|  PREDICTED: polygalacturonase At1g48100             280   5e-83    
ref|XP_010422679.1|  PREDICTED: polygalacturonase At1g48100-like        279   8e-83    
ref|XP_010456113.1|  PREDICTED: polygalacturonase At1g48100-like        278   2e-82    
ref|XP_010472976.1|  PREDICTED: probable polygalacturonase At1g80170    276   3e-82    
ref|XP_006291145.1|  hypothetical protein CARUB_v10017263mg             275   7e-82    
ref|XP_011003168.1|  PREDICTED: polygalacturonase At1g48100 isofo...    275   8e-82    
ref|XP_007023876.1|  Pectin lyase-like superfamily protein              275   9e-82    
gb|EYU25413.1|  hypothetical protein MIMGU_mgv1a025252mg                273   1e-81    
ref|XP_009134468.1|  PREDICTED: polygalacturonase At1g48100             275   2e-81    
gb|AAD22651.1|AC007138_15  putative polygalacturonidase                 274   4e-81    
emb|CDY54312.1|  BnaC06g43100D                                          273   5e-81    
ref|NP_565232.1|  putative polygalacturonase                            272   1e-80    
ref|XP_002874953.1|  glycoside hydrolase family 28 protein              272   4e-80    
ref|XP_006841583.1|  hypothetical protein AMTR_s00003p00197210          270   2e-79    
ref|XP_006845770.1|  hypothetical protein AMTR_s00019p00250890          267   2e-79    
gb|KHN43364.1|  Polygalacturonase                                       265   4e-79    
ref|XP_002455572.1|  hypothetical protein SORBIDRAFT_03g013310          275   5e-79    
ref|XP_002968171.1|  hypothetical protein SELMODRAFT_89085              265   1e-78    
ref|XP_006664897.1|  PREDICTED: polygalacturonase-like                  266   1e-78    
ref|XP_002970401.1|  hypothetical protein SELMODRAFT_93668              264   3e-78    
ref|XP_010041884.1|  PREDICTED: polygalacturonase At1g48100-like        261   3e-78    
ref|XP_006655543.1|  PREDICTED: probable polygalacturonase At1g80...    265   4e-78    
ref|XP_009614195.1|  PREDICTED: probable polygalacturonase At3g15720    263   5e-78    



>ref|XP_009796485.1| PREDICTED: polygalacturonase At1g48100 [Nicotiana sylvestris]
Length=480

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/463 (71%), Positives = 377/463 (81%), Gaps = 10/463 (2%)
 Frame = -3

Query  1651  AAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPG-----NCYP  1487
              AFSM+SVEARK+ H KK +    H   + R++ ++N            P        YP
Sbjct  22    TAFSMVSVEARKH-HTKKSKI---HHKHRNRNNKQKNGGGNKAPDCSDSPSPAPSHGFYP  77

Query  1486  PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCM  1307
                 +FDILSFGAKGDGVSDDSKALE AW AACKV GAT+ IPS+F FLINPITLQGPCM
Sbjct  78    TQFPIFDILSFGAKGDGVSDDSKALEGAWEAACKVQGATLHIPSEFQFLINPITLQGPCM  137

Query  1306  PDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS  1127
             P+ + QVDG ++AP  VG+WPKSS+FQW+NFKW+H+FTIQG GTFDGQG NWWKLSQI  
Sbjct  138   PNFIFQVDGTLLAPSKVGTWPKSSLFQWLNFKWMHNFTIQGTGTFDGQGYNWWKLSQIDY  197

Query  1126  LQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAP  947
              QE K SK+I  ++KPT LRFY S NVT+  I I+NSPQCHLKFDNSKGV ++N+TISAP
Sbjct  198   FQEMKTSKSI-PDIKPTVLRFYASYNVTVRDIKIMNSPQCHLKFDNSKGVKINNVTISAP  256

Query  946   ENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGK  767
              +SPNTDGIHLQNSQDVEIHHS IG+GDDCVSIQTGCSN+HVHHINCGPGHGISLGGLGK
Sbjct  257   GSSPNTDGIHLQNSQDVEIHHSNIGTGDDCVSIQTGCSNIHVHHINCGPGHGISLGGLGK  316

Query  766   DKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYC  587
             DKSVACVS+I+VENV +E+T+YGARIKTWQGG+GSVKN+SFS IQVSDVKVPIMIDQYYC
Sbjct  317   DKSVACVSDIIVENVNLESTMYGARIKTWQGGLGSVKNISFSNIQVSDVKVPIMIDQYYC  376

Query  586   DKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGF  407
             DKH CKNQTGAVAI  VKF QI GT++A+P HLACSNS+PCTDV L DIQL+PS  YRG 
Sbjct  377   DKHVCKNQTGAVAISNVKFNQITGTYSAKPIHLACSNSIPCTDVDLIDIQLKPSFNYRGI  436

Query  406   RNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             + G CWNSYGKSQ  L P+SMDYC+R GS  V+RI+RSHEN+C
Sbjct  437   QQGLCWNSYGKSQAPLLPSSMDYCVRRGSGFVRRISRSHENVC  479



>ref|XP_009616734.1| PREDICTED: polygalacturonase At1g48100 [Nicotiana tomentosiformis]
Length=474

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/458 (72%), Positives = 378/458 (83%), Gaps = 6/458 (1%)
 Frame = -3

Query  1651  AAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPPSSV  1472
               FS++SVEARK+ H KK +    H+   G +      P  + +P+  P   CYP  S +
Sbjct  22    TVFSIVSVEARKH-HTKKSKIHHKHRKNGGGN----KAPDCSDSPSPAPSHGCYPTQSPI  76

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVL  1292
             FDI SFGAKGDGVSDDSKALE AW AACKV GAT+ IPS+F  LINPITLQGPCMP+ +L
Sbjct  77    FDISSFGAKGDGVSDDSKALEGAWEAACKVQGATLHIPSEFKILINPITLQGPCMPNFIL  136

Query  1291  QVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKK  1112
             QVDG ++AP  VGSWPKSS FQW+NFKW+H+FTIQG GTFDGQG NWWKLSQI   QE K
Sbjct  137   QVDGILLAPSKVGSWPKSSFFQWLNFKWMHNFTIQGTGTFDGQGYNWWKLSQIDYFQEMK  196

Query  1111  ASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPN  932
              SK+I  ++KPT LRFY S NVT+  I IVNSPQCHLKFDNSKGV ++N+TISAPE+SPN
Sbjct  197   TSKSI-PDIKPTVLRFYASYNVTVRDIKIVNSPQCHLKFDNSKGVKINNVTISAPESSPN  255

Query  931   TDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVA  752
             TDGIHLQNSQDVEIHHS IG+GDDCVSIQTGCSN+HVHH+NCGPGHGISLGGLGKDKSVA
Sbjct  256   TDGIHLQNSQDVEIHHSNIGTGDDCVSIQTGCSNIHVHHLNCGPGHGISLGGLGKDKSVA  315

Query  751   CVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHAC  572
             CVS+I+VENV ME+T+YGARIKTWQGG+GSVKN+SFS IQVSDVKVPIMIDQYYCDKH C
Sbjct  316   CVSDIIVENVNMESTMYGARIKTWQGGLGSVKNISFSNIQVSDVKVPIMIDQYYCDKHVC  375

Query  571   KNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQC  392
             KNQTGAVAI  VKF QI+GT++A+P HLACS+S+PCTDV L DIQL+ S  YRG + G C
Sbjct  376   KNQTGAVAISNVKFNQIIGTYSAKPIHLACSSSIPCTDVDLIDIQLKSSLNYRGIQQGLC  435

Query  391   WNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             WNSYGKSQ  L P+SMDYC+R GS  V+RI+RSHEN+C
Sbjct  436   WNSYGKSQAPLLPSSMDYCVRRGSGFVRRISRSHENVC  473



>ref|XP_002266099.1| PREDICTED: polygalacturonase At1g48100 [Vitis vinifera]
 emb|CBI28580.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/460 (70%), Positives = 365/460 (79%), Gaps = 6/460 (1%)
 Frame = -3

Query  1651  AAFSMMSVEARKNRHAKKPRTPPPH-KLKKGRSDYRRNFpapapapaqlpPGN-CYPPPS  1478
                S+ SV+ARK+ H+KK R+   H K + G  +   +   P        P    YPP S
Sbjct  21    TTLSITSVDARKH-HSKKSRSHSKHHKHRSGNGNSAPDSENPPAPAPAPLPPYASYPPQS  79

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
              +FD+LSFGAKGDG+SDDSKAL AAWGAACKV GAT++IPS+F FLI PITLQGPCMP L
Sbjct  80    RIFDVLSFGAKGDGISDDSKALLAAWGAACKVPGATLEIPSEFKFLIEPITLQGPCMPRL  139

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             VLQ+DG ++AP  V SWPKSS+FQWINFKW+H+FTIQG GT DGQG NWW LSQIH +Q+
Sbjct  140   VLQIDGTLLAPPKVASWPKSSLFQWINFKWLHNFTIQGTGTVDGQGSNWWSLSQIHYIQK  199

Query  1117  KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENS  938
             +  SK I  NMKPTALRFY S +VT+  I I+NSPQCHLKFD S  VNV NITIS+PENS
Sbjct  200   R--SKDI-PNMKPTALRFYASYDVTVCNIRIINSPQCHLKFDYSGRVNVTNITISSPENS  256

Query  937   PNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKS  758
             PNTDGIHLQN+QDVEI HS IG GDDCVSIQTGCSNVHVHHINCGPGHGISLGGLGK+KS
Sbjct  257   PNTDGIHLQNTQDVEIQHSNIGCGDDCVSIQTGCSNVHVHHINCGPGHGISLGGLGKEKS  316

Query  757   VACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKH  578
              ACVSN++V+N+ ++N LYG RIKTWQGG+GSVKNVSFS IQVSDVKVPIMIDQYYCDKH
Sbjct  317   AACVSNLVVDNISVQNALYGVRIKTWQGGIGSVKNVSFSNIQVSDVKVPIMIDQYYCDKH  376

Query  577   ACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNG  398
              CKNQTGAVAI GV + QI+GT++ QP HLACSN+VPCTDV L DIQL PSP YR F+  
Sbjct  377   ICKNQTGAVAISGVTYNQIIGTYSVQPIHLACSNNVPCTDVDLIDIQLNPSPRYRSFQQA  436

Query  397   QCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
              CWNSYGKSQ  L P+S+DYCLR  S     IA+SHE IC
Sbjct  437   LCWNSYGKSQAPLVPSSIDYCLRRHSGSFMEIAKSHEIIC  476



>ref|XP_006356444.1| PREDICTED: polygalacturonase At1g48100-like [Solanum tuberosum]
Length=481

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/483 (67%), Positives = 382/483 (79%), Gaps = 5/483 (1%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRR--N  1541
             MK+N   +  +   V+LLIF   FS++SV+ARK+ H KK +    HK ++   D  +  N
Sbjct  1     MKKNYRHTSFIFLFVLLLIFATTFSIISVDARKHHHNKKSKIHHKHKKQQKNGDGNKAPN  60

Query  1540  FpapapapaqlpPGNCYPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQI  1361
                          G  YP  S +F+ILSFGAKGDG +DD+KALEAAW AACKV GAT++I
Sbjct  61    CTNSPSPAPSSSHG-FYPTQSPIFNILSFGAKGDGATDDTKALEAAWEAACKVQGATLEI  119

Query  1360  PSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGP  1181
             P++F FLINPITLQGPCMP+ V QVDG ++AP  VGSWPKSS+FQW+N KW+++FTIQG 
Sbjct  120   PTEFQFLINPITLQGPCMPNFVFQVDGIILAPPKVGSWPKSSLFQWLNVKWMYNFTIQGT  179

Query  1180  GTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHL  1001
             GT DGQG NWWKLSQI   Q  K SK    +MKPT LRFY S NVTI  I I+NSPQCHL
Sbjct  180   GTLDGQGYNWWKLSQIDYFQVMKKSKNTP-DMKPTVLRFYGSYNVTIRDIKIINSPQCHL  238

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDNSKGV ++N+TISAPE SPNTDGIHLQN+QDVEIHHS IG+GDDC+SIQTGCSN+HV
Sbjct  239   KFDNSKGVKINNVTISAPEISPNTDGIHLQNTQDVEIHHSNIGTGDDCISIQTGCSNIHV  298

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             HH+NCGPGHGISLGGLGKDKSVACVS+I+V++V   +T+YGARIKTWQGGVGSVKN+SFS
Sbjct  299   HHLNCGPGHGISLGGLGKDKSVACVSDIIVDSVNFASTMYGARIKTWQGGVGSVKNISFS  358

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQVS+VKVPIMIDQYYCDKH CKNQTGAVAI  V+F QI+GT++ +P HLACSNS+PCT
Sbjct  359   NIQVSNVKVPIMIDQYYCDKHVCKNQTGAVAISNVQFNQIIGTYSTKPIHLACSNSIPCT  418

Query  460   DVHLADIQLEPSPGYRGFRN-GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHEN  284
             DV L DIQL+PS  YRG    G CWNSYGKSQ  L P+SMDYC+R GS LV+ I+RSHE+
Sbjct  419   DVDLIDIQLKPSTNYRGINQLGLCWNSYGKSQAPLLPSSMDYCVRRGSGLVRGISRSHEH  478

Query  283   ICL  275
             +CL
Sbjct  479   VCL  481



>ref|XP_004239337.1| PREDICTED: polygalacturonase At1g48100 [Solanum lycopersicum]
Length=468

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/404 (74%), Positives = 347/404 (86%), Gaps = 3/404 (1%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
             S +F+ILSFGAKGDGVSDD+KALE AW AACKV GAT++IPS+F FLINPITLQGPCMP+
Sbjct  66    SPIFNILSFGAKGDGVSDDTKALETAWEAACKVQGATLEIPSEFQFLINPITLQGPCMPN  125

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
              V Q+DG ++ P  VGSWPKSS+FQW+N KW+H+FTIQG GT DGQG NWWKLSQI   Q
Sbjct  126   FVFQIDGIILGPPKVGSWPKSSLFQWLNLKWMHNFTIQGTGTLDGQGYNWWKLSQIDFFQ  185

Query  1120  EKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
               K SK I  +MKPT LRFY S NVTI  + I+NSPQCHLKFDNSKGV ++N+TISAPE+
Sbjct  186   VMKKSKNIP-DMKPTVLRFYGSYNVTIRDVKIINSPQCHLKFDNSKGVKINNVTISAPES  244

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQN+QDVEIHHS IG+GDDC+SIQTGCSN+HVHH+NCGPGHGISLGGLGKDK
Sbjct  245   SPNTDGIHLQNTQDVEIHHSNIGTGDDCISIQTGCSNIHVHHMNCGPGHGISLGGLGKDK  304

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             S+ACVS+I+V+NV +++T+YGARIKTWQGGVGSVKN+SF+ IQVS+VKVPIMIDQYYCDK
Sbjct  305   SIACVSDIIVDNVNLQSTMYGARIKTWQGGVGSVKNISFTNIQVSNVKVPIMIDQYYCDK  364

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRN  401
             H CKNQTGAVAI  V+F QI+GT++ +P HLACSNS+PCTDV L DIQL+PS  YRG   
Sbjct  365   HVCKNQTGAVAISNVQFNQIIGTYSTKPIHLACSNSIPCTDVDLIDIQLKPSTNYRGINQ  424

Query  400   --GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENICL  275
               G CWNSYGKSQ  L P+SMDYC+R GS  V+ I+RSHE++CL
Sbjct  425   LAGLCWNSYGKSQAPLLPSSMDYCVRRGSGFVRGISRSHEHVCL  468



>ref|XP_011071123.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=472

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/458 (68%), Positives = 354/458 (77%), Gaps = 9/458 (2%)
 Frame = -3

Query  1648  AFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPG-NCYPPPSSV  1472
             A S +S+EARKN H KK +    HK K+   +   N      +     P    YP  S V
Sbjct  22    ALSTISIEARKN-HGKKSKM---HKSKRHNQNSPPNRANSPASAPAPLPQFGTYPTQSRV  77

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVL  1292
             F+ILSFGAK +GVSDDSKAL AAW +ACKV G  V IP+   FLI P+TLQGPCMP+LVL
Sbjct  78    FNILSFGAKANGVSDDSKALLAAWKSACKVPGGVVAIPAGLKFLIKPVTLQGPCMPNLVL  137

Query  1291  QVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKK  1112
             Q+DG ++AP  +GSWPKSS++QWINFKW+ +FT+QG GT DGQG NWW  SQ     +KK
Sbjct  138   QIDGTLLAPPKIGSWPKSSLYQWINFKWLQNFTVQGAGTADGQGSNWWSSSQ---NDQKK  194

Query  1111  ASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPN  932
               K I   MKPTALRFYE  NVT+  I I+NSP CHLKFDNSK V V+N+TISAPE+SPN
Sbjct  195   RVKCIPA-MKPTALRFYEGYNVTVRDIRIINSPLCHLKFDNSKRVKVNNVTISAPESSPN  253

Query  931   TDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVA  752
             TDGIHLQNSQDVEI HS IG+GDDCVSIQTGCSN+HVHHINCGPGHGI       DKSVA
Sbjct  254   TDGIHLQNSQDVEILHSDIGTGDDCVSIQTGCSNIHVHHINCGPGHGIXXXXXXXDKSVA  313

Query  751   CVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHAC  572
             CVSNI+VEN++M+NTLYGARIKTWQGG+GSVKNV+FS IQVSDVKVPI IDQYYCDK+ C
Sbjct  314   CVSNIVVENIIMQNTLYGARIKTWQGGLGSVKNVTFSNIQVSDVKVPITIDQYYCDKNVC  373

Query  571   KNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQC  392
             KNQTGAVAI GV F QI+GT+A QP HLACSNS+PCTDV L  I+LEPSP YRGF+   C
Sbjct  374   KNQTGAVAISGVTFNQIIGTYAVQPIHLACSNSIPCTDVDLISIRLEPSPQYRGFQQALC  433

Query  391   WNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             WNSYGKS G L PASMDYC+RSGS  VKRIARSH+  C
Sbjct  434   WNSYGKSFGPLAPASMDYCVRSGSDFVKRIARSHDASC  471



>ref|XP_006483913.1| PREDICTED: polygalacturonase At1g48100-like [Citrus sinensis]
Length=474

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/458 (70%), Positives = 369/458 (81%), Gaps = 6/458 (1%)
 Frame = -3

Query  1648  AFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCY-PPPSSV  1472
              FS+MSVEARK+ H KK + P PHK +K +     +   P PAPA LP    Y    SS+
Sbjct  22    TFSIMSVEARKH-HTKKSK-PRPHKHQKDKHGPEPDSRFPLPAPAPLPHYGSYNRTKSSI  79

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVL  1292
             FD+LSFGAKGDGVSDD+KAL AAW AAC+V+GATV+IPS+F FLI PITLQGPCMP+LVL
Sbjct  80    FDVLSFGAKGDGVSDDTKALIAAWKAACRVAGATVEIPSEFKFLIKPITLQGPCMPNLVL  139

Query  1291  QVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKK  1112
             Q+DG ++AP  VGSWPKSS+FQWINFKW+H+FTIQG G  DGQG  WW  SQ +S+Q+K 
Sbjct  140   QIDGTLLAPPKVGSWPKSSLFQWINFKWLHNFTIQGNGIVDGQGFEWWGGSQSNSIQKK-  198

Query  1111  ASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPN  932
              SK I   MKPTALRFY S NVT+  I I NSP CHLKFD+S G+ V NI IS+PENSPN
Sbjct  199   -SKHI-PEMKPTALRFYASYNVTVRDIKINNSPLCHLKFDSSGGIKVKNIHISSPENSPN  256

Query  931   TDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVA  752
             TDGIHLQN++DVEI HS I  GDDCVSIQTGCSNVH+HHINCGPGHGISLGGLGKDKSVA
Sbjct  257   TDGIHLQNTKDVEIQHSDIACGDDCVSIQTGCSNVHIHHINCGPGHGISLGGLGKDKSVA  316

Query  751   CVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHAC  572
             CVS+I+VE + ++NTL G RIKTWQGG+GSVKNVSFS IQVSDVKVPI+IDQYYCDKH C
Sbjct  317   CVSDIVVEKISLQNTLAGVRIKTWQGGIGSVKNVSFSSIQVSDVKVPIIIDQYYCDKHLC  376

Query  571   KNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQC  392
              NQTGAVAI GV+F QI+GT++ QP HLACSNSVPC+DV L DIQL+PS  Y+ F+   C
Sbjct  377   NNQTGAVAISGVEFNQIIGTYSVQPIHLACSNSVPCSDVDLIDIQLKPSSKYQSFQQALC  436

Query  391   WNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             WNSYGKSQ  L P+S+DYCLR  S  VKRIARS E++C
Sbjct  437   WNSYGKSQAPLVPSSIDYCLRRDSGSVKRIARSREHMC  474



>ref|XP_010248557.1| PREDICTED: polygalacturonase At1g48100 [Nelumbo nucifera]
Length=473

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/481 (66%), Positives = 383/481 (80%), Gaps = 10/481 (2%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFp  1535
             MK++K+ S++   + +++IF  AFS +SVEARKN H  K R+P   K ++ RSD   N P
Sbjct  1     MKKSKNRSLLFLLVFLIMIF-IAFSTISVEARKN-HRMKSRSPKNQKQRR-RSDNSGNAP  57

Query  1534  apapapaqlpPGNCYPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPS  1355
              PAPAPA       YP  S++FDILSFGAKGDG+SDDSKA +AAW AAC+V  ATV+IPS
Sbjct  58    GPAPAPAPYYGS--YPSHSTIFDILSFGAKGDGISDDSKAFQAAWKAACRVPSATVEIPS  115

Query  1354  QFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGT  1175
             +F FLI PITLQGPCMP LVLQ+DG ++AP  + +W KSS+FQWINFKWVH+FTIQG GT
Sbjct  116   EFRFLIRPITLQGPCMPHLVLQIDGTLLAPPQISAWSKSSLFQWINFKWVHNFTIQGTGT  175

Query  1174  FDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKF  995
              DGQG  WW LSQ++ +Q++  SK I  ++KPTALRFY S +VT+  I+IVNSPQCHLKF
Sbjct  176   VDGQGSAWWSLSQVNYIQKR--SKYIP-DIKPTALRFYASYDVTVRDITIVNSPQCHLKF  232

Query  994   DNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHH  815
             D+S  V ++NITIS+PE SPNTDGIHLQN++DVEI HS IG GDDCVSIQTGCSN+H+HH
Sbjct  233   DSSGRVKINNITISSPETSPNTDGIHLQNTRDVEIQHSNIGCGDDCVSIQTGCSNIHIHH  292

Query  814   INCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGI  635
              NCGPGHGIS+GGLGKD+SVACVS+I+VEN+ ++NTLYG RIKTWQGG+GSVKN+SFS +
Sbjct  293   SNCGPGHGISVGGLGKDRSVACVSSIVVENINIQNTLYGVRIKTWQGGIGSVKNLSFSNV  352

Query  634   QVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDV  455
             QVSDVKVPI IDQYYCDK +C+NQT AVAI GVK+ QI GT++ QP HLACSN VPCTDV
Sbjct  353   QVSDVKVPIAIDQYYCDKKSCRNQTEAVAISGVKYNQITGTYSVQPIHLACSNRVPCTDV  412

Query  454   HLADIQLEPSPGYRGF-RNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIA-RSHENI  281
              L DIQLE SP  RGF +   CWNSYGKSQ  L P+S+DYCL+ G  L KR A RSHE  
Sbjct  413   DLVDIQLEQSPSSRGFQQQALCWNSYGKSQAPLVPSSIDYCLQGGRGLAKRPATRSHEFS  472

Query  280   C  278
             C
Sbjct  473   C  473



>gb|EYU22514.1| hypothetical protein MIMGU_mgv1a017703mg [Erythranthe guttata]
Length=453

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/403 (74%), Positives = 342/403 (85%), Gaps = 5/403 (1%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
             SSVF ILSFGAK +GVSDDSKAL +AW +ACKV G  V+IPS+F FLI P+TLQGPCMP+
Sbjct  55    SSVFSILSFGAKANGVSDDSKALVSAWKSACKVIGGVVEIPSEFKFLIKPVTLQGPCMPN  114

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             LVLQ+DG ++AP  +GSW KS+++QW+NFKW+ +FTIQG GT DGQG NWW  SQ++  +
Sbjct  115   LVLQIDGTLLAPPKIGSWAKSNLYQWMNFKWLQNFTIQGTGTVDGQGSNWWCSSQVN--K  172

Query  1120  EKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
             +K+A K     +KPTALRFY S NVT+  ISIVNSP CHLKFDNSKGV V N+TISAPE+
Sbjct  173   KKRAKKL--PGIKPTALRFYSSYNVTVRDISIVNSPLCHLKFDNSKGVKVENVTISAPED  230

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQNSQDVEI HS IG+GDDCVSIQTGCSN+HVHHINCGPGHGISLGGLGKDK
Sbjct  231   SPNTDGIHLQNSQDVEIMHSDIGTGDDCVSIQTGCSNIHVHHINCGPGHGISLGGLGKDK  290

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             S ACVSNILVEN+VM+NTLYGARIKTWQGG+GSVKNV+FS IQVSDVKVPI IDQYYCDK
Sbjct  291   STACVSNILVENIVMQNTLYGARIKTWQGGIGSVKNVTFSNIQVSDVKVPITIDQYYCDK  350

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYR-GFR  404
             + CKNQTGAVAI GVKF QI+GT+  QP HLACS+SVPCTDV L  IQLEPS   + GF+
Sbjct  351   NQCKNQTGAVAISGVKFDQIIGTYLVQPIHLACSSSVPCTDVDLISIQLEPSINNKHGFQ  410

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENICL  275
              G CWNSYGKS G L PASMDYC+RSGS  VKRI++SH+  CL
Sbjct  411   QGLCWNSYGKSLGPLAPASMDYCVRSGSEFVKRISKSHDISCL  453



>ref|XP_006438313.1| hypothetical protein CICLE_v10033716mg [Citrus clementina]
 gb|ESR51553.1| hypothetical protein CICLE_v10033716mg [Citrus clementina]
Length=483

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/465 (69%), Positives = 370/465 (80%), Gaps = 11/465 (2%)
 Frame = -3

Query  1648  AFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCY-PPPSSV  1472
              FS+MSVEARK+ H KK + P PHK +K +     +   P+PAPA LP    Y    SS+
Sbjct  22    TFSIMSVEARKH-HTKKSK-PRPHKHQKDKHGPEPDSRFPSPAPAPLPHYGSYNRTKSSI  79

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVL  1292
             FD+LSFGAKGDGVSDD+KAL AAW AAC+V+GATV+IPS+F FLI PITLQGPCMP+LVL
Sbjct  80    FDVLSFGAKGDGVSDDTKALIAAWKAACRVAGATVEIPSEFKFLIKPITLQGPCMPNLVL  139

Query  1291  QVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE--  1118
             Q+DG ++AP  VGSWPKSS+FQWINFKW+H+FTIQG G  DGQG  WW  S+ +S+Q   
Sbjct  140   QIDGTLLAPPKVGSWPKSSLFQWINFKWLHNFTIQGNGIVDGQGFEWWGGSESNSIQLYV  199

Query  1117  -----KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
                  +K SK I   MKPTALRFY S NVT+  I I NSP CHLKFD+S G+ V NI IS
Sbjct  200   VTSHWQKKSKHI-PEMKPTALRFYASYNVTVRDIKINNSPLCHLKFDSSGGIKVKNIHIS  258

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +PENSPNTDGIHLQN++DVEI HS I  GDDCVSIQTGCSNVH+HHINCGPGHGISLGGL
Sbjct  259   SPENSPNTDGIHLQNTKDVEIQHSDIACGDDCVSIQTGCSNVHIHHINCGPGHGISLGGL  318

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             GKDKSVACVS+I+VE + ++NTL G RIKTWQGG+GSVKNVSFS IQVSDVKVPI+IDQY
Sbjct  319   GKDKSVACVSDIVVEKISLQNTLAGVRIKTWQGGIGSVKNVSFSSIQVSDVKVPIIIDQY  378

Query  592   YCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYR  413
             YCDKH C NQTGAVAI GV+F QI+GT++ QP HLACSNSVPC+DV L DIQL+PS  Y+
Sbjct  379   YCDKHLCNNQTGAVAISGVEFNQIIGTYSVQPIHLACSNSVPCSDVDLIDIQLKPSSKYQ  438

Query  412   GFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
              F+   CWNSYGKSQ  L P+S+DYCLR  S  VKRIARS E++C
Sbjct  439   SFQQALCWNSYGKSQAPLVPSSIDYCLRRDSGSVKRIARSREHMC  483



>ref|XP_002527898.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF34455.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=477

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/482 (66%), Positives = 374/482 (78%), Gaps = 8/482 (2%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFp  1535
             MK+NK+   +    V++  F   F+M+SV+ARK+ H KK ++    K + G  +   +  
Sbjct  1     MKKNKNIPRLFFIFVMIAAF-TMFTMISVDARKHHHNKKSKSHKHIKDRSGNGNNAPDSA  59

Query  1534  apapapaqlp--PGNCYPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQI  1361
                          G  YP  S++FD+LSFGAKGDGVSDDSKAL AAW AACKV GATV+I
Sbjct  60    TVPSPAPAPLPHYGYSYPTQSNIFDVLSFGAKGDGVSDDSKALLAAWKAACKVPGATVEI  119

Query  1360  PSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGP  1181
             P++F FLI PITLQGPCMP LVLQ+DG V+AP  VGSWPKSS+FQW NFKWVH FTIQG 
Sbjct  120   PAEFKFLIKPITLQGPCMPHLVLQIDGTVLAPPEVGSWPKSSLFQWFNFKWVHDFTIQGT  179

Query  1180  GTFDGQGPNWWKLSQIHSLQEKKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCH  1004
             G+ +GQG  WW  S ++ +Q++      H+ +MKPTALRFY S NVT+  I I+NSPQCH
Sbjct  180   GSVNGQGFYWWTPSNVYFIQKRFK----HIPDMKPTALRFYASYNVTVRNIEIINSPQCH  235

Query  1003  LKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVH  824
             LKFDNSKG+ V+NITIS+PENSPNTDGIHLQN+QDVEI HS IG+GDDC+SIQTGCSN+H
Sbjct  236   LKFDNSKGIKVNNITISSPENSPNTDGIHLQNTQDVEIQHSNIGTGDDCISIQTGCSNIH  295

Query  823   VHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSF  644
             VHHINCGPGHGISLGGLGKDKSVACVSNI+VE + + NTL GARIKTWQGG+GSVKNVSF
Sbjct  296   VHHINCGPGHGISLGGLGKDKSVACVSNIVVEKISLHNTLAGARIKTWQGGLGSVKNVSF  355

Query  643   SGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPC  464
             S IQVSDVK PI+IDQ+YCDKH CKNQT AVAI GVKF QI+G++  QP HLACS  VPC
Sbjct  356   SNIQVSDVKYPIIIDQFYCDKHICKNQTEAVAISGVKFDQIIGSYITQPIHLACSKDVPC  415

Query  463   TDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHEN  284
              DV L DIQL+PSPGYR FR   CWNSYGKSQ  L P+S+DYCL+  S  +KR+ARSHEN
Sbjct  416   IDVDLIDIQLKPSPGYRSFRQALCWNSYGKSQAPLVPSSIDYCLKRDSGWIKRVARSHEN  475

Query  283   IC  278
             +C
Sbjct  476   LC  477



>ref|XP_007157357.1| hypothetical protein PHAVU_002G063500g [Phaseolus vulgaris]
 gb|ESW29351.1| hypothetical protein PHAVU_002G063500g [Phaseolus vulgaris]
Length=471

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 360/480 (75%), Gaps = 11/480 (2%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLK-KGRSDYRRNF  1538
             MKRN+S S++    ++++IF   FS +SVEARK    K+      H     GR  +    
Sbjct  1     MKRNRSFSLLFFLSLLVIIF-VTFSTVSVEARKKNLHKRNNHKDGHSGNGHGRGSHSPRP  59

Query  1537  papapapaqlpPGNCYPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIP  1358
                 P          Y    S+FD+LSFGAKG+GVSDDS+AL AAW  ACKV+GATV+IP
Sbjct  60    TPTPPPY--------YGSQGSMFDVLSFGAKGNGVSDDSEALVAAWKGACKVAGATVKIP  111

Query  1357  SQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPG  1178
             +Q  FLI P+TLQGPCMPDL LQ+DG ++AP  + SWP SS+FQWINFKWV +FTI+G G
Sbjct  112   AQLKFLIKPVTLQGPCMPDLTLQIDGTLLAPPQISSWPTSSLFQWINFKWVQNFTIKGSG  171

Query  1177  TFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLK  998
             T DGQG  WWK S+ + +Q+K  SK I  +MKPTA+RFY S +VT+  I I+NSP CHLK
Sbjct  172   TVDGQGYYWWKSSEFYDIQKKSYSKNIP-SMKPTAIRFYSSNSVTVRDIRIINSPLCHLK  230

Query  997   FDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVH  818
             FDNSKG+ V NITIS+PE+SPNTDGIHLQN+QDVEI  S I +GDDCVSIQTGCSN+HVH
Sbjct  231   FDNSKGIEVDNITISSPESSPNTDGIHLQNTQDVEIKRSIIATGDDCVSIQTGCSNIHVH  290

Query  817   HINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSG  638
             HINCGPGHGISLGGLGKDKS ACVS+I+VE++ M+NTLYGARIKTWQGG G VKNVSFS 
Sbjct  291   HINCGPGHGISLGGLGKDKSAACVSDIIVEDISMKNTLYGARIKTWQGGFGMVKNVSFSR  350

Query  637   IQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTD  458
             IQV DV  PIMIDQYYCDK  CKN T  V I GVKF +I GTF  QP HLACS S+PCTD
Sbjct  351   IQVYDVMFPIMIDQYYCDKQKCKNHTSTVVISGVKFDEISGTFGIQPVHLACSTSIPCTD  410

Query  457   VHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             V L DIQL PSP Y+G +   CWNSYGKSQG L P+S+D CL+SG  L+KRIARSH+ +C
Sbjct  411   VDLTDIQLSPSPKYKGLQQAVCWNSYGKSQGPLLPSSIDDCLKSGGGLIKRIARSHDRVC  470



>ref|XP_004489794.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=468

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/446 (65%), Positives = 344/446 (77%), Gaps = 23/446 (5%)
 Frame = -3

Query  1615  NRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPPSSVFDILSFGAKGDG  1436
             NRH +   + PP  L +  S                     +P   + FDI+SFGAKG+G
Sbjct  42    NRHTRGKGSHPPSPLPRYES---------------------HPTQVNTFDIMSFGAKGNG  80

Query  1435  VSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNV  1256
             VSDDS+AL AAW  ACK+SGAT+++P++F FLI PITLQGPCM DL LQ+DG V+AP  V
Sbjct  81    VSDDSEALVAAWECACKISGATIKVPAKFKFLIKPITLQGPCMNDLTLQIDGIVLAPSEV  140

Query  1255  GSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPT  1076
              SWPKSS+FQWINFKWV +FTI+G GT DGQG NWW LS+++ +Q+  + +    +MKPT
Sbjct  141   SSWPKSSLFQWINFKWVQNFTIKGSGTVDGQGSNWWILSELYDMQKTHSEQI--PSMKPT  198

Query  1075  ALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDV  896
             A+RFY S  V +  I I+NSP CHLKFDNSKG+ V NITI +P NSPNTDGIHLQN+QDV
Sbjct  199   AIRFYSSNFVKVRDIKIINSPLCHLKFDNSKGIKVDNITIISPANSPNTDGIHLQNTQDV  258

Query  895   EIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVM  716
             EI HS IG+GDDCVSIQTGCSN+HVHHI CGPGHGISLGGLGKDKSVACVS+I+VE++ M
Sbjct  259   EIQHSHIGTGDDCVSIQTGCSNIHVHHIKCGPGHGISLGGLGKDKSVACVSDIIVEDISM  318

Query  715   ENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGV  536
             +NTLYGARIKTWQGG+G VKNVSFS I+  DV  PIMIDQYYCDK  CKNQTG V I GV
Sbjct  319   KNTLYGARIKTWQGGIGMVKNVSFSRIKAYDVMFPIMIDQYYCDKQICKNQTGTVVISGV  378

Query  535   KFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLF  356
             KF QI G+++ QP HLACSNS+PCTDV L DIQL PS  YRG +   CWNSYGKSQGQL 
Sbjct  379   KFDQISGSYSVQPVHLACSNSIPCTDVDLTDIQLRPSLKYRGLQQAMCWNSYGKSQGQLV  438

Query  355   PASMDYCLRSGSLLVKRIARSHENIC  278
             P+S+DYCLRSG  L+KRIARSH+++C
Sbjct  439   PSSIDYCLRSGGGLIKRIARSHDSVC  464



>ref|XP_003517718.1| PREDICTED: polygalacturonase At1g48100-like [Glycine max]
Length=461

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/484 (64%), Positives = 359/484 (74%), Gaps = 29/484 (6%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFp  1535
             MKRN+S S++    ++++IF   FS++SVEARK    KK      HK  KG         
Sbjct  1     MKRNRSFSLLFFLSLLVIIF-VTFSIVSVEARKTNIKKKL-----HKRHKG---------  45

Query  1534  apapapaqlpPGNCYP-----PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGAT  1370
                        G+  P     P  S FD+LSFGAKG+GVSDDS+A  AAW  ACKV+GAT
Sbjct  46    -------GHTQGSHSPCPVPTPQGSTFDVLSFGAKGNGVSDDSEAFLAAWNGACKVAGAT  98

Query  1369  VQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTI  1190
             V+IP+Q  FLI P+TLQGPC+ DL LQ+DG ++AP    +WPKSS+FQWINFKWV +FTI
Sbjct  99    VKIPAQLKFLIKPVTLQGPCISDLTLQIDGTLLAPPEASTWPKSSLFQWINFKWVRNFTI  158

Query  1189  QGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
             +G GT DGQG NWW  S+ + +Q K  SK I   MKPTA+RFY S  VT+  I I+NSP 
Sbjct  159   KGSGTVDGQGYNWWSSSEFYDIQ-KSYSKHIP-GMKPTAIRFYSSNFVTVRDIRIINSPL  216

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDNSKG+ V+NITIS+PENSPNTDGIHLQN+QDVEI  S I +GDDCVSIQTGCSN
Sbjct  217   CHLKFDNSKGIKVNNITISSPENSPNTDGIHLQNTQDVEIQRSIISTGDDCVSIQTGCSN  276

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             +HVHHINCGPGHGISLGGLGKDKS ACVS+I VE++ M+NTLYGARIKTWQGG+G VKNV
Sbjct  277   IHVHHINCGPGHGISLGGLGKDKSAACVSDITVEDISMKNTLYGARIKTWQGGIGMVKNV  336

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
             +FS IQV DV  PIMIDQYYCDK  CKN T  V I GVKF QI GT+  QP HLACSNS+
Sbjct  337   TFSRIQVYDVMYPIMIDQYYCDKQICKNHTSTVVISGVKFDQIHGTYGMQPVHLACSNSI  396

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PCTDV L DIQL PSP YRG +   CWNSYGKSQG   P+S+DYCLRSG  L+KRIARSH
Sbjct  397   PCTDVDLTDIQLSPSPKYRGLQQAVCWNSYGKSQGPFLPSSIDYCLRSGGGLIKRIARSH  456

Query  289   ENIC  278
             + +C
Sbjct  457   DKVC  460



>ref|XP_004300928.1| PREDICTED: polygalacturonase At1g48100-like [Fragaria vesca subsp. 
vesca]
Length=471

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/468 (66%), Positives = 360/468 (77%), Gaps = 27/468 (6%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             I    FS+ SVEARK++  K      PHK +KG +    +                 P P
Sbjct  18    IVLVTFSITSVEARKHQTKKTK----PHKHQKGGNGTHGSHLPC-------------PAP  60

Query  1480  SSV-----FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
             + V     F +LSFGAKGDGVSDDSKAL AAW AACKV+GA+V+IPS F FLI PITLQG
Sbjct  61    TPVPQDGSFSVLSFGAKGDGVSDDSKALTAAWKAACKVNGASVEIPSGFKFLIKPITLQG  120

Query  1315  PCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
             PCMP+LVLQ+DG ++AP  VGSW KSS+FQWINFKWVH+FTIQG G  DGQG +WW    
Sbjct  121   PCMPNLVLQIDGTLMAPPKVGSWSKSSLFQWINFKWVHNFTIQGTGVVDGQGFDWWSSCS  180

Query  1135  IHSLQ----EKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVH  968
               S      +KK++K I  N KPTALRFY S +V +  I I+NSPQCHLKFD+S G+ V+
Sbjct  181   SSSSSVCYLQKKSNKHIP-NFKPTALRFYSSYDVIVRDIRIINSPQCHLKFDSSGGIKVN  239

Query  967   NITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgi  788
             NITIS+PENSPNTDGIHLQN+Q+VEIHHSTIG GDDCVSIQTGCSNVHVHHINCGPGHGI
Sbjct  240   NITISSPENSPNTDGIHLQNTQNVEIHHSTIGCGDDCVSIQTGCSNVHVHHINCGPGHGI  299

Query  787   slgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPI  608
             SLGGLGKD+SVACVSNI+V +V  +NTL G RIKTWQGG+GSVKNVSFS IQVSDVKVP+
Sbjct  300   SLGGLGKDRSVACVSNIIVNDVSFQNTLSGVRIKTWQGGIGSVKNVSFSNIQVSDVKVPV  359

Query  607   MIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP  428
             MIDQYYCDK +CKNQTGAVAI GVK+ QI+GT++ QP HLACS+ VPCTDV L DIQL+P
Sbjct  360   MIDQYYCDKKSCKNQTGAVAISGVKYDQIIGTYSVQPVHLACSSDVPCTDVDLIDIQLKP  419

Query  427   SPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHEN  284
             S GY+ F++  CWNSYGKSQ  L P+S+DYCLR     VKRIARSH++
Sbjct  420   SAGYQRFQHALCWNSYGKSQPPLVPSSIDYCLRRDENPVKRIARSHDH  467



>gb|KHN14552.1| Polygalacturonase [Glycine soja]
Length=461

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/484 (64%), Positives = 360/484 (74%), Gaps = 29/484 (6%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFp  1535
             MKRN+S S++    ++++IF   FS++SVEARK    KK      HK  KG         
Sbjct  1     MKRNRSFSLLFFLSLLVIIF-VTFSIVSVEARKTNIKKKL-----HKRHKG---------  45

Query  1534  apapapaqlpPGNCYP-----PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGAT  1370
                        G+  P     P  S FD+LSFGAKG+GVSDDS+AL AAW  ACKV+GAT
Sbjct  46    -------GHTQGSHSPCPVPTPQGSNFDVLSFGAKGNGVSDDSEALLAAWNGACKVAGAT  98

Query  1369  VQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTI  1190
             V+IP+Q  FLI P+TLQGPC+ DL LQ+DG ++AP    +WPKSS+FQWINFKWV +FTI
Sbjct  99    VKIPAQLKFLIKPVTLQGPCISDLTLQIDGTLLAPPEASTWPKSSLFQWINFKWVRNFTI  158

Query  1189  QGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
             +G GT DGQG NWW  S+ + +Q K  SK I   MKPTA+RFY S  VT+  I I+NSP 
Sbjct  159   KGSGTVDGQGYNWWSSSEFYDIQ-KSYSKHIP-GMKPTAIRFYSSNFVTVRDIRIINSPL  216

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDNSKG+ V+NITIS+PENSPNTDGIHLQN+QDVEI  S I +GDDCVSIQTGCSN
Sbjct  217   CHLKFDNSKGIKVNNITISSPENSPNTDGIHLQNTQDVEIQRSIISTGDDCVSIQTGCSN  276

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             +HVHHINCGPGHGISLGGLGKDKS ACVS+I VE++ M+NTLYGARIKTWQGG+G VKNV
Sbjct  277   IHVHHINCGPGHGISLGGLGKDKSAACVSDITVEDISMKNTLYGARIKTWQGGIGMVKNV  336

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
             +FS IQV DV  PIMIDQYYCDK  CKN T  V I GVKF QI GT+  QP HLACSNS+
Sbjct  337   TFSRIQVYDVMYPIMIDQYYCDKQICKNHTSTVVISGVKFDQIHGTYGMQPVHLACSNSI  396

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PCTDV L DIQL PSP YRG +   CWNSYGKSQG   P+S+DYCLRSG  L+KRIARSH
Sbjct  397   PCTDVDLTDIQLSPSPKYRGLQQAVCWNSYGKSQGPFLPSSIDYCLRSGGGLIKRIARSH  456

Query  289   ENIC  278
             + +C
Sbjct  457   DKVC  460



>ref|XP_003519827.1| PREDICTED: polygalacturonase At1g48100-like [Glycine max]
Length=462

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/485 (63%), Positives = 364/485 (75%), Gaps = 30/485 (6%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFp  1535
             MKR++S S++    +++++F A FS++S+EARK    KK      HK  KG         
Sbjct  1     MKRSRSFSLLFYLYLLVIVF-ATFSIVSMEARKTNIKKKL-----HKRHKG---------  45

Query  1534  apapapaqlpPGNCYP-----PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGAT  1370
                        G+  P     P  S FD+L+FGAKG+GVSDDS+AL AAW  ACKV+ AT
Sbjct  46    -------GHTRGSHSPCPVPAPQGSTFDVLAFGAKGNGVSDDSEALLAAWNGACKVAAAT  98

Query  1369  VQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTI  1190
             V+IP+QF FL+ P+TLQGPCMPDL LQ+DG ++AP    SWP+SS+FQWINFKWV +FTI
Sbjct  99    VKIPAQFKFLMKPVTLQGPCMPDLTLQIDGTLLAPSEASSWPQSSLFQWINFKWVQNFTI  158

Query  1189  QGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
              G GT DGQG NWW  S+ + +Q K  SK I  ++KPTA+RFY S  VT+  I I+NSP 
Sbjct  159   IGSGTVDGQGYNWWSSSEFYDMQ-KTYSKHIP-SIKPTAIRFYSSNFVTVRDIRIINSPL  216

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDNSKG+ V+NITIS+PENSPNTDGIHLQN+QDVEI  S I +GDDCVSIQTGCSN
Sbjct  217   CHLKFDNSKGIKVNNITISSPENSPNTDGIHLQNTQDVEIQRSIISTGDDCVSIQTGCSN  276

Query  829   VHVHHINCgpghgislgglGKDK-SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKN  653
             VHVHHINCGPGHGISLGGLGKDK S ACVS+I VE++ M+NTL+GARIKTWQGG+G VKN
Sbjct  277   VHVHHINCGPGHGISLGGLGKDKTSAACVSDITVEDISMKNTLFGARIKTWQGGIGMVKN  336

Query  652   VSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNS  473
             V+FS IQV DV  PIMIDQYYCDK  CKN T  V I GVKF QI GT+  QP HLACSNS
Sbjct  337   VTFSRIQVYDVMYPIMIDQYYCDKEICKNHTSTVVISGVKFDQIHGTYGMQPVHLACSNS  396

Query  472   VPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS  293
             +PCTDV L+DIQL PSP YRG +   CWNSYGKSQG L P+S+DYCLRSG  L+KRIARS
Sbjct  397   IPCTDVDLSDIQLSPSPKYRGLQQAVCWNSYGKSQGPLIPSSIDYCLRSGGGLIKRIARS  456

Query  292   HENIC  278
             H+ +C
Sbjct  457   HDRVC  461



>gb|AES96137.2| polygalacturonase [Medicago truncatula]
Length=470

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/403 (71%), Positives = 330/403 (82%), Gaps = 2/403 (0%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             +P   + FDI+SFGAKG+GVSDDS+A  AAW  ACKVSGAT+++P +  FLI PITLQGP
Sbjct  52    HPIQPNTFDIMSFGAKGNGVSDDSEAFLAAWKCACKVSGATIKVPEKLKFLIKPITLQGP  111

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI  1133
             CMPDL LQ+DG ++AP  V SWPKS++FQWINFKWV +FTI+G GT DGQG NWW  S++
Sbjct  112   CMPDLTLQIDGTILAPPEVSSWPKSNLFQWINFKWVQNFTIKGYGTIDGQGSNWWSSSKL  171

Query  1132  HSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
             + +Q K  SK I  +MKPTA+RFY S  V I  I I NSP CHLKFDNSKG+ V NITIS
Sbjct  172   YDIQ-KTHSKQIP-SMKPTAIRFYSSNFVKIRDIKIKNSPLCHLKFDNSKGIKVDNITIS  229

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +PENSPNTDGIHLQN+QDVEI HS IG+GDDCVSIQTGCSN+HVHHI CGPGHGISLGGL
Sbjct  230   SPENSPNTDGIHLQNTQDVEIQHSNIGTGDDCVSIQTGCSNIHVHHIKCGPGHGISLGGL  289

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             GKDKSVACVS+I+VE++ M+NTLYGARIKTWQGG G VKNVSFS I+V DV  P+MIDQY
Sbjct  290   GKDKSVACVSDIIVEDISMKNTLYGARIKTWQGGNGMVKNVSFSRIKVYDVMYPVMIDQY  349

Query  592   YCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYR  413
             YCDK  CKNQTG V I GVKF QI G++  QP HLACSNS+PCTDV L DIQL PS  YR
Sbjct  350   YCDKQICKNQTGTVIISGVKFDQISGSYTLQPVHLACSNSIPCTDVDLTDIQLRPSLSYR  409

Query  412   GFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHEN  284
             G +   CWNSYGKSQGQL P+S+DYCLRSG  L+KRIA+SH++
Sbjct  410   GMQQAMCWNSYGKSQGQLVPSSIDYCLRSGGGLIKRIAKSHDS  452



>ref|XP_010100420.1| Polygalacturonase [Morus notabilis]
 gb|EXB82554.1| Polygalacturonase [Morus notabilis]
Length=495

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/413 (70%), Positives = 338/413 (82%), Gaps = 6/413 (1%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             YP  SS+FD++SFGAKGDGVSDDSKAL AAW AACKV+GATV+IPS+F FLI PITLQGP
Sbjct  75    YPSRSSIFDVMSFGAKGDGVSDDSKALLAAWEAACKVAGATVEIPSEFKFLIKPITLQGP  134

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI  1133
             CMP LVLQ+DG+++AP  VGSW K S+FQWINFKW+H+FTIQG G  DGQG NWW  S+ 
Sbjct  135   CMPQLVLQIDGSILAPPKVGSWQKYSLFQWINFKWLHNFTIQGSGIVDGQGTNWWSNSKT  194

Query  1132  HSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
             + +Q+K  SK I   MKPTALRFY S +VT+  I I+NSPQCHLKFD+SKG+ V NITIS
Sbjct  195   YQIQKK--SKHIP-GMKPTALRFYSSYDVTVRNIRIINSPQCHLKFDSSKGIKVDNITIS  251

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +PENSPNTDGIHLQN+QDVEI HS +G GDDCVSIQTGCSNVH+HHINCGPGHGISLGGL
Sbjct  252   SPENSPNTDGIHLQNTQDVEIQHSNVGCGDDCVSIQTGCSNVHIHHINCGPGHGISLGGL  311

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             GKDK+VACVSNI+V+NV ++NTL G RIKTWQGG+GSVKNVSFS IQVSDVKVPI+IDQY
Sbjct  312   GKDKTVACVSNIIVDNVSIQNTLSGVRIKTWQGGIGSVKNVSFSNIQVSDVKVPIVIDQY  371

Query  592   YCDKHA-CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YCD    CKNQTGAVAI  VK+ +I+GT++AQP HLACS  +PCTDV L +IQL PSP  
Sbjct  372   YCDNSIFCKNQTGAVAISDVKYDRIIGTYSAQPLHLACSKDIPCTDVDLNNIQLNPSPRC  431

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENICL*PSSHG  257
             RGF+   C NSYGKS+  L P+++DYCLR+    ++ IAR  +     P  HG
Sbjct  432   RGFKQALCLNSYGKSEAPLVPSNIDYCLRAVGGPIRGIARDVKRAV--PGRHG  482



>gb|KHN00378.1| Polygalacturonase [Glycine soja]
Length=449

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/485 (62%), Positives = 355/485 (73%), Gaps = 43/485 (9%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFp  1535
             MKR++S S++    +++++F A FS++S+EARK    KK      HK  KG         
Sbjct  1     MKRSRSFSLLFYLYLLVIVF-ATFSIVSMEARKTNIKKKL-----HKRHKG---------  45

Query  1534  apapapaqlpPGNCYP-----PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGAT  1370
                        G+  P     P  S FD+L+FGAKG+GVSDDS+AL AAW  ACKV+ AT
Sbjct  46    -------GHTRGSHSPCPVPAPQGSTFDVLAFGAKGNGVSDDSEALLAAWNGACKVAAAT  98

Query  1369  VQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTI  1190
             V+IP+QF FL+ P+TLQGPCMPDL LQ+DG ++AP    SWP+SS+FQWINFKWV +FTI
Sbjct  99    VKIPAQFKFLMKPVTLQGPCMPDLTLQIDGTLLAPSEASSWPQSSLFQWINFKWVQNFTI  158

Query  1189  QGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
              G GT DGQG NWW  S+ + +Q               A+RFY S  VT+  I I+NSP 
Sbjct  159   IGSGTVDGQGYNWWSSSEFYDMQ---------------AIRFYSSNFVTVRDIRIINSPL  203

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDNSKG+ V+NITIS+PENSPNTDGIHLQN+QDVEI  S I +GDDCVSIQTGCSN
Sbjct  204   CHLKFDNSKGIKVNNITISSPENSPNTDGIHLQNTQDVEIQRSIISTGDDCVSIQTGCSN  263

Query  829   VHVHHINCgpghgislgglGKDK-SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKN  653
             VHVHHINCGPGHGISLGGLGKDK S ACVS+I VE++ M+NTL+GARIKTWQGG+G VKN
Sbjct  264   VHVHHINCGPGHGISLGGLGKDKTSAACVSDITVEDISMKNTLFGARIKTWQGGIGMVKN  323

Query  652   VSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNS  473
             V+FS IQV DV  PIMIDQYYCDK  CKN T  V I GVKF QI GT+  QP HLACSNS
Sbjct  324   VTFSRIQVYDVMYPIMIDQYYCDKEICKNHTSTVVISGVKFDQIHGTYGMQPVHLACSNS  383

Query  472   VPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS  293
             +PCTDV L+DIQL PSP YRG +   CWNSYGKSQG L P+S+DYCLRSG  L+KRIARS
Sbjct  384   IPCTDVDLSDIQLSPSPKYRGLQQAVCWNSYGKSQGPLIPSSIDYCLRSGGGLIKRIARS  443

Query  292   HENIC  278
             H+ +C
Sbjct  444   HDRVC  448



>ref|XP_007044724.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY00556.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=473

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/482 (65%), Positives = 377/482 (78%), Gaps = 11/482 (2%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFp  1535
             M+R+KS  ++    ++ L+F  + S+ SVE RK+   K      PHK +K ++      P
Sbjct  1     MRRDKSLYLLALVAIMFLVFITS-SITSVEGRKHNVNKGK----PHKHQKDKNHKGNGAP  55

Query  1534  apapapaqlpPGNCYPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPS  1355
               +PAPA LP  + YP  S++FD+LSFGAKGDGVSDDSKAL AAW AACKV GATV+IPS
Sbjct  56    HSSPAPAPLPGYDYYPTGSNIFDVLSFGAKGDGVSDDSKALLAAWKAACKVPGATVEIPS  115

Query  1354  QFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGT  1175
             +F FL+ P+TLQGPCMP+LV Q+DG ++AP  VGSWPKSS+FQWINFKW+H+FTIQG G 
Sbjct  116   EFKFLVKPLTLQGPCMPNLVFQIDGALLAPPKVGSWPKSSLFQWINFKWIHNFTIQGTGV  175

Query  1174  FDGQGPNWWKLS-QIHSLQEKKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHL  1001
              DGQG  WW  S QI+ +Q+K      H+ N KPTALRFY S NVT+  I I+NSPQCHL
Sbjct  176   VDGQGSQWWTPSDQIYYIQKKFK----HIPNWKPTALRFYSSYNVTVRDIQIINSPQCHL  231

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFD+S G+ V+N+TIS+PE+SPNTDGIHLQN++DVEI +S IG GDDCVSIQTGCSNVH+
Sbjct  232   KFDSSGGIKVNNLTISSPESSPNTDGIHLQNTRDVEILYSNIGCGDDCVSIQTGCSNVHI  291

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             HH+NCGPGHGISLGGLGKDKSVACVS+I+VE + + NTL G RIKTWQGG+GSVKNVSFS
Sbjct  292   HHVNCGPGHGISLGGLGKDKSVACVSDIVVEKISLLNTLAGVRIKTWQGGMGSVKNVSFS  351

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQVSDVKVPI+IDQYYCDK+ CKNQTGAVAI GV + QI+GT++ QP HLACSN +PCT
Sbjct  352   NIQVSDVKVPIIIDQYYCDKNVCKNQTGAVAISGVTYDQIIGTYSVQPVHLACSNDIPCT  411

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENI  281
             DV L DIQL+PS  YRGF    CWNSYGKSQ  L P+++D CLR     VKRIARS E++
Sbjct  412   DVDLIDIQLKPSLRYRGFHQALCWNSYGKSQAPLLPSNIDSCLRRDGGSVKRIARSREHV  471

Query  280   CL  275
             C 
Sbjct  472   CF  473



>ref|XP_011034109.1| PREDICTED: polygalacturonase At1g48100-like [Populus euphratica]
Length=481

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/464 (67%), Positives = 368/464 (79%), Gaps = 15/464 (3%)
 Frame = -3

Query  1645  FSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPG-----NCYPPP  1481
             F+M+SVEARK+ H+ + +   PHK  K +     N P PA      PP        +PP 
Sbjct  23    FAMISVEARKH-HSNRNK---PHKHLKDKGSNGHNAPDPATNIPGPPPAPLPYHGSFPPH  78

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
             S +FD+LSFGAKGDGVSDDSKAL AAW AACKVSGA V+IP++F FLI PITLQGPCMP 
Sbjct  79    SVIFDVLSFGAKGDGVSDDSKALLAAWKAACKVSGAVVEIPAEFKFLIRPITLQGPCMPH  138

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             LVL+VDG ++AP  VG+WPKS +FQW+NFKWVH FTIQG G  DGQG  WW  S ++S+Q
Sbjct  139   LVLEVDGILLAPPQVGAWPKSCLFQWLNFKWVHDFTIQGTGKLDGQGSAWWSPSGVYSIQ  198

Query  1120  EKKASKTIHVNMK-PTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
               K+SK  + +MK PTALRFY+S NVT+  I I+NSPQCHLKFD+S G+ V+NITI++PE
Sbjct  199   --KSSKH-NPDMKVPTALRFYDSHNVTVRDIQIMNSPQCHLKFDSSSGIKVNNITINSPE  255

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             NSPNTDGIHLQN++DVEI HS IG GDDCVSIQTGCSN+HVHHINCGPGHGISLGGLGKD
Sbjct  256   NSPNTDGIHLQNTKDVEIQHSNIGCGDDCVSIQTGCSNIHVHHINCGPGHGISLGGLGKD  315

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
             KS ACVS+I+VE + ++NTL G RIKTWQGGVGSVKNV+FS I+VSDVK P++IDQ+YCD
Sbjct  316   KSAACVSDIVVEKISLQNTLSGVRIKTWQGGVGSVKNVTFSSIEVSDVKYPVIIDQFYCD  375

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSP-GYRGF  407
             K  CKNQT AVAI GVK+ +I+G+++ QP HLACSN VPCTDV L DIQL+PS  G+RGF
Sbjct  376   KKICKNQTDAVAISGVKYDRIIGSYSVQPLHLACSNDVPCTDVDLIDIQLKPSSNGFRGF  435

Query  406   RNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS-HENIC  278
             R   CWNSYGKSQ  L P+S+DYCLR+ S  VK+IARS  E+IC
Sbjct  436   RQALCWNSYGKSQAPLLPSSIDYCLRTKSRSVKKIARSPTEHIC  479



>ref|XP_004135482.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
 ref|XP_004165356.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
Length=467

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/452 (67%), Positives = 354/452 (78%), Gaps = 15/452 (3%)
 Frame = -3

Query  1630  VEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPPSSVFDILSFG  1451
             VEARK  H KK +    H+ +KG  +   + PAP P P            S++F+ILSFG
Sbjct  29    VEARKQYHNKKSK----HQKQKGAGNGHGSGPAPTPLPYYNQS------QSTIFNILSFG  78

Query  1450  AKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVLQVDGNVV  1271
             AKG+GVSDDSKAL AAW AAC++ GAT++IPSQ+ FLI PITL GPCM   VLQ+DG V+
Sbjct  79    AKGNGVSDDSKALLAAWKAACEIPGATLEIPSQYKFLIKPITLNGPCMAQFVLQIDGAVL  138

Query  1270  APLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHV  1091
             AP  V SWPKSS+FQW+NFKW+H+FTIQG GT +GQG NWW L+ I  LQ+K      H+
Sbjct  139   APPKVSSWPKSSLFQWLNFKWLHNFTIQGSGTVNGQGFNWWTLNNILFLQKKLK----HI  194

Query  1090  -NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHL  914
              +MKPTALRFY S NVT+  I+I+NSPQCHLKFDNS  V + NITIS+PENSPNTDGIHL
Sbjct  195   SDMKPTALRFYSSYNVTVRDITIINSPQCHLKFDNSGTVKIDNITISSPENSPNTDGIHL  254

Query  913   QNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNIL  734
             QN++DVEI HS IG GDDCVSIQTGCSN+H+HHINCGPGHGISLGGLGKDKS ACVSNI+
Sbjct  255   QNTRDVEIQHSNIGCGDDCVSIQTGCSNIHIHHINCGPGHGISLGGLGKDKSAACVSNIV  314

Query  733   VENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGA  554
             VEN+ ++NTL G RIKTWQGG+GSVKNVSFS IQVSDVKVPIMIDQYYCDK  CKNQTGA
Sbjct  315   VENISIQNTLSGVRIKTWQGGIGSVKNVSFSNIQVSDVKVPIMIDQYYCDKSKCKNQTGA  374

Query  553   VAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGK  374
             VAI G+ + QI+G+++ QP HLACS+ +PC DV L DIQL+PS   RGF+N  CWNSYGK
Sbjct  375   VAISGITYDQIIGSYSVQPIHLACSSQIPCVDVDLIDIQLKPSSESRGFQNSICWNSYGK  434

Query  373   SQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             SQ  L P S+D CLR G   V+RIARSH+ +C
Sbjct  435   SQAPLLPTSIDSCLRRGGGAVRRIARSHDYVC  466



>ref|XP_002312682.2| polygalacturonase family protein [Populus trichocarpa]
 gb|EEE90049.2| polygalacturonase family protein [Populus trichocarpa]
Length=468

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/464 (65%), Positives = 356/464 (77%), Gaps = 26/464 (6%)
 Frame = -3

Query  1648  AFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPG-----NCYPP  1484
              F+M+SVEARK+ H+ + +   PHK  K +     N P PA       P        YP 
Sbjct  22    TFAMISVEARKH-HSNRNK---PHKHLKDKGSNGHNAPDPATNIPGPAPAPLPYYGSYPT  77

Query  1483  PSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMP  1304
              S +FD+LSFGAKGDGVSDDSKAL AAW AACKVSGA V+IP++F FLI PITLQGPCMP
Sbjct  78    HSIIFDVLSFGAKGDGVSDDSKALLAAWKAACKVSGAVVEIPAEFKFLIKPITLQGPCMP  137

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
              LVL+VDG ++AP  VG+WPKS +FQW+NFKWVH FTIQG G  DGQG  WW  S ++ +
Sbjct  138   HLVLEVDGILLAPPQVGAWPKSGLFQWLNFKWVHDFTIQGTGKLDGQGSAWWSPSGVYYI  197

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
             Q               ALRFY+S NVT+  I I+NSPQCHLKFD+S G+ V+NITI +PE
Sbjct  198   Q---------------ALRFYDSHNVTVRDIKIMNSPQCHLKFDSSSGIKVNNITIDSPE  242

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             NSPNTDGIHLQN++DVEI HS IG GDDCVSIQTGCSN+HVHHINCGPGHGISLGGLGKD
Sbjct  243   NSPNTDGIHLQNTKDVEIQHSNIGCGDDCVSIQTGCSNIHVHHINCGPGHGISLGGLGKD  302

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
             KSVACVS+I+VE + ++NTL G RIKTWQGGVGSVKNV+FS I+VSDVK P++IDQ+YCD
Sbjct  303   KSVACVSDIVVEKISLQNTLSGVRIKTWQGGVGSVKNVTFSSIEVSDVKYPVIIDQFYCD  362

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSP-GYRGF  407
             K  CKNQT AVAI GVK+ +I+G+++ QP HLACSN VPCTDV L DIQL+PS  G+RGF
Sbjct  363   KKICKNQTEAVAISGVKYDRIIGSYSVQPLHLACSNDVPCTDVDLIDIQLKPSSNGFRGF  422

Query  406   RNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH-ENIC  278
             R   CWNSYGKSQ  L P+S+DYCLR+ S  VKRIARSH E+IC
Sbjct  423   RQALCWNSYGKSQAPLLPSSIDYCLRTESRSVKRIARSHTEHIC  466



>ref|XP_008446184.1| PREDICTED: polygalacturonase At1g48100 [Cucumis melo]
Length=466

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/401 (71%), Positives = 332/401 (83%), Gaps = 3/401 (1%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
             S++F+ILSFGAKG+GVSDDSKAL AAW AAC++ GAT++IPSQ  FLI PITL GPCM  
Sbjct  68    STIFNILSFGAKGNGVSDDSKALLAAWKAACEIPGATLEIPSQHKFLIKPITLNGPCMAQ  127

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             LVLQ+DG V+AP  V SWPKSS+FQW+NFKW+H+FT+QG GT +GQG NWW LS  ++  
Sbjct  128   LVLQIDGAVLAPPKVSSWPKSSLFQWLNFKWLHNFTVQGSGTVNGQGFNWWTLSTFYN--  185

Query  1120  EKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
              KK  K I  +MKPTALRFY S NVT+  I+I+NSPQCHLKFDNS  V + NITIS+PEN
Sbjct  186   NKKKLKHIP-DMKPTALRFYSSYNVTVRDITIINSPQCHLKFDNSGAVKIDNITISSPEN  244

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQN++DVEI HS IG GDDCVSIQTGCSN+H+HHINCGPGHGISLGGLGKDK
Sbjct  245   SPNTDGIHLQNTRDVEIQHSNIGCGDDCVSIQTGCSNIHIHHINCGPGHGISLGGLGKDK  304

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             S ACVSNI+V+N+ ++NTL G RIKTWQGG+GSVKNVSFS IQVSDVKVPIMIDQYYCDK
Sbjct  305   SAACVSNIVVQNISIQNTLSGVRIKTWQGGIGSVKNVSFSNIQVSDVKVPIMIDQYYCDK  364

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRN  401
               CKNQTGAVAI G+ + QI+G+++ QP HLACS+ +PC DV L DIQL+PS   RGF+N
Sbjct  365   SKCKNQTGAVAISGITYDQIIGSYSVQPIHLACSSQIPCVDVDLIDIQLKPSSESRGFQN  424

Query  400   GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
               CWNSYGKSQ  L P S+D CLR G   V+RIARSH+ +C
Sbjct  425   SLCWNSYGKSQAPLLPTSIDSCLRRGGGAVRRIARSHDYVC  465



>emb|CDP13196.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/483 (63%), Positives = 358/483 (74%), Gaps = 11/483 (2%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFp  1535
             MKRN++SS     L  L I   AFS +SVEARK+   K  R        K  ++++ N  
Sbjct  1     MKRNRNSSAYFFRLFSL-ILLFAFSALSVEARKSHGQKMHRAQ-----HKKHTNHKGNVS  54

Query  1534  apapapaqlpPGNCYPPP----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATV  1367
              P        P +    P    S++FD+LSFGAKGDG+ DDSKA+ AAW AACKV GAT+
Sbjct  55    TPPRTRRSRIPAHAPASPPITESTIFDVLSFGAKGDGICDDSKAVAAAWEAACKVPGATM  114

Query  1366  QIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQ  1187
             + PS+F FLI P TLQGPC P L LQ+DG V+AP  V S PKSS+FQWINFKW+ +FTIQ
Sbjct  115   EFPSEFKFLIKPTTLQGPCQPHLTLQIDGLVLAPSKVWSGPKSSLFQWINFKWLQNFTIQ  174

Query  1186  GPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQC  1007
             G G  DGQG NWW  S      + K  KT   +MKPTALRFY S NVT+  I I+NSP C
Sbjct  175   GSGIVDGQGSNWWTPSSPFDSMKDKRPKTF-PDMKPTALRFYSSYNVTVRDIKIINSPNC  233

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDNS+GV V+NITISAPE S NTDGIHLQNSQDVEIHHS IG GDDCVSIQTGCSNV
Sbjct  234   HLKFDNSRGVEVNNITISAPETSLNTDGIHLQNSQDVEIHHSYIGCGDDCVSIQTGCSNV  293

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
              VHHINCGPGHGISLGGLGK  +VAC SNI+V+++ M NTLYGARIKTWQGG+G+VKNVS
Sbjct  294   FVHHINCGPGHGISLGGLGKGGTVACASNIIVDSIFMNNTLYGARIKTWQGGLGAVKNVS  353

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVSDVKVPIMIDQYYCDKH CKN+TGAVAI GVKF +I GT++AQP HLACS+SVP
Sbjct  354   FSNIQVSDVKVPIMIDQYYCDKHICKNKTGAVAISGVKFDKITGTYSAQPLHLACSSSVP  413

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C++V L+ I L+PS  +RG R+  CWNSYGKSQ  L P S+DYCL  G  ++++I+RSH 
Sbjct  414   CSNVDLSAINLQPSLEFRGLRDALCWNSYGKSQAPLVPTSIDYCLLKGGSVLQKISRSHG  473

Query  286   NIC  278
               C
Sbjct  474   KSC  476



>ref|XP_010023494.1| PREDICTED: polygalacturonase At1g48100 [Eucalyptus grandis]
Length=467

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/404 (68%), Positives = 324/404 (80%), Gaps = 3/404 (1%)
 Frame = -3

Query  1489  PPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPC  1310
             P  SS+F++LSFGAKGDGVSDDSKA  AAW AAC+V  AT+ IP    FL+ PI+ +GPC
Sbjct  66    PAESSMFNVLSFGAKGDGVSDDSKAFSAAWKAACQVPSATLVIPQGLKFLVKPISFKGPC  125

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
             MP+LVLQ+DG V AP  VGSW KSS+FQW+NFKWV +FT+QG GT DGQG  WW LSQ+ 
Sbjct  126   MPNLVLQIDGIVQAPPKVGSWKKSSLFQWLNFKWVQNFTVQGTGTVDGQGSEWWSLSQML  185

Query  1129  SLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
                 +  SK + + MKPTALRFY S NV++ GISIVNSP CHLKFDNS+G+ + NI IS+
Sbjct  186   PYNVQSTSKHV-LGMKPTALRFYSSCNVSVRGISIVNSPLCHLKFDNSRGIKISNIAISS  244

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             P++SPNTDGIHLQNSQ VEI HS IG GDDC+S+QTGCS+V++HHINCGPGHGISLGGLG
Sbjct  245   PKDSPNTDGIHLQNSQHVEIEHSNIGCGDDCISVQTGCSDVYIHHINCGPGHGISLGGLG  304

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             KDKSVACVSNI+V+N+ +E+TLYG RIKTWQGG+GSVKNVSFS +QVS+VKVP+MIDQYY
Sbjct  305   KDKSVACVSNIIVDNLSLESTLYGVRIKTWQGGLGSVKNVSFSNVQVSNVKVPMMIDQYY  364

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CDK  CKNQTG +AI  VKF Q VGT+AAQP H+ACS  VPCT+V L DIQL+P PG  G
Sbjct  365   CDKKFCKNQTGGIAISRVKFNQFVGTYAAQPLHIACSQDVPCTNVDLVDIQLKPLPGLGG  424

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
              R   C+NSYGK+   L PAS+D CLRS      RIARSH+ +C
Sbjct  425   SREALCYNSYGKAVAPLVPASIDDCLRSDG--GSRIARSHDVVC  466



>ref|XP_003613179.1| Polygalacturonase [Medicago truncatula]
Length=489

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/435 (64%), Positives = 321/435 (74%), Gaps = 47/435 (11%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             +P   + FDI+SFGAKG+GVSDDS+A  AAW  ACKVSGAT+++P +  FLI PITLQGP
Sbjct  52    HPIQPNTFDIMSFGAKGNGVSDDSEAFLAAWKCACKVSGATIKVPEKLKFLIKPITLQGP  111

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI  1133
             CMPDL LQ+DG ++AP  V SWPKS++FQWINFKWV +FTI+G GT DGQG NWW  S++
Sbjct  112   CMPDLTLQIDGTILAPPEVSSWPKSNLFQWINFKWVQNFTIKGYGTIDGQGSNWWSSSKL  171

Query  1132  HSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
             + +Q               A+RFY S  V I  I I NSP CHLKFDNSKG+ V NITIS
Sbjct  172   YDIQ---------------AIRFYSSNFVKIRDIKIKNSPLCHLKFDNSKGIKVDNITIS  216

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +PENSPNTDGIHLQN+QDVEI HS IG+GDDCVSIQTGCSN+HVHHI CGPGHGISLGGL
Sbjct  217   SPENSPNTDGIHLQNTQDVEIQHSNIGTGDDCVSIQTGCSNIHVHHIKCGPGHGISLGGL  276

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQ----------------------------  677
             GKDKSVACVS+I+VE++ M+NTLYGARIKTWQ                            
Sbjct  277   GKDKSVACVSDIIVEDISMKNTLYGARIKTWQYHVKSFTLKVMRSEQMFISDEYLHLTSR  336

Query  676   ----GGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTF  509
                 GG G VKNVSFS I+V DV  P+MIDQYYCDK  CKNQTG V I GVKF QI G++
Sbjct  337   FCGVGGNGMVKNVSFSRIKVYDVMYPVMIDQYYCDKQICKNQTGTVIISGVKFDQISGSY  396

Query  508   AAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLR  329
               QP HLACSNS+PCTDV L DIQL PS  YRG +   CWNSYGKSQGQL P+S+DYCLR
Sbjct  397   TLQPVHLACSNSIPCTDVDLTDIQLRPSLSYRGMQQAMCWNSYGKSQGQLVPSSIDYCLR  456

Query  328   SGSLLVKRIARSHEN  284
             SG  L+KRIA+SH++
Sbjct  457   SGGGLIKRIAKSHDS  471



>ref|XP_011045279.1| PREDICTED: polygalacturonase At1g48100-like [Populus euphratica]
Length=466

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/462 (65%), Positives = 349/462 (76%), Gaps = 22/462 (5%)
 Frame = -3

Query  1648  AFSMMSVEARK---NRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPPS  1478
             AF+++SVEARK   NRH  KP      K   G          P P PA LP    YP  S
Sbjct  22    AFAIISVEARKHHNNRH--KPHKHLKDKGSNGHKAPDPAANIPVPTPAPLPHYGSYPTKS  79

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
             ++FD+LSFGAKGDGVSDDSKAL AAW AAC+VSGA V+IP++F FLI PI LQGPCMP L
Sbjct  80    NIFDVLSFGAKGDGVSDDSKALLAAWKAACQVSGAIVEIPAEFKFLIKPIILQGPCMPHL  139

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             VL++DG +++P  VG+WPKSS+FQWINFKWVH FTIQG G  DGQG  WW  S+ + +Q 
Sbjct  140   VLEIDGILLSPPRVGAWPKSSLFQWINFKWVHDFTIQGTGKVDGQGSEWWSPSEAYYIQ-  198

Query  1117  KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENS  938
                           ALRFY+S N+T+  I IVNSPQCHLKFD+S G+ V NITI++PE S
Sbjct  199   --------------ALRFYDSHNITVRDIEIVNSPQCHLKFDSSSGIKVDNITINSPEIS  244

Query  937   PNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKS  758
             PNTDGIHLQN++DVEI HS IG GDDCVSIQTGCSN+HVHHINCGPGHGIS+GGLGKDKS
Sbjct  245   PNTDGIHLQNTKDVEIEHSNIGCGDDCVSIQTGCSNIHVHHINCGPGHGISVGGLGKDKS  304

Query  757   VACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKH  578
             VACVS+I+VE + ++NTL G RIKTWQGG+GSVKNV+FS I+VSDVK P++IDQ+YCDK 
Sbjct  305   VACVSDIVVEKISLQNTLSGVRIKTWQGGIGSVKNVTFSNIEVSDVKYPVIIDQFYCDKK  364

Query  577   ACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSP-GYRGFRN  401
              CKNQT AVAI GVK+  I G+++ QP HLACSN VPCT V L DIQL+PS  GY GFR 
Sbjct  365   RCKNQTDAVAISGVKYDSIKGSYSVQPIHLACSNDVPCTGVDLIDIQLKPSSNGYGGFRQ  424

Query  400   GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS-HENIC  278
               CWNSYGKSQ  L P+S+DYCLR+ S  VK  ARS HE+IC
Sbjct  425   ALCWNSYGKSQAPLVPSSIDYCLRTESGSVKGTARSHHEHIC  466



>ref|XP_010695816.1| PREDICTED: polygalacturonase At1g48100 [Beta vulgaris subsp. 
vulgaris]
Length=460

 Score =   530 bits (1366),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 262/399 (66%), Positives = 318/399 (80%), Gaps = 4/399 (1%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
             + F++LSFGAKGDG +DDSKAL  AW AACKV GAT++IPS +   I PITLQGPCMP L
Sbjct  56    TTFNVLSFGAKGDGATDDSKALLKAWEAACKVQGATLEIPSGYKLFIKPITLQGPCMPQL  115

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             VLQ++G ++AP  V SWPKS +FQWIN KWV +FTIQG G  DGQG  WW  +   S   
Sbjct  116   VLQINGKIIAPPKVSSWPKSGLFQWINIKWVQNFTIQGNGVVDGQGSEWW--TSFSSTTN  173

Query  1117  KKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
             KK  +   V +MKPTALRFY S N+ +  I I NSP CHLKFDNS GV VHN+TIS+PE+
Sbjct  174   KKRYQPRRVPSMKPTALRFYGSNNIKVRDIMITNSPLCHLKFDNSVGVEVHNVTISSPED  233

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQN++DV+IHHSTIG GDDCVSIQTGCSN++VHHINCGPGHGISLGGLGKDK
Sbjct  234   SPNTDGIHLQNTRDVQIHHSTIGCGDDCVSIQTGCSNIYVHHINCGPGHGISLGGLGKDK  293

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             +VACVS+I+VEN++M+NTL+G RIKTW GG+GSVKN+SFS IQV DVKVP++IDQ+YC+ 
Sbjct  294   TVACVSDIVVENILMQNTLFGVRIKTWPGGIGSVKNISFSDIQVKDVKVPVIIDQFYCEN  353

Query  580   HA-CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
             +  CKNQTGAVAI  V+F +IVGT++AQP HLACSN +PC+ V L DI+L PSP  RG +
Sbjct  354   NVHCKNQTGAVAISNVQFNKIVGTYSAQPIHLACSNDIPCSHVDLMDIRLTPSPRNRGLQ  413

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
                CWNSYG+++  L P S+DYCLR    +V R+ RS++
Sbjct  414   QALCWNSYGRTEAPLVPQSIDYCLRESHRMVPRVQRSYD  452



>ref|XP_002315680.2| hypothetical protein POPTR_0010s05390g [Populus trichocarpa]
 gb|EEF01851.2| hypothetical protein POPTR_0010s05390g [Populus trichocarpa]
Length=471

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 298/462 (65%), Positives = 351/462 (76%), Gaps = 17/462 (4%)
 Frame = -3

Query  1648  AFSMMSVEARK---NRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPPS  1478
              F+++SVEARK   NRH  KP      K   G          P PAPA LP    YP  S
Sbjct  22    TFAIISVEARKHHNNRH--KPHKHLKDKGGNGHKAPDPATNIPGPAPAPLPHYGSYPTNS  79

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
             ++FD+LSFGAKGDGVSDDSKAL AAW AAC+VSGA V+IP++F FLI PI LQGPCMP L
Sbjct  80    NIFDVLSFGAKGDGVSDDSKALLAAWKAACQVSGAIVEIPAEFKFLIKPIILQGPCMPHL  139

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             VL++DG +++P  VG+WPKSS+FQWINFKWVH FTIQG G  DGQG +WW  S+++ +Q 
Sbjct  140   VLEIDGILLSPPRVGAWPKSSLFQWINFKWVHDFTIQGTGKVDGQGSDWWSPSEVYYIQV  199

Query  1117  KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENS  938
              +            ALRFY+S NVT+  I IVNSPQCHLKFD+S G+ V NITI++PE S
Sbjct  200   CQCR----------ALRFYDSHNVTVRDIEIVNSPQCHLKFDSSSGIKVDNITINSPEMS  249

Query  937   PNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKS  758
             PNTDGIHLQN++DVEI HS IG GDDCVSIQTGCSN+HVH INCGPGHGIS+GGLGKDKS
Sbjct  250   PNTDGIHLQNTKDVEIQHSNIGCGDDCVSIQTGCSNIHVHDINCGPGHGISVGGLGKDKS  309

Query  757   VACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKH  578
             VACVS+I+VE + ++NTL G RIKTWQGG+GSVKNV+FS I+VSDVK P++IDQ+YCDK 
Sbjct  310   VACVSDIVVEKISLQNTLSGVRIKTWQGGIGSVKNVTFSNIEVSDVKYPVIIDQFYCDKK  369

Query  577   ACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSP-GYRGFRN  401
              CKNQT AVAI GVK+  I G+++ QP HLACSN VPCT V L DIQL+PS  GY GFR 
Sbjct  370   TCKNQTDAVAISGVKYDSIKGSYSVQPIHLACSNDVPCTGVDLIDIQLKPSSNGYGGFRQ  429

Query  400   GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS-HENIC  278
               CWNSYGKSQ  L P+S+DYCLR+ S  VK  ARS HE+IC
Sbjct  430   ALCWNSYGKSQAPLVPSSIDYCLRTESGSVKGTARSRHEHIC  471



>ref|XP_006841022.1| hypothetical protein AMTR_s00085p00112760 [Amborella trichopoda]
 gb|ERN02697.1| hypothetical protein AMTR_s00085p00112760 [Amborella trichopoda]
Length=486

 Score =   527 bits (1357),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 259/401 (65%), Positives = 316/401 (79%), Gaps = 0/401 (0%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             Y P  ++FDILSFGAKGDGVSDDSK+L AAW AACKV  A V+IPS+F FLI+ +TLQGP
Sbjct  80    YQPTRTIFDILSFGAKGDGVSDDSKSLLAAWRAACKVGSAIVEIPSEFRFLISAVTLQGP  139

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI  1133
             CMP LVLQ+DG V+AP  + +WP + + QWINFKWV +F+IQG GT DGQG  WW +  I
Sbjct  140   CMPQLVLQIDGTVIAPSQLSAWPNNGLLQWINFKWVQNFSIQGTGTIDGQGSAWWGIPDI  199

Query  1132  HSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
              S +    S     + KPTA+RFY S NVTI  ++I+NSP CHLKFDN  GV V NITIS
Sbjct  200   QSEKFSGKSSKYIPSTKPTAVRFYASYNVTIRDVAIINSPLCHLKFDNCGGVKVLNITIS  259

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +P +SPNTDGIH+QN+QDVE+ HSTIG GDDCVSIQTGCSNV++HHINCGPGHGISLG L
Sbjct  260   SPGDSPNTDGIHIQNTQDVEVEHSTIGCGDDCVSIQTGCSNVNIHHINCGPGHGISLGSL  319

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             GKD S+ACV N+ V+N+ +++ L G RIKTWQGG+GSVKN+SFSGIQVS+V++PI+IDQ+
Sbjct  320   GKDNSLACVYNVTVQNITIQDALSGVRIKTWQGGLGSVKNISFSGIQVSNVRIPIVIDQF  379

Query  592   YCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYR  413
             YCDK  CKNQTGAV I+G+K+ QI GT+AAQP HLACS++VPCT++ L DIQLEPS   R
Sbjct  380   YCDKKRCKNQTGAVEIEGIKYDQITGTYAAQPIHLACSDAVPCTNIDLNDIQLEPSQTAR  439

Query  412   GFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             G + G CWNSYGKSQ  L P+S++   +SG+L       SH
Sbjct  440   GIQQGLCWNSYGKSQAPLIPSSINCLQKSGNLAKSMRKSSH  480



>ref|XP_010502593.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=469

 Score =   522 bits (1345),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 279/474 (59%), Positives = 338/474 (71%), Gaps = 37/474 (8%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             I  AA S +SVE RK            H +KK +S +RR+           P G+  P P
Sbjct  18    IVAAAISTISVEGRK------------HHVKKIKSKHRRH-------SKTTPSGSPAPAP  58

Query  1480  -----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
                    VF+ILSFGA GDG+SDDSKAL  AW AACKV+G  V IP+   FL+  +TLQG
Sbjct  59    YPSTHDGVFNILSFGAMGDGLSDDSKALVGAWKAACKVAGGKVDIPAGKQFLVKAVTLQG  118

Query  1315  PCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
             PC  D V+Q++G +VAP  +GSWPKS++FQW+NFKWV    IQG GT +G+G NWW L  
Sbjct  119   PCKDDTVIQIEGTLVAPEKIGSWPKSNLFQWLNFKWVSHVIIQGSGTLNGRGSNWWNLDT  178

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               +   K         MKPTALRFY S NVT+  ISIVNSP CHLKFD+S GV V+NITI
Sbjct  179   YQTQSRKYIPP-----MKPTALRFYASENVTVRDISIVNSPLCHLKFDDSDGVKVNNITI  233

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+PENSPNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHINCGPGHGIS+GG
Sbjct  234   SSPENSPNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHINCGPGHGISIGG  293

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKDKSVACVS+I+VE++ ++NTL G RIKTWQGG+G VKN++FS IQV+DVKVPI+IDQ
Sbjct  294   LGKDKSVACVSDIIVEDISIQNTLAGVRIKTWQGGLGVVKNLTFSNIQVTDVKVPIVIDQ  353

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYCDK  CKNQT AV+I GVK+  IVG+F  QP  +ACSN+VPC  V L DI+L PS G 
Sbjct  354   YYCDKSTCKNQTRAVSISGVKYNNIVGSFTVQPVRIACSNNVPCMGVDLMDIRLRPSGGI  413

Query  415   RGFRNGQ-----CWNSYGKSQGQLFPASMDYCLRS---GSLLVKRIARSHENIC  278
             RG +  Q     CWNSYGK+QG L P+S+ YCLR    G+   +++ARS++NIC
Sbjct  414   RGLQTHQQQQALCWNSYGKTQGPLVPSSIGYCLRKSNIGAYYSQKVARSYDNIC  467



>ref|XP_006395541.1| hypothetical protein EUTSA_v10004137mg [Eutrema salsugineum]
 gb|ESQ32827.1| hypothetical protein EUTSA_v10004137mg [Eutrema salsugineum]
Length=473

 Score =   522 bits (1344),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 284/477 (60%), Positives = 343/477 (72%), Gaps = 39/477 (8%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             I  AA S +SVE RK            H +KK +  +RR+           P G+  P P
Sbjct  18    IVAAAISTISVEGRK------------HHVKKIKPKHRRH-------SKNTPTGSPAPAP  58

Query  1480  -----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
                    VFDILSFGAKGDGVSDDSKAL  AW AAC+V+G  ++IP+   F++ P+TLQG
Sbjct  59    YPSTHEGVFDILSFGAKGDGVSDDSKALVGAWKAACEVAGGKIEIPAGKEFMVKPVTLQG  118

Query  1315  PCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
             PC  + V+Q++G +VAP  +GSWPKSS+FQW+NFKWV   TIQG GTFD +G NWW L  
Sbjct  119   PCKEETVIQIEGTLVAPGKIGSWPKSSLFQWLNFKWVGHVTIQGSGTFDARGFNWWNLD-  177

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               + Q  K +K I   MKPTALRFY S NVT+  ISIVNSP CHLKFDNS GV V+NITI
Sbjct  178   --TYQTHKRNKYIP-PMKPTALRFYASDNVTVRDISIVNSPLCHLKFDNSDGVRVNNITI  234

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+PENSPNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHI+CGPGHGIS+GG
Sbjct  235   SSPENSPNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHISCGPGHGISIGG  294

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKDKSVACVS+I+VE++ ++NTL G RIKTWQGG+G VKN++FS IQV+DVKVPI+IDQ
Sbjct  295   LGKDKSVACVSDIIVEDISLQNTLAGVRIKTWQGGLGVVKNLTFSNIQVTDVKVPIVIDQ  354

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYCDK  CKNQTGAV+I GVK+  IVG+F  QP  +ACSN+VPC DV L DI+L PS G 
Sbjct  355   YYCDKSKCKNQTGAVSISGVKYNNIVGSFTVQPVRIACSNNVPCMDVDLLDIRLRPSGGI  414

Query  415   RGFRNGQ-----CWNSYGKSQGQLFPASMDYCLRSGS----LLVKRI--ARSHENIC  278
             RG +  Q     CWNSYGK+QG L P+S+ YCL+  +       KR   + SH+ IC
Sbjct  415   RGLQTHQQQQALCWNSYGKTQGPLVPSSIGYCLKKSNTGRGYYPKRFIASSSHDKIC  471



>ref|XP_010556330.1| PREDICTED: polygalacturonase At1g48100 [Tarenaya hassleriana]
Length=474

 Score =   521 bits (1341),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 269/410 (66%), Positives = 320/410 (78%), Gaps = 7/410 (2%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKV---SGATVQIPSQFSFLINPITL  1322
             YP    +FDILSFGAK DGVSDDS AL  AW AAC+    + A V+IP+   F++ P+TL
Sbjct  66    YPAHEGIFDILSFGAKADGVSDDSMALVEAWKAACEEEVGTEARVKIPAGKKFMVKPVTL  125

Query  1321  QGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKL  1142
             QGPC   LV+Q+DG VVAP  +G+WPKSS+FQW+NFKW+   T+QG GT D +G  WW  
Sbjct  126   QGPCKQKLVVQIDGTVVAPDKIGTWPKSSLFQWLNFKWLDQITVQGSGTLDARGSAWWDT  185

Query  1141  SQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNI  962
             +Q    Q +K  K I   MKPTALRFY S+NVT+  I IVNSP CHLKFDNS+GVNV NI
Sbjct  186   TQ-DVYQTQKRHKYIP-PMKPTALRFYASSNVTVRDIRIVNSPLCHLKFDNSEGVNVDNI  243

Query  961   TISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgisl  782
             TIS+PENSPNTDGIHLQN++ V I HS I  GDDCVSIQTG S+VH+HHINCGPGHGISL
Sbjct  244   TISSPENSPNTDGIHLQNTRHVHIQHSNIACGDDCVSIQTGSSDVHIHHINCGPGHGISL  303

Query  781   gglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMI  602
             GGLGKDKSVACVS+I+VE++ ++NTL G RIKTWQGG+G VKNV+FS IQVSDVKVPI+I
Sbjct  304   GGLGKDKSVACVSDIIVEDISIQNTLAGVRIKTWQGGLGMVKNVTFSKIQVSDVKVPIVI  363

Query  601   DQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSP  422
             DQYYCDK+ CKNQTGAVAI GV++  IVG+F  QP H+ACS+ VPC DV L DI+L+PS 
Sbjct  364   DQYYCDKYKCKNQTGAVAISGVRYDNIVGSFTVQPVHIACSSDVPCMDVDLVDIRLKPSQ  423

Query  421   GYRGF-RNGQCWNSYGKSQGQLFPASMDYCLR-SGSLLVKRIARSHENIC  278
               RGF +   CWNSYGK+QG L P+++D CLR SG    +RIARSHE+IC
Sbjct  424   ASRGFQQQALCWNSYGKTQGPLVPSAIDDCLRNSGGGFPRRIARSHEHIC  473



>ref|NP_189293.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
 emb|CAA66811.1| polygalacturonase-like protein [Arabidopsis thaliana]
 dbj|BAB01843.1| polygalacturonase [Arabidopsis thaliana]
 dbj|BAC42276.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE77185.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
Length=470

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 279/474 (59%), Positives = 339/474 (72%), Gaps = 36/474 (8%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             I  AA S +SVE RK            H +KK +  +RR+           P G+  P P
Sbjct  18    IVAAAISTVSVEGRK------------HHVKKIKPKHRRH-------SKNTPTGSPAPAP  58

Query  1480  -----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
                    VF+I S+GAKGDGVSDDSKAL  AW AACKV G  V+IP+   FL+  +TLQG
Sbjct  59    YPSTNEGVFNIFSYGAKGDGVSDDSKALVGAWKAACKVVGGKVEIPAGTQFLVKAVTLQG  118

Query  1315  PCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
             PC  + V+Q++G +VAP  +GSWP SS+FQW+NFKWV   TIQG GT +G+G NWW L  
Sbjct  119   PCKEETVVQIEGILVAPEKIGSWPNSSLFQWLNFKWVSHLTIQGSGTLNGRGYNWWNLD-  177

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               + Q +  +K I   MKPTALRFY S NVT+  ISIVNSP CHLKFD+S GV V+NITI
Sbjct  178   --TYQTQTRNKYIP-PMKPTALRFYSSNNVTVRDISIVNSPLCHLKFDDSDGVKVNNITI  234

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+PENSPNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHINCGPGHGIS+GG
Sbjct  235   SSPENSPNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHINCGPGHGISIGG  294

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKDKSVACVS+I+VE++ ++NTL G RIKTWQGG+G VKN++FS IQV DVKVPI+IDQ
Sbjct  295   LGKDKSVACVSDIIVEDISIQNTLAGVRIKTWQGGLGVVKNLTFSNIQVKDVKVPIVIDQ  354

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYCDK  CKNQT AV+I GVK+  IVG+F  QP  +ACSN+VPC DV L DI+L PS G 
Sbjct  355   YYCDKSKCKNQTRAVSISGVKYNNIVGSFTVQPVRIACSNNVPCMDVDLMDIRLRPSGGI  414

Query  415   RGFRNGQ-----CWNSYGKSQGQLFPASMDYCLRS---GSLLVKRIARSHENIC  278
             RG +  Q     CWNSYGK+QG L P+S+ YCLR    G    ++++RS++ IC
Sbjct  415   RGLQTHQQQQALCWNSYGKTQGPLVPSSIGYCLRKSNIGGYYSQKVSRSYDKIC  468



>ref|XP_002875326.1| hypothetical protein ARALYDRAFT_484425 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51585.1| hypothetical protein ARALYDRAFT_484425 [Arabidopsis lyrata subsp. 
lyrata]
Length=470

 Score =   516 bits (1329),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 277/474 (58%), Positives = 341/474 (72%), Gaps = 36/474 (8%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             I  AA S +SVE RK            H +KK +  +RR+           P G+  P P
Sbjct  18    IVAAAISTISVEGRK------------HHVKKIKPKHRRH-------SKNTPTGSPAPAP  58

Query  1480  -----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
                    VF+I+SFGAKGDGVSDDSKAL  AW AAC+V G  V+IP+   FL+  +TLQG
Sbjct  59    YPSTHEGVFNIISFGAKGDGVSDDSKALVRAWKAACEVVGGKVEIPAGKQFLVKAVTLQG  118

Query  1315  PCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
             PC  + V+Q++G +VAP  +GSWPKSS+FQW+N KWV   TIQG GT +G+G NWW L  
Sbjct  119   PCKEETVVQIEGTLVAPEKIGSWPKSSLFQWLNIKWVSHVTIQGSGTLNGRGSNWWNLD-  177

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               + Q +  +K I   MKPTALRFY + NVT+  ISIVNSP CHLKFD+S GV V+NITI
Sbjct  178   --TYQIQTRNKYIP-PMKPTALRFYAAHNVTVRDISIVNSPLCHLKFDDSDGVKVNNITI  234

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+PENSPNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHINCGPGHGIS+GG
Sbjct  235   SSPENSPNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHINCGPGHGISIGG  294

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKDKSVACVS+I+VE++ ++NTL G RIKTWQGG+G VKN++FS IQV+DVKVPI+IDQ
Sbjct  295   LGKDKSVACVSDIIVEDISIQNTLAGVRIKTWQGGLGVVKNLTFSNIQVTDVKVPIVIDQ  354

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYCDK  CKNQT AV+I G+K+  IVG+F  QP  +ACSN+VPC DV L DI+L PS G 
Sbjct  355   YYCDKSKCKNQTRAVSISGIKYNNIVGSFTVQPVRIACSNNVPCMDVDLMDIRLRPSGGI  414

Query  415   RGFRNGQ-----CWNSYGKSQGQLFPASMDYCLRS---GSLLVKRIARSHENIC  278
             RG +  Q     CWNSYGK+QG L P+S+ YCLR    G    ++++RS++ IC
Sbjct  415   RGLQTHQQQQALCWNSYGKTQGPLVPSSIGYCLRKSNIGGYYSQKVSRSYDKIC  468



>ref|XP_010425372.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=453

 Score =   514 bits (1323),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 271/458 (59%), Positives = 329/458 (72%), Gaps = 34/458 (7%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             I  AA S +SVE RK            H +KK +S +RR+           P G+  P P
Sbjct  18    IVAAAISTISVEGRK------------HHVKKIKSKHRRH-------SKTTPSGSPAPAP  58

Query  1480  -----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
                    +F+ILSFGA GDG+SDDSKAL  AW AACKV+G  V+IP+   F++  +TLQG
Sbjct  59    YPSTHDGLFNILSFGAMGDGISDDSKALVGAWKAACKVAGGKVEIPAGKQFMVKAVTLQG  118

Query  1315  PCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
             PC  D V+Q++G +VAP  +GSWPKS++FQW+NFKWV   TIQG GT +G+G NWW L  
Sbjct  119   PCKDDTVIQIEGTLVAPEKIGSWPKSTLFQWLNFKWVSHVTIQGSGTLNGRGSNWWNLET  178

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               +   K         MKPTALRFY S NVT+  ISIVNSP CHLKFD+S GV V+NITI
Sbjct  179   YQTQSRKYIPP-----MKPTALRFYASENVTVRDISIVNSPLCHLKFDDSDGVKVNNITI  233

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+PENSPNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHINCGPGHGIS+GG
Sbjct  234   SSPENSPNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHINCGPGHGISIGG  293

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKDKSVACVS+I+VE++ ++NTL G RIKTWQGG+G VKN++FS IQV+DVKVPI+IDQ
Sbjct  294   LGKDKSVACVSDIIVEDISIQNTLAGVRIKTWQGGLGVVKNLTFSNIQVTDVKVPIVIDQ  353

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYCDK  CKNQT AV+I GVK+  IVG+F  QP  +ACSN+VPC  V L DI+L PS G 
Sbjct  354   YYCDKSTCKNQTRAVSISGVKYNNIVGSFTVQPVRIACSNNVPCMGVDLMDIRLRPSGGI  413

Query  415   RGFRNGQ-----CWNSYGKSQGQLFPASMDYCLRSGSL  317
             RG +  Q     CWNSYGK+QG L P+S+ YCLR  ++
Sbjct  414   RGLQTHQQQQALCWNSYGKTQGPLVPSSIGYCLRKSNI  451



>gb|KFK33587.1| hypothetical protein AALP_AA5G033100 [Arabis alpina]
Length=472

 Score =   509 bits (1310),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 335/475 (71%), Gaps = 37/475 (8%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             +  A  S +SVE RK            H +KK +  + R+           P G+  P P
Sbjct  19    VAVAMISTISVEGRK------------HHVKKFKPKHPRH-------SKNTPIGSPAPAP  59

Query  1480  -----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
                    +FDI SFGAKGDGVSDDSKAL  AW AACKV+G  V+IP    FL+ P+TLQG
Sbjct  60    YPSTDEGIFDIRSFGAKGDGVSDDSKALVGAWKAACKVAGGKVEIPVGKEFLVKPVTLQG  119

Query  1315  PCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
             PC  ++V+Q++G ++AP  +GSWPKSS+FQW+NFKWV   TIQG GT DG+G NWW L  
Sbjct  120   PCKGEIVIQIEGTLLAPEKIGSWPKSSLFQWLNFKWVSHITIQGSGTLDGRGSNWWNLD-  178

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               + Q +K +K I   MKPTALRFY S NVT+  ISIVNSP CHLKFDNS GV V+NITI
Sbjct  179   --TYQTQKKNKYIP-PMKPTALRFYASDNVTVRDISIVNSPLCHLKFDNSDGVKVNNITI  235

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P NSPNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHINCGPGHGIS+G 
Sbjct  236   SSPANSPNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHINCGPGHGISIGS  295

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKDKSVACVS+I+VE++ ++NTL G RIKTWQGG+G VKN++FS IQV+DV+VPI IDQ
Sbjct  296   LGKDKSVACVSDIIVEDISIQNTLAGVRIKTWQGGLGVVKNLTFSNIQVTDVQVPIEIDQ  355

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYCDK  CKNQT AV+I GV +  IVG+F  QP  +ACSN+VPC  V L DI+L+PS G 
Sbjct  356   YYCDKSKCKNQTRAVSISGVTYNNIVGSFTVQPIRIACSNNVPCMGVELMDIRLKPSGGI  415

Query  415   RGFRNGQ-----CWNSYGKSQGQLFPASMDYCLR----SGSLLVKRIARSHENIC  278
             RG +  Q     CWNSYGK+QG L P+S+ YCL+    +G    + I  SH+  C
Sbjct  416   RGLQTHQQQQALCWNSYGKTQGPLVPSSIGYCLKKSNINGYYPKRFITSSHDKTC  470



>emb|CDX83631.1| BnaC07g23710D [Brassica napus]
Length=471

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 271/469 (58%), Positives = 336/469 (72%), Gaps = 37/469 (8%)
 Frame = -3

Query  1642  SMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP-----S  1478
             S +SVE RK            H +K+ +  +RR+           P G+  P P      
Sbjct  24    STISVEGRK------------HHVKRIKPKHRRH-------SKDTPTGSPAPAPYPSTHD  64

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
              VFDILSFGAKGDG+SDDSKAL  AW AAC+V+G  V+IP+   F++  +TLQGPC  + 
Sbjct  65    GVFDILSFGAKGDGISDDSKALIGAWKAACRVAGGKVEIPAGKEFMVKAVTLQGPCKEET  124

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             V+Q++G +VAP  +GSWPKSS+FQW+NFKWV   TIQG GT D +G NWW L    + Q 
Sbjct  125   VVQIEGTLVAPTKIGSWPKSSLFQWLNFKWVSHVTIQGSGTLDARGYNWWNLD---NYQT  181

Query  1117  KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENS  938
             +K +K I   MKPTALRFY S NV +  ISIVNSP CHLKFD+S GV ++NITIS+PENS
Sbjct  182   QKRNKYIP-PMKPTALRFYSSGNVMVRDISIVNSPLCHLKFDDSDGVKINNITISSPENS  240

Query  937   PNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKS  758
             PNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHI+CGPGHGIS+G LGKD++
Sbjct  241   PNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHISCGPGHGISIGSLGKDET  300

Query  757   VACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKH  578
             VACVS+I+VE++ ++NTL G RIKTWQGG+G VKN++FS IQV+DV+VPI+IDQYYCDK 
Sbjct  301   VACVSDIIVEDISIQNTLAGVRIKTWQGGLGVVKNLTFSNIQVTDVQVPIVIDQYYCDKS  360

Query  577   ACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNG  398
              CKNQT AV+I  VK+  IVG+F AQP  +ACSN+VPC DV L DI+L PS G RG +  
Sbjct  361   KCKNQTSAVSISDVKYNNIVGSFTAQPVRIACSNNVPCMDVDLMDIRLRPSGGIRGLQTH  420

Query  397   Q-----CWNSYGKSQGQLFPASMDYCLR----SGSLLVKRIARSHENIC  278
             Q     CWNSYGK+QG L P+S+ YCL+     G    + IA SHE +C
Sbjct  421   QQQHALCWNSYGKTQGPLVPSSIGYCLKKSNIDGYYPKRFIASSHEKLC  469



>ref|XP_009152042.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
Length=470

 Score =   507 bits (1305),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 271/469 (58%), Positives = 331/469 (71%), Gaps = 38/469 (8%)
 Frame = -3

Query  1642  SMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP-----S  1478
             S +SVE RK            H +K+ +  +RR+           P G+  P P      
Sbjct  24    STISVEGRK------------HHVKRIKPKHRRH-------SRDTPTGSPAPAPYPSTHD  64

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
              VFDILSFGAKGDG+SDDSKAL  AW AACKV G  V+IP+   F++  +TLQGPC  + 
Sbjct  65    GVFDILSFGAKGDGISDDSKALIGAWKAACKVVGGKVEIPAGKEFMVKAVTLQGPCKEET  124

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             V+Q++G +VAP   GSWPKSS+FQW+NFKWV   TIQG GT D +G NWW L    + + 
Sbjct  125   VVQIEGTLVAPTKTGSWPKSSLFQWLNFKWVSHVTIQGSGTLDARGYNWWNLDNYQTQKN  184

Query  1117  KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENS  938
             K         MKPTALRFY S NVT+  ISIVNSP CHLKFD+S GV ++NITIS+PENS
Sbjct  185   KYIPP-----MKPTALRFYSSGNVTVRDISIVNSPLCHLKFDDSDGVKINNITISSPENS  239

Query  937   PNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKS  758
             PNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHI+CGPGHGIS+G LGKD++
Sbjct  240   PNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHISCGPGHGISIGSLGKDET  299

Query  757   VACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKH  578
             VACVS+I+VE+V ++NTL G RIKTWQGG+G VKN++FS IQV+DV+VPI+IDQYYCDK 
Sbjct  300   VACVSDIIVEDVSIQNTLAGVRIKTWQGGLGVVKNLTFSNIQVTDVQVPIVIDQYYCDKS  359

Query  577   ACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNG  398
              CKNQT AV+I  VK+  IVG+F AQP  +ACSN+VPC DV L DI+L PS G RG +  
Sbjct  360   KCKNQTSAVSISDVKYNNIVGSFTAQPVRIACSNNVPCMDVDLMDIRLRPSGGIRGLQTH  419

Query  397   Q-----CWNSYGKSQGQLFPASMDYCLR----SGSLLVKRIARSHENIC  278
             Q     CWNSYGK+QG L P+S+ YCL+     G    + IA SHE +C
Sbjct  420   QQQHALCWNSYGKTQGPLVPSSIGYCLKKSNIDGYYPKRFIASSHEKLC  468



>emb|CDY13645.1| BnaA06g32780D [Brassica napus]
Length=470

 Score =   505 bits (1301),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 270/469 (58%), Positives = 331/469 (71%), Gaps = 38/469 (8%)
 Frame = -3

Query  1642  SMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP-----S  1478
             S +SVE RK            H +K+ +  +RR+           P G+  P P      
Sbjct  24    STISVEGRK------------HHVKRIKPKHRRH-------SRDTPTGSPAPTPYPSTHD  64

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
              VFDILSFGAKGDG+SDDSKAL  AW AACKV G  V+IP+   F++  +TLQGPC  + 
Sbjct  65    GVFDILSFGAKGDGISDDSKALIGAWKAACKVVGGKVEIPAGKEFMVKAVTLQGPCKEET  124

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             V+Q++G +VAP   GSWPKSS+FQW+NFKWV   TIQG GT D +G NWW L    + + 
Sbjct  125   VVQIEGTLVAPTKTGSWPKSSLFQWLNFKWVSHVTIQGSGTLDARGYNWWNLDNYQTQKN  184

Query  1117  KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENS  938
             K         MKPTALRFY S NVT+  ISIVNSP CHLKFD+S GV ++NITIS+P+NS
Sbjct  185   KYIPP-----MKPTALRFYSSGNVTVRDISIVNSPLCHLKFDDSDGVKINNITISSPQNS  239

Query  937   PNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKS  758
             PNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHI+CGPGHGIS+G LGKD++
Sbjct  240   PNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHISCGPGHGISIGSLGKDET  299

Query  757   VACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKH  578
             VACVS+I+VE+V ++NTL G RIKTWQGG+G VKN++FS IQV+DV+VPI+IDQYYCDK 
Sbjct  300   VACVSDIIVEDVSIQNTLAGVRIKTWQGGLGVVKNLTFSNIQVTDVQVPIVIDQYYCDKS  359

Query  577   ACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNG  398
              CKNQT AV+I  VK+  IVG+F AQP  +ACSN+VPC DV L DI+L PS G RG +  
Sbjct  360   KCKNQTSAVSISDVKYNNIVGSFTAQPVRIACSNNVPCMDVDLMDIRLRPSGGIRGLQTH  419

Query  397   Q-----CWNSYGKSQGQLFPASMDYCLR----SGSLLVKRIARSHENIC  278
             Q     CWNSYGK+QG L P+S+ YCL+     G    + IA SHE +C
Sbjct  420   QQQHALCWNSYGKTQGPLVPSSIGYCLKKSNIDGYYPKRFIASSHEKLC  468



>ref|XP_007224576.1| hypothetical protein PRUPE_ppa1027214mg [Prunus persica]
 gb|EMJ25775.1| hypothetical protein PRUPE_ppa1027214mg [Prunus persica]
Length=470

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 335/460 (73%), Gaps = 18/460 (4%)
 Frame = -3

Query  1639  MMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPPSSVFDIL  1460
             + SVEARKN H KK +   PHK  +G+     N            P    P  S++F +L
Sbjct  23    ITSVEARKN-HTKKSK---PHKHHQGKGATSGN-RTHNSHLPGPAPAPPQPQQSTIFPVL  77

Query  1459  SFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLVLQVD  1283
             SFGAKGDGVSDDSKAL AAW AAC+V GATV+IPS F FLI PITL G  CMPDLVLQ+D
Sbjct  78    SFGAKGDGVSDDSKALVAAWEAACRVKGATVEIPSGFKFLIQPITLDGSGCMPDLVLQID  137

Query  1282  GNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASK  1103
             G ++AP    +WP+SS+FQWINFK+  +FTIQG G  DGQG +WW     +S   K++  
Sbjct  138   GTLLAPSKASTWPESSLFQWINFKYARNFTIQGTGIVDGQGSDWW-----NSSAHKRSKH  192

Query  1102  TIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDG  923
             T   + KPTALRFY S++VT+  I I+NSPQCHLKFDNS  + V+NITI++P+ SPNTDG
Sbjct  193   T--PDTKPTALRFYFSSDVTVRNIKIINSPQCHLKFDNSSWIKVNNITITSPDYSPNTDG  250

Query  922   IHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVS  743
             IHLQN+Q+VEIHHSTIG GDDCVSIQTGCSNVH+HH+ CGPGHGISLGGLGK  SVACVS
Sbjct  251   IHLQNTQNVEIHHSTIGCGDDCVSIQTGCSNVHIHHVKCGPGHGISLGGLGKAGSVACVS  310

Query  742   NILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD---KHAC  572
             NI+V N++ +NT  G RIKTW GG GSVKNVSFS IQVS+V VPI+IDQ YCD   KH C
Sbjct  311   NIIVNNILFQNTQSGVRIKTWPGGKGSVKNVSFSNIQVSNVGVPIVIDQNYCDNMKKHLC  370

Query  571   KNQT-GAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY-RGFRNG  398
             +NQ  GAVAI GVKF  I+G ++ +P  LACSN  PCTDV L DI+L+P+ G  R  R+ 
Sbjct  371   QNQIRGAVAISGVKFDNIIGNYSKEPIRLACSNDTPCTDVDLIDIRLKPTTGDPRSLRSD  430

Query  397   QCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
              C NSYGKS+  L P+ +DYCLR     VK IARSHE +C
Sbjct  431   LCRNSYGKSKAPLLPSVIDYCLRRDGGQVKHIARSHEKMC  470



>ref|XP_008221862.1| PREDICTED: polygalacturonase At1g48100 [Prunus mume]
Length=470

 Score =   504 bits (1299),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 282/460 (61%), Positives = 334/460 (73%), Gaps = 18/460 (4%)
 Frame = -3

Query  1639  MMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPPSSVFDIL  1460
             + SVEARKN H KK +   PHK  +G+     N            P    P  S+VF IL
Sbjct  23    IASVEARKN-HTKKSK---PHKHHQGKGATSGN-NTHNSHLPGPAPAPPQPQQSTVFPIL  77

Query  1459  SFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLVLQVD  1283
             SFGAKGDGVSDDSKAL AAW AAC+V GATV+IPS F FLI PITL G  CMPDLVLQ+D
Sbjct  78    SFGAKGDGVSDDSKALVAAWEAACRVKGATVEIPSGFKFLIQPITLDGSGCMPDLVLQID  137

Query  1282  GNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASK  1103
             G ++AP    +WP+SS+FQWINFK+  +FTIQG G  DGQG +WW  S  H   E  +  
Sbjct  138   GTLLAPSKASTWPESSLFQWINFKYARNFTIQGTGIVDGQGSDWWN-SSAHKRSEHTS--  194

Query  1102  TIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDG  923
                 + KPTALRFY S++VT+  I I+NSPQCHLKFD+S  + V+NITI++P+ SPNTDG
Sbjct  195   ----DTKPTALRFYCSSDVTVRNIKIINSPQCHLKFDSSSWIKVNNITITSPDYSPNTDG  250

Query  922   IHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVS  743
             IHLQN+Q+VEIHHSTIG GDDCVSIQTGCSNVH+HHI CGPGHGISLGGLGK +S+ACVS
Sbjct  251   IHLQNTQNVEIHHSTIGCGDDCVSIQTGCSNVHIHHIKCGPGHGISLGGLGKAESLACVS  310

Query  742   NILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD---KHAC  572
             NI+V N++ +NT  G RIKTW GG GSVKNVSFS IQVS+V VPI+IDQ YCD   KH C
Sbjct  311   NIIVNNILFQNTQSGVRIKTWPGGKGSVKNVSFSNIQVSNVGVPIVIDQNYCDNMKKHLC  370

Query  571   KNQT-GAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY-RGFRNG  398
             +NQT GAVAI GVK+  I+G ++ +P  LACSN  PCTDV L DIQL+P+ G  R  R+ 
Sbjct  371   QNQTRGAVAISGVKYDNIIGNYSKEPIRLACSNDTPCTDVDLIDIQLKPTTGDPRSLRSD  430

Query  397   QCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
              C NSYGKS+  L P+ +DYCLR     VK IARS E +C
Sbjct  431   LCRNSYGKSKAPLLPSVIDYCLRRDGGQVKHIARSLEKMC  470



>ref|XP_010924245.1| PREDICTED: polygalacturonase At1g48100 [Elaeis guineensis]
Length=457

 Score =   490 bits (1262),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 250/461 (54%), Positives = 328/461 (71%), Gaps = 20/461 (4%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             +    F M+S       H K+ R       K GR D+  +    +   +    G  Y P 
Sbjct  17    VLSNTFPMLSAVTS---HRKQSRVHKHEGSKDGRHDHDFDHFNSSSTSSAHHNG-FYKPH  72

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
             S +FD++SFGA GDG+SDDSKAL++AW AAC + GATV+IPS+F FLI P+TLQGPCMP 
Sbjct  73    SKIFDVISFGAMGDGISDDSKALKSAWKAACLIPGATVKIPSEFRFLIRPVTLQGPCMPH  132

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             L LQ+DG+++AP  V +WPKS++FQW+N KW++ FTIQG GTFDGQG  +W  SQ    Q
Sbjct  133   LNLQIDGDIIAPTGVAAWPKSNLFQWMNLKWLNDFTIQGRGTFDGQGSTFWNFSQSRHTQ  192

Query  1120  EKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
                            A+RFY+S NVT+ G+ I+NSPQCHLKFD+S+G+ V NITIS+PE+
Sbjct  193   ---------------AVRFYKSYNVTVRGVQIINSPQCHLKFDSSQGIKVKNITISSPED  237

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQN+ DVEI HS IG GDDCVSIQTGCSN+H+HHINC PGHGIS+GGLGK  
Sbjct  238   SPNTDGIHLQNTHDVEIKHSNIGCGDDCVSIQTGCSNIHIHHINCSPGHGISIGGLGKGN  297

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             S+ACVSN+ V+++ ++N L G RIKTWQGG+GSV+NV FS ++VS+V++P++IDQYYC+K
Sbjct  298   SLACVSNVTVDSINVQNALSGVRIKTWQGGLGSVRNVIFSDVRVSNVEIPVVIDQYYCNK  357

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRN  401
              ACKN+T AVA+ GV + +I GT++ QP HLACS+S PCT + L DI+L P    +  ++
Sbjct  358   KACKNKTDAVAVSGVMYKRITGTYSYQPMHLACSDSSPCTGIKLTDIRLSPVNASQFQQD  417

Query  400   GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
               CW SYG+SQG L P S+  CL+  S  +K + +S  + C
Sbjct  418   AFCWKSYGESQGPLEPLSIG-CLQRTSRSIKPLIKSSNHTC  457



>gb|KGN51783.1| hypothetical protein Csa_5G599870 [Cucumis sativus]
Length=338

 Score =   478 bits (1229),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 242/344 (70%), Positives = 279/344 (81%), Gaps = 7/344 (2%)
 Frame = -3

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
             M   VLQ+DG V+AP  V SWPKSS+FQW+NFKW+H+FTIQG GT +GQG NWW      
Sbjct  1     MAQFVLQIDGAVLAPPKVSSWPKSSLFQWLNFKWLHNFTIQGSGTVNGQGFNWW------  54

Query  1129  SLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
             +L  KK  K I  +MKPTALRFY S NVT+  I+I+NSPQCHLKFDNS  V + NITIS+
Sbjct  55    TLNNKKKLKHIS-DMKPTALRFYSSYNVTVRDITIINSPQCHLKFDNSGTVKIDNITISS  113

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             PENSPNTDGIHLQN++DVEI HS IG GDDCVSIQTGCSN+H+HHINCGPGHGISLGGLG
Sbjct  114   PENSPNTDGIHLQNTRDVEIQHSNIGCGDDCVSIQTGCSNIHIHHINCGPGHGISLGGLG  173

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             KDKS ACVSNI+VEN+ ++NTL G RIKTWQGG+GSVKNVSFS IQVSDVKVPIMIDQYY
Sbjct  174   KDKSAACVSNIVVENISIQNTLSGVRIKTWQGGIGSVKNVSFSNIQVSDVKVPIMIDQYY  233

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CDK  CKNQTGAVAI G+ + QI+G+++ QP HLACS+ +PC DV L DIQL+PS   RG
Sbjct  234   CDKSKCKNQTGAVAISGITYDQIIGSYSVQPIHLACSSQIPCVDVDLIDIQLKPSSESRG  293

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             F+N  CWNSYGKSQ  L P S+D CLR G   V+RIARSH+ +C
Sbjct  294   FQNSICWNSYGKSQAPLLPTSIDSCLRRGGGAVRRIARSHDYVC  337



>gb|KDO82321.1| hypothetical protein CISIN_1g046362mg, partial [Citrus sinensis]
Length=334

 Score =   466 bits (1199),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 242/337 (72%), Positives = 278/337 (82%), Gaps = 3/337 (1%)
 Frame = -3

Query  1288  VDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKA  1109
             +DG ++AP  VGSWPKSS+FQWINFKW+H+FTIQG G  DGQG  WW  SQ +S+Q+K  
Sbjct  1     IDGTLLAPPKVGSWPKSSLFQWINFKWLHNFTIQGNGIVDGQGFEWWGGSQSNSIQKK--  58

Query  1108  SKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNT  929
             SK I   MKPTALRFY S NVT+  I I NSP CHLKFD+S G+ V NI IS+PENSPNT
Sbjct  59    SKHI-PEMKPTALRFYASYNVTVRDIKINNSPLCHLKFDSSGGIKVKNIHISSPENSPNT  117

Query  928   DGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVAC  749
             DGIHLQN++DVEI HS I  GDDCVSIQTGCSNVH+HHI+CGPGHGISLGGLGKDKSVAC
Sbjct  118   DGIHLQNTKDVEIQHSDIACGDDCVSIQTGCSNVHIHHISCGPGHGISLGGLGKDKSVAC  177

Query  748   VSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACK  569
             VS+I+VE + ++NTL G RIKTWQGG+GSVKNVSFS IQV DVKVPI+IDQYYCDKH C 
Sbjct  178   VSDIVVEKISLQNTLAGVRIKTWQGGIGSVKNVSFSSIQVWDVKVPIIIDQYYCDKHLCN  237

Query  568   NQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCW  389
             NQTGAVAI GV+F QI+GT++ QP HLACSNSVPC+DV L DIQL+PS  Y+ F+   CW
Sbjct  238   NQTGAVAISGVEFNQIIGTYSVQPIHLACSNSVPCSDVDLIDIQLKPSSKYQSFQQALCW  297

Query  388   NSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             NSYGKSQ  L P+S+DYCLR  S  VKRIARSHE++C
Sbjct  298   NSYGKSQAPLVPSSIDYCLRRDSGSVKRIARSHEHMC  334



>ref|XP_008361805.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=466

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 275/472 (58%), Positives = 328/472 (69%), Gaps = 40/472 (8%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPPP  1481
             I C  F  +S++AR   H KK +    H   KG S ++ +FP PAPAP            
Sbjct  16    IVCVTFFTVSIDAR-THHNKKSKPHNEHHEGKGGS-HKSHFPGPAPAPLPPSGSR-----  68

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
              + F +LSFGAKGDGVSDDSKAL AAW AAC+V GATV+IPS F FL++PITL+G CMPD
Sbjct  69    -TTFPVLSFGAKGDGVSDDSKALLAAWKAACRVKGATVEIPSGFKFLVHPITLEGACMPD  127

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             LVLQ+DG ++AP  VGSWP S + QWIN K+VH+FTIQG G+ DGQG +WW         
Sbjct  128   LVLQIDGTLLAPSKVGSWPDSGLLQWINLKYVHNFTIQGTGSVDGQGFDWW---------  178

Query  1120  EKKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                 SK+ HV   KPTALRFY   +VT+  I I+NSPQCHLKFDNS  + V NITI++PE
Sbjct  179   ----SKSNHVPKSKPTALRFYSGFDVTVRDIKILNSPQCHLKFDNSASIKVDNITITSPE  234

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             NSPNTDGIHLQN+++VEI HSTIG GDDCVSIQTGC NVHVHHI CGPGHGISLGGLG +
Sbjct  235   NSPNTDGIHLQNTKNVEIQHSTIGCGDDCVSIQTGCDNVHVHHIKCGPGHGISLGGLGGN  294

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
             +S ACVSNI+V ++   NT  G RIKTW GG GSVKNVSFS I+VS+V  PI+IDQ YCD
Sbjct  295   QSTACVSNIIVNDISFNNTQLGVRIKTWPGGRGSVKNVSFSNIEVSNVGKPIVIDQNYCD  354

Query  583   KH-----ACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP---  428
                    + KN  GAVAI GVK+ +I G +  QP  L CS+  PCTDV + DIQL+P   
Sbjct  355   NKLKKIMSKKNHRGAVAISGVKYERITGNYTQQPILLNCSSDTPCTDVDIIDIQLKPISE  414

Query  427   ----SPGYRGFRNGQCWNSYGKSQGQLFPASMDYCL-RSGSLLVKRIARSHE  287
                 SPG        C NSYGK++  L P+S+DYCL R GS L+K IA+SHE
Sbjct  415   KLSSSPGLD-----WCQNSYGKTKAPLVPSSIDYCLGRDGSPLLKNIAKSHE  461



>emb|CAN63436.1| hypothetical protein VITISV_021123 [Vitis vinifera]
Length=418

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 232/294 (79%), Positives = 256/294 (87%), Gaps = 3/294 (1%)
 Frame = -3

Query  1420  KALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPK  1241
             +AL AAWGAACKV GAT++IPS+F FLI PITLQGPCMP LVLQ+DG ++AP  V SWPK
Sbjct  54    QALLAAWGAACKVPGATLEIPSEFKFLIEPITLQGPCMPRLVLQIDGTLLAPPKVASWPK  113

Query  1240  SSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFY  1061
             SS+FQWINFKW+H+FTIQG GT DGQG NWW LSQIH +Q  K SK I  NMKPTALRFY
Sbjct  114   SSLFQWINFKWLHNFTIQGTGTVDGQGSNWWSLSQIHYIQ--KRSKDIP-NMKPTALRFY  170

Query  1060  ESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHS  881
              S +VT+  I I+NSPQCHLKFDNS  VNV NITIS+PENSPNTDGIHLQN+QDVEI HS
Sbjct  171   ASYDVTVCNIRIINSPQCHLKFDNSGRVNVTNITISSPENSPNTDGIHLQNTQDVEIQHS  230

Query  880   TIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLY  701
              IG GDDCVSIQTGCSNVHVHHINCGPGHGISLGGLGK+KS ACVSN++V+N+ ++N LY
Sbjct  231   NIGCGDDCVSIQTGCSNVHVHHINCGPGHGISLGGLGKEKSAACVSNLVVDNISVQNALY  290

Query  700   GARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQG  539
             G RIKTWQGG+GSVKNVSFS IQVSDVKVPIMIDQYYCDKH CKNQTGAVAI G
Sbjct  291   GVRIKTWQGGIGSVKNVSFSNIQVSDVKVPIMIDQYYCDKHICKNQTGAVAISG  344



>ref|XP_002270821.2| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Vitis 
vinifera]
Length=469

 Score =   450 bits (1157),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 298/405 (74%), Gaps = 5/405 (1%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             Y P S +FD+ SFGA+GDGVSDDSKA +  W AAC V  AT++IPS+F  LI+PITLQGP
Sbjct  63    YQPYSPIFDVPSFGARGDGVSDDSKAFQVTWSAACAVKNATIKIPSKFRLLISPITLQGP  122

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-Q  1136
             C P LVLQ+DG +VAP     W K  + QWINFK +H F IQG GT +GQG  WW ++ +
Sbjct  123   CEPGLVLQIDGMIVAPGGPRMWLKPELLQWINFKNLHDFVIQGRGTINGQGSAWWWITPR  182

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
             I   Q    +      MKPTA+RFY S N+TI  I I NSP+CHLKFDN  GV V N++I
Sbjct  183   ILQNQLTNRNSRYDDTMKPTAVRFYSSLNLTIRDIQIQNSPRCHLKFDNCAGVKVTNLSI  242

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P +SPNTDGIHLQNSQ VE+ +STI  GDDC+SIQTGCS+V++ +I CGPGHGIS+GG
Sbjct  243   SSPGDSPNTDGIHLQNSQRVEVENSTISCGDDCISIQTGCSDVNIQNIKCGPGHGISIGG  302

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKD ++ACVSNI+V+N +M +TLYG RIKTWQGGVGSVK+V F  I+VS+VKVPIMIDQ
Sbjct  303   LGKDGTLACVSNIVVQNSIMVDTLYGIRIKTWQGGVGSVKSVIFLDIEVSNVKVPIMIDQ  362

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             +YC+   C+N+T AV++  + + QI GT+A Q  HLACS+S+PCT++ + ++ L PS   
Sbjct  363   FYCEGGTCRNKTDAVSLTNITYNQINGTYATQAIHLACSDSIPCTNISMGNVLLTPSTTT  422

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIA---RSH  290
             +G     CWNSYGKS   +FP S++ CL +G+ L K+ +   R+H
Sbjct  423   KGLMQDLCWNSYGKSLATVFPPSLN-CLETGNPLSKKASNFNRTH  466



>ref|XP_006840430.1| hypothetical protein AMTR_s00045p00161910 [Amborella trichopoda]
 gb|ERN02105.1| hypothetical protein AMTR_s00045p00161910 [Amborella trichopoda]
Length=476

 Score =   447 bits (1149),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 224/385 (58%), Positives = 285/385 (74%), Gaps = 3/385 (1%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSK-ALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
             ++ D+LSFGA GDG SDDSK A  A W AACKV  A  ++PS+F FLI P+T +GPC P 
Sbjct  77    TILDVLSFGAMGDGTSDDSKVAFLATWAAACKVESAIFEVPSEFRFLIGPLTFRGPCEPG  136

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             LVL++DG +VAP N+  WP+S +F WINFK++ +F + G G+ DGQG  WW +    S Q
Sbjct  137   LVLKIDGTIVAPSNLDDWPESGLFTWINFKFLQNFKVTGTGSIDGQGSAWWDVPLFQSNQ  196

Query  1120  EKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
                 S T +  MKPTA+RFYES N++I  I+I NSP  HLKFDN  GV V N+T+S+P N
Sbjct  197   SVGNS-TNNPKMKPTAVRFYESFNLSIGDITIENSPSIHLKFDNCGGVLVTNLTVSSPGN  255

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQNSQDVE+ +S+I  GDDC+SIQTGCSNV +H + CGPGHGIS+G LGKD 
Sbjct  256   SPNTDGIHLQNSQDVEVEYSSIACGDDCISIQTGCSNVCIHDVQCGPGHGISIGALGKDN  315

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             S+ACVSNI V+N+ +++T YGARIKTWQGG+GSV++V FS IQV++VKVPI IDQ+YCDK
Sbjct  316   SLACVSNITVQNITLQDTAYGARIKTWQGGLGSVESVFFSDIQVTNVKVPITIDQFYCDK  375

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRN  401
               C NQT AV++  V F +I GTF +Q  HLACS+S PC D+ + ++ L PS G R  + 
Sbjct  376   RVCHNQTDAVSVANVGFNRISGTFTSQAIHLACSDSTPCIDISIGEVNLAPSAGVRKIKP  435

Query  400   GQCWNSYGKSQGQLFPASMDYCLRS  326
               CWNSYG+ Q  +FP S+D CL +
Sbjct  436   TLCWNSYGEMQAPVFPTSID-CLET  459



>ref|XP_008792872.1| PREDICTED: polygalacturonase At1g48100 [Phoenix dactylifera]
Length=407

 Score =   442 bits (1138),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 221/381 (58%), Positives = 286/381 (75%), Gaps = 16/381 (4%)
 Frame = -3

Query  1420  KALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPK  1241
             +AL++AW AAC + GATV++PS+F FLI P TLQGPC P L LQ+DG+++AP  V +WPK
Sbjct  43    QALKSAWKAACLIPGATVKLPSEFRFLIKPATLQGPCKPHLTLQIDGDIIAPSGVAAWPK  102

Query  1240  SSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFY  1061
             S++FQW+N KW++ FTIQG GTFDGQG  +W  SQ    Q                +RFY
Sbjct  103   SNLFQWVNLKWLNDFTIQGSGTFDGQGFTFWNFSQSRHTQ---------------VVRFY  147

Query  1060  ESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHS  881
             +S NVT+ GI I+NSPQCHLKFD+S+G+ V NITIS+P+NSPNTDGIHLQN+QDVEI HS
Sbjct  148   KSYNVTVRGIQIINSPQCHLKFDSSQGITVKNITISSPKNSPNTDGIHLQNTQDVEIKHS  207

Query  880   TIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLY  701
              IG GDDCVSIQTGCSN+ VHHINC PGHGISLGGLGK  S+ACVSN+ V+++ ++N L 
Sbjct  208   NIGCGDDCVSIQTGCSNIRVHHINCNPGHGISLGGLGKGNSLACVSNVTVDSINVQNALS  267

Query  700   GARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQI  521
             G RIKTWQGG+GS +NV+FS ++VS+V++P++IDQYYC+K ACKN+T AVA+ GV + +I
Sbjct  268   GVRIKTWQGGLGSARNVTFSNVRVSNVEIPVVIDQYYCNKRACKNKTNAVAVSGVMYKRI  327

Query  520   VGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMD  341
              GT++ QP HLACS+S PCT + L DI+L P    +  +   CW SYG+SQG L P S+ 
Sbjct  328   TGTYSYQPMHLACSDSSPCTGIKLTDIRLSPVNVSQVRQEAFCWKSYGESQGTLEPLSIG  387

Query  340   YCLRSGSLLVKRIARSHENIC  278
              CL+  S  +K + +S  + C
Sbjct  388   -CLQRSSRPIKALIKSSNHTC  407



>emb|CAA66407.1| polygalacturonase precursor homologue [Arabidopsis thaliana]
Length=328

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 262/331 (79%), Gaps = 4/331 (1%)
 Frame = -3

Query  1417  ALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKS  1238
             AL  AW AACKV G  V+IP+   FL+  +TLQGPC  + V+Q++G +VAP  +GSWP S
Sbjct  1     ALVGAWKAACKVVGGKVEIPAGTQFLVKAVTLQGPCKEETVVQIEGILVAPEKIGSWPNS  60

Query  1237  SIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYE  1058
             S+FQW+NFKWV   TIQG GT +G+G NWW L    + Q +  +K I   MKPTALRFY 
Sbjct  61    SLFQWLNFKWVSHLTIQGSGTLNGRGYNWWNLD---TYQTQTRNKYIP-PMKPTALRFYS  116

Query  1057  STNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHST  878
             S NVT+  ISIVNSP CHLKFD+S GV V+NITIS+PENSPNTDGIHLQN+++VEI HS 
Sbjct  117   SNNVTVRDISIVNSPLCHLKFDDSDGVKVNNITISSPENSPNTDGIHLQNTRNVEIQHSN  176

Query  877   IGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYG  698
             I  GDDCVSIQTG SNVH+HHINCGPGHGIS+GGLGKDKSVACVS+I+VE++ ++NTL G
Sbjct  177   IACGDDCVSIQTGSSNVHIHHINCGPGHGISIGGLGKDKSVACVSDIIVEDISIQNTLAG  236

Query  697   ARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIV  518
              RIKTWQGG+G VKN++FS IQV DVKVPI+IDQYYCDK  CKNQT AV+I GVK+  IV
Sbjct  237   VRIKTWQGGLGVVKNLTFSNIQVKDVKVPIVIDQYYCDKSKCKNQTRAVSISGVKYNNIV  296

Query  517   GTFAAQPFHLACSNSVPCTDVHLADIQLEPS  425
             G+F  QP  +ACSN+VPC DV L DI+L PS
Sbjct  297   GSFTVQPVRIACSNNVPCMDVDLMDIRLRPS  327



>ref|XP_009403999.1| PREDICTED: polygalacturonase At1g48100 [Musa acuminata subsp. 
malaccensis]
Length=463

 Score =   427 bits (1097),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 238/405 (59%), Positives = 304/405 (75%), Gaps = 7/405 (2%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             Y P S  F+IL FGA GDGV+DDSKA +AAW AAC V  AT+++PS+F FL+ PITLQGP
Sbjct  64    YMPHSKKFNILFFGATGDGVADDSKAFKAAWKAACLVPRATIELPSEFKFLVRPITLQGP  123

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI  1133
             CMP LVLQ+DG +VAP +V    KS+++QWIN KW+H FTIQG GT DGQG   W +S+ 
Sbjct  124   CMPHLVLQIDGTLVAPSSVA---KSNLYQWINIKWLHDFTIQGSGTVDGQGFVLWNISES  180

Query  1132  HSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
             H ++++    +   +M+PT +R Y+  NVT+  I I+NSP CHLKFD+S+GV V NITIS
Sbjct  181   HHIEKETKYGS---SMRPTVIRLYKCYNVTVRNIRIINSPLCHLKFDSSQGVKVKNITIS  237

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +P++SPNTDGIHLQN++DVEI HS IG GDDCVSIQ GCSNVH+HH+ C PGHGIS+GGL
Sbjct  238   SPKDSPNTDGIHLQNTRDVEIKHSDIGCGDDCVSIQAGCSNVHIHHLRCSPGHGISVGGL  297

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             GK  S+ACVSNI V +V ++N L G RIKTWQGGVGSV+NVSFS +QV DV VPI+IDQY
Sbjct  298   GKGSSLACVSNISVNSVTVQNALSGVRIKTWQGGVGSVRNVSFSNVQVVDVDVPIVIDQY  357

Query  592   YCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYR  413
             YC++ +C+N+T AVAI  V + +I GT+  QP +LACS+ +PCT V L DI+L P+   +
Sbjct  358   YCNRRSCRNRTDAVAISEVTYKKISGTYRFQPMNLACSDGMPCTGVALRDIELSPANETQ  417

Query  412   GFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
               R   CW SYG+SQG L P S+  CL+  + L+K   +SH + C
Sbjct  418   VPREAFCWKSYGESQGLLHPLSLG-CLQRPTRLMKAQMKSHNDTC  461



>gb|KEH20046.1| polygalacturonase plant-like protein [Medicago truncatula]
Length=521

 Score =   409 bits (1050),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 218/429 (51%), Positives = 288/429 (67%), Gaps = 31/429 (7%)
 Frame = -3

Query  1489  PPP-------SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINP  1331
             PPP       S+ F++L FGAKGDG SDD+KA EA WGAACKV  +T+ IP+ ++F + P
Sbjct  94    PPPQTYIGGSSTTFNVLDFGAKGDGRSDDTKAFEATWGAACKVEASTMLIPADYTFYVGP  153

Query  1330  ITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPN  1154
             I   GP C P ++ QVDG ++AP N  +W +  + QW++F  +  FTIQG G FDG+G  
Sbjct  154   IVFSGPYCKPRIIFQVDGTIIAPTNSNAWGRG-LLQWLDFTKLVGFTIQGNGIFDGRGSV  212

Query  1153  WWKLSQIHSLQEKKASKTIHVN--------------------MKPTALRFYESTNVTIHG  1034
             WW+ +Q +   + +    + +N                    +KPTA+RFY S N T+ G
Sbjct  213   WWQDTQYNDPLDDEEKLLVPLNNTIVSPPMQIESSLGGKMPSIKPTAIRFYGSINPTVTG  272

Query  1033  ISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCV  854
             I+I NSPQCHLKFDN  GV VH++TIS+P +SPNTDGIHLQNS+DV I+ ST+  GDDC+
Sbjct  273   ITIQNSPQCHLKFDNCNGVLVHDVTISSPGDSPNTDGIHLQNSRDVLIYKSTMACGDDCI  332

Query  853   SIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQG  674
             SIQTGCSNV+VH+++CGPGHGIS+GGLGKD + ACVSNI V +V M NT+ G RIKTWQG
Sbjct  333   SIQTGCSNVYVHNVDCGPGHGISIGGLGKDNTRACVSNITVRDVNMHNTMNGVRIKTWQG  392

Query  673   GVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPF  494
             G GSV+ V FS IQVS V+VPI+IDQ+YCDK  CKNQT AVA+ G+ +  I GT+  +P 
Sbjct  393   GSGSVQGVLFSNIQVSQVQVPIIIDQFYCDKRNCKNQTAAVALTGINYEGIKGTYTVKPV  452

Query  493   HLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLL  314
             H ACS+S+PC DV L  ++L+P        +  CW +YG+ +    P  +D CL+ G   
Sbjct  453   HFACSDSLPCIDVSLTSVELQPVQDKYHLYDPFCWETYGELKTATVPP-ID-CLQIGKPP  510

Query  313   VKRIARSHE  287
               RI  +H+
Sbjct  511   NNRIQTAHD  519



>ref|XP_008657773.1| PREDICTED: polygalacturonase At1g48100 [Zea mays]
Length=427

 Score =   404 bits (1037),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 213/390 (55%), Positives = 279/390 (72%), Gaps = 10/390 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQI-PSQFSFLINPITLQGPCMPD  1301
             +   +LSFGA G+GV+DD++AL AAW  AC+V  ATV + PS   FL++P+TLQGPC   
Sbjct  27    TTLSVLSFGAAGNGVTDDAQALVAAWQVACRVPRATVLVLPSGHRFLLSPVTLQGPCSAK  86

Query  1300  LVLQVDGNVVAPLNVGSWPK-SSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             L LQ+DG V+AP  +GSWPK     QW+NFKW+  F+IQG G  DG        S  ++ 
Sbjct  87    LTLQIDGTVLAPPEMGSWPKPRRPLQWLNFKWLQGFSIQGTGAVDG---GQQSASPANAS  143

Query  1123  QEKKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAP  947
             Q    +   H   +KPT +RFY S NV++  I I NSPQCHLKFD+S G+ V N+TIS+P
Sbjct  144   QTSTGTGHWHSPGVKPTLIRFYNSFNVSVRNIRISNSPQCHLKFDSSGGIRVKNVTISSP  203

Query  946   ENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGK  767
              +SPNTDGIHLQN++DVEI  STIG GDDCVSIQTGCSNVH+ ++ C PGHGISLGGLGK
Sbjct  204   GDSPNTDGIHLQNTKDVEIRSSTIGCGDDCVSIQTGCSNVHMKNVVCNPGHGISLGGLGK  263

Query  766   DKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYC  587
             D S+ACVS+++ EN+V++N LYG RIKTWQGGVGSV+N++FS ++V++V  PI IDQ+YC
Sbjct  264   DNSLACVSDVVAENIVVQNALYGVRIKTWQGGVGSVRNITFSNVRVANVATPIAIDQFYC  323

Query  586   DKHA--CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYR  413
             D+    C N+TGAVAI GV + ++VGT+  QP  LACS++ PCT V + D++L P+    
Sbjct  324   DRGGARCANRTGAVAIAGVAYRRVVGTYTFQPLRLACSDARPCTGVTMLDVRLSPAAA-G  382

Query  412   GFRNGQCWNSYGKSQGQLF-PASMDYCLRS  326
             G     CWNSYG+++G +  P S+    RS
Sbjct  383   GTVAPLCWNSYGEARGTIIQPLSVGCLQRS  412



>gb|AFW83000.1| hypothetical protein ZEAMMB73_048385 [Zea mays]
Length=436

 Score =   403 bits (1035),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 217/396 (55%), Positives = 281/396 (71%), Gaps = 13/396 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQI-PSQFSFLINPITLQGPCMPD  1301
             +   +LSFGA G+GV+DD++AL AAW  AC+V  ATV + PS   FL++P+TLQGPC   
Sbjct  27    TTLSVLSFGAAGNGVTDDAQALVAAWQVACRVPRATVLVLPSGHRFLLSPVTLQGPCSAK  86

Query  1300  LVLQVDGNVVAPLNVGSWPK-SSIFQWINFKWVHSFTIQGPGTFDGQGPNW-----WKLS  1139
             L LQ+DG V+AP  +GSWPK     QW+NFKW+  F+IQG G  DG   N        LS
Sbjct  87    LTLQIDGTVLAPPEMGSWPKPRRPLQWLNFKWLQGFSIQGTGAVDGGQQNLDLDMKCCLS  146

Query  1138  QIH-SLQEKKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHN  965
               H  LQ    +   H   +KPT +RFY S NV++  I I NSPQCHLKFD+S G+ V N
Sbjct  147   ITHFYLQTSTGTGHWHSPGVKPTLIRFYNSFNVSVRNIRISNSPQCHLKFDSSGGIRVKN  206

Query  964   ITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgis  785
             +TIS+P +SPNTDGIHLQN++DVEI  STIG GDDCVSIQTGCSNVH+ ++ C PGHGIS
Sbjct  207   VTISSPGDSPNTDGIHLQNTKDVEIRSSTIGCGDDCVSIQTGCSNVHMKNVVCNPGHGIS  266

Query  784   lgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIM  605
             LGGLGKD S+ACVS+++ EN+V++N LYG RIKTWQGGVGSV+N++FS ++V++V  PI 
Sbjct  267   LGGLGKDNSLACVSDVVAENIVVQNALYGVRIKTWQGGVGSVRNITFSNVRVANVATPIA  326

Query  604   IDQYYCDKHA--CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLE  431
             IDQ+YCD+    C N+TGAVAI GV + ++VGT+  QP  LACS++ PCT V + D++L 
Sbjct  327   IDQFYCDRGGARCANRTGAVAIAGVAYRRVVGTYTFQPLRLACSDARPCTGVTMLDVRLS  386

Query  430   PSPGYRGFRNGQCWNSYGKSQGQLF-PASMDYCLRS  326
             P+    G     CWNSYG+++G +  P S+    RS
Sbjct  387   PAAA-GGTVAPLCWNSYGEARGTIIQPLSVGCLQRS  421



>ref|XP_007044684.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY00516.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=524

 Score =   402 bits (1033),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 212/432 (49%), Positives = 285/432 (66%), Gaps = 34/432 (8%)
 Frame = -3

Query  1489  PPP---------SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLI  1337
             PPP         S +FD++ FGAKGDG +DD+KA ++AW AACKV  +TV +P++F FL+
Sbjct  94    PPPQKGYGSGQHSDIFDVVDFGAKGDGKTDDTKAFQSAWAAACKVEASTVVVPAEFVFLV  153

Query  1336  NPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQG  1160
              PI+  GP C  ++V Q+DG ++AP +   W +  I QW+ F  +   T+QG G  DG+G
Sbjct  154   GPISFSGPYCQANIVFQLDGTIIAPADSQPWGQG-ILQWLEFSKLRGITVQGKGIIDGRG  212

Query  1159  PNWWKLSQIHSLQEKKASKTIHVN---------------------MKPTALRFYESTNVT  1043
               WW+ +      + +    I +N                     +KPTALRFY S NVT
Sbjct  213   SGWWQDAPYEDPYDDERKLIIPLNSIVQEMPPMPVRNELSGKMPSIKPTALRFYGSFNVT  272

Query  1042  IHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGD  863
             + GI+I NSPQCHLKFDN  GV VH++T+S+P +SPNTDGIHLQNS+DV IH S +  GD
Sbjct  273   VTGITIQNSPQCHLKFDNCMGVVVHDMTVSSPGDSPNTDGIHLQNSKDVLIHGSNLACGD  332

Query  862   DCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKT  683
             DCVSIQTGCSNV++H++NCGPGHGIS+G LGKD + ACVSNI V +++M+NT+ G RIKT
Sbjct  333   DCVSIQTGCSNVYIHNVNCGPGHGISIGSLGKDNTKACVSNITVRDIIMQNTMNGVRIKT  392

Query  682   WQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAA  503
             WQGG GSV+ V FS IQVS+V++PI+IDQYYCDK ACKN+T AVA+ G+ + +I GT+  
Sbjct  393   WQGGSGSVQGVLFSNIQVSEVQLPIVIDQYYCDKRACKNETAAVALSGITYEKIRGTYTV  452

Query  502   QPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             +P HLACS+S+PC  V L+ I+L+P        +  CW S+G+      P     CL+ G
Sbjct  453   KPVHLACSDSLPCIGVTLSAIELKPLQERYHLYDPFCWQSFGELTTPTVPPIS--CLQIG  510

Query  322   SLLVKRIARSHE  287
                  R+   H+
Sbjct  511   KPSNNRVQADHD  522



>ref|XP_010652248.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Vitis 
vinifera]
Length=442

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 211/405 (52%), Positives = 274/405 (68%), Gaps = 32/405 (8%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             Y P S +FD+ SFGA+GDGVSDDSKA +  W AAC V  AT++IPS+F  LI+PITLQGP
Sbjct  63    YQPYSPIFDVPSFGARGDGVSDDSKAFQVTWSAACAVKNATIKIPSKFRLLISPITLQGP  122

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-Q  1136
             C P LVLQ+DG +VAP     W K  + QWINFK +H F IQG GT +GQG  WW ++ +
Sbjct  123   CEPGLVLQIDGMIVAPGGPRMWLKPELLQWINFKNLHDFVIQGRGTINGQGSAWWWITPR  182

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
             I   Q    +      MKPTA+RFY S N+TI  I I NSP+CHLKFDN  GV V N++I
Sbjct  183   ILQNQLTNRNSRYDDTMKPTAVRFYSSLNLTIRDIQIQNSPRCHLKFDNCAGVKVTNLSI  242

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P +SPNTDGIHLQNSQ VE+ +STI  GDDC+SIQTGCS+V++ +I CGPGHGIS+GG
Sbjct  243   SSPGDSPNTDGIHLQNSQRVEVENSTISCGDDCISIQTGCSDVNIQNIKCGPGHGISIGG  302

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKD ++ACVSNI+V+N +M +TLYG RIKTW                           Q
Sbjct  303   LGKDGTLACVSNIVVQNSIMVDTLYGIRIKTW---------------------------Q  335

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             +YC+   C+N+T AV++  + + QI GT+A Q  HLACS+S+PCT++ + ++ L PS   
Sbjct  336   FYCEGGTCRNKTDAVSLTNITYNQINGTYATQAIHLACSDSIPCTNISMGNVLLTPSTTT  395

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIA---RSH  290
             +G     CWNSYGKS   +FP S++ CL +G+ L K+ +   R+H
Sbjct  396   KGLMQDLCWNSYGKSLATVFPPSLN-CLETGNPLSKKASNFNRTH  439



>ref|XP_010925884.1| PREDICTED: polygalacturonase At1g48100-like [Elaeis guineensis]
Length=483

 Score =   396 bits (1017),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 209/400 (52%), Positives = 284/400 (71%), Gaps = 8/400 (2%)
 Frame = -3

Query  1474  VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDL  1298
             +F++L FGAKGDGVSDD+KA EAAW AACKV  +T+ +P++F FL+ PI+  GP C P++
Sbjct  88    MFNVLDFGAKGDGVSDDTKAFEAAWAAACKVEASTMVVPAEFQFLVGPISFSGPFCQPNI  147

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ--IHSL  1124
             V Q+DG ++AP +  +W  S + QW+ F  +   TIQG GT +G+G  WW  S+  +  +
Sbjct  148   VFQLDGTIIAPTSSTAW-GSGLLQWLEFTKLRGITIQGSGTIEGRGSIWWTGSESDVDPI  206

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
               + ++K   +  KPTALRFY S NVT+ GI+I NSPQCHLKFD  + V V N+TIS+P 
Sbjct  207   NARLSAKMPQI--KPTALRFYGSYNVTVTGITIQNSPQCHLKFDYCEAVQVFNMTISSPG  264

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNS DV IHH+ +G GDDC+SIQTGCSNV++H++NCGPGHGIS+GGLGKD
Sbjct  265   DSPNTDGIHLQNSIDVSIHHTDLGCGDDCISIQTGCSNVYIHNVNCGPGHGISIGGLGKD  324

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSNI V +V M NT+ G RIKTWQGG GSV+++ F+ I+VS+V+ PI+IDQ+YCD
Sbjct  325   NTKACVSNITVRDVNMHNTMTGVRIKTWQGGSGSVQSIRFANIKVSEVQTPIIIDQFYCD  384

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
             + +CKNQT AVA+  + +  I GTF  +P H ACS+S+PC+D+ L +++LEP        
Sbjct  385   RRSCKNQTAAVALSSIAYENIKGTFTVKPVHFACSDSMPCSDISLTEVELEPLQEQYHMY  444

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHEN  284
                CW  YG+      P    +CL++G     RI   H++
Sbjct  445   EPFCWQVYGELYTPTVPPI--FCLQTGKPTSNRIQSDHDS  482



>gb|ABV24999.1| polygalacturonase 2 [Oncidium hybrid cultivar]
Length=483

 Score =   395 bits (1016),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/404 (50%), Positives = 286/404 (71%), Gaps = 9/404 (2%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             +S+F++  FGAKGDGV+DD+KA E AW +AC+V  +T+QIPS ++F + PI+  GP C P
Sbjct  86    NSMFNVPDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQIPSDYTFFVGPISFSGPYCQP  145

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS-  1127
             +++ Q+DG +VAP N   W  S +  WI F  +   TIQG GT +G+G  WW   + +  
Sbjct  146   NIIFQLDGTIVAPTNSKIW-SSGLLWWIEFTKLKGITIQGSGTIEGRGSVWWSQPEPNDE  204

Query  1126  -LQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
              + E+  SK    ++KPTALRFY S NVT+ GI+I NSPQCHLKFDN + V+V+N+++++
Sbjct  205   PISEELGSKM--PSIKPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTS  262

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             P +SPNTDGIHLQNS+DV IHH  +  GDDCVSIQTGC+ V +H++NCGPGHGIS+GGLG
Sbjct  263   PGDSPNTDGIHLQNSKDVVIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLG  322

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +D + ACVSNI V++V M  T+ G RIKTWQGG GSV+++ FS I+VS+V+ PI+IDQ+Y
Sbjct  323   RDNTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFY  382

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CD+ +CKNQT AVA+ G+ +  I GT+  +P HLACS+  PC+D+ L +I+L+P   +  
Sbjct  383   CDRSSCKNQTAAVALSGIAYESIKGTYTVKPVHLACSDGTPCSDISLTEIELQPMQEHYH  442

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
               +  CW ++G+      P  +  C+++G     RI   H+ IC
Sbjct  443   MYDPFCWQTFGELYTPTVPPIL--CMQNGKPTSNRILSDHD-IC  483



>gb|ABV25002.1| polygalacturonase 5 [Oncidium hybrid cultivar]
Length=484

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 205/402 (51%), Positives = 284/402 (71%), Gaps = 9/402 (2%)
 Frame = -3

Query  1474  VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDL  1298
             +F++L FGAKGDGV+DD+KA E AW +AC+V  +TVQIPS ++FLI PI+  GP C P++
Sbjct  89    MFNVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTVQIPSDYTFLIGPISFSGPYCQPNI  148

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ--IHSL  1124
             + Q+DG +VAP     W  S +  WI F  +   TIQG GT +G+G  WW   +    S+
Sbjct  149   IFQLDGTIVAPTISKIW-SSGLLWWIEFTKLKGITIQGSGTIEGRGSVWWSQPEPNDESI  207

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
              E+  SK    ++KPTALRFY S NVT+ GI+I NSPQCHLKFDN + V+V+N+++++P 
Sbjct  208   SEELGSKM--PSIKPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  265

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +S NTDGIHLQNS+DV IHH  +  GDDCVSIQTGC+ V +H++NCGPGHGIS+GGLG+D
Sbjct  266   DSLNTDGIHLQNSKDVVIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  325

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSNI V++V M  T+ G RIKTWQGG GSV+++ FS I+VS+V+ PI+IDQ+YCD
Sbjct  326   NTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  385

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
             + +CKNQT AVA+ G+ +  I GT+  +P HLACS+  PC+D+ L +I+L+P   +    
Sbjct  386   RSSCKNQTAAVALSGIAYESIKGTYTVKPVHLACSDGTPCSDISLTEIELQPMQEHYHMY  445

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             +  CW ++G+      P  +  C+++G     RI   H+ IC
Sbjct  446   DPFCWQTFGELYTPTVPPIL--CMQNGKPTSNRILSDHD-IC  484



>ref|XP_007153746.1| hypothetical protein PHAVU_003G061600g [Phaseolus vulgaris]
 gb|ESW25740.1| hypothetical protein PHAVU_003G061600g [Phaseolus vulgaris]
Length=534

 Score =   396 bits (1017),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 207/419 (49%), Positives = 277/419 (66%), Gaps = 24/419 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++ F++L FGAKGDG +DD+KA +AAW  ACKV  +T+ +PS + F + PI+  GP C P
Sbjct  117   TTTFNVLDFGAKGDGKTDDTKAFQAAWAEACKVEASTMVVPSDYVFFVGPISFSGPYCKP  176

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG +VAP N  +W +  + QW+ F  +   TIQG G  DG+G  WW+  Q    
Sbjct  177   NIVFQLDGTIVAPTNPNAWGRG-LLQWLEFTKLVGITIQGNGIIDGKGSVWWQDHQYDDP  235

Query  1123  QEKKASKTIHVN--------------------MKPTALRFYESTNVTIHGISIVNSPQCH  1004
              + +    + +N                    +KPTALRFY S N T+ GI+I+NSPQCH
Sbjct  236   IDDEEKLIVPLNQTVPSPPLPIQSELGGKMPSVKPTALRFYGSFNPTVTGITILNSPQCH  295

Query  1003  LKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVH  824
             LKFDN  GV VHN++IS+P NSPNTDGIHLQNS+DV I+ ST+  GDDC+SIQTGCSNV+
Sbjct  296   LKFDNCNGVLVHNVSISSPGNSPNTDGIHLQNSKDVLIYGSTMACGDDCISIQTGCSNVY  355

Query  823   VHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSF  644
             VH++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGG GSV+ + F
Sbjct  356   VHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNMHNTMTGVRIKTWQGGSGSVQGILF  415

Query  643   SGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPC  464
             S IQVS+V+ PI+IDQ+YCDK  CKNQT AV++ G+ + +I GT+   P + ACS+S+PC
Sbjct  416   SNIQVSEVQFPIVIDQFYCDKRTCKNQTSAVSLAGINYERIRGTYTVMPVNFACSDSLPC  475

Query  463   TDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
              DV L  ++L+P        +  CW +YG+ +    P     CL+ G     RI   H+
Sbjct  476   VDVSLTAVELKPLQEQNHLYDPFCWQTYGELKTPTLPPIG--CLQIGKPTSNRIQTDHD  532



>emb|CDM83489.1| unnamed protein product [Triticum aestivum]
Length=536

 Score =   396 bits (1018),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 206/409 (50%), Positives = 284/409 (69%), Gaps = 13/409 (3%)
 Frame = -3

Query  1483  PSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CM  1307
             P +VF+++ FGAKGDGVSDD+KA +AAW A CK+  +TV +PS+  FL+ PI+  GP C 
Sbjct  134   PGAVFNVVDFGAKGDGVSDDTKAFQAAWAAVCKLGASTVLVPSELEFLVGPISFSGPNCK  193

Query  1306  PDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS  1127
             P+++ Q++G ++AP N  +W  S + QW+ F  +   +IQG GT +G+G  WW  S  + 
Sbjct  194   PNILFQLEGTILAPTNAKAW-GSGLLQWLEFTKLSGLSIQGSGTINGRGQQWWTYSDPND  252

Query  1126  LQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
              ++          M   KPTALR Y S+NV + GI+IVNS QCHLKFDN +GV VH++TI
Sbjct  253   DEDDDKYNEELERMPRVKPTALRLYGSSNVVVAGITIVNSSQCHLKFDNCQGVLVHDLTI  312

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H++NCGPGHGIS+GG
Sbjct  313   SSPENSLNTDGIHLQNSKDVSIHHTNLACGDDCISIQTGCSNIYIHNVNCGPGHGISIGG  372

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LG+D + ACVSN+ V +V M  T+ G RIKTWQGG+G V+++ FS IQVS+V+ PIMIDQ
Sbjct  373   LGRDNTKACVSNVTVRDVNMFRTMTGVRIKTWQGGIGLVQDIRFSNIQVSEVQTPIMIDQ  432

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP-SPG  419
             +YCDK  C NQT AVA+ GV++  I GTF  +P H ACS+S PC+ + L  +QL+P    
Sbjct  433   FYCDKRTCTNQTTAVAVSGVQYENIRGTFTIKPLHFACSDSSPCSGITLTGVQLKPVQIA  492

Query  418   YRGFRNGQCWNSYGKSQGQLFPASMD--YCLRSGSLLVKRIARSHENIC  278
             +    N  CW ++    G+LF  ++    CL+ G      + +S+ +IC
Sbjct  493   HYHLNNPFCWQAF----GELFTPTIPPIACLQIGKPAGNNL-QSYHDIC  536



>gb|ABV25001.1| polygalacturonase 4 [Oncidium hybrid cultivar]
Length=483

 Score =   394 bits (1012),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 203/402 (50%), Positives = 284/402 (71%), Gaps = 9/402 (2%)
 Frame = -3

Query  1474  VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDL  1298
             +F++L FGAKGDGV+DD+KA E AW +AC+V  +T+QIPS ++FL+ PI+  GP C P++
Sbjct  88    MFNVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQIPSDYTFLVGPISFSGPYCQPNI  147

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS--L  1124
             + Q+DG +VAP N   W  S +  WI F  +   TIQG GT +G+G  WW   + +   +
Sbjct  148   IFQLDGTIVAPTNSKIW-SSGLLWWIEFTKLKGITIQGSGTIEGRGSVWWSQPEPNDEPI  206

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
              E+  SK    ++KP ALRFY S NVT+ GI+I NSPQCHLKFDN + V+V+N+++++P 
Sbjct  207   SEELGSKM--PSIKPAALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  264

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +S NTDGIHLQNS+DV IHH  +  GDDCVSIQTGC+ V +H++NCGPGHGIS+GGLG+D
Sbjct  265   DSLNTDGIHLQNSKDVVIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  324

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSNI V++V M  T+ G RIKTWQGG GSV+++ FS I+VS+V+ PI+IDQ+YCD
Sbjct  325   NTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  384

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
             + +CKNQT AVA+ G+ +  I GT+  +P HLACS+  PC+D+ L +I+L+P   +    
Sbjct  385   RSSCKNQTAAVALSGIAYESIKGTYTVKPVHLACSDGTPCSDISLTEIELQPMQEHYHMY  444

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             +  CW ++G+      P  +  CL++G     RI   H+ IC
Sbjct  445   DPFCWQTFGELYTPTVPPIL--CLQNGKPTSNRILSDHD-IC  483



>ref|XP_010108791.1| Polygalacturonase [Morus notabilis]
 gb|EXC20306.1| Polygalacturonase [Morus notabilis]
Length=472

 Score =   393 bits (1010),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 272/399 (68%), Gaps = 16/399 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S++F++L +GAKGDG +DD+KA EAAW AACKV  +T+ +PS   FL+ PI+  G  C P
Sbjct  63    SAIFNVLDYGAKGDGRADDTKAFEAAWEAACKVKASTITVPSGSVFLVKPISFSGSGCQP  122

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH--  1130
             D+V Q+DG ++AP + GSW  S + QWI F      TI+G G  DGQG  WW  S  +  
Sbjct  123   DIVFQLDGKIIAPTDSGSW-GSGLLQWIEFAKHDGITIKGKGIIDGQGSVWWNDSPTYYP  181

Query  1129  ----------SLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKG  980
                        LQ+ +++     N KPTALRFY S  VT+ GI+I NSPQ HLKFD+   
Sbjct  182   TDDFTYNSSEDLQQTESNSGKLPNTKPTALRFYGSNGVTVTGITIQNSPQTHLKFDDCTN  241

Query  979   VNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgp  800
             V V ++ +S+PE+SPNTDGIHLQNSQDV I++S +  GDDCVSIQTGCSNV++H++NCGP
Sbjct  242   VQVFSVGVSSPESSPNTDGIHLQNSQDVVIYNSNLACGDDCVSIQTGCSNVYIHNVNCGP  301

Query  799   ghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDV  620
             GHGIS+G LGKD + ACVSNI V +V ++NTL G RIKTWQGG GSV+NV FS IQVS+V
Sbjct  302   GHGISIGSLGKDNTRACVSNITVRDVKIQNTLTGVRIKTWQGGSGSVQNVMFSNIQVSEV  361

Query  619   KVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADI  440
             K PIMIDQ+YCDK  C N++ AVA+ G+ +  + GT+  +P H ACS+S+PCT V L  I
Sbjct  362   KTPIMIDQFYCDKSKCANESSAVAVSGINYINVKGTYTEKPVHFACSDSLPCTGVSLNTI  421

Query  439   QLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             QL             CW +YG+ +    P  +D CL++G
Sbjct  422   QLNSVQESEHLSGPFCWEAYGELETATVPP-ID-CLKTG  458



>gb|ABV25000.1| polygalacturonase 3 [Oncidium hybrid cultivar]
Length=483

 Score =   394 bits (1011),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 201/402 (50%), Positives = 281/402 (70%), Gaps = 5/402 (1%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             +S+F++L FGAKGDGV+DD+KA E AW +AC+V  +T+QIPS ++F + PI+  GP C P
Sbjct  86    NSMFNVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQIPSDYTFFVGPISFSGPYCQP  145

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             +++ Q+DG +VAP N   W  S +  WI F  +   TIQG GT +G+G  WW   + +  
Sbjct  146   NIIFQLDGTIVAPTNSKIW-SSGLLWWIEFTKLKGITIQGNGTIEGRGSVWWSQPEPNDE  204

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                +       ++KPTALRFY S NVT+ GI+I NSPQCHLKFDN + V+V+N+++++P 
Sbjct  205   PISEELGKKMPSIKPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  264

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +S NTDGIHLQNS+DV IHH  +  GDDCVSIQTGC+ V +H++NCGPGHGIS+GGLG+D
Sbjct  265   DSLNTDGIHLQNSKDVVIHHRNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  324

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSNI V +V M  T+ G RIKTWQGG GSV+++ FS I+VS+V+ PI+IDQ+YCD
Sbjct  325   NTKACVSNITVRDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  384

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
             + +CKNQT AVA+ G+ +  I GT+  +P HLACS+  PC+D+ L +I+L+P   +    
Sbjct  385   RSSCKNQTAAVALSGIAYESIKGTYTVKPVHLACSDGTPCSDISLTEIELQPMQEHYHMY  444

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             +  CW ++G+      P  +  CL++G     RI   H+ IC
Sbjct  445   DPFCWQTFGELYTPTVPPIL--CLQNGKPTSNRILSGHD-IC  483



>gb|ABV25003.1| polygalacturonase 6 [Oncidium hybrid cultivar]
Length=483

 Score =   393 bits (1009),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 203/404 (50%), Positives = 284/404 (70%), Gaps = 9/404 (2%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             +S+ ++L FGAKGDGV+DD+KA E AW +AC+V  +T+QIPS ++FL+ PI+  GP C P
Sbjct  86    NSMLNVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQIPSDYTFLVGPISFSGPYCQP  145

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ--IH  1130
             +++ Q+DG +VAP N   W  S +  WI F  +   TIQG GT +G+G  WW   +    
Sbjct  146   NIIFQLDGTIVAPTNSKIW-SSGLLWWIEFTKLKGITIQGSGTIEGRGSVWWSQPEPNDE  204

Query  1129  SLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
             S+ E+  SK    ++KPTALRFY S NVT+ GI+I NSPQCHLKFDN + V+V+N+++++
Sbjct  205   SISEELGSKM--PSIKPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTS  262

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             P +  NTDGIHLQNS+DV IHH  +  GDDCVSIQTGC+ V +H++NCGPGHGIS+GGLG
Sbjct  263   PGDILNTDGIHLQNSKDVVIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLG  322

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +D + ACVSNI V++V M  T+ G RIKTWQGG GSV+++ FS I+VS+V+ PI+IDQ+Y
Sbjct  323   RDNTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFY  382

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CD+ +CKNQT AVA+ G+ +  I GT+  +P HLACS+  PC+D  L +I+L+P   +  
Sbjct  383   CDRSSCKNQTAAVALSGIAYESIKGTYTVKPVHLACSDGTPCSDTSLTEIELQPMQEHYH  442

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
               +  CW ++G+      P  +  C+++G     RI   H+ IC
Sbjct  443   MYDPFCWQTFGELYTPTVPPIL--CMQNGKPTSNRILSDHD-IC  483



>ref|XP_009769209.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Nicotiana 
sylvestris]
Length=434

 Score =   390 bits (1002),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 263/388 (68%), Gaps = 13/388 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SSVF++L +GAKGDG +DD+K  EAAW  ACKV G+T+ +PS + FL+ PI+  GP C  
Sbjct  31    SSVFNVLDYGAKGDGTTDDTKTFEAAWIEACKVEGSTIVVPSDYDFLVGPISFSGPHCEE  90

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V  +DG ++AP N   W  S + QW+ FK ++  +++G GT DGQG  WW+ + +   
Sbjct  91    NIVFLLDGRIIAPTNPKIW-GSGLLQWLEFKKLNGISVKGKGTIDGQGSVWWQNTHLEDP  149

Query  1123  QEKKASKTIHV-----------NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
              +     T+               +PTALRFY  +NV + GI+I NSP+ HLKFD+   +
Sbjct  150   DDDPNYTTLFALTSSTAKGKMPRTRPTALRFYGCSNVVVTGITIQNSPKAHLKFDSCVTI  209

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V  ITIS+PE+SPNTDGIHLQNSQ+V IH S +  GDDC+SIQTG S V +H + CGPG
Sbjct  210   QVSGITISSPEDSPNTDGIHLQNSQNVVIHSSDLACGDDCISIQTGTSAVFIHDVKCGPG  269

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HG S+GGLG D + ACVSNI V +  + NTL G RIKTWQGG GSV+ + FS IQVSDV+
Sbjct  270   HGFSIGGLGNDNTKACVSNITVRDSTLHNTLTGVRIKTWQGGSGSVQGIMFSNIQVSDVE  329

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PI+IDQ+YCDK  CKNQT AVAI GV +  I GT++ +P H ACS+SVPCT V LADIQ
Sbjct  330   TPIIIDQFYCDKSKCKNQTSAVAISGVSYQSIKGTYSYEPLHFACSDSVPCTGVSLADIQ  389

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             L+PSP    F    CW +YG+ + +  P
Sbjct  390   LKPSPKREHFYGPYCWQTYGELKTKTTP  417



>ref|XP_008444333.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis melo]
Length=505

 Score =   393 bits (1009),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 206/423 (49%), Positives = 281/423 (66%), Gaps = 25/423 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             +++F++L FGAKG+G +DD+KA E AW AACKV G+TV +P+++ F + PI+  GP C P
Sbjct  86    AAIFNVLDFGAKGNGETDDTKAFEDAWAAACKVEGSTVMVPAEYVFFVGPISFSGPYCQP  145

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             D+V Q+DG ++AP +  +W K  + QWI F  +   TI+G G  DG+G  WW+ S     
Sbjct  146   DIVFQLDGTIIAPTDHQTWGKG-LLQWIQFTKLVGITIRGNGIIDGRGSVWWQDSSFDEP  204

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              + +    I VN                     +KPTALRFY S N T+ GI+I NSPQC
Sbjct  205   IDDEMKLIIPVNNTRDETKPTPIGSNLEGKMPSIKPTALRFYGSFNATVTGITIQNSPQC  264

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH+I++S+P +S NTDGIHLQNS+DV IH +++  GDDCVSIQTGCSNV
Sbjct  265   HLKFDNCVGVLVHDISVSSPGDSLNTDGIHLQNSKDVLIHSTSLSCGDDCVSIQTGCSNV  324

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+G LGKD + ACVSNI V +V M +T+ G RIKTWQGG GSV+NV 
Sbjct  325   YIHNVNCGPGHGISIGSLGKDHTKACVSNITVRDVTMHDTMNGVRIKTWQGGFGSVQNVL  384

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ+S+V++PI+IDQ+YCDK  C NQT AVA+ G+ + +I GT+  +P H ACS+++P
Sbjct  385   FSNIQMSEVQLPIVIDQFYCDKAKCSNQTSAVALSGINYERIRGTYTVKPVHFACSDNLP  444

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             CTDV L  I+L+P        +  CW ++G+ +    P     CL+ G     R+     
Sbjct  445   CTDVTLTTIELKPLQERYHLYDPFCWQTFGELRTPTSPPIG--CLQIGKPSSNRVQYEEN  502

Query  286   NIC  278
             + C
Sbjct  503   DSC  505



>gb|KHN26888.1| Polygalacturonase [Glycine soja]
Length=538

 Score =   394 bits (1012),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 209/422 (50%), Positives = 279/422 (66%), Gaps = 26/422 (6%)
 Frame = -3

Query  1483  PSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CM  1307
             P++ F++L FGAKGDG SDD+KA + AW  ACKV  +T+ +P+ + F + PI+  GP C 
Sbjct  118   PTTTFNVLDFGAKGDGKSDDTKAFQEAWAEACKVESSTMLVPADYVFFVGPISFSGPYCK  177

Query  1306  PDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS  1127
             P +V Q+DG +VAP +  +W K  + QW+ F  +   TIQG G  DG+G  WW+ +    
Sbjct  178   PSIVFQLDGTIVAPTSPNAWGKG-LLQWLEFSKLVGITIQGNGIIDGRGSVWWQDNPYDD  236

Query  1126  LQEKKASKTIHVN----------------------MKPTALRFYESTNVTIHGISIVNSP  1013
               + +    + +N                      +KPTALRFY S N T+ GI+I NSP
Sbjct  237   PIDDEEKLIVPLNHTIGSPSPPLPIQSEMGGKMPSVKPTALRFYGSFNPTVTGITIQNSP  296

Query  1012  QCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCS  833
             QCHLKFD+  GV VHN+TIS+P +SPNTDGIHLQNS+DV I+ ST+  GDDC+SIQTGCS
Sbjct  297   QCHLKFDSCNGVMVHNVTISSPGDSPNTDGIHLQNSKDVLIYGSTMACGDDCISIQTGCS  356

Query  832   NVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKN  653
             NV+VH++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGG GSV+ 
Sbjct  357   NVYVHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNMHNTMNGVRIKTWQGGSGSVQG  416

Query  652   VSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNS  473
             V FS IQVS+V++PI+IDQ+YCDK  CKNQT AV++ G+ + +I GT+  +P H ACS+S
Sbjct  417   VLFSNIQVSEVELPIVIDQFYCDKRTCKNQTSAVSLAGINYERIRGTYTVKPVHFACSDS  476

Query  472   VPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS  293
             +PC DV L  ++L+P        N  CW +YG+ +    P  +D CL+ G     RI   
Sbjct  477   LPCVDVSLTSVELKPIQEKYHLYNPFCWQTYGELKTPTVPP-ID-CLQIGKPTNNRIQTD  534

Query  292   HE  287
             H+
Sbjct  535   HD  536



>ref|XP_004509758.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=526

 Score =   393 bits (1010),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 210/430 (49%), Positives = 277/430 (64%), Gaps = 32/430 (7%)
 Frame = -3

Query  1489  PPP-------SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINP  1331
             PPP       S+ F++L FGAKGD  SDD+KA EA W  ACKV  +T+ IP+ + F + P
Sbjct  98    PPPQTYNGGSSTTFNVLDFGAKGDAKSDDTKAFEATWAEACKVEASTMLIPADYVFYVGP  157

Query  1330  ITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPN  1154
             I   GP C P++V QVDG ++AP N   W +  I QW++F  +  FTIQG G  DG+G  
Sbjct  158   IAFSGPYCKPNIVFQVDGTIIAPTNANVWGR-GILQWLDFTKLVGFTIQGNGIVDGRGSV  216

Query  1153  WWKLSQIHS---------------------LQEKKASKTIHVNMKPTALRFYESTNVTIH  1037
             WW+ +  ++                     +Q +         +KPTALRFY S N T+ 
Sbjct  217   WWQDTTPYNNPIDDEEKLLVPLNNTVGRPPMQIESELGGKMPGIKPTALRFYGSINPTVT  276

Query  1036  GISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDC  857
             GI+I NSPQCHLKFDN  GV VH++ IS+P +SPNTDGIHLQNS+DV I+ ST+  GDDC
Sbjct  277   GITIQNSPQCHLKFDNCNGVLVHDVNISSPGDSPNTDGIHLQNSKDVLIYKSTLACGDDC  336

Query  856   VSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQ  677
             +SIQTGCSNV+VH++NCGPGHGIS+G LGKD + ACVSNI + +V M NT+ G RIKTWQ
Sbjct  337   ISIQTGCSNVYVHNVNCGPGHGISIGSLGKDNTRACVSNITIRDVNMHNTMNGVRIKTWQ  396

Query  676   GGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQP  497
             GG GSV+ V FS I+VS+V++PI+IDQ+YCDK +C NQT AV++ G+ +  I GT+  +P
Sbjct  397   GGSGSVQGVLFSNIKVSEVQLPIVIDQFYCDKRSCTNQTSAVSLSGINYENIKGTYTVKP  456

Query  496   FHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSL  317
              H ACS+S+PC DV L  ++LEP        +  CW +YG+ +    P     CL  G  
Sbjct  457   VHFACSDSLPCVDVSLTSVELEPVQEKYHLYDPFCWKTYGELKTPTLPPIG--CLEIGKP  514

Query  316   LVKRIARSHE  287
                RI  +H+
Sbjct  515   PNNRIQTAHD  524



>ref|XP_004297473.1| PREDICTED: polygalacturonase At1g48100-like [Fragaria vesca subsp. 
vesca]
Length=527

 Score =   393 bits (1009),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 203/416 (49%), Positives = 278/416 (67%), Gaps = 24/416 (6%)
 Frame = -3

Query  1474  VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDL  1298
              +++L FGAKGDG SDD+KA + AW AACKV  + + +P+ + FL+ PI+  GP C P++
Sbjct  112   TYNVLDFGAKGDGSSDDTKAFQGAWAAACKVEASKIIVPADYQFLVGPISFSGPYCQPNI  171

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             + Q+DG +VAP +   W K  +FQW+ F  +   T+QG G  DG+G  WW+ +      +
Sbjct  172   LFQLDGTIVAPSDT-KWGKG-LFQWLEFTKLRGITVQGKGVIDGRGSPWWQDTPYGDPYD  229

Query  1117  KKASKTIHVN-------------------MKPTALRFYESTNVTIHGISIVNSPQCHLKF  995
              +    I +N                   MKPTALRFY S NVT+ GI+I NSPQCHLKF
Sbjct  230   DELKLIIPLNSTHPPLIPIRNELNGKISGMKPTALRFYGSYNVTVTGITIQNSPQCHLKF  289

Query  994   DNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHH  815
             DN  GV VH++++S+P +SPNTDGIHLQNS+DV IH ST+  GDDC+SIQTGCSNV+VH+
Sbjct  290   DNCDGVLVHDMSVSSPGDSPNTDGIHLQNSKDVLIHSSTLACGDDCISIQTGCSNVYVHN  349

Query  814   INCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGI  635
             +NCGPGHGIS+G LGKD + ACVSNI V ++VM NT+ G R+KTWQGG GSV+ V FS I
Sbjct  350   VNCGPGHGISIGSLGKDNTKACVSNITVRDIVMHNTMNGVRVKTWQGGSGSVQGVLFSNI  409

Query  634   QVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDV  455
             QV++V++PI+IDQ+YCDK  C+NQ+ AVA+ G+ + +I GT+  +P H ACS+S+PC DV
Sbjct  410   QVNEVQLPIVIDQFYCDKSTCRNQSSAVALSGITYERIRGTYTVKPVHFACSDSLPCVDV  469

Query  454   HLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
              L  IQL+P        +  CW ++G+ +    P     CL+ G     ++   H+
Sbjct  470   TLNGIQLKPVQQRYHMYDPFCWQTFGELRTPTLPPIS--CLQIGKPANNKVNSDHD  523



>gb|ABV24998.1| polygalacturonase 1 [Oncidium hybrid cultivar]
Length=482

 Score =   391 bits (1004),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 199/402 (50%), Positives = 281/402 (70%), Gaps = 5/402 (1%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             +S+ ++L FGAKGDGV+DD+KA E AW +AC+V  +T+QIPS ++FL+ PI+  GP C P
Sbjct  85    NSMLNVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQIPSDYTFLVGPISFSGPYCQP  144

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             +++ Q+DG +VAP N   W  S +  WI F  +   TIQG GT +G+G  WW   + +  
Sbjct  145   NIIFQLDGTIVAPTNSKIW-SSGLLWWIEFTKLKGITIQGNGTIEGRGSVWWSQPEPNDE  203

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                +       ++KPTALRFY S NVT+ GI+I NSPQCHLKFDN + V+V+N+++++P 
Sbjct  204   PISEELGKKMPSIKPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  263

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +S NTDGIHLQNS+DV IHH  +  GDDCVSIQTGC+ V +H++NCGPGHGIS+GGLG+D
Sbjct  264   DSLNTDGIHLQNSKDVAIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  323

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSNI V++V M  T+ G RIKTWQGG GSV+++ FS I+VS+V+ PI+IDQ+YCD
Sbjct  324   NTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  383

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
             + +CKNQT AVA+  + +  I GT+  +P HLACS+  PC+D+ L +I+L+P   +    
Sbjct  384   RSSCKNQTAAVALSSIAYESIKGTYTVKPVHLACSDGTPCSDISLTEIELQPMQEHYHMY  443

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             +  CW ++G+      P  +  C+++G     RI   H+ IC
Sbjct  444   DPFCWQTFGELYTPTVPPIL--CMQNGKPTSNRILSDHD-IC  482



>ref|XP_011013806.1| PREDICTED: polygalacturonase At1g48100-like [Populus euphratica]
Length=516

 Score =   392 bits (1007),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 207/420 (49%), Positives = 278/420 (66%), Gaps = 25/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L FGAKGDG SDD+KA +AAW  ACKV+ +T+ +P+++ FL+ PI+  GP C  
Sbjct  98    STTFNVLDFGAKGDGKSDDTKAFQAAWAEACKVAASTMSVPAEYVFLVGPISFSGPYCQA  157

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP N  +W +  +FQW+ F  +   TIQG GT DG G  WW+       
Sbjct  158   NIVFQLDGTIIAPKNSNAWGRG-LFQWLEFTKLVGITIQGGGTIDGSGSVWWQDYPFEDP  216

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              + ++   + +N                     +KPTALRFY S NVT+ GI+I NSPQC
Sbjct  217   IDNESEFIVPLNNTAQQHPPMPIRNELSGKMPSIKPTALRFYGSFNVTVTGITIQNSPQC  276

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++  S+P +SPNTDGIHLQNS+DV IH + +  GDDCVSIQTGCSNV
Sbjct  277   HLKFDNCIGVVVHDMRTSSPGDSPNTDGIHLQNSKDVLIHSTDLACGDDCVSIQTGCSNV  336

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+GGLGKD + ACVSNI V +VVM  T+ G RIKTWQGG GSV+ V 
Sbjct  337   YIHNVNCGPGHGISIGGLGKDNTKACVSNITVRDVVMHGTMTGVRIKTWQGGSGSVQGVL  396

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H ACS+++P
Sbjct  397   FSNIQVSEVQLPIVIDQFYCDKSKCKNQTSAVALSGITYEKIRGTYTVKPVHFACSDALP  456

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L  I+L+P        +  CW ++G+      P     CL+ G     R    H+
Sbjct  457   CMDVSLTTIELQPQKEQYHLYDPFCWQTFGELNTPTMPPIS--CLQIGKPSSNRPQTDHD  514



>ref|XP_006350314.1| PREDICTED: polygalacturonase At1g48100-like [Solanum tuberosum]
Length=476

 Score =   390 bits (1002),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/391 (51%), Positives = 271/391 (69%), Gaps = 23/391 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++ F++  +GAKGDG SDD+KA EAAW AACKV  +T+ +PS++ FL+ PI+  GP C  
Sbjct  58    ATTFNVRDYGAKGDGKSDDTKAFEAAWTAACKVEASTMLVPSEYVFLLGPISFSGPYCQH  117

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             +++ Q+DG ++AP +  +W  S I QW++F  +   TI+G G  DG G  WW  +     
Sbjct  118   NILFQLDGTIIAPADAEAW-GSDILQWLDFTKLVGITIKGSGKIDGNGAVWWHDTPFDDP  176

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              E+++   I  N                     +KPTALRFY S+NVT+ GI+I NSPQC
Sbjct  177   TEEESKLIIPSNNTMQTSLPIPLNSSLGGRMPGIKPTALRFYGSSNVTVTGITIQNSPQC  236

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV+V+N ++S+P +SPNTDGIHLQNS+D+ I  S +  GDDC+SIQTGCSNV
Sbjct  237   HLKFDNCIGVSVYNFSVSSPGDSPNTDGIHLQNSKDILIRSSNVSCGDDCISIQTGCSNV  296

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H+INCGPGHGIS+GGLGKD + ACVSN+ V++++M NT+ G RIKTWQGG GSV+ + 
Sbjct  297   YIHNINCGPGHGISIGGLGKDNTKACVSNVTVKDIIMHNTMNGVRIKTWQGGSGSVQGLM  356

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  C NQT AVA+  + + +I GT+  +P HLACS+S+P
Sbjct  357   FSNIQVSEVQIPIVIDQFYCDKSKCPNQTSAVALSEINYEKITGTYTVKPVHLACSDSMP  416

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGK  374
             C DV L DIQL+P           CW ++G+
Sbjct  417   CVDVTLTDIQLKPLQEQYHMYEPYCWQTFGE  447



>gb|KHG05280.1| hypothetical protein F383_31181 [Gossypium arboreum]
Length=519

 Score =   391 bits (1005),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/424 (49%), Positives = 275/424 (65%), Gaps = 25/424 (6%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             Y   S+VF++L FGAKGDG SDD+KA +  W AACKV  +TV +P++F FL+ PI+  GP
Sbjct  97    YDQQSTVFNVLDFGAKGDGKSDDTKAFQDTWAAACKVEASTVVVPAEFVFLVGPISFSGP  156

Query  1312  -CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
              C  ++V Q+ G ++AP +   W K  + QW+ F  +    IQG G  DG+G  WW+ + 
Sbjct  157   YCQANIVFQLHGTIIAPTDARPWGKG-LLQWLEFTKLKGIAIQGKGIIDGRGSGWWQDAP  215

Query  1135  IHSLQEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVN  1019
                  + +    I +N                     +KPTALRFY S NVT+ GI+I N
Sbjct  216   YEDPYDDERKLIIPLNSTVQERPPMPVRNELSGKMPSIKPTALRFYGSFNVTVTGITIQN  275

Query  1018  SPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTG  839
             SPQCHLKFDN  GV VH+IT+S+P +SPNTDGIHLQNS DV IH S +  GDDCVSIQTG
Sbjct  276   SPQCHLKFDNCMGVVVHDITVSSPGDSPNTDGIHLQNSNDVLIHSSDLACGDDCVSIQTG  335

Query  838   CSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSV  659
             CSNV++H++NCGPGHGIS+G LG+D S ACVSNI V ++VM NT+ G RIKTWQGG GSV
Sbjct  336   CSNVYIHNVNCGPGHGISIGSLGRDNSKACVSNITVRDIVMHNTMNGVRIKTWQGGSGSV  395

Query  658   KNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACS  479
             + V FS IQVS+V++PI+IDQ+YCDK  C N+T AVA+ G+ + +I GT+  +P H ACS
Sbjct  396   QGVLFSNIQVSEVQLPIVIDQFYCDKRKCSNETAAVALSGITYEKIRGTYTVKPVHFACS  455

Query  478   NSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIA  299
             +S+PC  V L+ I+L+P        +  CW ++G+      P     CL+ G     R+ 
Sbjct  456   DSLPCIGVTLSAIELKPVQERYHLYDPFCWQTFGELTTPTVPPIS--CLQIGKPTNNRVQ  513

Query  298   RSHE  287
               H+
Sbjct  514   SDHD  517



>ref|XP_003552026.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Glycine 
max]
 gb|KHN23203.1| Polygalacturonase [Glycine soja]
Length=538

 Score =   392 bits (1006),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/421 (49%), Positives = 280/421 (67%), Gaps = 26/421 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++ F++L FGAKGDG SDD+KA + AW  ACK+  +T+ +P+ ++F + PI+  GP C P
Sbjct  119   ATTFNVLDFGAKGDGKSDDTKAFQEAWAEACKIESSTMLVPADYAFFVGPISFSGPYCKP  178

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
              +V Q+DG +VAP +  +W K  + QW+ F  +   TIQG G  DG+G  WW+ +Q    
Sbjct  179   SIVFQLDGTIVAPTSPKAWGKG-LLQWLEFSKLVGITIQGNGIIDGRGSVWWQDNQYDDP  237

Query  1123  QEKKASKTIHVN----------------------MKPTALRFYESTNVTIHGISIVNSPQ  1010
              + +    + +N                      +KPTALRFY S N T+ GI+I NSPQ
Sbjct  238   IDDEEKLIVPLNHTVGSPSPPLPIQSEMGGKMPSVKPTALRFYGSFNPTVTGITIQNSPQ  297

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN  GV VH++TIS+P +SPNTDGIHLQNS+DV I+ S++  GDDC+SIQTGCSN
Sbjct  298   CHLKFDNCNGVMVHDVTISSPGDSPNTDGIHLQNSKDVLIYSSSMACGDDCISIQTGCSN  357

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             ++VH++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGG GSV+ V
Sbjct  358   IYVHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNMHNTMNGVRIKTWQGGSGSVQGV  417

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQVS+V++PI+IDQ+YCDK  CKNQT AV++ G+ + +I GT+  +P H ACS+++
Sbjct  418   LFSNIQVSEVELPIVIDQFYCDKRTCKNQTSAVSLAGINYERIRGTYTVKPVHFACSDNL  477

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L  ++L+P        N  CW +YG+ +    P  +D CL+ G     RI   H
Sbjct  478   PCVDVSLTSVELKPIQEQYHLYNPFCWQTYGELKTPTVPP-ID-CLQIGKPTNNRIQTDH  535

Query  289   E  287
             +
Sbjct  536   D  536



>ref|XP_002266600.1| PREDICTED: polygalacturonase At1g48100 [Vitis vinifera]
 emb|CBI28553.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   390 bits (1002),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 208/428 (49%), Positives = 284/428 (66%), Gaps = 29/428 (7%)
 Frame = -3

Query  1489  PPP----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITL  1322
             PPP    S  F++L FGAKGDG +DD+KA ++AW +ACKV  +T+ +PS++ FL+ PI+ 
Sbjct  80    PPPEKKGSETFNVLDFGAKGDGDTDDTKAFQSAWASACKVEASTIVVPSEYVFLVGPISF  139

Query  1321  QGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK  1145
              GP C  ++V Q+DG ++AP N  +W  S +  WI F  +   TI+G G  DG+G  WW+
Sbjct  140   SGPYCEANIVFQLDGTIIAPTNAKAW-GSGLLWWIEFTKLRGITIRGNGVIDGKGSVWWQ  198

Query  1144  LSQIHSLQEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGIS  1028
              S      + +A   I +N                      KPTALRFY S NVT+ GI+
Sbjct  199   DSPFDDPVDDEAKLIIPLNRTAKENSPIPINSKLGSKMPSTKPTALRFYGSFNVTVTGIT  258

Query  1027  IVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSI  848
             I NSPQCHLKFDN  GV+V+ +++S+P +S NTDGIHLQNS+DV IH + +  GDDCVSI
Sbjct  259   IQNSPQCHLKFDNCMGVSVYEMSVSSPGDSVNTDGIHLQNSKDVLIHATNLACGDDCVSI  318

Query  847   QTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGV  668
             QTGCSNV++H++NCGPGHGIS+GGLG+D + ACVSNI V +++M NT+ G RIKTWQGG 
Sbjct  319   QTGCSNVYIHNVNCGPGHGISIGGLGRDGTKACVSNITVRDIIMHNTMNGVRIKTWQGGS  378

Query  667   GSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHL  488
             GSV+ V FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H 
Sbjct  379   GSVQGVLFSNIQVSEVELPIVIDQFYCDKGKCKNQTSAVALSGITYEKIKGTYTVKPVHF  438

Query  487   ACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVK  308
             ACS+++PC DV L  I+L+P        +  CW ++G+      P  +D CL+ G     
Sbjct  439   ACSDNLPCMDVTLTGIELKPLQERYHMYDPFCWQTFGELTTPTVPP-ID-CLQIGKPSSN  496

Query  307   RIARSHEN  284
             RI   H++
Sbjct  497   RIQSDHDS  504



>tpg|DAA58413.1| TPA: polygalacturonase [Zea mays]
Length=542

 Score =   391 bits (1005),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 205/409 (50%), Positives = 284/409 (69%), Gaps = 17/409 (4%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDGV+DD+KA + AW AAC    +T+ +P +  FL+ PI+  GP C P+
Sbjct  142   AVFNVVDFGAKGDGVTDDTKAFQGAWAAACTQGASTLLVPPELEFLVGPISFSGPYCKPN  201

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             +V Q++G ++AP++  SW  S + QW+ F  ++   IQG G  +G+G  WW  S     +
Sbjct  202   IVFQLEGTILAPISAKSW-GSGLLQWLEFTKLNGIVIQGNGIINGRGQQWWTYS---DPE  257

Query  1120  EKKASKTIHVN------MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNIT  959
             ++    T HV       +KPTALRFY S NV + GI+IVNS QCHLKFDN +GV VH++T
Sbjct  258   DEDDDDTYHVEFQRMPQIKPTALRFYGSFNVVVSGITIVNSSQCHLKFDNCQGVMVHDVT  317

Query  958   ISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislg  779
             IS+PENS NTDGIHLQNS+DV IHH+T+  GDDC+SIQTGCSN+++H++NCGPGHGIS+G
Sbjct  318   ISSPENSLNTDGIHLQNSKDVSIHHTTLACGDDCISIQTGCSNINIHNVNCGPGHGISIG  377

Query  778   glGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMID  599
             GLG+D + ACVSN+ V +V M  T+ G RIKTWQGGVG V+++ FS IQVS+V+ PI+ID
Sbjct  378   GLGRDNTKACVSNVTVRDVNMFRTMNGVRIKTWQGGVGLVQDIRFSNIQVSEVQTPIIID  437

Query  598   QYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--S  425
             Q+YCD+  C+NQT AVA+ GV++  I GTF  +P H ACS+S+PC+ + L  +QL P   
Sbjct  438   QFYCDRSTCRNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSLPCSGISLTGVQLRPVQV  497

Query  424   PGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             P Y    N  CW ++G+      P     CL+ G      + +S+++IC
Sbjct  498   PHYH-LNNPFCWQAFGELYTPTVPPIA--CLQIGKPAGNNL-QSYDDIC  542



>ref|XP_010100443.1| Polygalacturonase [Morus notabilis]
 gb|EXB82577.1| Polygalacturonase [Morus notabilis]
Length=530

 Score =   390 bits (1003),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 204/396 (52%), Positives = 273/396 (69%), Gaps = 24/396 (6%)
 Frame = -3

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLV  1295
             FD+L FGAKGDG +DD+KA E AW AACKV  +T+ +P Q+ FL+ PI+  GP C  +LV
Sbjct  114   FDVLDFGAKGDGSTDDTKAFEVAWAAACKVEASTIIVPPQYQFLVGPISFSGPYCEANLV  173

Query  1294  LQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK----------  1145
              Q+DG ++AP +  +W K  + QW+ F  +   TIQG G  DG+G  WW+          
Sbjct  174   FQLDGTIIAPTDAKAWGKG-LLQWLEFSKLRGITIQGSGIIDGRGSVWWQEYSPYDDPAD  232

Query  1144  --LSQI---------HSLQEKKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHL  1001
               L  I         H  +  K+ ++  + ++KPTALRFY S NVT+ GI+I NSPQCHL
Sbjct  233   DDLKLIIPINSTFPEHPPEPMKSKQSGKMPSIKPTALRFYGSFNVTVTGITIRNSPQCHL  292

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN  GV VH++++S+P +S NTDGIHLQNS+DV IH ST   GDDC+SIQTGCSNV++
Sbjct  293   KFDNCVGVLVHDMSVSSPGDSANTDGIHLQNSKDVLIHSSTFACGDDCISIQTGCSNVYI  352

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LG+  + ACVSNI V +V M NT+ G RIKTWQGG+GSV+ V FS
Sbjct  353   HNVNCGPGHGISIGSLGRYNTKACVSNITVRDVNMHNTMTGVRIKTWQGGLGSVQGVLFS  412

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H ACS+++PCT
Sbjct  413   NIQVSEVQLPIVIDQFYCDKSTCKNQTSAVAVSGITYERIRGTYTVKPVHFACSDNLPCT  472

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             DV L  IQL+P   +    +  CW ++G+ +    P
Sbjct  473   DVTLNGIQLKPLQEHYHMYDPYCWQTFGELRSPTVP  508



>ref|XP_003531999.2| PREDICTED: polygalacturonase At1g48100 isoform 1 [Glycine max]
Length=601

 Score =   393 bits (1009),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 209/422 (50%), Positives = 279/422 (66%), Gaps = 26/422 (6%)
 Frame = -3

Query  1483  PSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CM  1307
             P++ F++L FGAKGDG SDD+KA + AW  ACKV  +T+ +P+ + F + PI+  GP C 
Sbjct  181   PTTTFNVLDFGAKGDGKSDDTKAFQEAWAEACKVESSTMLVPADYVFFVGPISFSGPYCK  240

Query  1306  PDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS  1127
             P +V Q+DG +VAP +  +W K  + QW+ F  +   TIQG G  DG+G  WW+ +    
Sbjct  241   PSIVFQLDGTIVAPTSPNAWGKG-LLQWLEFSKLVGITIQGNGIIDGRGSVWWQDNPYDD  299

Query  1126  LQEKKASKTIHVN----------------------MKPTALRFYESTNVTIHGISIVNSP  1013
               + +    + +N                      +KPTALRFY S N T+ GI+I NSP
Sbjct  300   PIDDEEKLIVPLNHTIGSPSPPLPIQSEMGGKMPSVKPTALRFYGSFNPTVTGITIQNSP  359

Query  1012  QCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCS  833
             QCHLKFD+  GV VHN+TIS+P +SPNTDGIHLQNS+DV I+ ST+  GDDC+SIQTGCS
Sbjct  360   QCHLKFDSCNGVMVHNVTISSPGDSPNTDGIHLQNSKDVLIYGSTMACGDDCISIQTGCS  419

Query  832   NVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKN  653
             NV+VH++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGG GSV+ 
Sbjct  420   NVYVHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNMHNTMNGVRIKTWQGGSGSVQG  479

Query  652   VSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNS  473
             V FS IQVS+V++PI+IDQ+YCDK  CKNQT AV++ G+ + +I GT+  +P H ACS+S
Sbjct  480   VLFSNIQVSEVELPIVIDQFYCDKRTCKNQTSAVSLAGINYERIRGTYTVKPVHFACSDS  539

Query  472   VPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS  293
             +PC DV L  ++L+P        N  CW +YG+ +    P  +D CL+ G     RI   
Sbjct  540   LPCVDVSLTSVELKPIQEKYHLYNPFCWQTYGELKTPTVPP-ID-CLQIGKPTNNRIQTD  597

Query  292   HE  287
             H+
Sbjct  598   HD  599



>ref|XP_008800720.1| PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera]
Length=483

 Score =   389 bits (999),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 208/408 (51%), Positives = 288/408 (71%), Gaps = 10/408 (2%)
 Frame = -3

Query  1492  YP--PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQ  1319
             YP  P ++ FD+L FGAKGDGV+DD+KA EAAW AACKV  +T+ +P++F F++ PI+  
Sbjct  80    YPTAPKAATFDVLDFGAKGDGVTDDTKAFEAAWAAACKVEASTMVVPAKFQFVVRPISFS  139

Query  1318  GP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKL  1142
             GP C P++V Q+DG +VAP +  +W  S + QW+ F  +   TI+G G  +GQG  WW  
Sbjct  140   GPYCQPNIVFQLDGRIVAPTSSKAW-GSGLLQWLQFTKLKGITIRGSGIIEGQGSVWWTN  198

Query  1141  SQ--IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVH  968
             S+  +  +  K ++K   +  KPTALRFY S +VT+ GI+I NSPQCHLKFDN + V V 
Sbjct  199   SESDVDPINAKLSAKMPEI--KPTALRFYGSYDVTVTGITIQNSPQCHLKFDNCEAVQVF  256

Query  967   NITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgi  788
             N+TIS+P NS NTDGIHLQNS+DV IHH+ +G GDDC+SIQTGCSNV++H++NCGPGHGI
Sbjct  257   NMTISSPGNSLNTDGIHLQNSKDVSIHHNDLGCGDDCISIQTGCSNVNIHNVNCGPGHGI  316

Query  787   slgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPI  608
             S+GGLGKD + ACVSNI V +V + +T+ G R+KTWQGG GSV+++ FS I+VS+V+ PI
Sbjct  317   SIGGLGKDNTKACVSNITVRDVNIHSTMTGVRVKTWQGGAGSVQSIRFSNIKVSEVQTPI  376

Query  607   MIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP  428
             +IDQ+YCD+ +CKNQT AV +  + +  I GTF  QP H ACS+S+PC+ + L +++L+P
Sbjct  377   VIDQFYCDRRSCKNQTSAVVLSSIAYENIKGTFTVQPVHFACSDSMPCSGISLTEVELKP  436

Query  427   SPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHEN  284
                +       CW +YG+      P  +  CL++G     RI   H++
Sbjct  437   LQEHYHMYEPFCWQAYGELYTPTVPPIV--CLQAGKPTSNRIQFDHDS  482



>ref|XP_004142980.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
Length=505

 Score =   389 bits (1000),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 204/423 (48%), Positives = 279/423 (66%), Gaps = 25/423 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S++F++L FGAKG+G +DD+KA E AW  ACKV G+TV +P+ + F + PI+  GP C P
Sbjct  86    SAIFNVLDFGAKGNGETDDTKAFEDAWAEACKVEGSTVMVPADYVFFVGPISFSGPYCQP  145

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             D++ Q+DG ++AP +  +W K  + QWI F  +   TI+G G  DG+G  WW+ S     
Sbjct  146   DIIFQLDGTIIAPTDHQTWGKG-LLQWIQFTKLVGITIRGNGIIDGRGSVWWQDSSFDEP  204

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              + +    I VN                     +KPTALRFY S N T+ GI+I NSPQC
Sbjct  205   IDDEMKLIIPVNNTINETKPTPIGSNLEGKMPSIKPTALRFYGSFNATVTGITIQNSPQC  264

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH+I++S+P +S NTDGIHLQNS+DV IH +++  GDDCVSIQTGCSN+
Sbjct  265   HLKFDNCVGVLVHDISVSSPGDSLNTDGIHLQNSKDVLIHSTSLSCGDDCVSIQTGCSNI  324

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+G LGKD + ACVSNI V +V M +T+ G RIKTWQGG GSV+NV 
Sbjct  325   YIHNVNCGPGHGISIGSLGKDHTKACVSNITVRDVTMHDTMNGVRIKTWQGGSGSVQNVL  384

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ+S+V++PI+IDQ+YCDK  C NQT AVA+ G+ + +I GT+  +P H ACS+++P
Sbjct  385   FSNIQMSEVQLPIVIDQFYCDKAKCSNQTSAVALSGINYERIRGTYTVKPVHFACSDNLP  444

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             CTDV L  I+L+P        +  CW ++G+ +    P     CL+ G     R+     
Sbjct  445   CTDVTLTTIELKPLQERYHLYDPFCWQTFGELRTPTSPPIG--CLQIGKPSSNRVQYEEN  502

Query  286   NIC  278
             + C
Sbjct  503   DSC  505



>gb|KGN62292.1| hypothetical protein Csa_2G348790 [Cucumis sativus]
Length=521

 Score =   390 bits (1001),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 204/423 (48%), Positives = 279/423 (66%), Gaps = 25/423 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S++F++L FGAKG+G +DD+KA E AW  ACKV G+TV +P+ + F + PI+  GP C P
Sbjct  102   SAIFNVLDFGAKGNGETDDTKAFEDAWAEACKVEGSTVMVPADYVFFVGPISFSGPYCQP  161

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             D++ Q+DG ++AP +  +W K  + QWI F  +   TI+G G  DG+G  WW+ S     
Sbjct  162   DIIFQLDGTIIAPTDHQTWGKG-LLQWIQFTKLVGITIRGNGIIDGRGSVWWQDSSFDEP  220

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              + +    I VN                     +KPTALRFY S N T+ GI+I NSPQC
Sbjct  221   IDDEMKLIIPVNNTINETKPTPIGSNLEGKMPSIKPTALRFYGSFNATVTGITIQNSPQC  280

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH+I++S+P +S NTDGIHLQNS+DV IH +++  GDDCVSIQTGCSN+
Sbjct  281   HLKFDNCVGVLVHDISVSSPGDSLNTDGIHLQNSKDVLIHSTSLSCGDDCVSIQTGCSNI  340

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+G LGKD + ACVSNI V +V M +T+ G RIKTWQGG GSV+NV 
Sbjct  341   YIHNVNCGPGHGISIGSLGKDHTKACVSNITVRDVTMHDTMNGVRIKTWQGGSGSVQNVL  400

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ+S+V++PI+IDQ+YCDK  C NQT AVA+ G+ + +I GT+  +P H ACS+++P
Sbjct  401   FSNIQMSEVQLPIVIDQFYCDKAKCSNQTSAVALSGINYERIRGTYTVKPVHFACSDNLP  460

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             CTDV L  I+L+P        +  CW ++G+ +    P     CL+ G     R+     
Sbjct  461   CTDVTLTTIELKPLQERYHLYDPFCWQTFGELRTPTSPPIG--CLQIGKPSSNRVQYEEN  518

Query  286   NIC  278
             + C
Sbjct  519   DSC  521



>ref|XP_002456022.1| hypothetical protein SORBIDRAFT_03g029030 [Sorghum bicolor]
 gb|EES01142.1| hypothetical protein SORBIDRAFT_03g029030 [Sorghum bicolor]
Length=532

 Score =   390 bits (1001),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 206/414 (50%), Positives = 280/414 (68%), Gaps = 15/414 (4%)
 Frame = -3

Query  1489  PPPSS----VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITL  1322
             PPP++    VF+++ FGAKGDGV+DD+KA E AW AAC    +TV +P +  FL+ PI+ 
Sbjct  124   PPPATSQGAVFNVVDFGAKGDGVTDDTKAFEGAWAAACNQGASTVLVPPELEFLVGPISF  183

Query  1321  QGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK  1145
              GP C P++V Q++G ++AP +  SW  S + QW+ F  ++   IQG G  +G+G  WW 
Sbjct  184   SGPYCKPNIVFQLEGTILAPTSAKSW-GSGLLQWLEFTKLNGIVIQGNGIINGRGQQWWT  242

Query  1144  LSQIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVN  974
                     +          M   KPTALRFY S NV + GI+IVNS QCHLKFDN +GV 
Sbjct  243   YLDPEDEDDDDTYDVEFERMPQIKPTALRFYGSFNVVVAGITIVNSSQCHLKFDNCQGVM  302

Query  973   VHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpgh  794
             VH++TIS+PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H++NCGPGH
Sbjct  303   VHDVTISSPENSLNTDGIHLQNSKDVSIHHTNLACGDDCISIQTGCSNINIHNVNCGPGH  362

Query  793   gislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKV  614
             GIS+GGLG+D + ACVSN+ V +V M  T+ G RIKTWQGGVG V+++ FS IQVS+V+ 
Sbjct  363   GISIGGLGRDNTKACVSNVTVRDVNMFRTMNGVRIKTWQGGVGLVQDIRFSNIQVSEVQT  422

Query  613   PIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQL  434
             PI+IDQ+YCD+  C+NQT AVA+ GV++  I GTF  +P H ACS+S+PC+ + L  +QL
Sbjct  423   PIIIDQFYCDRSTCRNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSLPCSGISLTGVQL  482

Query  433   EP--SPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
              P   P Y    N  CW ++G+      P     CL+ G      + +S+++IC
Sbjct  483   RPVQVPHYH-LNNPFCWQAFGELYTPTVPPIA--CLQIGKPAGNNL-QSYDDIC  532



>ref|XP_008812598.1| PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera]
Length=480

 Score =   388 bits (996),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/404 (51%), Positives = 287/404 (71%), Gaps = 8/404 (2%)
 Frame = -3

Query  1486  PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-C  1310
             P ++ FD+L FGAKGDGV+DD+KA EAAW AACKV  +T+ IP++  FL+ PI+  GP C
Sbjct  81    PHAATFDVLDFGAKGDGVTDDTKAFEAAWAAACKVEASTMVIPAESQFLVGPISFSGPYC  140

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ--  1136
               ++V Q+DG ++AP +  +W  S + QW+ F  ++  TI+G G  +G+G  WW  S+  
Sbjct  141   QHNIVFQLDGTIIAPTSSKAW-GSGLLQWLEFTKLNGITIRGSGIIEGRGSVWWTHSESD  199

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
             +  +  K ++K   +  KPTALRFY S NVT+ GI+I NS QCHLKFD  +GV V N+TI
Sbjct  200   VDPINVKLSAKMPQI--KPTALRFYGSFNVTVTGITIQNSQQCHLKFDYCEGVQVFNMTI  257

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P +SPNTDGIHLQNS++V IHH+ +G GDDCVSIQTGCSNV++H++NCGPGHGIS+GG
Sbjct  258   SSPGDSPNTDGIHLQNSREVSIHHTNLGCGDDCVSIQTGCSNVYIHNVNCGPGHGISIGG  317

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LG+D + ACVSNI V +V + NT+ G RIKTWQGG GSV+++ F+ I+VS+V+ PI+IDQ
Sbjct  318   LGRDNTKACVSNITVRDVNIHNTMTGVRIKTWQGGAGSVQSIRFTNIKVSEVQTPIIIDQ  377

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             +YCD+ +CKNQT AVA+  + +  I GTF  +P H ACS+S+PC+D+ L +++LEP   +
Sbjct  378   FYCDRRSCKNQTSAVALSSIAYENIKGTFTVKPVHFACSDSMPCSDISLTEVELEPLQEH  437

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHEN  284
                    CW +YG+      P  +  CL++G     RI   H++
Sbjct  438   YHMYEPFCWKAYGELYTPTVPPII--CLQTGKPTSNRIQSDHDS  479



>ref|XP_010924274.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Elaeis 
guineensis]
Length=487

 Score =   387 bits (994),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 209/413 (51%), Positives = 288/413 (70%), Gaps = 12/413 (3%)
 Frame = -3

Query  1501  GNCYPPPSS----VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLIN  1334
             G  YP P++    +FD+L FGAKGDGV+DD+KA EAAW AACKV  +T+ +P++F FL+ 
Sbjct  79    GKRYPTPAAPKAAMFDVLDFGAKGDGVTDDTKAFEAAWAAACKVEASTMVVPAEFRFLVR  138

Query  1333  PITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGP  1157
             PI+  GP C P++V Q+DG ++AP +  +W  S + QW+ F  +   TI G G  +G+G 
Sbjct  139   PISFSGPYCQPNIVFQLDGTIIAPTSSKAW-GSGLLQWLEFTKLKGITISGCGIIEGRGS  197

Query  1156  NWWKLSQ--IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSK  983
              WW  S+  +  +  K ++K   +  KPTALRFY S NVT+ GI+I NSPQCHLKFD   
Sbjct  198   VWWTNSESDVDPIHAKLSAKMPEI--KPTALRFYGSYNVTVTGITIQNSPQCHLKFDFCD  255

Query  982   GVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCg  803
              V V NITIS+P +S NTDGIHLQNS+DV IHH+ +G GDDC+SIQTGCSN+++H++NCG
Sbjct  256   AVQVFNITISSPGSSLNTDGIHLQNSKDVSIHHTDLGCGDDCISIQTGCSNINIHNVNCG  315

Query  802   pghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSD  623
             PGHGIS+GGLG+D + ACVSNI V +V M NT+ G R+KTWQGG GSV+++ FS I+VS+
Sbjct  316   PGHGISIGGLGRDNTKACVSNITVRDVNMHNTMNGVRVKTWQGGSGSVQSIRFSNIKVSE  375

Query  622   VKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLAD  443
             V+ PI+IDQ+YCD+ +CKNQT AVA+  + +  I GTF  QP  LACS+S+PC+ + L +
Sbjct  376   VQTPIVIDQFYCDRRSCKNQTSAVALSSIAYENIKGTFTVQPVRLACSDSLPCSGISLTE  435

Query  442   IQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHEN  284
             ++L+P   +       CW +YG+      P  +  CL++G     RI   H++
Sbjct  436   VELKPLQEHYHMYEPFCWQAYGELYTPTVPPIV--CLQTGKPTSNRIQSDHDS  486



>ref|XP_009629756.1| PREDICTED: polygalacturonase At1g48100-like [Nicotiana tomentosiformis]
Length=509

 Score =   388 bits (996),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 217/423 (51%), Positives = 284/423 (67%), Gaps = 26/423 (6%)
 Frame = -3

Query  1486  PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-C  1310
             P S++FD+ SFGA GDG +DD+KA +AAW AACKV  +T+ +PSQ+ FL+ PI+  GP C
Sbjct  88    PSSTIFDVRSFGATGDGKTDDTKAFQAAWAAACKVEASTIVVPSQYVFLVGPISFSGPYC  147

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
               ++V Q+DG ++AP++  SW  S + QW+ F  +   T++G G  DG+G  WW+ +   
Sbjct  148   QHNIVFQLDGTIIAPVDAKSW-GSGLMQWLEFTKLVGITVKGSGLIDGRGAVWWQDTPYD  206

Query  1129  SLQEKKASKTIHVN----------------------MKPTALRFYESTNVTIHGISIVNS  1016
                + +    I +N                      +KPTALRFY S NVT+ GI I NS
Sbjct  207   DPLDDELKLIIPLNKTSLRYPPIPLNSSLGGGKMPSIKPTALRFYGSFNVTVTGIIIQNS  266

Query  1015  PQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGC  836
              QCHLKFDN  GV V+N T+S+P +SPNTDGIHLQNS+DV I  S I  GDDCVSIQTGC
Sbjct  267   QQCHLKFDNCIGVTVYNFTVSSPGDSPNTDGIHLQNSKDVLIRSSNIACGDDCVSIQTGC  326

Query  835   SNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVK  656
             +NV+VH+INCGPGHGIS+G LGKD + ACVSNI V++VVM+NT+ G RIKTWQGG GSV+
Sbjct  327   TNVYVHNINCGPGHGISIGSLGKDNTKACVSNITVKDVVMQNTMNGVRIKTWQGGSGSVQ  386

Query  655   NVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSN  476
              V FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ F +I GT+  +P HLACS+
Sbjct  387   GVFFSNIQVSEVQLPIVIDQFYCDKSKCKNQTSAVALSGINFERIRGTYTVKPVHLACSD  446

Query  475   SVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIAR  296
             S+PC DV L DIQL+P        +  CW ++G+      P  +D CL+ G     RI  
Sbjct  447   SMPCQDVTLTDIQLKPIQERYHMYDPYCWQTFGELYTPTLPP-ID-CLQVGKPSSNRIQG  504

Query  295   SHE  287
              H+
Sbjct  505   DHD  507



>emb|CDY20962.1| BnaA08g25630D [Brassica napus]
Length=531

 Score =   389 bits (998),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 278/417 (67%), Gaps = 24/417 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG+ DD+KA EAAW AACKV  + + IP +++FL+ PI+  GP C P
Sbjct  118   SQVFNVMDFGAKGDGIRDDTKAFEAAWEAACKVEASMMIIPPEYTFLVGPISFSGPYCQP  177

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  ++ WI+F  +    +QG G  DG+G  WW+  Q +  
Sbjct  178   NIVFQLDGTIIAPTDSKSWGKGLMW-WIDFTKLVGIKVQGKGVIDGRGSGWWQ--QDYPF  234

Query  1123  QEKKASKTIHVN------------------MKPTALRFYESTNVTIHGISIVNSPQCHLK  998
              + +    + +N                  +KPTALRFY S  V + GI+I NSPQCHLK
Sbjct  235   IDGETKLIVPLNNSVNQNPPGSEFDLKMPSIKPTALRFYGSIGVEVSGITIQNSPQCHLK  294

Query  997   FDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVH  818
             FDN   V VH++T+S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSNV++H
Sbjct  295   FDNCGDVVVHDMTVSSPGDSPNTDGIHLQNTRDVLIHSTTLSCGDDCISIQTGCSNVYIH  354

Query  817   HINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSG  638
              + CGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS 
Sbjct  355   TVTCGPGHGISIGSLGKDSTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFSN  414

Query  637   IQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTD  458
             IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+  PC D
Sbjct  415   IQLNEVQLPIVIDQFYCDHTTCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDDFPCVD  474

Query  457   VHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             V L+ I+L+P        +  CW ++G+      P  +D CL+ G     R+   H+
Sbjct  475   VLLSAIELKPVQERYHMYDPFCWQTFGELNTPTLPP-ID-CLQIGKPARNRVQSDHD  529



>ref|XP_002314612.2| hypothetical protein POPTR_0010s05180g [Populus trichocarpa]
 gb|EEF00783.2| hypothetical protein POPTR_0010s05180g [Populus trichocarpa]
Length=516

 Score =   388 bits (996),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 200/391 (51%), Positives = 269/391 (69%), Gaps = 23/391 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L FGAKG+G SDD+KA +AAW  ACKV+ +T+ +P+++ FL+ PI+  GP C  
Sbjct  98    STTFNVLDFGAKGNGKSDDTKAFQAAWAEACKVAASTMIVPAEYVFLVGPISFSGPYCQA  157

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP N   W +  +FQW+ F  +   TIQG GT DG G  WW+       
Sbjct  158   NIVFQLDGTIIAPTNSNVWGRG-LFQWLEFTKLVGITIQGEGTIDGSGSVWWQDYPFEDP  216

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              + ++   + +N                     +KPTALRFY S NVT+ GI+I NSPQC
Sbjct  217   IDNESEFIVPLNNTAQQHPPMPIRSELSGKMPSIKPTALRFYGSFNVTVTGITIQNSPQC  276

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++  S+P +SPNTDGIHLQNS+DV IH + +  GDDCVSIQTGCSNV
Sbjct  277   HLKFDNCIGVVVHDMRTSSPGDSPNTDGIHLQNSKDVLIHSTDLACGDDCVSIQTGCSNV  336

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+GGLGKD + ACVSNI V +VV+  T+ G RIKTWQGG GSVK V 
Sbjct  337   YIHNVNCGPGHGISIGGLGKDNTKACVSNITVRDVVLHGTMTGVRIKTWQGGSGSVKGVL  396

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H ACS+++P
Sbjct  397   FSNIQVSEVQLPIVIDQFYCDKSICKNQTSAVALSGITYEKIRGTYTVKPVHFACSDALP  456

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGK  374
             C DV L  I+L+P        +  CW ++G+
Sbjct  457   CMDVSLTTIELQPLKEQYHLYDPFCWQTFGE  487



>ref|XP_009774333.1| PREDICTED: polygalacturonase At1g48100-like [Nicotiana sylvestris]
Length=505

 Score =   387 bits (995),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 235/495 (47%), Positives = 311/495 (63%), Gaps = 40/495 (8%)
 Frame = -3

Query  1660  IFCAAFSMMS--VE---ARKNRHAKKPRTPPPHKLKK-GRSDYRRNFpapapapaqlpPG  1499
             +F  AF + S  VE   AR+ RH ++  T      KK G+S +  N     P  +  P  
Sbjct  12    MFIVAFLVWSSNVETCYARRGRHWRQTTTSSASLYKKKGKSHHHNNGSKSKPKHSSPPSM  71

Query  1498  NCYPP--------PSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSF  1343
                PP         S++FD+ SFGA GDG +DD+KA +AAW AACKV  +T  +PSQ+ F
Sbjct  72    PTNPPRKGYDDVPSSTIFDVRSFGATGDGKTDDTKAFQAAWAAACKVEASTFVVPSQYVF  131

Query  1342  LINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDG  1166
             L+ PI+  GP C  ++V Q+DG ++AP++  SW  S + QW+ F  +   T++G G  DG
Sbjct  132   LVGPISFSGPYCQHNIVFQLDGTIIAPVDAKSW-GSGLMQWLEFTKLVGITVKGSGVIDG  190

Query  1165  QGPNWWKLSQIHSLQEKKASKTIHVN----------------------MKPTALRFYEST  1052
             +G  WW+ +      + +    I +N                      +KPTALRFY S 
Sbjct  191   RGSVWWQDTPYDDPLDDELKLIIPLNKTSLRYPPIPLNSSLGGGKMPSIKPTALRFYGSF  250

Query  1051  NVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIG  872
             NVT+ GI+I NS QCHLKFDN  GV V+N T+S+P +SPNTDGIHLQNS+DV I  S I 
Sbjct  251   NVTVTGITIQNSQQCHLKFDNCIGVTVYNFTVSSPGDSPNTDGIHLQNSKDVLIRSSNIA  310

Query  871   SGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGAR  692
              GDDCVSIQTGC+NV+VH+INCGPGHGIS+G LGKD + ACVSNI V++VVM+NT+ G R
Sbjct  311   CGDDCVSIQTGCTNVYVHNINCGPGHGISIGSLGKDNTKACVSNITVKDVVMQNTMNGVR  370

Query  691   IKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGT  512
             IKTWQGG GSV+ V FS IQVS+V++PI+IDQ+YCDK  CKNQ+ AVA+ G+ F +I GT
Sbjct  371   IKTWQGGSGSVQGVFFSNIQVSEVQLPIVIDQFYCDKSKCKNQSSAVALSGINFERIRGT  430

Query  511   FAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCL  332
             +  +P HLACS+S+PC DV L DIQL+P        +  CW ++G+      P  +D CL
Sbjct  431   YTVKPVHLACSDSMPCQDVTLTDIQLKPIQERYHMYDPYCWQTFGELYTPTLPP-ID-CL  488

Query  331   RSGSLLVKRIARSHE  287
             + G     RI   H+
Sbjct  489   QVGKPSSNRIQGDHD  503



>ref|XP_009144427.1| PREDICTED: polygalacturonase At1g48100-like [Brassica rapa]
Length=531

 Score =   388 bits (997),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 203/420 (48%), Positives = 281/420 (67%), Gaps = 25/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG+ DD+KA EAAW AACKV  + + IP +++FL+ PI+  GP C P
Sbjct  118   SQVFNVMDFGAKGDGIRDDTKAFEAAWEAACKVEASMMIIPPEYTFLVGPISFSGPYCQP  177

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  ++ WI+F  +    +QG G  DG+G  WW+  Q +  
Sbjct  178   NIVFQLDGTIIAPTDSKSWGKGLMW-WIDFTKLVGIKVQGKGVIDGRGSGWWQ--QDYPF  234

Query  1123  QEKKASKTIHVN------------------MKPTALRFYESTNVTIHGISIVNSPQCHLK  998
              + +    + +N                  +KPTALRFY S  V + GI+I NSPQCHLK
Sbjct  235   IDGETKLIVPLNNSVNQNPPISEFDLKMPSIKPTALRFYGSIGVEVSGITIQNSPQCHLK  294

Query  997   FDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVH  818
             FDN   V VH++T+S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSNV++H
Sbjct  295   FDNCGDVVVHDMTVSSPGDSPNTDGIHLQNTRDVLIHSTTLSCGDDCISIQTGCSNVYIH  354

Query  817   HINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSG  638
              + CGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS 
Sbjct  355   TVTCGPGHGISIGSLGKDSTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFSN  414

Query  637   IQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTD  458
             IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+  PC D
Sbjct  415   IQLNEVQLPIVIDQFYCDHTTCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDDFPCVD  474

Query  457   VHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             V L+ I+L+P        +  CW ++G+      P  +D CL+ G    + I +S  ++C
Sbjct  475   VQLSAIELKPVQERYHMYDPFCWQTFGELNTPTLPP-ID-CLQIGK-PARNIVQSDHDVC  531



>ref|XP_010533949.1| PREDICTED: polygalacturonase At1g48100-like [Tarenaya hassleriana]
Length=541

 Score =   388 bits (996),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 284/423 (67%), Gaps = 25/423 (6%)
 Frame = -3

Query  1489  PPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-  1313
             P  S VF++L FGAKGDG SDD+KA EAAW  ACKV  + + +P+ + FL+ PI+  GP 
Sbjct  120   PQGSGVFNVLDFGAKGDGRSDDTKAFEAAWAEACKVEASMMIVPNDYVFLVGPISFSGPY  179

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK----  1145
             C  ++V Q+DG +VAP +  SW K  +  WI F  +   T+QG G  DG+G  WW+    
Sbjct  180   CQANIVFQLDGTMVAPTDSNSWGKG-LMWWIEFTKLKGITVQGNGVIDGRGSGWWQDYPF  238

Query  1144  ------LSQI-----HSLQEKKASKTIHV------NMKPTALRFYESTNVTIHGISIVNS  1016
                   L+++     +S+QE+              ++KPTALRFY S NVT+ GI+I NS
Sbjct  239   EDPIDDLTKLIVPLNNSVQERPPMPVRSELSGRMPSIKPTALRFYGSFNVTVTGITIQNS  298

Query  1015  PQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGC  836
             PQCHLKFDN  GV VH++++S+P +SPNTDGIHLQNS+DV IH +T+  GDDC+SIQTGC
Sbjct  299   PQCHLKFDNCVGVLVHDMSVSSPGDSPNTDGIHLQNSKDVLIHGTTLSCGDDCISIQTGC  358

Query  835   SNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVK  656
             SNV++H++NCGPGHGIS+G LG+D + ACVSNI V +V+M NT+ G RIKTWQGG GSV+
Sbjct  359   SNVYIHNVNCGPGHGISIGSLGRDSTKACVSNITVRDVIMHNTMTGVRIKTWQGGSGSVQ  418

Query  655   NVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSN  476
              V FS IQVS+V+ PI+IDQ+YCD  +CKNQT AVA++GV + +I GT+  +P H ACS+
Sbjct  419   GVMFSNIQVSEVQFPIVIDQFYCDHASCKNQTSAVAVKGVTYEKIRGTYTVKPVHFACSD  478

Query  475   SVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIAR  296
             + PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G      +  
Sbjct  479   NSPCVDVQLSSIELKPIQEQYHMYDPYCWQTFGELNTPTVPP-ID-CLQIGKPSRNGVQS  536

Query  295   SHE  287
              H+
Sbjct  537   DHD  539



>emb|CDY47212.1| BnaC09g14610D [Brassica napus]
Length=536

 Score =   387 bits (995),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 210/424 (50%), Positives = 285/424 (67%), Gaps = 26/424 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  117   SQEFNVLDFGAKGDGMSDDTEAFEAAWASACKVEASTMVIPPDYIFLVGPISFSGPYCQA  176

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             ++V Q+DG +VAP +  SW +  +  WI F  +   TIQG G  DG+G  WW+       
Sbjct  177   NIVFQLDGMIVAPTDSESWGRG-LLWWIEFTKLKGITIQGNGVIDGRGTGWWQQDNPFDY  235

Query  1144  ---------LSQIHSLQEK-----KASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQC  1007
                      +   +++QE+     ++      ++KPTALRFY S +VT+ GI+I NSPQC
Sbjct  236   PVDDDFKLIVPLNNTVQERPPMPIRSELNGMPSIKPTALRFYGSIDVTVTGITIQNSPQC  295

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN   V VH++T+S+P +SPNTDGIHLQN++DV IH ST+  GDDC+SIQTGCSNV
Sbjct  296   HLKFDNCVQVLVHDVTVSSPGDSPNTDGIHLQNTRDVMIHTSTLACGDDCISIQTGCSNV  355

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             +VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGGVGSVK V 
Sbjct  356   YVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGVGSVKGVL  415

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ+++V++PI+IDQ+YCD   C+NQT AVA++GV + +I GT+  +P H ACS+S P
Sbjct  416   FSNIQLTEVQLPIVIDQFYCDHSKCRNQTSAVAVEGVTYEKIRGTYTVKPVHFACSDSFP  475

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L+ I+L+P        +  CW ++G       P  +D CL+ G      +   H+
Sbjct  476   CVDVQLSGIELKPVQLQYHMYDPFCWKAFGLLNSPTVPP-ID-CLQIGKPARNGVHTDHD  533

Query  286   NICL  275
              IC+
Sbjct  534   -ICV  536



>ref|NP_001148771.1| polygalacturonase precursor [Zea mays]
 gb|ACG32854.1| polygalacturonase precursor [Zea mays]
Length=541

 Score =   388 bits (996),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 204/406 (50%), Positives = 276/406 (68%), Gaps = 11/406 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDGV+DD+KA E AW AACK    TV +P +  FL+ PI+  GP C  +
Sbjct  141   AVFNVVDFGAKGDGVTDDTKAFEGAWAAACKKGACTVLVPPELEFLVGPISFSGPYCKSN  200

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             +V Q++G ++AP +  SW  S + QW+ F  ++   IQG G  +G+G  WW  S      
Sbjct  201   IVFQLEGTILAPTSAKSW-GSGLLQWLEFTKLNGMVIQGNGIINGRGQQWWTYSDTEDED  259

Query  1120  EKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
             +          M   KPTALRFY S NV + GI+IVNS QCHLKFDN +GV VH++TIS+
Sbjct  260   DDDTYDVEFERMPQIKPTALRFYGSFNVVVAGITIVNSSQCHLKFDNCQGVMVHDLTISS  319

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H++NCGPGHGIS+GGLG
Sbjct  320   PENSLNTDGIHLQNSKDVSIHHTNLACGDDCISIQTGCSNINIHNVNCGPGHGISIGGLG  379

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +D + ACVSN+ V +V M  T+ G RIKTWQGGVG V+++ FS IQVS+V+ PI+IDQ+Y
Sbjct  380   RDNTKACVSNVTVRDVNMFRTMNGVRIKTWQGGVGLVQDIRFSNIQVSEVQTPIIIDQFY  439

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--SPGY  416
             CD+  C+NQT AVA+ GV++  I GTF  +P H ACS+S+PC+ + L  +QL P   P Y
Sbjct  440   CDRSTCRNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSLPCSGISLTGVQLRPVQVPHY  499

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
                 N  CW ++G+      P     CL+ G      + +S+++IC
Sbjct  500   H-LNNPFCWQAFGELYTPTVPPIA--CLQIGKPAGNNL-QSYDDIC  541



>ref|XP_006392146.1| hypothetical protein EUTSA_v10023404mg [Eutrema salsugineum]
 gb|ESQ29432.1| hypothetical protein EUTSA_v10023404mg [Eutrema salsugineum]
Length=538

 Score =   387 bits (995),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 208/424 (49%), Positives = 286/424 (67%), Gaps = 26/424 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG++DD++A E+AW +ACKV  +T+ IPS + FL+ PI+  GP C P
Sbjct  118   SQEFNVLDFGAKGDGMTDDTEAFESAWASACKVEASTMIIPSDYIFLVGPISFSGPYCQP  177

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             ++V Q+DG +VAP +  +W +  +  WI F  + + TIQG G  DG+G  WW+       
Sbjct  178   NIVFQLDGMIVAPTDSETWGRG-LMWWIEFTKLKAITIQGKGVIDGRGTVWWQQDYPFNY  236

Query  1144  ---------LSQIHSLQEK-----KASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQC  1007
                      +   +S+QE+     ++      ++KPTALRFY S +VT+ GI+I NSPQC
Sbjct  237   PIDDDFKLIVPLNNSVQERPPMPIRSELNGMPSIKPTALRFYGSIDVTVTGITIQNSPQC  296

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN   V VH++ +S+P +SPNTDGIHLQN++DV I+ ST+  GDDC+SIQTGCSNV
Sbjct  297   HLKFDNCVQVLVHDVNVSSPGDSPNTDGIHLQNTRDVLIYSSTLACGDDCISIQTGCSNV  356

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             +VH +NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGGVGSVK + 
Sbjct  357   YVHGVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGVGSVKGIV  416

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+S P
Sbjct  417   FSNIQLTEVQLPIVIDQFYCDHSKCKNQTSAVAVEGVTYEKIRGTYTVKPVHFACSDSFP  476

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L+ I+L+P           CW ++G+      P  +D CL+ G      +   H+
Sbjct  477   CIDVQLSGIELKPVQQQYHMYEPFCWKTFGELNSPTVPP-ID-CLQIGKPARNGVHTDHD  534

Query  286   NICL  275
              IC+
Sbjct  535   -ICV  537



>emb|CDY50367.1| BnaA09g13160D [Brassica napus]
Length=536

 Score =   387 bits (995),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 210/424 (50%), Positives = 286/424 (67%), Gaps = 26/424 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  117   SQEFNVLDFGAKGDGMSDDTEAFEAAWASACKVEASTMVIPPDYIFLVGPISFSGPYCQA  176

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             ++V Q+DG +VAP +  SW +  ++ WI F  +   TIQG G  DG+G  WW+       
Sbjct  177   NIVFQLDGMIVAPTDSESWGRGLLW-WIEFTKLKGITIQGNGVIDGRGTGWWQQDNPFDY  235

Query  1144  ---------LSQIHSLQEK-----KASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQC  1007
                      +   +++QE+     ++      ++KPTALRFY S +VT+ GI+I NSPQC
Sbjct  236   PIDDDFKLIVPLNNTVQERPPMPIRSELNGMPSIKPTALRFYGSIDVTVTGITIQNSPQC  295

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN   V VH++T+S+P +SPNTDGIHLQN++DV IH ST+  GDDC+SIQTGCSNV
Sbjct  296   HLKFDNCVQVLVHDVTVSSPGDSPNTDGIHLQNTRDVMIHTSTLACGDDCISIQTGCSNV  355

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             +VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGGVGSVK V 
Sbjct  356   YVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGVGSVKGVL  415

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ+++V++PI+IDQ+YCD   C+NQT AVA++GV + +I GT+  +P H ACS+S P
Sbjct  416   FSNIQLTEVQLPIVIDQFYCDHSKCRNQTSAVAVEGVTYEKIRGTYTVKPVHFACSDSFP  475

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L+ I+L+P        +  CW ++G       P  +D CL+ G      +   H+
Sbjct  476   CVDVQLSGIELKPVQLQYHMYDPFCWKAFGLLNSPTVPP-ID-CLQIGKPARNGVHTDHD  533

Query  286   NICL  275
              IC+
Sbjct  534   -ICV  536



>ref|NP_001150912.1| polygalacturonase precursor [Zea mays]
 gb|ACG40925.1| polygalacturonase precursor [Zea mays]
Length=536

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 203/409 (50%), Positives = 281/409 (69%), Gaps = 17/409 (4%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF ++ FGAKGDG +DD+KA + AW AAC    +T+ +P +  FL+ PI+  GP C P+
Sbjct  136   AVFSVVDFGAKGDGATDDTKAFQGAWAAACTQGASTLLVPPELEFLVGPISFSGPYCKPN  195

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             +V Q++G ++AP++  SW  S + QW+ F  ++   IQG G  +G+G  WW  S     +
Sbjct  196   IVFQLEGTILAPISAKSW-GSGLLQWLEFTKLNGVVIQGNGIINGRGQQWWTYS---DPE  251

Query  1120  EKKASKTIHVN------MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNIT  959
             ++    T HV       +KPTALRFY S NV + GI+IVNS QCHLKFDN +GV VH++T
Sbjct  252   DEDDDDTYHVEFQRMPQIKPTALRFYGSFNVVVSGITIVNSSQCHLKFDNCQGVMVHDVT  311

Query  958   ISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislg  779
             IS+PE S NTDGIHLQNS+DV IHH+T+  GDDC+SIQTGCSN+++H++NCGPGHGIS+G
Sbjct  312   ISSPEKSLNTDGIHLQNSKDVSIHHTTLACGDDCISIQTGCSNINIHNVNCGPGHGISIG  371

Query  778   glGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMID  599
             GLG+D + ACVSN+ V +V M  T+ G RIKTWQGGVGSV+++ FS IQVS+V+ PI+ID
Sbjct  372   GLGRDNTKACVSNVTVRDVNMFRTMNGVRIKTWQGGVGSVQDIRFSNIQVSEVQTPIIID  431

Query  598   QYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--S  425
             Q+YCD+  C+NQT AV + GV++  I GTF  +P H ACS+S+PC+ + L  +QL P   
Sbjct  432   QFYCDRSTCRNQTSAVEVSGVQYENIRGTFTIKPVHFACSDSLPCSGISLTGVQLRPVQV  491

Query  424   PGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             P Y    N  CW ++G+      P     CL+ G      + +S+++IC
Sbjct  492   PHYH-LNNPFCWQAFGELYTPTVPPIA--CLQIGKPAGNNL-QSYDDIC  536



>ref|XP_010417992.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=540

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 209/425 (49%), Positives = 282/425 (66%), Gaps = 27/425 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  120   SQQFNVLDFGAKGDGMSDDTQAFEAAWASACKVEASTMVIPPDYIFLVGPISFSGPYCQA  179

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI---  1133
             ++V Q+DG +VAP +  SW +  +  WI F  +   TIQG G  DG+G  WW+   +   
Sbjct  180   NIVFQLDGMIVAPTDTKSWGRG-LLWWIEFTKLKGITIQGKGVIDGRGTVWWQQDYLTDY  238

Query  1132  -------------HSLQE------KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
                          +S+QE      +        ++KPTALRFY S +VT+ G++I NSPQ
Sbjct  239   PIDDDFKLIVRLNNSVQEHPPMPIRSELNGRMPSIKPTALRFYGSIDVTVTGVTIQNSPQ  298

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQNS+DV IH ST+  GDDC+SIQTGCSN
Sbjct  299   CHLKFDNCVQVLVHDVNVSSPGDSPNTDGIHLQNSKDVMIHTSTLACGDDCISIQTGCSN  358

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V+VH++NCGPGHGIS+G LGKD S ACVSNI V +VVM NT+ G RIKTWQGG+GSVK +
Sbjct  359   VYVHNVNCGPGHGISIGSLGKDSSKACVSNITVRDVVMHNTMTGVRIKTWQGGIGSVKGI  418

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   C NQT AV+++GV + +I GT+  +P H ACS+S 
Sbjct  419   LFSNIQLTEVQLPIVIDQFYCDHSKCMNQTSAVSVEGVTYEKIRGTYTVKPVHFACSDSF  478

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G      +   H
Sbjct  479   PCIDVQLSGIELKPVQLQYHMSDPFCWKTFGELTSTTVPP-ID-CLQIGKPARNGVHSDH  536

Query  289   ENICL  275
             + ICL
Sbjct  537   D-ICL  540



>gb|ACN35722.1| unknown [Zea mays]
 gb|AFW83379.1| polygalacturonase [Zea mays]
Length=541

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 204/406 (50%), Positives = 276/406 (68%), Gaps = 11/406 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDGV+DD+KA E AW AACK    TV +P +  FL+ PI+  GP C  +
Sbjct  141   AVFNVVDFGAKGDGVTDDTKAFEGAWAAACKKGACTVLVPPELEFLVGPISFSGPYCKSN  200

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             +V Q++G ++AP +  SW  S + QW+ F  ++   IQG G  +G+G  WW  S      
Sbjct  201   IVFQLEGTILAPTSAKSW-GSGLLQWLEFTKLNGMVIQGNGIINGRGQQWWTYSDTEDED  259

Query  1120  EKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
             +          M   KPTALRFY S NV + GI+IVNS QCHLKFDN +GV VH++TIS+
Sbjct  260   DDDTYDVEFERMPQIKPTALRFYGSFNVVVAGITIVNSSQCHLKFDNCQGVMVHDLTISS  319

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H++NCGPGHGIS+GGLG
Sbjct  320   PENSLNTDGIHLQNSKDVSIHHTNLACGDDCISIQTGCSNINIHNVNCGPGHGISIGGLG  379

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +D + ACVSN+ V +V M  T+ G RIKTWQGGVG V+++ FS IQVS+V+ PI+IDQ+Y
Sbjct  380   RDNTKACVSNVTVRDVNMFRTMNGVRIKTWQGGVGLVQDIRFSNIQVSEVQTPIIIDQFY  439

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--SPGY  416
             CD+  C+NQT AVA+ GV++  I GTF  +P H ACS+S+PC+ + L  +QL P   P Y
Sbjct  440   CDRSTCRNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSLPCSGISLTGVQLRPVQVPHY  499

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
                 N  CW ++G+      P     CL+ G      + +S+++IC
Sbjct  500   H-LNNPFCWQAFGELYTPTVPPIA--CLQIGKPAGNNL-QSYDDIC  541



>ref|XP_004969270.1| PREDICTED: polygalacturonase At1g48100-like [Setaria italica]
Length=538

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 205/412 (50%), Positives = 280/412 (68%), Gaps = 14/412 (3%)
 Frame = -3

Query  1486  PPSS---VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
             PP+S   VF+++ FGAKGDGV+DD+KA E AW AACK   +TV +P +  FL+ PI+  G
Sbjct  132   PPASQGEVFNVVDFGAKGDGVTDDTKAFEGAWAAACKQGASTVLVPPELEFLVGPISFSG  191

Query  1315  P-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS  1139
             P C P++V Q++G ++AP +  +W  S + QW+ F  ++   IQG G  +G+G  WW  +
Sbjct  192   PYCKPNIVFQLEGTILAPTSAKAW-GSGLLQWLEFTKLNGIVIQGNGIINGRGQQWWTYA  250

Query  1138  QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVH  968
              +    E          M   KPTALRFY S NV + GI+IVNS QCHLKFDN +GV VH
Sbjct  251   DLEDEDEDDTYDVEFETMPHIKPTALRFYGSFNVLVAGITIVNSSQCHLKFDNCQGVMVH  310

Query  967   NITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgi  788
             ++TIS+PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H++NCGPGHGI
Sbjct  311   DVTISSPENSLNTDGIHLQNSKDVSIHHTNMACGDDCISIQTGCSNINIHNVNCGPGHGI  370

Query  787   slgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPI  608
             S+GGLG+D + ACVSN+ V +V M  T+ G RIKTWQGGVG V+++ FS IQV++V+ PI
Sbjct  371   SIGGLGRDNTKACVSNVTVRDVNMLRTMNGVRIKTWQGGVGLVQDIRFSNIQVTEVQTPI  430

Query  607   MIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP  428
             +IDQ+YCDK  C+NQT AV + GV++  I GTF  +P H ACS+S+PC+ + L  +QL P
Sbjct  431   IIDQFYCDKSTCRNQTSAVGVSGVQYENIRGTFTIKPVHFACSDSLPCSGISLTGVQLRP  490

Query  427   --SPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
                P Y    N  CW ++G+      P     CL+ G      + +++ +IC
Sbjct  491   VQVPHYH-LNNPFCWQAFGELYTPTVPPIA--CLQLGKPAGNNL-QTYNDIC  538



>gb|ABK95830.1| unknown [Populus trichocarpa]
Length=516

 Score =   386 bits (991),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/391 (51%), Positives = 269/391 (69%), Gaps = 23/391 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L FGAKG+G SDD+KA +AAW  ACKV+ +T+ +P+++ FL+ PI+  GP C  
Sbjct  98    STTFNVLDFGAKGNGKSDDTKAFQAAWAEACKVAASTMIVPAEYVFLVGPISFSGPYCQA  157

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP N   W +  +FQW+ F  +   TIQG GT DG G  WW+       
Sbjct  158   NIVFQLDGTIIAPTNSNVWGRG-LFQWLEFTKLVGITIQGEGTIDGSGSVWWQDYPFEDP  216

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              + ++   + +N                     +KPTALRFY S NVT+ GI+I NSPQC
Sbjct  217   IDNESEFIVPLNNTAQQHPPMPIRSELSGKMPSIKPTALRFYGSFNVTVTGITIQNSPQC  276

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++  S+P +SPNTDGIHLQNS+DV IH + +  GDDCVSIQTGCSNV
Sbjct  277   HLKFDNCIGVVVHDMRTSSPGDSPNTDGIHLQNSKDVLIHSTDLACGDDCVSIQTGCSNV  336

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+GGLGKD + ACVSNI V +VV+  T+ G RIKTWQGG GSV+ V 
Sbjct  337   YIHNVNCGPGHGISIGGLGKDNTKACVSNITVRDVVLHGTMTGVRIKTWQGGSGSVQGVL  396

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H ACS+++P
Sbjct  397   FSNIQVSEVQLPIVIDQFYCDKSICKNQTSAVALSGITYEKIRGTYTVKPVHFACSDALP  456

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGK  374
             C DV L  I+L+P        +  CW ++G+
Sbjct  457   CMDVSLTTIELQPLKEQYHLYDPFCWQTFGE  487



>ref|XP_009394799.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=475

 Score =   384 bits (987),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 215/465 (46%), Positives = 303/465 (65%), Gaps = 14/465 (3%)
 Frame = -3

Query  1660  IFCAAFS-MMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCYPP  1484
             +F   +S     E R+ +H ++ + PP   L + ++    N             G   P 
Sbjct  16    VFLVMYSNFHDCEGRRGKH-RRAKQPPSSSLARKKAK-GNNGGDRRHGSGGGSGGQPRPT  73

Query  1483  P---SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             P   +++FD+L FGAKGDGV+DD+KA EAAW AACKV  +TV +P++F FL+ PI+  GP
Sbjct  74    PETMAAMFDVLDFGAKGDGVTDDTKAFEAAWAAACKVEASTVIVPAEFEFLVRPISFSGP  133

Query  1312  -CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWW--KL  1142
              C P++V Q+DG +VAP + G+W   S+ QW+ F  +   TI+G G  DG+G  WW    
Sbjct  134   YCEPNIVFQLDGTIVAPTSAGAWGAGSL-QWLEFTKLQEITIRGSGVIDGRGSVWWTNSD  192

Query  1141  SQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNI  962
             S I  +  +  SK   +  KPTALRFY S NVT+ GI I NSP+CHLKFDN + V V NI
Sbjct  193   SDIDPINAELGSKMPQI--KPTALRFYGSYNVTVTGIRIQNSPRCHLKFDNCEAVEVFNI  250

Query  961   TISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgisl  782
             T+S+P +SPNTDGIHLQNS++V IH   +G GDDCVSIQTGCSN+++H ++CGPGHGIS+
Sbjct  251   TVSSPGDSPNTDGIHLQNSRNVLIHRVDMGCGDDCVSIQTGCSNIYIHDVDCGPGHGISI  310

Query  781   gglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMI  602
             GGLG+D + ACVSNI V ++ + NT+ G RIKTWQGG GSV+ + FS I+V +V++P++I
Sbjct  311   GGLGRDNTKACVSNITVRDINLRNTMTGVRIKTWQGGSGSVQAIQFSNIKVWEVQIPMVI  370

Query  601   DQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSP  422
             DQ+YCD+ +C+NQ+ AVA+  + +  I GTF  +P HLACS+S PC+ + L++++LEP  
Sbjct  371   DQFYCDRSSCENQSSAVALSSIAYESIRGTFTVKPVHLACSDSSPCSGISLSEVELEPLQ  430

Query  421   GYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
                   +  CW ++G+      P     CL+ G     RI+  H+
Sbjct  431   ERYHMTDPFCWQAFGELYAPTIPPIT--CLQIGKPASNRISTDHD  473



>ref|XP_010510936.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=534

 Score =   386 bits (992),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 209/425 (49%), Positives = 282/425 (66%), Gaps = 27/425 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  114   SQQFNVLDFGAKGDGMSDDTQAFEAAWASACKVEASTMVIPPDYIFLVGPISFSGPYCQA  173

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI---  1133
             ++V Q+DG +VAP +  SW +  +  WI F  +   TIQG G  DG+G  WW+   +   
Sbjct  174   NIVFQLDGMIVAPTDTKSWGRG-LLWWIEFTKLKGITIQGKGVIDGRGTVWWQQDYLSDY  232

Query  1132  -------------HSLQE------KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
                          +S+QE      +        ++KPTALRFY S +VT+ GI+I NSPQ
Sbjct  233   PIDDDFKLIVPLNNSVQEHPPMPIRSELNGRMPSIKPTALRFYGSIDVTVTGITIQNSPQ  292

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQNS+DV IH ST+  GDDC+SIQTGCSN
Sbjct  293   CHLKFDNCVQVLVHDVNVSSPGDSPNTDGIHLQNSKDVMIHTSTLACGDDCISIQTGCSN  352

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V+VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGG+GSVK +
Sbjct  353   VYVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTITGVRIKTWQGGIGSVKGI  412

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   C NQT AV+++GV + +I GT+  +P H ACS+S 
Sbjct  413   LFSNIQLTEVQLPIVIDQFYCDHSKCMNQTSAVSVEGVTYEKIRGTYTVKPVHFACSDSF  472

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G      +   H
Sbjct  473   PCIDVQLSGIELKPVQLQYHMSDPFCWKTFGELTSATVPP-ID-CLQIGKPARNGVHSDH  530

Query  289   ENICL  275
             + ICL
Sbjct  531   D-ICL  534



>ref|XP_002457998.1| hypothetical protein SORBIDRAFT_03g025260 [Sorghum bicolor]
 gb|EES03118.1| hypothetical protein SORBIDRAFT_03g025260 [Sorghum bicolor]
Length=420

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 204/392 (52%), Positives = 269/392 (69%), Gaps = 23/392 (6%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
             +   +LSFGA  DGV+DD++AL AAW  AC+V  ATV +PS   FL++P+TLQGPC   L
Sbjct  29    TTLSVLSFGAAADGVTDDAEALVAAWRVACRVPRATVLLPSGHRFLLSPVTLQGPCSTKL  88

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
              LQ              P+  + QW+NFKW+  F+I G GT DGQ     + +   +   
Sbjct  89    TLQ--------------PRRPL-QWLNFKWLQDFSILGAGTVDGQSITSLQSASSPANNS  133

Query  1117  KKASKTIH---VNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAP  947
                + T H     +KPT +RFY S NVT+  I I NSPQCHLKFD+S G+ V NITIS+P
Sbjct  134   TSQTSTGHWHSPGVKPTLIRFYNSFNVTVRNIRITNSPQCHLKFDSSGGIKVKNITISSP  193

Query  946   ENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGK  767
              +SPNTDGIHLQN++DVEI  STIG GDDCVSIQTGCSNVH+ ++ C PGHGISLGGLGK
Sbjct  194   GDSPNTDGIHLQNTRDVEIKSSTIGCGDDCVSIQTGCSNVHIKNVVCNPGHGISLGGLGK  253

Query  766   DKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYC  587
             D S+ACVS+++ EN++++N LYG RIKTWQGGVGSV+N++FS ++V++V  PI IDQ+YC
Sbjct  254   DYSLACVSDVVAENIIVQNALYGVRIKTWQGGVGSVRNITFSNVRVANVATPIAIDQFYC  313

Query  586   DKHA--CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYR  413
             D+    C N+TGAVAI GV + ++VGT++ QP  LACS++ PCT V + D++L P+    
Sbjct  314   DRGGARCANRTGAVAITGVAYRRVVGTYSFQPVRLACSDARPCTGVTMVDVRLSPAATAA  373

Query  412   GFRNGQ---CWNSYGKSQGQLFPASMDYCLRS  326
             G        CWNSYG+++G + P  +    RS
Sbjct  374   GGGATVAPLCWNSYGEARGTIQPLGVGCLQRS  405



>ref|XP_006307174.1| hypothetical protein CARUB_v10008765mg [Capsella rubella]
 gb|EOA40072.1| hypothetical protein CARUB_v10008765mg [Capsella rubella]
Length=549

 Score =   387 bits (993),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 200/421 (48%), Positives = 280/421 (67%), Gaps = 23/421 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KA EAAW  ACK+  +T+ +PS+++FL+ PI+  GP C  
Sbjct  132   SQVFNVMDFGAKGDGKCDDTKAFEAAWAGACKIEASTMIVPSEYTFLVGPISFSGPYCQA  191

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W K  +  WI+F  +    +QG G  DG+G  WW+       
Sbjct  192   NIVFQLDGTIIAPTDAKTWGKG-LMWWIDFTKLKGIKVQGKGVIDGRGSGWWQQDYPFID  250

Query  1123  QEKKASKTIH-------------------VNMKPTALRFYESTNVTIHGISIVNSPQCHL  1001
              E K    ++                    ++KPTALRFY S  V + GI+I NSPQCHL
Sbjct  251   GETKLIVPLYNSTHQHPPMPIRSELDGRMPSIKPTALRFYGSFGVEVSGITIQNSPQCHL  310

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN  GV+VH++ +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSNV+V
Sbjct  311   KFDNCVGVSVHDMVVSSPGDSPNTDGIHLQNTKDVLIHSATLACGDDCISIQTGCSNVYV  370

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LGK+ + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS
Sbjct  371   HNVNCGPGHGISIGSLGKEGTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFS  430

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS++ PC 
Sbjct  431   NIQLNEVQLPIVIDQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDNSPCV  490

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENI  281
             DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     ++  S  ++
Sbjct  491   DVQLSSIELKPVQERYHMYDPFCWQTFGELNTPTLPP-ID-CLQIGKPPRNKVHESDHDV  548

Query  280   C  278
             C
Sbjct  549   C  549



>ref|XP_008446197.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis melo]
 gb|ADN33828.1| polygalacturonase [Cucumis melo subsp. melo]
Length=530

 Score =   386 bits (991),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 278/417 (67%), Gaps = 31/417 (7%)
 Frame = -3

Query  1489  PPP-----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPIT  1325
             PPP     S +F++L FGAKGDG +DD+KA +  W A+CKV+ +T  +PS++ FL+ PI+
Sbjct  103   PPPQKGGHSFMFNVLDFGAKGDGKTDDTKAFQDTWTASCKVAASTFIVPSKYVFLVGPIS  162

Query  1324  LQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWW  1148
               GP C PD+V Q+DG ++AP +   W K  + QW+ F  +   TIQG G  DG+G  WW
Sbjct  163   FSGPYCQPDIVFQLDGTIIAPTDFKVWGKG-LLQWLQFTKLMGLTIQGNGVIDGRGSVWW  221

Query  1147  K---------------LSQIHSLQEKKASKTIHVNM-------KPTALRFYESTNVTIHG  1034
             +               L  ++S  ++K        +       KPTALRFY S NVT+ G
Sbjct  222   QEISPYDDPIDDEFKLLIPLNSTVQEKPPAPARSELVGKMPRIKPTALRFYGSFNVTVTG  281

Query  1033  ISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCV  854
             I+I NSPQCHLKFDN  GV VH+  +S+P +S NTDGIHLQNS+DV I+ ST+  GDDC+
Sbjct  282   ITIQNSPQCHLKFDNCIGVLVHDFNVSSPGDSLNTDGIHLQNSKDVLIYSSTLSCGDDCI  341

Query  853   SIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQG  674
             SIQTGCSNV++H++NCGPGHGIS+G LGKD + ACVSNI V +V+M NT+ G RIKTWQG
Sbjct  342   SIQTGCSNVYIHNVNCGPGHGISIGSLGKDNTKACVSNITVRDVIMHNTMNGVRIKTWQG  401

Query  673   GVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPF  494
             G+G V+ V FS IQVS+VK+PI+IDQ+YCDK  C NQT AVA+ G+ + +I GT+  +P 
Sbjct  402   GLGFVQGVLFSNIQVSEVKIPIVIDQFYCDKAKCSNQTSAVALSGINYERIRGTYTVKPV  461

Query  493   HLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             H ACS+++PCTD+ L  I+L+P           CW ++G+ +    P  +D CL+ G
Sbjct  462   HFACSDNLPCTDISLTAIELKPLQELYHLYGAYCWQTFGELRTPTVPP-ID-CLQIG  516



>ref|XP_002521450.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF40940.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=466

 Score =   383 bits (984),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 208/391 (53%), Positives = 273/391 (70%), Gaps = 15/391 (4%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             + F++L +GAKGDG +DD+KA EAAW AACKV  +T+ +PS   FL++PI+  GP C  +
Sbjct  75    ATFNVLDYGAKGDGRTDDTKAFEAAWIAACKVEASTIVVPSGSMFLVHPISFSGPACAEN  134

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             +V Q+DG ++AP +  +W  S + QWI F  +   TI+G G  DGQG  WW     +S  
Sbjct  135   IVFQLDGKIIAPTSATAW-GSGLLQWIEFTKLKGITIKGKGIIDGQGSVWWNDLPAYSPH  193

Query  1120  EKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
              + A + ++  M   KPTALRFY ST+VT+ GI+I NSPQ HLKFD+  GV V   T ++
Sbjct  194   SEVAGE-LNAKMPGTKPTALRFYGSTDVTVTGITIQNSPQTHLKFDDCTGVQVSEFTAAS  252

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             PENSPNTDGIHLQNS+DV I+ S +  GDDCVSIQTGCSNV++H++NCGPGHGIS+GGLG
Sbjct  253   PENSPNTDGIHLQNSRDVVIYSSDLSCGDDCVSIQTGCSNVYIHNVNCGPGHGISIGGLG  312

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             KD + ACVSN+ V +V M+NTL G RIKTWQGG GSV+ V+FS IQVS V+ PIMIDQ+Y
Sbjct  313   KDNTKACVSNVTVRDVQMQNTLTGVRIKTWQGGSGSVQGVTFSNIQVSGVETPIMIDQFY  372

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CD   C+N++ AVA+ G+ +  I GT+   P HLACS++ PCT V L  I+L+ S G   
Sbjct  373   CDGSKCRNESSAVAVSGINYMNIKGTYTRNPLHLACSDNSPCTGVSLETIELK-SVG---  428

Query  409   FRNGQ--CWNSYGKSQGQLFPASMDYCLRSG  323
               N Q  CWN+YG+ +    P     CL++G
Sbjct  429   -ENSQPFCWNTYGELRSATVPPV--NCLQTG  456



>ref|XP_004135250.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
 gb|KGN51797.1| hypothetical protein Csa_5G601470 [Cucumis sativus]
Length=530

 Score =   385 bits (990),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 278/417 (67%), Gaps = 31/417 (7%)
 Frame = -3

Query  1489  PPP-----SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPIT  1325
             PPP     S +F++L FGAKGDG +DD+KA +  W A+CKV+ +T  +PS++ FL+ PI+
Sbjct  103   PPPQKEGHSIMFNVLDFGAKGDGKTDDTKAFQDTWTASCKVAASTFIVPSKYVFLVGPIS  162

Query  1324  LQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWW  1148
               GP C PD+V Q+DG ++AP +   W K  + QW+ F  +   TIQG G  DG+G  WW
Sbjct  163   FSGPYCQPDIVFQLDGTIIAPTDFKVWGKG-LLQWLQFTKLMGLTIQGNGVIDGRGSVWW  221

Query  1147  K---------------LSQIHSLQEKKASKTIHVNM-------KPTALRFYESTNVTIHG  1034
             +               L  ++S  ++K        +       KPTALRFY S NVT+ G
Sbjct  222   QEISPYDDPIDDEFKLLIPLNSTVQEKPPPPARSELVGKMPRIKPTALRFYGSFNVTVTG  281

Query  1033  ISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCV  854
             I+I NSPQCHLKFDN  GV VH+  +S+P +S NTDGIHLQNS+DV I+ ST+  GDDC+
Sbjct  282   ITIQNSPQCHLKFDNCIGVLVHDFNVSSPGDSLNTDGIHLQNSKDVLIYSSTLSCGDDCI  341

Query  853   SIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQG  674
             SIQTGCSNV++H++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQG
Sbjct  342   SIQTGCSNVYIHNVNCGPGHGISIGSLGKDNTKACVSNITVRDVTMHNTMNGVRIKTWQG  401

Query  673   GVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPF  494
             G+G V+ V FS IQVS+VK+PI+IDQ+YCDK  C NQT AVA+ G+ + +I GT+  +P 
Sbjct  402   GLGFVQGVLFSNIQVSEVKIPIVIDQFYCDKAKCSNQTAAVALSGINYERIRGTYTVKPV  461

Query  493   HLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             H ACS+++PCTD+ L  I+L+P        +  CW ++G+ +    P  +D CL+ G
Sbjct  462   HFACSDNLPCTDISLTAIELKPLQELYHLYSAYCWQTFGELRTPTVPP-ID-CLQIG  516



>ref|XP_010473235.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=542

 Score =   386 bits (991),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 208/425 (49%), Positives = 281/425 (66%), Gaps = 27/425 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  122   SQQFNVLDFGAKGDGMSDDTQAFEAAWASACKVEASTMVIPPDYIFLVGPISFSGPYCQA  181

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI---  1133
             ++V Q+DG +VAP +  SW +  +  WI F  +   TIQG G  DG+G  WW+   +   
Sbjct  182   NIVFQLDGMIVAPTDTKSWGRG-LLWWIEFTKLKGITIQGKGVIDGRGTVWWQQDYLSDY  240

Query  1132  -------------HSLQE------KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
                          +S+QE      +        ++KPTALRFY S  VT+ G++I NSPQ
Sbjct  241   PIDDDFKLIVPLNNSVQEHPPMPIRSELSGRMPSIKPTALRFYGSIGVTVTGVTIQNSPQ  300

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQNS+DV IH ST+  GDDC+SIQTGCSN
Sbjct  301   CHLKFDNCVQVLVHDVNVSSPGDSPNTDGIHLQNSKDVMIHTSTLACGDDCISIQTGCSN  360

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V+VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGG+GSVK +
Sbjct  361   VYVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGIGSVKGI  420

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   C NQT AV+++GV + +I GT+  +P H ACS+S 
Sbjct  421   LFSNIQLTEVQLPIVIDQFYCDHSKCMNQTSAVSVEGVTYEKIRGTYTVKPVHFACSDSF  480

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G    +    S 
Sbjct  481   PCIDVQLSGIELKPVQLQYHMSDPFCWKTFGELTSTTVPP-ID-CLQIGK-PARNGVHSD  537

Query  289   ENICL  275
              +ICL
Sbjct  538   RDICL  542



>ref|XP_006302097.1| hypothetical protein CARUB_v10020088mg, partial [Capsella rubella]
 gb|EOA34995.1| hypothetical protein CARUB_v10020088mg, partial [Capsella rubella]
Length=550

 Score =   386 bits (991),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 206/425 (48%), Positives = 284/425 (67%), Gaps = 27/425 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ +P+++ FL+ PI+  GP C  
Sbjct  130   SQAFNVLDFGAKGDGMSDDTQAFEAAWASACKVEASTMIVPAEYIFLVGPISFSGPYCQA  189

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI---  1133
             ++V Q+DG +VAP +  SW +  +  WI F  +   TIQG G  DG+G  WW+   +   
Sbjct  190   NIVFQLDGMIVAPTDTDSWGRG-LMWWIEFTKLKGITIQGKGVIDGRGTVWWQQDYLSDY  248

Query  1132  -------------HSLQE------KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
                          +S+QE      +        ++KPTALRFY S +VT+ GI+I NSPQ
Sbjct  249   PIDDDFKLIVPLNNSVQEHPPMPIRSELNGRMPSIKPTALRFYGSIDVTVTGITIQNSPQ  308

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++++S+P +SPNTDGIHLQN++DV IH ST+  GDDC+SIQTGCSN
Sbjct  309   CHLKFDNCVQVLVHDVSVSSPGDSPNTDGIHLQNTKDVMIHTSTLACGDDCISIQTGCSN  368

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V+VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGG+GSVK +
Sbjct  369   VYVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGIGSVKGI  428

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   C N T AV+++GV + +I GT+  +P H ACS+S 
Sbjct  429   LFSNIQLTEVQLPIVIDQFYCDHSKCMNHTSAVSVEGVTYEKIRGTYTVKPVHFACSDSY  488

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G      +   H
Sbjct  489   PCIDVQLSGIELKPVQLQYHMSDPFCWKTFGELISTTVPP-ID-CLQIGKPARNGVHSDH  546

Query  289   ENICL  275
             + ICL
Sbjct  547   D-ICL  550



>ref|XP_006470302.1| PREDICTED: polygalacturonase At1g48100-like [Citrus sinensis]
Length=473

 Score =   383 bits (984),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 197/374 (53%), Positives = 260/374 (70%), Gaps = 9/374 (2%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S++F++LS+GAKGDG +DD+KA EAAW AACK+ GAT+ +PS   FL+ PI+  GP C P
Sbjct  73    SAIFNVLSYGAKGDGRTDDTKAFEAAWVAACKIEGATMVVPSGSVFLVGPISFSGPTCQP  132

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWW-KLSQIHS  1127
             +++ Q+DG ++AP N G+W  S I QW+ F  +   T+ G G  DGQG  WW      + 
Sbjct  133   NILFQLDGKIIAPTNSGAW-GSGILQWLEFSKLKGLTLTGKGIIDGQGSVWWHDAPSSYG  191

Query  1126  LQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               +  AS  +  NM   KPTALRFY S+ VT+ GI+I NS Q HLKFD+   V V + T 
Sbjct  192   TADDSASSALKGNMPGTKPTALRFYGSSGVTVAGITIQNSQQTHLKFDDCTAVQVSDFTA  251

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P +SPNTDGIHLQNSQDV IH ST+  GDDC+SIQTGCSN+ VH++NCGPGHGIS+G 
Sbjct  252   SSPGDSPNTDGIHLQNSQDVTIHSSTLACGDDCISIQTGCSNIDVHNVNCGPGHGISIGS  311

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKD + ACVS I V +V M +T+ G RIKTWQGG G V+ V+FS IQV+DVK PI+IDQ
Sbjct  312   LGKDNTKACVSKITVRDVTMHDTMTGVRIKTWQGGSGLVQQVTFSNIQVNDVKSPIVIDQ  371

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYC+K +C N++ AV +  + +  I GT+  QP H ACS+ +PCT + L+ + L+P    
Sbjct  372   YYCEKSSCHNESSAVQVSNIAYVNIRGTYTEQPAHFACSDILPCTGISLSTVALKP---V  428

Query  415   RGFRNGQCWNSYGK  374
             +  R   CW +YG+
Sbjct  429   QSARQPFCWEAYGE  442



>ref|XP_008230581.1| PREDICTED: polygalacturonase At1g48100 [Prunus mume]
Length=511

 Score =   384 bits (986),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 204/398 (51%), Positives = 272/398 (68%), Gaps = 15/398 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+VF++L +GAKGDG +DD+KA E AW AACKV  +T+ +PS   FL+ PI+  GP C P
Sbjct  100   SNVFNVLDYGAKGDGKADDTKAFETAWAAACKVQASTINVPSGSVFLVKPISFSGPNCEP  159

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP + G W  S + QW+ F  +   +I+G G  DGQG  WW  S  +++
Sbjct  160   NIVFQLDGKIIAPTSSGDW-GSGLLQWLEFTKLKGISIKGKGVIDGQGSVWWSDSPTYNI  218

Query  1123  ---QEKKASKTIHV--------NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
                Q   +S+   +        + KPTALRFY S  V++ GI++ NSPQ HLKFD    V
Sbjct  219   PADQTYSSSQDTVIESDSGKMPSTKPTALRFYGSDGVSVTGITLQNSPQAHLKFDACTNV  278

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V +I+IS+P +SPNTDGIHLQNSQDV I  ++I  GDDC+SIQTGCS+++VH++NCGPG
Sbjct  279   QVSDISISSPGDSPNTDGIHLQNSQDVVIFGTSIACGDDCISIQTGCSSIYVHNVNCGPG  338

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HG+S+GGLGKD + ACVSN+ V +V M NTL G RIKTWQGG GSV+N+ FS IQVS+V 
Sbjct  339   HGVSIGGLGKDNTRACVSNVTVRDVKMHNTLTGVRIKTWQGGSGSVQNIMFSNIQVSEVA  398

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PIMIDQ+YCDK  C+N+T AVAI GV +  I GT+  +P H ACS+S+PCT V L  IQ
Sbjct  399   TPIMIDQFYCDKSKCQNETSAVAISGVNYVNIQGTYTTKPVHFACSDSLPCTGVSLDTIQ  458

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             L+     +      CW +YG+ +    P  +D CL+ G
Sbjct  459   LKSVDEGKQLYGPFCWEAYGELKTSTVP-EID-CLKKG  494



>ref|XP_009419849.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=461

 Score =   382 bits (981),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 202/408 (50%), Positives = 286/408 (70%), Gaps = 9/408 (2%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             YP  +++F++L FGAKGDG++DD++A +AAW AACKV G+TV +P++F FL+ PI+  GP
Sbjct  60    YPMKTAMFNVLDFGAKGDGITDDTEAFQAAWAAACKVEGSTVVVPAEFEFLVGPISFSGP  119

Query  1312  -CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKL--  1142
              C P++ LQ+DG ++AP +   W  S +  WI F  +   +IQG GT +GQG  WW    
Sbjct  120   YCQPNIALQLDGMIIAPTDAKRW-GSGLLWWIEFSKLQGISIQGSGTIEGQGSVWWTTME  178

Query  1141  SQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNI  962
             S +  +  + + K   +  KPTALRFY S NVT+ GI+I NSPQCHLKFDN + V V N+
Sbjct  179   SDVDPINAELSMKLPQI--KPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVQVFNM  236

Query  961   TISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgisl  782
             TI++P +S NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H + CGPGHGIS+
Sbjct  237   TINSPGSSLNTDGIHLQNSRDVMIHHTNMSCGDDCISIQTGCSNINIHSVECGPGHGISI  296

Query  781   gglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMI  602
             GGLG+D + ACVSNI + +V M NT+ G RIKTWQGG GSV+++ FS I+VS+V+ P++I
Sbjct  297   GGLGRDNTKACVSNITIRDVNMHNTMTGVRIKTWQGGSGSVQSIKFSNIRVSEVQTPVVI  356

Query  601   DQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSP  422
             DQ+YCD+ +CKNQT AVA+  + +  I GT+  +P H ACS+S PC+D+ L +++LEP  
Sbjct  357   DQFYCDRSSCKNQTSAVALSSIAYENIKGTYTVKPVHFACSDSSPCSDISLTEVELEPLQ  416

Query  421   GYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
              +       CW ++G+      P  +  CL++G    K I  S +++C
Sbjct  417   EHYHIYEPFCWQAFGELYTPTVPPIV--CLQNGKPTSKPIL-SDDDLC  461



>ref|XP_010044612.1| PREDICTED: polygalacturonase At1g48100-like [Eucalyptus grandis]
 gb|KCW86702.1| hypothetical protein EUGRSUZ_B03312 [Eucalyptus grandis]
Length=521

 Score =   384 bits (986),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/390 (51%), Positives = 265/390 (68%), Gaps = 23/390 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L FGAKGDG +DD+KA E AW AACKV  + + IP+++ F + PI+  GP C  
Sbjct  101   SATFNVLDFGAKGDGSTDDTKAFEDAWAAACKVEASMMIIPAKYVFFVGPISFSGPFCQA  160

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             ++++QVDG +VAP    +W K  + QW+ F  +   TIQG GT DG+G  WW+       
Sbjct  161   NILVQVDGTIVAPTENKAWGKG-LLQWLEFTKLRGITIQGQGTIDGRGSVWWEDYPFDEP  219

Query  1144  -------LSQIHSLQEKKASKTIHVNM-------KPTALRFYESTNVTIHGISIVNSPQC  1007
                    L  ++S  E+     +   +       KPTALRFY S NVT+ GI+I NSPQ 
Sbjct  220   IDDETQLLIPLNSTVERSPPMPVRNELGAKMPSIKPTALRFYGSFNVTVTGITIRNSPQF  279

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++++S+P NSPNTDGIHLQNS+DV IH + +  GDDC+SIQTGCSNV
Sbjct  280   HLKFDNCMGVLVHDMSVSSPGNSPNTDGIHLQNSKDVLIHSTDLACGDDCISIQTGCSNV  339

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+G LG+D + ACVSNI V +V + NT+ G RIKTWQGG GSV+ V 
Sbjct  340   YIHNVNCGPGHGISIGSLGRDHTKACVSNITVRDVNIHNTMTGVRIKTWQGGSGSVQGVM  399

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS +QVS+V+ PI+IDQYYCDK  C NQ+ AVA+ G+ + +I GT+  +P H ACS+S+P
Sbjct  400   FSNVQVSEVQFPIIIDQYYCDKSTCMNQSSAVALSGITYERIRGTYTVRPVHFACSDSLP  459

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYG  377
             C DV L  IQL+P        N  CW ++G
Sbjct  460   CVDVTLTAIQLKPVQEQYHLYNPFCWQTFG  489



>ref|XP_010682533.1| PREDICTED: polygalacturonase At1g48100 [Beta vulgaris subsp. 
vulgaris]
Length=542

 Score =   384 bits (987),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 201/423 (48%), Positives = 283/423 (67%), Gaps = 26/423 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             +++F +L +GAKGDG +DD+KA E+AW AACKV  +T+ IPS + FL+ PI+  GP C  
Sbjct  124   NNIFSVLDYGAKGDGNNDDTKAFESAWAAACKVQSSTMLIPSGYQFLVGPISFSGPYCQR  183

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             +++ Q+DG +VAP +  +W K+++  W++F  +   TIQG G  DG G  WW  +     
Sbjct  184   NIIFQLDGTIVAPTSPNAW-KANLMWWMDFTKLVGITIQGKGVIDGSGSVWWTNAPYDPE  242

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
             ++ +    + +N                     +KPTALRFY S NVT+ GI+I NSPQC
Sbjct  243   EDHEMKLVVPLNNSILERPPMPVRSQLNGRMPSVKPTALRFYGSINVTVTGITIQNSPQC  302

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV V+++++S+P +SPNTDGIHLQNS+DV IH S +  GDDC+SIQTGCSNV
Sbjct  303   HLKFDNCNGVLVYSMSVSSPGDSPNTDGIHLQNSKDVLIHSSNLACGDDCISIQTGCSNV  362

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H +NCGPGHGIS+G LG+  + ACVSN+ V +V ++ T+ G RIKTWQGG GSV+ ++
Sbjct  363   YIHSVNCGPGHGISIGSLGRYNTKACVSNVTVRDVNIQGTMTGVRIKTWQGGSGSVQGIT  422

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQYYCDK  CKNQT AVA+ GV +  I GT+  +P HLACS+ +P
Sbjct  423   FSNIQVSEVQLPIVIDQYYCDKSTCKNQTTAVAVSGVTYQNIKGTYTVKPVHLACSDGLP  482

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             CTD+ L  IQL+P        +  CW ++G+    + P     CL+ G  L  ++ ++  
Sbjct  483   CTDITLNTIQLKPLQERYHLYDPYCWETFGELMAPIAPPLG--CLQIGKPLKNKV-QTDV  539

Query  286   NIC  278
             +IC
Sbjct  540   DIC  542



>ref|XP_009113198.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
Length=536

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/424 (49%), Positives = 284/424 (67%), Gaps = 26/424 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  117   SQEFNVLDFGAKGDGMSDDTEAFEAAWASACKVEASTMVIPPDYIFLVGPISFSGPYCQA  176

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             ++V Q+DG +VAP +  SW +  +  WI F  +   TIQG G  DG+G  WW+       
Sbjct  177   NIVFQLDGMIVAPTDSESWGRG-LLWWIEFTKLKGITIQGNGVIDGRGTGWWQQDNPFDY  235

Query  1144  ---------LSQIHSLQEK-----KASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQC  1007
                      +   +++QE+     ++      ++KPTALRFY S +VT+ GI+I NSPQC
Sbjct  236   PIDDDFKLIVPLNNTVQERPPMPIRSELNGMPSIKPTALRFYGSIDVTVTGITIQNSPQC  295

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN   V VH++T+S+P +SPNTDGIHLQN++DV IH ST+  GDDC+SIQTGCSNV
Sbjct  296   HLKFDNCVQVLVHDVTVSSPGDSPNTDGIHLQNTRDVMIHTSTLACGDDCISIQTGCSNV  355

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             +VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGGVGSVK V 
Sbjct  356   YVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGVGSVKGVL  415

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ+++V++PI+IDQ+YCD   CKNQ+ AV+++GV +  I GT+  +P H ACS+S P
Sbjct  416   FSNIQLTEVQLPIVIDQFYCDHSKCKNQSSAVSVEGVTYENIRGTYTVKPVHFACSDSFP  475

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L+ I+L+P        +  CW ++G       P  +D CL+ G      +   H+
Sbjct  476   CVDVQLSGIELKPVQLQYHMYDPFCWKAFGLLNSPTVPP-ID-CLQIGKPARNGVHTDHD  533

Query  286   NICL  275
              +C+
Sbjct  534   -VCV  536



>ref|XP_006841584.1| hypothetical protein AMTR_s00003p00197480 [Amborella trichopoda]
 gb|ERN03259.1| hypothetical protein AMTR_s00003p00197480 [Amborella trichopoda]
Length=466

 Score =   381 bits (978),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 205/387 (53%), Positives = 266/387 (69%), Gaps = 8/387 (2%)
 Frame = -3

Query  1492  YPPPS------SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINP  1331
             YPPP+      + FD+L+FGA GDGV+DD+KA EAAW AACKV  +T+ +P++F FL+ P
Sbjct  59    YPPPAYRDRSENAFDVLNFGAVGDGVTDDTKAFEAAWAAACKVEASTLVVPAEFHFLVGP  118

Query  1330  ITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPN  1154
             I+  GP C P++V Q++G +VAP     W +  + QWI F  +   T+ G G  DG+G  
Sbjct  119   ISFAGPYCQPNIVFQLEGTIVAPTKREVWGRYGMLQWIQFSKLRGITVSGQGVIDGRGAA  178

Query  1153  WWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVN  974
             WW  S    +   + SK    ++KPTALRFY S NV + GI+I NSPQCHLKFD   GV 
Sbjct  179   WWGGSSYQQI-TGQFSKVAMPSIKPTALRFYGSFNVMVTGITIQNSPQCHLKFDACTGVI  237

Query  973   VHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpgh  794
             V NI + +P +S NTDGIHLQNS+DV + HS    GDDCVSIQTGCSNV++H INCGPGH
Sbjct  238   VSNINVLSPGDSLNTDGIHLQNSKDVLVQHSNFACGDDCVSIQTGCSNVYLHDINCGPGH  297

Query  793   gislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKV  614
             GIS+GGLG+D + ACVSN+ V NVV+ NT++G RIKTWQGG GSV+ V FS +QV +V+ 
Sbjct  298   GISIGGLGRDNTKACVSNVTVRNVVIRNTMHGVRIKTWQGGSGSVQGVLFSNVQVFEVQF  357

Query  613   PIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQL  434
             PI+IDQ+YCD+  CKNQT AVA++G+ +  I GT+  +P H ACS+SVPC  V L +IQL
Sbjct  358   PIVIDQFYCDRRTCKNQTAAVALEGITYENIRGTYTIKPMHFACSDSVPCMGVVLNNIQL  417

Query  433   EPSPGYRGFRNGQCWNSYGKSQGQLFP  353
              P        +  CW++YG S     P
Sbjct  418   HPIQEAFHMYDADCWHAYGVSLATCIP  444



>ref|XP_010475939.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=537

 Score =   383 bits (984),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 200/421 (48%), Positives = 278/421 (66%), Gaps = 23/421 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KALE+AW A CK   + + +P +++FL+ PIT  GP C  
Sbjct  120   SQVFNVMDFGAKGDGKCDDTKALESAWAATCKTEASMMIVPPEYTFLVGPITFSGPYCQA  179

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  +  WI+F  +    +QG G  DG+G  WW+     + 
Sbjct  180   NIVFQLDGTIIAPTDSKSWGKG-LMWWIDFTKLKGIKVQGKGVIDGRGSGWWQQDYPFTD  238

Query  1123  QEKKASKTIH-------------------VNMKPTALRFYESTNVTIHGISIVNSPQCHL  1001
              E K    ++                    ++KPTALRF  S  V + GI+I NSPQCHL
Sbjct  239   GETKLIVPLYNSTHQHPPMPIRSELDGRMPSIKPTALRFSGSIGVEVTGITIQNSPQCHL  298

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN  GV+VH+I +S+P +SPNTDGIH+QN++DV IH +T+  GDDC+SIQTGCSNV+V
Sbjct  299   KFDNCVGVSVHDIVVSSPGDSPNTDGIHIQNTKDVLIHSATLACGDDCISIQTGCSNVYV  358

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LGK+ + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS
Sbjct  359   HNVNCGPGHGISIGSLGKEGTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFS  418

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+S PC 
Sbjct  419   NIQLNEVELPIVIDQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDSFPCV  478

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENI  281
             DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     ++  S  ++
Sbjct  479   DVQLSSIELKPVQERYHMYDPFCWQTFGELGTPTLPP-ID-CLQIGKPPRNKVHESDHDV  536

Query  280   C  278
             C
Sbjct  537   C  537



>gb|EPS67779.1| polygalacturonase, partial [Genlisea aurea]
Length=489

 Score =   381 bits (979),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 205/406 (50%), Positives = 266/406 (66%), Gaps = 28/406 (7%)
 Frame = -3

Query  1489  PPPSS----VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITL  1322
             PP SS    VF++L FGAKGDG +DD+KA E AW  ACKV  + + IP  ++FL+ PI+ 
Sbjct  63    PPASSLLPNVFNVLDFGAKGDGTTDDTKAFEGAWAEACKVEASVIYIPPHYAFLVGPISF  122

Query  1321  QGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK  1145
              GP C  +++ Q+DG +VAP +   W  S   QW+ F  +   TI+G GT DG G  WW+
Sbjct  123   SGPYCQHNIIFQLDGTIVAPTSSDKW-GSGTLQWLEFSKLVGVTIRGSGTVDGSGDVWWQ  181

Query  1144  LSQIHSLQEKKASKTIHV----------------------NMKPTALRFYESTNVTIHGI  1031
              +          SK I                         +KPTA+RFY S NVT+ GI
Sbjct  182   SAPFDDDPLDDQSKLIFPLNQTLPKHRLIPSGIDSAGEMPKIKPTAVRFYGSFNVTVTGI  241

Query  1030  SIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVS  851
             +I  SPQCHLKFDN  GV+VHN T+S+P +SPNTDGIHLQNS+DV IH S +  GDDCVS
Sbjct  242   TIRRSPQCHLKFDNCIGVHVHNFTVSSPGDSPNTDGIHLQNSKDVLIHTSNVSCGDDCVS  301

Query  850   IQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGG  671
             IQTGC+NV+VH+INCGPGHGIS+GGLG+D + ACVSNI V +V M+NT+ G RIKTWQGG
Sbjct  302   IQTGCTNVYVHNINCGPGHGISIGGLGRDNTKACVSNITVRDVSMDNTMNGVRIKTWQGG  361

Query  670   VGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFH  491
              GSV+ V FS IQ+S+V++PI+IDQ+YCDK  CKNQ+ AV++ G+ +  I GT+  +P H
Sbjct  362   SGSVRGVQFSNIQMSNVQLPIVIDQFYCDKAQCKNQSSAVSLTGINYENIRGTYTVKPVH  421

Query  490   LACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             LACS+  PC DV L +IQL+  P      +  CW ++G+      P
Sbjct  422   LACSDYTPCVDVSLKNIQLKAQPQRYHMYDPYCWQTFGQLYSPTIP  467



>gb|EYU44763.1| hypothetical protein MIMGU_mgv1a018728mg, partial [Erythranthe 
guttata]
Length=430

 Score =   379 bits (972),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 203/399 (51%), Positives = 270/399 (68%), Gaps = 20/399 (5%)
 Frame = -3

Query  1474  VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDL  1298
              F++L +GAKGDG++DD+ A   AW  ACKV G+ + +PS   FL+ PI+  GP CM ++
Sbjct  21    TFNVLKYGAKGDGIADDTNAFGGAWADACKVQGSIMLVPSGSVFLVKPISFSGPNCMSNI  80

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             V Q++G ++AP N G+W  S + QW+ F  +   TI+G G  DGQG  WWKL+   +++ 
Sbjct  81    VFQLEGKIIAPTNSGAW-GSGLLQWLEFTKLKGITIRGKGIIDGQGSIWWKLTTNSAVES  139

Query  1117  KKASKTIHVNM---------KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHN  965
             + +     +N          KPTALRFY ST+VT+ GI+I NSPQ HLKFD   GV V  
Sbjct  140   ESSYLPNSINTEANGGMPSTKPTALRFYGSTDVTVTGITIQNSPQTHLKFDGCTGVQVSG  199

Query  964   ITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgis  785
             ++IS+P NSPNTDGIHLQNSQ+V I  +T+  GDDC+SIQTGCSN++V ++NCGPGHGIS
Sbjct  200   VSISSPGNSPNTDGIHLQNSQNVVIQATTLACGDDCISIQTGCSNIYVRNVNCGPGHGIS  259

Query  784   lgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIM  605
             +GGLGKD + ACVSN+ V + +++NTL G RIK+WQGG GSVK V F  IQVS+V+ PI+
Sbjct  260   IGGLGKDGTKACVSNVTVRDSIIQNTLNGIRIKSWQGGSGSVKGVLFVNIQVSEVENPII  319

Query  604   IDQYYCDKH-ACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP  428
             IDQYYCD H  C N+T AVAI GV +  I GT+ A P HLACS+S+PC  + L+ I L P
Sbjct  320   IDQYYCDGHNNCPNKTSAVAISGVSYQSIKGTYTANPVHLACSDSIPCAGITLSTIALNP  379

Query  427   SPGYRGFRNGQ----CWNSYGKSQGQLFPASMDYCLRSG  323
             S   +G +N      CW ++G+ Q    P     CL+ G
Sbjct  380   S--TKGVKNNNNNPYCWRAFGEIQTATTPPVS--CLQKG  414



>dbj|BAH56488.1| polygalacturonase 1 [Prunus persica]
Length=510

 Score =   381 bits (979),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 203/399 (51%), Positives = 268/399 (67%), Gaps = 16/399 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+VF++L +GAKGDG +DD+KA E AW AACKV  +T+ +PS   FL+ PI+  GP C  
Sbjct  98    SNVFNVLDYGAKGDGKADDTKAFETAWAAACKVPASTINVPSGSVFLVKPISFSGPNCEA  157

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
             ++V Q+DG ++AP + G W  S + QW+ F  +   +I+G G  DGQG  WW  S     
Sbjct  158   NIVFQLDGKIIAPTSSGDW-GSGLLQWLEFTKLKGISIKGKGVIDGQGSVWWSDSPTTYN  216

Query  1138  ----QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKG  980
                 Q +S  +    ++    M   KPTALRFY S  V++ GI++ NSPQ HLKFD    
Sbjct  217   IPADQTYSSSQDTVIESDSGKMPSTKPTALRFYGSDGVSVTGITLQNSPQTHLKFDACTN  276

Query  979   VNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgp  800
             V V +I+IS+P +SPNTDGIHLQNSQDV I  ++I  GDDC+SIQTGCSN++VH++NCGP
Sbjct  277   VQVSDISISSPGDSPNTDGIHLQNSQDVVIFGTSIACGDDCISIQTGCSNIYVHNVNCGP  336

Query  799   ghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDV  620
             GHG+S+ GLGKD + ACVSN+ V +V M NTL G RIKTWQGG GSV+N+ FS IQVS+V
Sbjct  337   GHGVSIVGLGKDNTRACVSNVTVRDVKMHNTLTGVRIKTWQGGSGSVQNIMFSNIQVSEV  396

Query  619   KVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADI  440
               PIMIDQ+YCDK  C+N+T AVA+ GV +  I GT+  +P H ACS+S+PCT V L  I
Sbjct  397   ATPIMIDQFYCDKSKCQNETSAVAVSGVNYVNIQGTYTTKPVHFACSDSLPCTGVSLDTI  456

Query  439   QLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             QL+     +      CW +YG+ +    P  +D CL+ G
Sbjct  457   QLKSVDEGKQLYGPFCWEAYGELKTSTVP-EID-CLKKG  493



>ref|XP_007217288.1| hypothetical protein PRUPE_ppa018113mg [Prunus persica]
 gb|EMJ18487.1| hypothetical protein PRUPE_ppa018113mg [Prunus persica]
Length=510

 Score =   381 bits (978),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 204/399 (51%), Positives = 269/399 (67%), Gaps = 16/399 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+VF++L +GAKGDG +DD+KA E AW AACKV  +T+ +PS   FL+ PI+  GP C  
Sbjct  98    SNVFNVLDYGAKGDGKADDTKAFETAWAAACKVPASTINVPSGSVFLVKPISFSGPNCEA  157

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
             ++V Q+DG ++AP + G W  S + QW+ F  +   +I+G G  DGQG  WW  S     
Sbjct  158   NIVFQLDGKIIAPTSSGDW-GSGLLQWLEFTKLKGISIKGKGVIDGQGSVWWSDSPTTYN  216

Query  1138  ----QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKG  980
                 Q +S  +    ++    M   KPTALRFY S  V++ GI++ NSPQ HLKFD    
Sbjct  217   IPADQTYSSSQDTVIESDSGKMPSTKPTALRFYGSDGVSVTGITLQNSPQTHLKFDACTN  276

Query  979   VNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgp  800
             V V +I+IS+P +SPNTDGIHLQNSQDV I  ++I  GDDC+SIQTGCSN++VH++NCGP
Sbjct  277   VQVSDISISSPGDSPNTDGIHLQNSQDVVIFGTSIACGDDCISIQTGCSNIYVHNVNCGP  336

Query  799   ghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDV  620
             GHG+S+GGLGKD + ACVSN+ V +V M NTL G RIKTWQGG GSV+N+ FS IQVS+V
Sbjct  337   GHGVSIGGLGKDNTRACVSNVTVRDVKMHNTLTGVRIKTWQGGSGSVQNIMFSNIQVSEV  396

Query  619   KVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADI  440
               PIMIDQ+YCDK  C+N+T AVA+ GV +  I GT+  +P H ACS+S+PCT V L  I
Sbjct  397   ATPIMIDQFYCDKSKCQNETSAVAVSGVNYVNIQGTYTTKPVHFACSDSLPCTGVSLDTI  456

Query  439   QLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             QL+     +      CW +YG+ +    P  +D CL+ G
Sbjct  457   QLKSVDEGKQLYGPFCWEAYGELKTSTVP-EID-CLKKG  493



>ref|XP_004489829.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=532

 Score =   382 bits (980),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 216/481 (45%), Positives = 296/481 (62%), Gaps = 37/481 (8%)
 Frame = -3

Query  1627  EARKNRHA----KKPRTPPPHK----LKKGRSDYRRNFpapapapaqlpPGNCYPPP---  1481
             + +KN H      KP++PP HK    L      Y+      +P  ++       PPP   
Sbjct  58    DHKKNHHNGGSNSKPKSPPTHKSVPQLPNSPPPYKS--IPISPPISKPKYSPSTPPPKAY  115

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S +F++L +GAKGDG +DD+KA EA W A CKV  +T+ +P+ + F + PI+  GP C P
Sbjct  116   SIIFNVLDYGAKGDGNTDDTKAFEATWAATCKVEASTMVVPADYVFYVGPISFSGPYCKP  175

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP N  +W    + QWI F  +   TIQG G  DG+G  WW+     + 
Sbjct  176   NIVFQLDGTIIAPTNPNAW-SGVMLQWIEFTKLDGITIQGNGVIDGRGSIWWQDFPYDNP  234

Query  1123  QEKKASKTIHVNM-------------------KPTALRFYESTNVTIHGISIVNSPQCHL  1001
              + +    + +N                    KPTALRFY S   T+ GI+I NSPQCHL
Sbjct  235   IDDEEKLIVPLNHTQTPPLPVQNEMGRKMPSNKPTALRFYGSYGPTVTGITIQNSPQCHL  294

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN  GV VH+++IS+P +SPNTDGIHLQNS+DV IH S +  GDDC+SIQTGCSNV+V
Sbjct  295   KFDNCNGVLVHDVSISSPGDSPNTDGIHLQNSKDVLIHSSKLACGDDCISIQTGCSNVYV  354

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LGKD + ACVSNI V +V + N++ G RIKTWQGG GSV+ V FS
Sbjct  355   HNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNIHNSMNGVRIKTWQGGSGSVQGVLFS  414

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              +QVS+V++PI+IDQ+YCDK  C N T AVA+ G+ + +I GT+  +P H ACS+S+PC 
Sbjct  415   NVQVSEVQLPIVIDQFYCDKRTCTNHTSAVALAGINYERIKGTYTVKPVHFACSDSLPCV  474

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENI  281
             DV L  ++L+P        +  CW ++G+ +    P     CL+ G     RI   H+ I
Sbjct  475   DVSLTTVELKPIQEKYHLDDPFCWQTFGELRTPTVPPIG--CLQIGKPSNNRIQTDHD-I  531

Query  280   C  278
             C
Sbjct  532   C  532



>ref|XP_010491600.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=534

 Score =   381 bits (979),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/421 (48%), Positives = 276/421 (66%), Gaps = 23/421 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KA EAAW A CK   + + +P +++FL+ PI+  GP C  
Sbjct  117   SQVFNVMDFGAKGDGKCDDTKAFEAAWAAVCKTEASMMIVPPEYTFLVGPISFSGPYCQA  176

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  +  WI+F  +    +QG G  DG+G  WW+       
Sbjct  177   NIVFQLDGTIIAPTDSKSWGKG-LMWWIDFTKLKGIKVQGKGVIDGRGSGWWQQDYPFID  235

Query  1123  QEKKASKTIH-------------------VNMKPTALRFYESTNVTIHGISIVNSPQCHL  1001
              E K    ++                    ++KPTALRF  S  V + GI+I NSPQCHL
Sbjct  236   GETKLIVPLYNSTHQHPPMPIRSELDGRMPSIKPTALRFSGSLGVEVTGITIQNSPQCHL  295

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN  GV+VH+I +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSNV+V
Sbjct  296   KFDNCVGVSVHDIVVSSPGDSPNTDGIHLQNTKDVLIHSATLACGDDCISIQTGCSNVYV  355

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LGK+ + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS
Sbjct  356   HNVNCGPGHGISIGSLGKEGTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFS  415

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+S PC 
Sbjct  416   NIQLNEVQLPIVIDQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDSFPCV  475

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENI  281
             DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     ++  S  ++
Sbjct  476   DVQLSSIELKPVQERYHMYDPFCWQTFGELGAPTLPP-ID-CLQIGKPPRNKVHESDHDV  533

Query  280   C  278
             C
Sbjct  534   C  534



>ref|XP_006417442.1| hypothetical protein EUTSA_v10007255mg [Eutrema salsugineum]
 gb|ESQ35795.1| hypothetical protein EUTSA_v10007255mg [Eutrema salsugineum]
Length=560

 Score =   382 bits (981),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 203/421 (48%), Positives = 280/421 (67%), Gaps = 23/421 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KA EA W  ACK+  + + +PS++ FL+ PIT  GP C  
Sbjct  143   SQVFNVMDFGAKGDGKCDDTKAFEATWAEACKIEASMMIVPSEYIFLVGPITFSGPYCQA  202

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q++G ++AP +  SW K  ++ WI+F  +    +QG G  DG+G  WW+       
Sbjct  203   NIVFQLEGTIIAPTDSKSWGKGLMW-WIDFTKLKGIKVQGKGVIDGRGSGWWQQDYPFID  261

Query  1123  QEKKA----SKTIHVN---------------MKPTALRFYESTNVTIHGISIVNSPQCHL  1001
              E K     + ++H N               +KPTALRF  ST V + GI+I NSPQCHL
Sbjct  262   GETKLIVPLNNSVHQNPPMPIRSELDWKMPSIKPTALRFSGSTGVEVSGITIQNSPQCHL  321

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN   V VH++++S+P +SPNTDGIHLQN+++V IH +T+  GDDC+SIQTGCSNV+V
Sbjct  322   KFDNCVDVLVHDMSVSSPGDSPNTDGIHLQNTREVLIHSTTLACGDDCISIQTGCSNVYV  381

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS
Sbjct  382   HNVNCGPGHGISIGSLGKDSTKACVSNITVRDVTMHNTMTGVRIKTWQGGVGSVKGILFS  441

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P HLACS++ PC 
Sbjct  442   NIQLNEVQLPIVIDQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHLACSDNFPCV  501

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENI  281
             DVHL+ I+L+P        +  CW ++G+      P  +D CL+ G     R+  S  + 
Sbjct  502   DVHLSAIELKPVQERYHMYDPFCWQTFGELNTPTLPP-ID-CLQIGKPPRNRVHDSDHDQ  559

Query  280   C  278
             C
Sbjct  560   C  560



>gb|KDP26605.1| hypothetical protein JCGZ_17763 [Jatropha curcas]
Length=517

 Score =   380 bits (977),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 214/431 (50%), Positives = 283/431 (66%), Gaps = 32/431 (7%)
 Frame = -3

Query  1492  YPPPSS-------VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLIN  1334
             Y PPS+        F++L FGAKGDG SDD+KA +AAW AACKV  +T+ IP+++ FL+ 
Sbjct  88    YTPPSTSPIKGSATFNVLDFGAKGDGKSDDTKAFQAAWAAACKVEASTMLIPAEYVFLVG  147

Query  1333  PITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGP  1157
             P++  GP C  D+V Q+DG ++AP N   W K  +  WI F  +   TIQG GT DG G 
Sbjct  148   PVSFSGPYCQADIVFQLDGTIIAPTNSYIWGKG-LLWWIEFTKLKGITIQGTGTIDGSGS  206

Query  1156  NWWKLSQIHSLQEKKASKTIHVN---------------------MKPTALRFYESTNVTI  1040
              WW+   ++   + +    I +N                     +KPTALRFY S N T+
Sbjct  207   VWWQDYPLNDPVDDETKLIIPLNNTIEEHPPMPIKSELSKKMPSIKPTALRFYGSFNATV  266

Query  1039  HGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDD  860
              GI+I NSPQCHLKFDN  GV VH+I+IS+P NSPNTDGIHLQNS+DV IH S +  GDD
Sbjct  267   TGITIQNSPQCHLKFDNCMGVVVHDISISSPGNSPNTDGIHLQNSRDVLIHSSNLACGDD  326

Query  859   CVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTW  680
             CVSIQTGC+NV++H++NCGPGHGIS+G LGKD + ACVSNI V +V+M NT+ G RIKTW
Sbjct  327   CVSIQTGCTNVYIHNVNCGPGHGISIGSLGKDNTKACVSNITVRDVIMHNTMTGVRIKTW  386

Query  679   QGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQ  500
             QGG GSV+ V FS IQ+S+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +
Sbjct  387   QGGSGSVQGVLFSNIQLSEVELPIVIDQFYCDKSTCKNQTSAVALSGINYEKIRGTYTVK  446

Query  499   PFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGS  320
             P H ACS+++PC DV L  I+L+P   +    +  CW ++G+      P  +D CL+ G 
Sbjct  447   PVHFACSDALPCIDVSLTTIELKPLQEHYHMYDPFCWQTFGELNTPTTPP-ID-CLQIGK  504

Query  319   LLVKRIARSHE  287
                 R    H+
Sbjct  505   PPNNRPQSDHD  515



>gb|AAL31197.1| At1g60590/F8A5_12 [Arabidopsis thaliana]
 gb|AAN18178.1| At1g60590/F8A5_12 [Arabidopsis thaliana]
Length=474

 Score =   379 bits (973),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 205/425 (48%), Positives = 280/425 (66%), Gaps = 27/425 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  54    SQQFNVLDFGAKGDGMSDDTQAFEAAWASACKVEASTMIIPPDYIFLVGPISFSGPYCQA  113

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI---  1133
             ++V Q++G +VAP +  SW    +  WI F  +   TIQG G  DG+G  WW+   +   
Sbjct  114   NIVFQLEGMIVAPTDTESW-GGGLMWWIEFTKLSGITIQGNGVIDGRGTVWWQQDYLSDY  172

Query  1132  -------------HSLQEKKASKTIHV------NMKPTALRFYESTNVTIHGISIVNSPQ  1010
                          +S+QE+              ++KPTALRFY S +VT+ GI+I NSPQ
Sbjct  173   PIDDDFKLIVPLNNSVQERPPMPIRSELNWRMPSIKPTALRFYGSIDVTVTGITIQNSPQ  232

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSN
Sbjct  233   CHLKFDNCVKVLVHDVNVSSPGDSPNTDGIHLQNTRDVMIHTTTLACGDDCISIQTGCSN  292

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V+VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGG+GSVK +
Sbjct  293   VYVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGIGSVKGI  352

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   C N T AV+++GV + +I GT+  +P H ACS+S 
Sbjct  353   LFSNIQLTEVQLPIVIDQFYCDHSKCMNHTSAVSVEGVTYEKIRGTYTVKPVHFACSDSF  412

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G      +   H
Sbjct  413   PCIDVQLSGIELKPVQLQYHMYDPFCWKTFGELNSATVPP-ID-CLQIGKPARNGVHSDH  470

Query  289   ENICL  275
             + ICL
Sbjct  471   D-ICL  474



>ref|XP_010458422.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=531

 Score =   380 bits (977),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 200/421 (48%), Positives = 276/421 (66%), Gaps = 23/421 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KA EAAW A CK   + + +P +++FL+ PI+  GP C  
Sbjct  114   SQVFNVMDFGAKGDGKCDDTKAFEAAWAAVCKTEASMMIVPPEYTFLVGPISFSGPYCQA  173

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  +  WI+F  +    +QG G  DG+G  WW+       
Sbjct  174   NIVFQLDGTIIAPTDSKSWGK-GLMWWIDFTKLKGIKVQGKGVIDGRGSGWWQQDYPFID  232

Query  1123  QEKKASKTIH-------------------VNMKPTALRFYESTNVTIHGISIVNSPQCHL  1001
              E K    ++                    ++KPTALRF  S  V + GI+I NSPQCHL
Sbjct  233   GETKLIVPLYNSTHKHPPMPLRSELDGRMPSIKPTALRFSGSLGVEVTGITIQNSPQCHL  292

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN  GV+VH+I +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSNV+V
Sbjct  293   KFDNCVGVSVHDIVVSSPGDSPNTDGIHLQNTKDVLIHSATLACGDDCISIQTGCSNVYV  352

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LGK+ + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS
Sbjct  353   HNVNCGPGHGISIGSLGKEGTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFS  412

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+S PC 
Sbjct  413   NIQLNEVQLPIVIDQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTLKPVHFACSDSFPCV  472

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENI  281
             DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     ++  S  ++
Sbjct  473   DVQLSSIELKPVQERYHMYDPFCWQTFGELGTPTLPP-ID-CLQIGKPPRNKVHESDHDV  530

Query  280   C  278
             C
Sbjct  531   C  531



>gb|EEE64806.1| hypothetical protein OsJ_19662 [Oryza sativa Japonica Group]
Length=534

 Score =   380 bits (977),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 196/389 (50%), Positives = 273/389 (70%), Gaps = 20/389 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++VF+++ FGA+GDGV+DD++A E AW AACKV  +TV +PS+  F++ PI+  GP C P
Sbjct  131   NTVFNVVDFGARGDGVTDDTQAFEEAWAAACKVEASTVLVPSELEFVVGPISFSGPYCKP  190

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ----  1136
             +++ Q+DG ++A  +   W  S + QW+ F  +   +IQG G  +G+G  WW  S     
Sbjct  191   NILFQLDGTILAQTSTRVW-GSGLLQWLEFTKLSGISIQGSGVINGRGQEWWTYSDPNDD  249

Query  1135  ------IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVN  974
                    ++++ +K  +     +KPTALRFY S+NVT+ GI+IVNS QCHLKFD+ +GV 
Sbjct  250   DNDDVDAYNVELEKMPQ-----IKPTALRFYGSSNVTVTGITIVNSSQCHLKFDSCQGVM  304

Query  973   VHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpgh  794
             VH++TIS+PENSPNTDGIHLQNS+ V IHHS +  GDDCVSIQTGCS++++H++NCGPGH
Sbjct  305   VHDLTISSPENSPNTDGIHLQNSKQVSIHHSNLACGDDCVSIQTGCSDINIHNVNCGPGH  364

Query  793   gislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKV  614
             GIS+GGLG+  + ACVSN+ V +V M  T+ G RIKTWQGG G V+ + FS IQVS+V+ 
Sbjct  365   GISIGGLGRYNTKACVSNVTVRDVNMFKTMTGVRIKTWQGGSGLVQGIRFSNIQVSEVQT  424

Query  613   PIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQL  434
             PI+IDQ+YCD+  C+NQT AVA+ GV++  I GTF  +P H ACS+S PC+++ L  IQL
Sbjct  425   PIIIDQFYCDRTTCRNQTSAVAVLGVQYENIRGTFTIKPAHFACSDSSPCSEITLTGIQL  484

Query  433   EP--SPGYRGFRNGQCWNSYGKSQGQLFP  353
             +P   P Y    N  CW ++G+      P
Sbjct  485   KPLIVPQYH-LYNPFCWQAFGELSTPTIP  512



>ref|XP_002886607.1| hypothetical protein ARALYDRAFT_893483 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62866.1| hypothetical protein ARALYDRAFT_893483 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   380 bits (977),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 206/425 (48%), Positives = 283/425 (67%), Gaps = 27/425 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  118   SQEFNVLDFGAKGDGMSDDTEAFEAAWASACKVEASTMIIPPDYIFLVGPISFSGPYCQG  177

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI---  1133
             ++V Q+DG +VAP +  SW    +  WI F  +   TIQG G  DG+G  WW+   +   
Sbjct  178   NIVFQLDGMIVAPTDTESW-GGGLMWWIEFTKLKGITIQGKGVIDGRGTVWWQQDYLSDY  236

Query  1132  -------------HSLQEK-----KASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQ  1010
                          +S+QE+     ++     + ++KPTALRFY S +VT+ GI+I NSPQ
Sbjct  237   PIDDDFKLIVPLNNSVQERPPMPIRSELNWRMPSIKPTALRFYGSIDVTVTGITIQNSPQ  296

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSN
Sbjct  297   CHLKFDNCVQVLVHDVNVSSPGDSPNTDGIHLQNTKDVMIHTTTLACGDDCISIQTGCSN  356

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V+VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGG+GSVK +
Sbjct  357   VYVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGIGSVKGI  416

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   C N T AV+++GV + +I GT+  +P H ACS+S 
Sbjct  417   LFSNIQLTEVQLPIVIDQFYCDHSKCMNHTSAVSVEGVTYEKIRGTYTVKPVHFACSDSF  476

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G      +   H
Sbjct  477   PCIDVQLSGIELKPVQLQYHMYDPFCWKTFGELNSATVPP-ID-CLQIGKPARNGVHSDH  534

Query  289   ENICL  275
             + ICL
Sbjct  535   D-ICL  538



>gb|EEC79746.1| hypothetical protein OsI_21117 [Oryza sativa Indica Group]
Length=534

 Score =   380 bits (976),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 195/388 (50%), Positives = 272/388 (70%), Gaps = 20/388 (5%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGA+GDGV+DD++A E AW AACKV  +TV +PS+  F++ PI+  GP C P+
Sbjct  132   TVFNVVDFGARGDGVTDDTQAFEEAWAAACKVEASTVLVPSELEFVVGPISFSGPYCKPN  191

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ-----  1136
             ++ Q+DG ++A  +   W  S + QW+ F  +   +IQG G  +G+G  WW  S      
Sbjct  192   ILFQLDGTILAQTSTRVW-GSGLLQWLEFTKLSGISIQGSGVINGRGQEWWTYSDPNDDD  250

Query  1135  -----IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNV  971
                   ++++ +K  +     +KPTALRFY S+NVT+ GI+IVNS QCHLKFD+ +GV V
Sbjct  251   NDDVDAYNVELEKMPQ-----IKPTALRFYGSSNVTVTGITIVNSSQCHLKFDSCQGVMV  305

Query  970   HNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghg  791
             H++TIS+PENSPNTDGIHLQNS+ V IHH+ +  GDDCVSIQTGCS++++H++NCGPGHG
Sbjct  306   HDLTISSPENSPNTDGIHLQNSKQVSIHHTNLACGDDCVSIQTGCSDINIHNVNCGPGHG  365

Query  790   islgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVP  611
             IS+GGLG+  + ACVSN+ V +V M  T+ G RIKTWQGG G V+ + FS IQVS+V+ P
Sbjct  366   ISIGGLGRYNTKACVSNVTVRDVNMFKTMTGVRIKTWQGGSGLVQGIRFSNIQVSEVQTP  425

Query  610   IMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLE  431
             I+IDQ+YCD+  C+NQT AVA+ GV++  I GTF  +P H ACS+S PC+++ L  IQL+
Sbjct  426   IIIDQFYCDRTTCRNQTSAVAVSGVQYENIRGTFTIKPAHFACSDSSPCSEITLTGIQLK  485

Query  430   P--SPGYRGFRNGQCWNSYGKSQGQLFP  353
             P   P Y    N  CW ++G+      P
Sbjct  486   PLIVPQYH-LYNPFCWQAFGELSTPTIP  512



>ref|XP_011086585.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=518

 Score =   380 bits (975),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 210/418 (50%), Positives = 278/418 (67%), Gaps = 26/418 (6%)
 Frame = -3

Query  1486  PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-C  1310
             P  +VFD+L FGAKGDG +DD+KA +AAW AACKV  + + +P++F FL+ PI+  GP C
Sbjct  97    PDPTVFDVLDFGAKGDGSTDDTKAFQAAWAAACKVEASVLNVPAEFVFLVGPISFSGPYC  156

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
               ++V Q+DG ++AP +   W  S + QW+ F  +   TI+G GT DG G  WW+ S   
Sbjct  157   QHNIVFQLDGTIIAPTSASHW-GSGLLQWLEFTKLVGLTIKGSGTIDGNGAVWWQSSPYD  215

Query  1129  SLQEKKASKTI----------------------HVNMKPTALRFYESTNVTIHGISIVNS  1016
                    SK I                        ++KPTALRFY S NVT+ GI+I NS
Sbjct  216   DDPLDDQSKLIVPLNATVALKPPIPISSSLGGKMPSIKPTALRFYGSFNVTVTGITIQNS  275

Query  1015  PQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGC  836
             PQCHLKFDN  GV+V+N ++S+P +SPNTDGIHLQNS+DV I  S +  GDDCVSIQTGC
Sbjct  276   PQCHLKFDNCIGVSVYNFSVSSPGDSPNTDGIHLQNSKDVLIRSSNLACGDDCVSIQTGC  335

Query  835   SNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVK  656
             +NV++H++NCGPGHGIS+GGLG+D + ACVSNI V ++VM NT+ G RIKTWQGG GSV+
Sbjct  336   TNVYIHNVNCGPGHGISIGGLGRDNTKACVSNITVRDIVMHNTMNGVRIKTWQGGSGSVQ  395

Query  655   NVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSN  476
              V FS IQVS+V++PI+IDQYYCDK  CKNQT AVA+ G+ +  I GT+  +P H ACS+
Sbjct  396   GVQFSNIQVSEVQLPIVIDQYYCDKAKCKNQTAAVALSGINYENIRGTYTVKPVHFACSD  455

Query  475   SVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRI  302
             ++PCTDV L++IQL+P        +  CW ++G+      P     CL+ G     +I
Sbjct  456   NMPCTDVTLSNIQLKPLQERYHMYDPYCWQTFGQLYTPTIPPV--ECLQLGKPTSNKI  511



>ref|XP_010551910.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Tarenaya hassleriana]
Length=458

 Score =   377 bits (969),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 197/388 (51%), Positives = 261/388 (67%), Gaps = 13/388 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L +GAKGDG++DD+KA EAAW AACKV+ +T+  P+  +FL+ PI+  G  C  
Sbjct  50    SKTFNVLDYGAKGDGITDDTKAFEAAWEAACKVAASTLVAPTGSTFLVGPISFLGTDCAE  109

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++  Q+DG ++AP +  +W  S + QWI FK +    ++G GT DGQG  WW  S  +  
Sbjct  110   NIAFQLDGKIIAPTSASAW-GSDLLQWIEFKTLKGIAVRGKGTIDGQGSVWWNDSPNYDP  168

Query  1123  QEKKASKTIHVN-----------MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
              ++  S+  + N            +PTALRFY S  VTI GI+I NSPQ HLKFD+  GV
Sbjct  169   TDESESRIGYSNDTDQLSQKMPRTRPTALRFYGSNGVTITGITIQNSPQTHLKFDDCSGV  228

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V   T S+P +SPNTDGIHLQNS DV I+ ST+  GDDC+SIQTGCSNV+VH+++CGPG
Sbjct  229   QVSGFTASSPGDSPNTDGIHLQNSHDVVIYSSTLACGDDCLSIQTGCSNVYVHNVDCGPG  288

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HGIS+GGLGKD S ACVSNI V +V M NTL G RIKTWQGG GSV+ V FS +QV+DV 
Sbjct  289   HGISIGGLGKDNSKACVSNITVRDVTMHNTLNGVRIKTWQGGSGSVQQVMFSNVQVNDVA  348

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PI+IDQYYCD   C+N+T AVA+ G+ +  I GT+  +P   ACS S+PC+ + L+ I+
Sbjct  349   SPIVIDQYYCDGRGCQNKTSAVAVSGINYINIKGTYTREPVRFACSESLPCSGISLSTIE  408

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             L+P+       N  CW +YG+ +    P
Sbjct  409   LKPASEKADSSNPFCWEAYGELKTTTVP  436



>ref|NP_564758.2| pectin lyase-like protein [Arabidopsis thaliana]
 gb|AAB71972.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE33700.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=540

 Score =   380 bits (976),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 205/425 (48%), Positives = 283/425 (67%), Gaps = 27/425 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG+SDD++A EAAW +ACKV  +T+ IP  + FL+ PI+  GP C  
Sbjct  120   SQQFNVLDFGAKGDGMSDDTQAFEAAWASACKVEASTMIIPPDYIFLVGPISFSGPYCQA  179

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI---  1133
             ++V Q++G +VAP +  SW    +  WI F  +   TIQG G  DG+G  WW+   +   
Sbjct  180   NIVFQLEGMIVAPTDTESW-GGGLMWWIEFTKLSGITIQGNGVIDGRGTVWWQQDYLSDY  238

Query  1132  -------------HSLQEK-----KASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQ  1010
                          +S+QE+     ++     + ++KPTALRFY S +VT+ GI+I NSPQ
Sbjct  239   PIDDDFKLIVPLNNSVQERPPMPIRSELNWRMPSIKPTALRFYGSIDVTVTGITIQNSPQ  298

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSN
Sbjct  299   CHLKFDNCVKVLVHDVNVSSPGDSPNTDGIHLQNTRDVMIHTTTLACGDDCISIQTGCSN  358

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V+VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGG+GSVK +
Sbjct  359   VYVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGIGSVKGI  418

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   C N T AV+++GV + +I GT+  +P H ACS+S 
Sbjct  419   LFSNIQLTEVQLPIVIDQFYCDHSKCMNHTSAVSVEGVTYEKIRGTYTVKPVHFACSDSF  478

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G      +   H
Sbjct  479   PCIDVQLSGIELKPVQLQYHMYDPFCWKTFGELNSATVPP-ID-CLQIGKPARNGVHSDH  536

Query  289   ENICL  275
             + ICL
Sbjct  537   D-ICL  540



>gb|EMT20816.1| Polygalacturonase [Aegilops tauschii]
Length=537

 Score =   380 bits (975),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 205/408 (50%), Positives = 285/408 (70%), Gaps = 14/408 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDGVSDD+KA +AAW AACK+  +TV +P++  FL+ PI+  GP C P+
Sbjct  136   AVFNVVDFGAKGDGVSDDTKAFQAAWAAACKLGASTVLVPAELEFLVGPISFSGPYCKPN  195

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q++G ++AP N  +W  S + QW+ F  +   +IQG GT +G+G  WW  S  +  +
Sbjct  196   ILFQLEGTILAPTNAKAW-GSGLLQWLEFTKLSGLSIQGSGTINGRGQQWWTYSDPNDDE  254

Query  1120  EKKASKTIHVN----MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
             +        +     +KPTALRFY S+NV + GI IVNS QCHLKFDN +GV VH++TIS
Sbjct  255   DDDKQYNEELERMPRVKPTALRFYGSSNVVVAGIKIVNSSQCHLKFDNCQGVLVHDLTIS  314

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H++NCGPGHGIS+GGL
Sbjct  315   SPENSLNTDGIHLQNSKDVSIHHTNLACGDDCISIQTGCSNIYIHNVNCGPGHGISIGGL  374

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             G+D + ACVSN+ V +V M  T+ G RIKTWQGG+G V+++ FS IQVS+V+ PIMIDQ+
Sbjct  375   GRDNTKACVSNVTVRDVNMFRTMTGVRIKTWQGGIGLVQDIRFSNIQVSEVQTPIMIDQF  434

Query  592   YCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP-SPGY  416
             YCDK  C NQT AVA+ GV++  I GTF  +P H ACS+S PC+ + L  +QL+P    +
Sbjct  435   YCDKRTCTNQTSAVAVSGVQYENIRGTFTIKPLHFACSDSSPCSGITLTGVQLKPVQIAH  494

Query  415   RGFRNGQCWNSYGKSQGQLFPASMD--YCLRSGSLLVKRIARSHENIC  278
                 N  CW ++    G+LF  ++    CL+ G      + +S+ +IC
Sbjct  495   YHLNNPFCWQAF----GELFTPTIPPIACLQIGKPAGNNL-QSYHDIC  537



>ref|XP_010551909.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Tarenaya hassleriana]
Length=460

 Score =   377 bits (968),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 197/390 (51%), Positives = 261/390 (67%), Gaps = 15/390 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L +GAKGDG++DD+KA EAAW AACKV+ +T+  P+  +FL+ PI+  G  C  
Sbjct  50    SKTFNVLDYGAKGDGITDDTKAFEAAWEAACKVAASTLVAPTGSTFLVGPISFLGTDCAE  109

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++  Q+DG ++AP +  +W  S + QWI FK +    ++G GT DGQG  WW  S  +  
Sbjct  110   NIAFQLDGKIIAPTSASAW-GSDLLQWIEFKTLKGIAVRGKGTIDGQGSVWWNDSPNYDP  168

Query  1123  QEKKASKTIHVN-------------MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSK  983
              ++  S+  + N              +PTALRFY S  VTI GI+I NSPQ HLKFD+  
Sbjct  169   TDESESRIGYSNDTMQDQLSQKMPRTRPTALRFYGSNGVTITGITIQNSPQTHLKFDDCS  228

Query  982   GVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCg  803
             GV V   T S+P +SPNTDGIHLQNS DV I+ ST+  GDDC+SIQTGCSNV+VH+++CG
Sbjct  229   GVQVSGFTASSPGDSPNTDGIHLQNSHDVVIYSSTLACGDDCLSIQTGCSNVYVHNVDCG  288

Query  802   pghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSD  623
             PGHGIS+GGLGKD S ACVSNI V +V M NTL G RIKTWQGG GSV+ V FS +QV+D
Sbjct  289   PGHGISIGGLGKDNSKACVSNITVRDVTMHNTLNGVRIKTWQGGSGSVQQVMFSNVQVND  348

Query  622   VKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLAD  443
             V  PI+IDQYYCD   C+N+T AVA+ G+ +  I GT+  +P   ACS S+PC+ + L+ 
Sbjct  349   VASPIVIDQYYCDGRGCQNKTSAVAVSGINYINIKGTYTREPVRFACSESLPCSGISLST  408

Query  442   IQLEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             I+L+P+       N  CW +YG+ +    P
Sbjct  409   IELKPASEKADSSNPFCWEAYGELKTTTVP  438



>gb|EYU28445.1| hypothetical protein MIMGU_mgv1a004469mg [Erythranthe guttata]
Length=525

 Score =   379 bits (973),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/395 (52%), Positives = 274/395 (69%), Gaps = 26/395 (7%)
 Frame = -3

Query  1486  PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-C  1310
             P  +VFD+L FGA+GDG +DD++A  AAW AACK+  + V +P+++ FL+ PI+  GP C
Sbjct  104   PDPTVFDVLDFGARGDGTTDDTQAFRAAWAAACKIEASIVNVPAEYVFLVGPISFSGPYC  163

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
               ++V Q+DG +VAP +   W  S I QW+ F  +   TI+G GT DG G  WW+ S   
Sbjct  164   QYNIVFQLDGTIVAPTSPSQW-GSGILQWLEFTKLVGLTIKGSGTIDGNGAAWWQSSNDD  222

Query  1129  SLQEKKASKT-------------IHVN---------MKPTALRFYESTNVTIHGISIVNS  1016
             +      SK              IH +         +KPTALRFY S NVT+ GI+I NS
Sbjct  223   NDPLDDQSKLIVPLNDTTEQNPRIHEDSWLGSKLPSIKPTALRFYGSYNVTVTGITIQNS  282

Query  1015  PQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGC  836
             PQCHLKFDN  GV+V+N T+S+P +SPNTDGIHLQNS+DV I  S +  GDDCVSIQTGC
Sbjct  283   PQCHLKFDNCVGVSVYNFTVSSPGDSPNTDGIHLQNSKDVLIRSSDLACGDDCVSIQTGC  342

Query  835   SNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVK  656
             +N+++H +NCGPGHGIS+G LGKD + ACVSNI V +V M+NT+ G RIKTWQGG+GSV+
Sbjct  343   TNIYIHDVNCGPGHGISIGSLGKDNTKACVSNITVRDVFMQNTMNGVRIKTWQGGLGSVQ  402

Query  655   NVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSN  476
              V FS IQVS+V++PI+IDQYYCDK  C+NQT AV++ G+ +  I GT+  +P H ACS+
Sbjct  403   GVQFSNIQVSEVQIPIVIDQYYCDKGKCRNQTSAVSLSGINYENIRGTYTVKPVHFACSD  462

Query  475   SVPCTDVHLADIQLEP-SPGYRGFRNGQCWNSYGK  374
             ++PCTDV LA+IQL+P   GY  + +  CW ++G+
Sbjct  463   NMPCTDVTLANIQLDPLEEGYHMY-DPFCWQTFGQ  496



>ref|XP_003569422.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Brachypodium 
distachyon]
Length=544

 Score =   379 bits (972),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 207/407 (51%), Positives = 281/407 (69%), Gaps = 12/407 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDGVSDD+KA +AAW AACK   +TV +PS+  FL+ PI+  GP C P+
Sbjct  143   AVFNVVDFGAKGDGVSDDTKAFQAAWAAACKQGSSTVLVPSELEFLVGPISFSGPYCKPN  202

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q++G ++AP N  +W  S + QW+ F  ++  +IQG G  +G+G  WW  S  +  +
Sbjct  203   ILFQLEGTILAPTNAKAW-GSGLLQWLEFTKLNGLSIQGSGVINGRGQQWWTYSDPNDDE  261

Query  1120  EKKASKTIHVN----MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
             +        +     +KPTALRFY S NV + GI+IVNS QCHLKFDN +GV VH++TIS
Sbjct  262   DDDTQYNQELERMPQVKPTALRFYGSFNVVVAGITIVNSSQCHLKFDNCQGVLVHDLTIS  321

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H++NCGPGHGIS+GGL
Sbjct  322   SPENSLNTDGIHLQNSKDVSIHHTNLACGDDCISIQTGCSNIYIHNVNCGPGHGISIGGL  381

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             G+D + ACVSN+ V +V M  T+ G RIKTWQGG+G V++V FS IQVS+V+ PIMIDQ+
Sbjct  382   GRDNTKACVSNVTVRDVNMFRTMTGVRIKTWQGGIGLVQDVRFSNIQVSEVQTPIMIDQF  441

Query  592   YCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS--PG  419
             YCDK  C NQT AVA+ GV++  I GTF  +P H ACS+S PC+ + L  +QL P   P 
Sbjct  442   YCDKRTCTNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSSPCSGITLTGVQLRPVQIPH  501

Query  418   YRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             Y    N  CW ++G+      P     CL+ G      + +S+ +IC
Sbjct  502   YH-LNNPFCWQAFGELYTPTIPPVA--CLQIGKPAGNNL-QSYNDIC  544



>ref|XP_010232068.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Brachypodium 
distachyon]
Length=543

 Score =   379 bits (972),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 208/406 (51%), Positives = 280/406 (69%), Gaps = 11/406 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDGVSDD+KA +AAW AACK   +TV +PS+  FL+ PI+  GP C P+
Sbjct  143   AVFNVVDFGAKGDGVSDDTKAFQAAWAAACKQGSSTVLVPSELEFLVGPISFSGPYCKPN  202

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q++G ++AP N  +W  S + QW+ F  ++  +IQG G  +G+G  WW  S  +  +
Sbjct  203   ILFQLEGTILAPTNAKAW-GSGLLQWLEFTKLNGLSIQGSGVINGRGQQWWTYSDPNDDE  261

Query  1120  EKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
             +          M   KPTALRFY S NV + GI+IVNS QCHLKFDN +GV VH++TIS+
Sbjct  262   DDDTYNQELERMPQVKPTALRFYGSFNVVVAGITIVNSSQCHLKFDNCQGVLVHDLTISS  321

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H++NCGPGHGIS+GGLG
Sbjct  322   PENSLNTDGIHLQNSKDVSIHHTNLACGDDCISIQTGCSNIYIHNVNCGPGHGISIGGLG  381

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +D + ACVSN+ V +V M  T+ G RIKTWQGG+G V++V FS IQVS+V+ PIMIDQ+Y
Sbjct  382   RDNTKACVSNVTVRDVNMFRTMTGVRIKTWQGGIGLVQDVRFSNIQVSEVQTPIMIDQFY  441

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS--PGY  416
             CDK  C NQT AVA+ GV++  I GTF  +P H ACS+S PC+ + L  +QL P   P Y
Sbjct  442   CDKRTCTNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSSPCSGITLTGVQLRPVQIPHY  501

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
                 N  CW ++G+      P     CL+ G      + +S+ +IC
Sbjct  502   H-LNNPFCWQAFGELYTPTIPPVA--CLQIGKPAGNNL-QSYNDIC  543



>gb|KFK40772.1| hypothetical protein AALP_AA2G039100 [Arabis alpina]
Length=520

 Score =   377 bits (969),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 205/424 (48%), Positives = 283/424 (67%), Gaps = 27/424 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG++DD+KA EAAW +ACKV  +T+ IP ++ FLI PI+  GP C  
Sbjct  100   SQEFNVLDFGAKGDGMTDDTKAFEAAWASACKVEASTMIIPPEYIFLIGPISFSGPYCQA  159

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             ++V Q+DG +VAP +  +W +  ++ WI F  ++  TIQG G  DG+G  WW+       
Sbjct  160   NIVFQLDGMIVAPTDSETWGRGLMW-WIEFTKLNGITIQGNGVIDGRGTVWWQQNYPFDY  218

Query  1144  ---------LSQIHSLQE------KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQ  1010
                      +   +S+QE      +        ++KPTALRFY S +VT+ GI+I NSPQ
Sbjct  219   PIDDEFKLIVPLNNSVQEHPPMPIRSELGERMPSIKPTALRFYGSIDVTVTGITIQNSPQ  278

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSN
Sbjct  279   CHLKFDNCVQVLVHDVNVSSPGDSPNTDGIHLQNTKDVMIHTTTLACGDDCISIQTGCSN  338

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V+VH++NCGPGHGIS+G LGKD + ACVSNI V +VVM NT+ G RIKTWQGG GSVK +
Sbjct  339   VYVHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGEGSVKGI  398

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   C+NQT AV+++GV + +I GT+  +P H ACS++ 
Sbjct  399   LFSNIQLTEVQLPIVIDQFYCDHSKCQNQTSAVSVEGVTYEKIRGTYTVKPVHFACSDNF  458

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L P        +  CW ++G+      P  +D CL+ G      +   H
Sbjct  459   PCIDVQLSGIELTPVQQQYHMYDPFCWKTFGEINSVTVPP-ID-CLQIGKPARNGVHTDH  516

Query  289   ENIC  278
             + IC
Sbjct  517   D-IC  519



>gb|ACF79104.1| unknown [Zea mays]
Length=496

 Score =   376 bits (966),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 276/382 (72%), Gaps = 7/382 (2%)
 Frame = -3

Query  1501  GNCYPPP--SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPI  1328
             G+  PPP  ++VF ++ FGAKGDGV+DD++A EAAW AACKV  +TV +PS   F++ PI
Sbjct  86    GSQAPPPQDTTVFSVVEFGAKGDGVTDDTQAFEAAWAAACKVEASTVLVPSGLEFVVGPI  145

Query  1327  TLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNW  1151
             +  GP C P+++ Q+DG ++A  +  +W  + + QW+ F  +    +QG G  +G+G +W
Sbjct  146   SFSGPYCKPNILFQLDGTILAQTSARAWGSAGLLQWLEFTKLTGIAVQGSGVINGRGQDW  205

Query  1150  WKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNV  971
             W  +  +   ++   + +    KPTALRFY S+NVT+ GI+IVNS QCHLKFD+ +GV V
Sbjct  206   WTYADPNDADDESV-EMLLPRTKPTALRFYGSSNVTVAGITIVNSSQCHLKFDSCEGVMV  264

Query  970   HNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghg  791
             H++++S+PE+SPNTDGIHLQNS+ V+IHH+T+  GDDC+SIQTGCS+V++H +NCGPGHG
Sbjct  265   HDLSVSSPEDSPNTDGIHLQNSRGVDIHHATLACGDDCISIQTGCSDVNIHSVNCGPGHG  324

Query  790   islgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVP  611
             IS+GGLG+  + ACVSN+ V +V M  T  G RIKTWQGG G V+ V FS IQV++V+ P
Sbjct  325   ISIGGLGRFNTKACVSNVTVRDVKMFRTTTGVRIKTWQGGSGLVQGVRFSNIQVTEVQTP  384

Query  610   IMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLE  431
             IMIDQ+YCD+  C+NQT AVA+ GV++  + GTF  +P HLACS+S PC+ + LA IQL+
Sbjct  385   IMIDQFYCDRATCRNQTSAVAVSGVQYEDVRGTFTVRPAHLACSDSSPCSGITLAGIQLQ  444

Query  430   PSPGYRGFR---NGQCWNSYGK  374
             P P  +  R   +  CW ++G+
Sbjct  445   PLPLPQHRRLSYDPFCWQAFGE  466



>ref|XP_002525361.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF36999.1| polygalacturonase, putative [Ricinus communis]
Length=519

 Score =   376 bits (966),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 280/420 (67%), Gaps = 25/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L+FGAKGDG +DD+KA +AAW AACKV  +T+ +P+++ FL+ P++  GP C  
Sbjct  101   SATFNVLNFGAKGDGKTDDTKAFQAAWAAACKVEASTMLVPAEYIFLVGPVSFSGPYCQA  160

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q++G ++AP N   W K  +  WI F  +   TIQG GT DG G  WW+   +   
Sbjct  161   NIVFQLNGKIIAPTNSYVWAKG-LLWWIEFTKLKGITIQGTGTIDGSGSVWWEDYPLDDP  219

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
             ++ +    I +N                     +KPTALRFY S N T+ GI+I NSPQC
Sbjct  220   EDDETKLIIPLNNTVQQHPPMPVRSELGKKMPSIKPTALRFYGSFNATVTGITIQNSPQC  279

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV +H+ITIS+P +SPNTDGIHLQNS+DV IH S +  GDDCVSIQTGC+NV
Sbjct  280   HLKFDNCIGVVIHDITISSPGDSPNTDGIHLQNSKDVLIHSSNLACGDDCVSIQTGCTNV  339

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+G LG+D + ACVSNI V +VVM NT+ G RIKTWQGG GSV+ V 
Sbjct  340   YIHNVNCGPGHGISIGSLGRDNTKACVSNITVRDVVMHNTMTGVRIKTWQGGSGSVQGVL  399

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AV++ G+ + +I GT+  +P H ACS+++P
Sbjct  400   FSNIQVSEVQLPIVIDQFYCDKSTCKNQTTAVSLSGINYEKIRGTYTVKPVHFACSDALP  459

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L  I+L+P        +  CW ++G+      P  +D CL+ G     R    H+
Sbjct  460   CIDVSLTTIELKPVQAQYHMYDPFCWQTFGELNTPTTPP-ID-CLQIGKPSSNRPQSDHD  517



>ref|NP_001141617.1| hypothetical protein [Zea mays]
 gb|ACF86730.1| unknown [Zea mays]
 gb|AFW81234.1| hypothetical protein ZEAMMB73_645258 [Zea mays]
Length=537

 Score =   377 bits (967),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 276/382 (72%), Gaps = 7/382 (2%)
 Frame = -3

Query  1501  GNCYPPP--SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPI  1328
             G+  PPP  ++VF ++ FGAKGDGV+DD++A EAAW AACKV  +TV +PS   F++ PI
Sbjct  127   GSQAPPPQDTTVFSVVEFGAKGDGVTDDTQAFEAAWAAACKVEASTVLVPSGLEFVVGPI  186

Query  1327  TLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNW  1151
             +  GP C P+++ Q+DG ++A  +  +W  + + QW+ F  +    +QG G  +G+G +W
Sbjct  187   SFSGPYCKPNILFQLDGTILAQTSARAWGSAGLLQWLEFTKLTGIAVQGSGVINGRGQDW  246

Query  1150  WKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNV  971
             W  +  +   ++   + +    KPTALRFY S+NVT+ GI+IVNS QCHLKFD+ +GV V
Sbjct  247   WTYADPNDADDESV-EMLLPRTKPTALRFYGSSNVTVAGITIVNSSQCHLKFDSCEGVMV  305

Query  970   HNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghg  791
             H++++S+PE+SPNTDGIHLQNS+ V+IHH+T+  GDDC+SIQTGCS+V++H +NCGPGHG
Sbjct  306   HDLSVSSPEDSPNTDGIHLQNSRGVDIHHATLACGDDCISIQTGCSDVNIHSVNCGPGHG  365

Query  790   islgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVP  611
             IS+GGLG+  + ACVSN+ V +V M  T  G RIKTWQGG G V+ V FS IQV++V+ P
Sbjct  366   ISIGGLGRFNTKACVSNVTVRDVKMFRTTTGVRIKTWQGGSGLVQGVRFSNIQVTEVQTP  425

Query  610   IMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLE  431
             IMIDQ+YCD+  C+NQT AVA+ GV++  + GTF  +P HLACS+S PC+ + LA IQL+
Sbjct  426   IMIDQFYCDRATCRNQTSAVAVSGVQYEDVRGTFTVRPAHLACSDSSPCSGITLAGIQLQ  485

Query  430   PSPGYRGFR---NGQCWNSYGK  374
             P P  +  R   +  CW ++G+
Sbjct  486   PLPLPQHRRLSYDPFCWQAFGE  507



>ref|XP_007227459.1| hypothetical protein PRUPE_ppa004002mg [Prunus persica]
 gb|EMJ28658.1| hypothetical protein PRUPE_ppa004002mg [Prunus persica]
Length=536

 Score =   376 bits (966),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 203/420 (48%), Positives = 280/420 (67%), Gaps = 25/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG +DD+KA +AAW AACKV  + + +P+ + FL+ PI+  GP C P
Sbjct  118   SSSFNVLDFGAKGDGSTDDTKAFQAAWAAACKVEASQIIVPAAYKFLVGPISFSGPYCQP  177

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             +++ Q+DG +VAP +  SW K  + QW+ F  +   T+QG G  DG+G +WW+       
Sbjct  178   NILFQLDGTIVAPTDSKSWGK-GLLQWLEFTKLRGITVQGKGLIDGRGSSWWQDTPYGDP  236

Query  1144  -------LSQIHSLQEKKASKTIHVNM-------KPTALRFYESTNVTIHGISIVNSPQC  1007
                    +  ++S  ++     I   +       KPTALRFY S NVT+ GI+I NSPQC
Sbjct  237   IDDDFKLIVPLNSTAQQHPPMPIRSELSGKMPSIKPTALRFYGSFNVTVTGITIQNSPQC  296

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++++S+P NSPNTDGIHLQNS+ V IH + +  GDDC+SIQTGCS+V
Sbjct  297   HLKFDNCAGVLVHDMSVSSPGNSPNTDGIHLQNSKQVLIHTTNLACGDDCISIQTGCSDV  356

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             +VH++NCGPGHGIS+G LG+D + ACVSNI V +++M NT+ G R+KTWQGG GSV+ V 
Sbjct  357   YVHNVNCGPGHGISIGSLGRDNTKACVSNITVRDIIMHNTMNGVRVKTWQGGSGSVQGVL  416

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H ACS+S+P
Sbjct  417   FSNIQVSEVQLPIVIDQFYCDKSQCKNQTSAVALSGITYERIRGTYTVKPVHFACSDSLP  476

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L  I+L+P           CW ++G+ +    P     CL+ G     R+   H+
Sbjct  477   CVDVTLNGIELKPVQEQYHMYEPFCWQTFGELRTPTVPPIA--CLQIGKPSSNRVNSDHD  534



>ref|NP_001043666.1| Os01g0636500 [Oryza sativa Japonica Group]
 dbj|BAD68931.1| polygalacturonase PG1-like [Oryza sativa Japonica Group]
 dbj|BAF05580.1| Os01g0636500 [Oryza sativa Japonica Group]
 gb|EEC71152.1| hypothetical protein OsI_02991 [Oryza sativa Indica Group]
 gb|EEE55052.1| hypothetical protein OsJ_02751 [Oryza sativa Japonica Group]
Length=538

 Score =   376 bits (966),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 270/375 (72%), Gaps = 9/375 (2%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDGVSDD+KA EAAW AACK   +TV +PS+  FL+ PI+  GP C P+
Sbjct  137   AVFNVVDFGAKGDGVSDDTKAFEAAWAAACKQGASTVVVPSELEFLVGPISFSGPYCKPN  196

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q+DG +VAP +  +W  S + QWI F  ++  +IQG G  +G+G  WW  S I   +
Sbjct  197   ILFQLDGTIVAPTSAKAW-GSGLLQWIEFTKLNGVSIQGNGIINGRGQQWWTYSDIDDDE  255

Query  1120  EKKASKTIHVN----MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
             +      +       +KPTALRFY S NV + GI+IVNS QCHLKFD+ +GV VH++TIS
Sbjct  256   DDDTQYDVEFERMPQVKPTALRFYGSFNVVVAGITIVNSSQCHLKFDSCQGVMVHDVTIS  315

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +PENS NTDGIHLQNS+DV IHH+ +  GDDCVSIQTGCSN+++H++NCGPGHGIS+GGL
Sbjct  316   SPENSLNTDGIHLQNSKDVSIHHTNLACGDDCVSIQTGCSNINIHNVNCGPGHGISIGGL  375

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             G+D + ACVSN+ V +V M  T+ G RIKTWQGG+G V++V FS IQVS+V+ PI+IDQ+
Sbjct  376   GRDNTKACVSNVTVRDVNMFRTMTGVRIKTWQGGLGLVQDVRFSNIQVSEVQTPIIIDQF  435

Query  592   YCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS--PG  419
             YCDK  C NQT AVA+ GV++  I GTF  +P H ACS+S PC+ + L  +QL P   P 
Sbjct  436   YCDKRTCSNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSSPCSGITLTGVQLRPVQIPH  495

Query  418   YRGFRNGQCWNSYGK  374
             YR   +  CW ++G+
Sbjct  496   YR-LNDPFCWQAFGE  509



>emb|CDP13178.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   375 bits (964),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 207/423 (49%), Positives = 283/423 (67%), Gaps = 25/423 (6%)
 Frame = -3

Query  1486  PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-C  1310
             P +S+F++L+FGAKGDG +DD+KA +AAW AACKV  +T+ +PS   FL+ PI+  GP C
Sbjct  111   PSTSIFNVLNFGAKGDGTTDDTKAFQAAWAAACKVEASTIVVPSDSVFLVGPISFSGPYC  170

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
               D+V Q+DG ++AP N  +W  S   QW+ F  +   TIQG GT DG+G  WW+ S + 
Sbjct  171   QHDIVFQLDGTIIAPTNTRAW-GSGTLQWLQFTKLVGITIQGSGTIDGRGAAWWQDSPLQ  229

Query  1129  SLQEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSP  1013
                + ++   + +N                     +KPTALRFY S NV++ GI+I NSP
Sbjct  230   DPVDSESKLIVPLNGTVGRNPSIPIQGSLGGKMPSIKPTALRFYGSFNVSVTGITIQNSP  289

Query  1012  QCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCS  833
             QCHLKFD   GV+V+N ++S+P +SPNTDGIHLQNS+DV I  + +  GDDCVSIQTGC+
Sbjct  290   QCHLKFDTCIGVSVYNFSVSSPGDSPNTDGIHLQNSRDVLIRSTNVACGDDCVSIQTGCT  349

Query  832   NVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKN  653
             NV++H+INCGPGHGIS+GGLGKD++ ACVSNI + +++M  T+ G RIKTWQGG GSV+ 
Sbjct  350   NVYIHNINCGPGHGISIGGLGKDETRACVSNITIRDIIMHQTMNGVRIKTWQGGSGSVQG  409

Query  652   VSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNS  473
             V FS I VS+V++PI+IDQ+YCDK  CKNQ+ AVA+ G+ +  I GT+  +P HLACS++
Sbjct  410   VLFSNIIVSEVQLPIVIDQFYCDKTTCKNQSSAVALSGIHYENIRGTYTVKPVHLACSDN  469

Query  472   VPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS  293
             VPCT V L DI+L+P        +  CW ++G+      P     CL+ G     RI   
Sbjct  470   VPCTQVTLNDIELKPLQERYHMYDPYCWQTFGELYSPTEPPIE--CLQIGKPPGNRIQAD  527

Query  292   HEN  284
             H++
Sbjct  528   HDS  530



>ref|XP_010547772.1| PREDICTED: polygalacturonase At1g48100 [Tarenaya hassleriana]
Length=526

 Score =   375 bits (963),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 205/423 (48%), Positives = 280/423 (66%), Gaps = 25/423 (6%)
 Frame = -3

Query  1489  PPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-  1313
             P P  VF++L FGAKGDG  DD+KA EAAW AACKV  +T+ +P+++ FL+ PI+  GP 
Sbjct  105   PKPPKVFNVLDFGAKGDGKIDDTKAFEAAWAAACKVEASTMVVPNEYVFLVGPISFSGPY  164

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI  1133
             C  ++V Q+DG ++AP++  SW +  +  WI F  +   T+QG G  DG+G  WW+    
Sbjct  165   CQANIVFQLDGTIIAPMDSKSWGRG-LLWWIEFTKLRGITVQGKGIIDGRGSGWWQDYPF  223

Query  1132  HSLQEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNS  1016
                 + ++   + +N                     +KPTALRFY S NVT+ GI+I NS
Sbjct  224   EDPLDDESKLIVPLNNSIQERPPMPVRSELSGSMPSIKPTALRFYGSFNVTVTGITIQNS  283

Query  1015  PQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGC  836
             PQCHLKFDN  GV VH++++S+P +SPNTDGIHLQNS+DV IH ST+  GDDC+SIQTGC
Sbjct  284   PQCHLKFDNCVGVLVHDMSVSSPGDSPNTDGIHLQNSKDVLIHSSTLACGDDCISIQTGC  343

Query  835   SNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVK  656
             SNV++H++NCGPGHGIS+G LG+D + ACVSNI V +V   NT+   RIKTWQGG GSV+
Sbjct  344   SNVYIHNVNCGPGHGISIGSLGRDSTKACVSNITVRDVNFHNTMTAVRIKTWQGGSGSVQ  403

Query  655   NVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSN  476
              V FS IQVS+V++PI+IDQ+YCD  +CKNQT AVA+ GV + +I GT+  +P H ACS+
Sbjct  404   GVLFSNIQVSEVQLPIVIDQFYCDHASCKNQTSAVAVNGVTYEKIRGTYTVKPVHFACSD  463

Query  475   SVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIAR  296
             + PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     R+  
Sbjct  464   NFPCVDVQLSSIELKPMQQLYHMYDPFCWQTFGELSTPTVPP-ID-CLQIGKPSRNRVQS  521

Query  295   SHE  287
              H+
Sbjct  522   DHD  524



>ref|XP_008221838.1| PREDICTED: polygalacturonase At1g48100 [Prunus mume]
Length=533

 Score =   375 bits (964),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 202/420 (48%), Positives = 280/420 (67%), Gaps = 25/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG +DD+KA +AAW AACKV  + + +P+ + FL+ PI+  GP C P
Sbjct  115   SSSFNVLDFGAKGDGSTDDTKAFQAAWAAACKVEASQIIVPAAYKFLVGPISFSGPYCQP  174

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             +++ Q+DG ++AP +  SW K  + QW+ F  +   T+QG G  DG+G +WW+       
Sbjct  175   NILFQLDGTIIAPTDPKSWGK-GLLQWLEFTKLRGITVQGKGLIDGRGSSWWQDTPYGDP  233

Query  1144  -------LSQIHSLQEKKASKTIHVNM-------KPTALRFYESTNVTIHGISIVNSPQC  1007
                    +  ++S  ++     I   +       KPTALRFY S NVT+ GI+I NSPQC
Sbjct  234   IDDDFKLIVPLNSTAQQHPPMPIRSELSGKMPSIKPTALRFYGSFNVTVTGITIQNSPQC  293

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++++S+P NSPNTDGIHLQNS+ V IH + +  GDDC+SIQTGCS+V
Sbjct  294   HLKFDNCAGVLVHDMSVSSPGNSPNTDGIHLQNSKQVLIHTTNLACGDDCISIQTGCSDV  353

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             +VH++NCGPGHGIS+G LG+D + ACVSNI V +++M NT+ G R+KTWQGG GSV+ V 
Sbjct  354   YVHNVNCGPGHGISIGSLGRDNTKACVSNITVRDIIMHNTMNGVRVKTWQGGSGSVQGVL  413

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H ACS+S+P
Sbjct  414   FSNIQVSEVQLPIVIDQFYCDKSQCKNQTSAVALSGITYERIRGTYTVKPVHFACSDSLP  473

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L  I+L+P           CW ++G+ +    P     CL+ G     R+   H+
Sbjct  474   CVDVTLNGIELKPVQEQYHMYEPFCWQTFGELRTPTVPPIA--CLQIGKPSSNRVNSDHD  531



>ref|XP_006359737.1| PREDICTED: polygalacturonase At1g48100-like [Solanum tuberosum]
Length=430

 Score =   372 bits (954),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 260/388 (67%), Gaps = 17/388 (4%)
 Frame = -3

Query  1474  VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDL  1298
             VF++L +GAKGDG++ D+KA EA W  ACKV G+ + +PS + FL+ PI+  G  C  ++
Sbjct  29    VFNVLDYGAKGDGITFDTKAFEATWIEACKVEGSIMMVPSDYDFLVGPISFSGSHCEKNI  88

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQE  1118
             V Q+DG ++AP N   W    + QW+ F  ++   ++G G  DGQG  WWK++    ++E
Sbjct  89    VFQLDGRIIAPTNPKVW---GVLQWLEFSKLNGICVKGKGIIDGQGSVWWKIAPFLLIEE  145

Query  1117  KKA-------------SKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
              +              SK      +P AL+FY S+NV + GI+I NSP+ HLKFDN   V
Sbjct  146   YEGDYSEEQDDYISSTSKGKMPRTRPAALKFYGSSNVVVTGITIQNSPKAHLKFDNCVAV  205

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V  IT+S+P +SPNTDGIHLQNSQ+V I+ S I  GDDC+SIQTG S V +H ++CGPG
Sbjct  206   QVSGITVSSPGDSPNTDGIHLQNSQNVVINSSHIACGDDCISIQTGSSAVFIHDVHCGPG  265

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HG S+GGLGKD + ACVSNI V++  ++NT+ G RIKTWQGG GSV+ + FS I VSDVK
Sbjct  266   HGFSIGGLGKDNTKACVSNITVQDSTLQNTMTGVRIKTWQGGSGSVQGIMFSNIHVSDVK  325

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
             +PIMIDQ+YCDK  C N+T AVAI GV +  I GT++ +P H ACS+SVPCT V LADI+
Sbjct  326   IPIMIDQFYCDKRKCGNRTSAVAISGVSYQSIKGTYSYKPVHFACSDSVPCTGVSLADIE  385

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             L+PS   + F    CW +YG+ +    P
Sbjct  386   LKPSSEKKHFYGPYCWETYGELRTNTTP  413



>ref|XP_011098761.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=462

 Score =   372 bits (956),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 203/398 (51%), Positives = 271/398 (68%), Gaps = 16/398 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L++GAKGDG++DD+ A EAAW  AC+  G+ + +PS   FL+ PI+  GP CM 
Sbjct  55    STTFNVLNYGAKGDGIADDTNAFEAAWTDACQEQGSVMLVPSGSVFLVKPISFSGPNCMS  114

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-LSQIHS  1127
             ++V Q+DG ++AP + G+W  S + QW+ F  +   TI+G G+ DGQG  WW   S  + 
Sbjct  115   NIVFQLDGKIIAPRSSGAW-GSGLLQWLEFTKLKGITIRGKGSIDGQGSVWWDDYSTANP  173

Query  1126  LQEKKAS----------KTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
               E  A+          K    + +PTALRFY ST+VT+ GI+I NSPQ HLKFD+  GV
Sbjct  174   TDESDAAGSPDWASAEAKGGMPSTRPTALRFYGSTDVTVTGITIQNSPQTHLKFDDCIGV  233

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V  I+IS+P +SPNTDGIHLQNSQDV IH +++  GDDC+SIQTGCS V+VH++NCGPG
Sbjct  234   QVFGISISSPGDSPNTDGIHLQNSQDVVIHTTSLACGDDCISIQTGCSGVYVHNVNCGPG  293

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HGIS+GGLGKD + ACVSNI V +  ++NTL G RIKTWQGG GSV+ V FS IQVS+V+
Sbjct  294   HGISIGGLGKDGTKACVSNITVRDSTIQNTLNGVRIKTWQGGSGSVQGVMFSNIQVSEVE  353

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PI+IDQ+YC+ H C N+T AVA+ GV +  I GT+   P   ACS+S PC  + L+ I 
Sbjct  354   TPIIIDQFYCNGHTCPNKTSAVAVSGVSYQSIKGTYTVNPVSFACSDSTPCAGITLSSIV  413

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             L PS   +   N  CW +YG+ Q    P  +D CL++G
Sbjct  414   LNPSSEAKN-DNPFCWKAYGELQTATTPP-ID-CLQTG  448



>ref|XP_003618193.1| Polygalacturonase [Medicago truncatula]
 gb|AES74411.1| polygalacturonase [Medicago truncatula]
Length=425

 Score =   371 bits (952),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 206/405 (51%), Positives = 271/405 (67%), Gaps = 25/405 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG SDD+KA E AW AACK+  +T+ +PS   FL+ PI+  GP C P
Sbjct  42    SSTFNVLDFGAKGDGHSDDTKAFEDAWAAACKMEASTMVVPSGSVFLVKPISFSGPNCEP  101

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W  S   QW+ F  ++  TI+G G  DGQG  WW  S+    
Sbjct  102   NIVFQLDGKIIAPTSPSAW-GSGTLQWLEFTKLNKITIKGKGVIDGQGSVWWNDSE----  156

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                K  KT     KPTALRFY S  V++ GI+I NS Q HLKFD+   V V +IT S+P 
Sbjct  157   ---KLPKT-----KPTALRFYGSDGVSVSGITIQNSQQTHLKFDSCTNVQVFDITTSSPG  208

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNSQDV I  ST+  GDDCVSIQTGCSN+ VH++NCGPGHGIS+G LGK+
Sbjct  209   DSPNTDGIHLQNSQDVVISGSTLSCGDDCVSIQTGCSNILVHNVNCGPGHGISIGSLGKE  268

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSN+ V +V ++NTL G RIKTWQGG GSV+N+ FS IQVSDVK PIMIDQ+YCD
Sbjct  269   NTKACVSNVTVRDVTLQNTLTGVRIKTWQGGSGSVQNIMFSNIQVSDVKTPIMIDQFYCD  328

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
                C+N T AVA+  + +  + GT+  +P + ACS+S+PC  + L  I+LE S      +
Sbjct  329   GGKCRNVTSAVAVSSIHYTNVHGTYTKEPIYFACSDSLPCKGITLDTIKLESS------Q  382

Query  403   NGQ---CWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             N     CW +YG+ + ++ P  +D CL+ G+     I  + E+ C
Sbjct  383   NSNVPFCWKAYGELKTEIVPP-VD-CLQRGNPSSGGITSNKESSC  425



>gb|AFK47772.1| unknown [Medicago truncatula]
Length=425

 Score =   371 bits (952),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 205/402 (51%), Positives = 270/402 (67%), Gaps = 19/402 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG SDD+KA E AW AACK+  +T+ +PS   FL+ PI+  GP C P
Sbjct  42    SSTFNVLDFGAKGDGHSDDTKAFEDAWAAACKMEASTMVVPSGSVFLVKPISFSGPNCEP  101

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W  S   QW+ F  ++  TI+G G  DGQG  WW  S+    
Sbjct  102   NIVFQLDGKIIAPTSPSAW-GSGTLQWLEFTKLNKITIKGKGVIDGQGSVWWNDSE----  156

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                K  KT     KPTALRFY S  V++ GI+I NS Q HLKFD+   V V +IT S+P 
Sbjct  157   ---KLPKT-----KPTALRFYGSDGVSVSGITIQNSQQTHLKFDSCTNVQVFDITTSSPG  208

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNSQDV I  ST+  GDDCVSIQTGCSN+ VH++NCGPGHGIS+G LGK+
Sbjct  209   DSPNTDGIHLQNSQDVVISGSTLSCGDDCVSIQTGCSNILVHNVNCGPGHGISIGSLGKE  268

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSN+ V +V ++NTL G RIKTWQGG GSV+N+ FS IQVSDVK PIMIDQ+YCD
Sbjct  269   NTKACVSNVTVRDVTLQNTLTGVRIKTWQGGSGSVQNIMFSNIQVSDVKTPIMIDQFYCD  328

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
                C+N T AVA+  + +  + GT+  +P + ACS+S+PC  + L  I+LE S   +   
Sbjct  329   GGKCRNVTSAVAVSSIHYTNVHGTYTKEPIYFACSDSLPCKGITLDTIKLESS---QNSN  385

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
                CW +YG+ + ++ P  +D CL+ G+     I  + E+ C
Sbjct  386   VPFCWKAYGELKTEIVPP-VD-CLQRGNPSSGGITSNKESSC  425



>ref|XP_009405655.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 272/389 (70%), Gaps = 8/389 (2%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++ FD+L FGAKGDGV+DD+KA +AAW AACKV G+T+ +P ++ FL+ PI+  GP C P
Sbjct  88    AATFDVLDFGAKGDGVTDDTKAFQAAWAAACKVGGSTMVVPEEYEFLVGPISFSGPYCQP  147

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK--LSQIH  1130
             ++V Q+DG ++AP +   W  S +  WI F  +   TIQG G  +G+G  WW    S + 
Sbjct  148   NIVFQLDGMIIAPTDARYW-GSGLLWWIEFTKLRGITIQGSGVIEGRGSVWWTNGESDVD  206

Query  1129  SLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
              + E+ +     +  KPTALRFY S NVT+ GI+I NS QCHLKFDN + V V N+TI++
Sbjct  207   PINEELSKNLPQI--KPTALRFYGSYNVTVTGITIQNSQQCHLKFDNCEAVQVFNMTIAS  264

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             P +S NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCSN+++H ++CGPGHGIS+GGLG
Sbjct  265   PGSSLNTDGIHLQNSRDVMIHHTNMSCGDDCISIQTGCSNINIHRVDCGPGHGISIGGLG  324

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +D + ACVSNI V +V M NT+ G RIKTWQGG GSV+N+ FS I VS+V+ PI+IDQ+Y
Sbjct  325   RDNTKACVSNITVRDVNMHNTMTGVRIKTWQGGSGSVQNIIFSNIGVSEVQTPIVIDQFY  384

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CD+ +CKNQT AV + G+ +  I GT+  +P H ACS++ PC+D+ L  IQLEP   +  
Sbjct  385   CDRSSCKNQTSAVTLSGIAYENIRGTYTVKPVHFACSDASPCSDISLTKIQLEPLQEHYH  444

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
                  CW ++G+      P  +  CL++G
Sbjct  445   MYQPFCWQAFGELYTPTVPPIV--CLQNG  471



>ref|XP_002311773.1| hypothetical protein POPTR_0008s19350g [Populus trichocarpa]
 gb|EEE89140.1| hypothetical protein POPTR_0008s19350g [Populus trichocarpa]
Length=517

 Score =   373 bits (957),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/420 (49%), Positives = 278/420 (66%), Gaps = 25/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L FGAKG+G SDD+KA +AAW AACKV  +T+ +P+++ FL+ PI+  GP C  
Sbjct  99    STTFNVLDFGAKGNGKSDDTKAFQAAWAAACKVEASTLIVPAEYVFLVGPISFSGPYCQA  158

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP N  +W +  + QW+ F  +   TIQG GT DG G  WW+       
Sbjct  159   NIVFQLDGTIIAPSNANAWGRG-LLQWLEFTKLVGITIQGKGTIDGSGSVWWQDYPFEDP  217

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              + ++   I +N                     +KPTALRFY S NVT+ GI+I NSPQC
Sbjct  218   IDSESELIIPLNNTVQQHPPMPIRNELNGKMPSIKPTALRFYGSFNVTVTGITIQNSPQC  277

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++ +S+P NSPNTDGIHLQNS+DV I  + +  GDDCVSIQTGC+NV
Sbjct  278   HLKFDNCVGVVVHDMRVSSPGNSPNTDGIHLQNSKDVLIRSTDLACGDDCVSIQTGCTNV  337

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+GGLGKD + ACVSNI V +VVM  T+ G R+KTWQGG GSV+ V 
Sbjct  338   YIHNVNCGPGHGISIGGLGKDNTKACVSNITVRDVVMHGTMTGVRVKTWQGGSGSVQGVL  397

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ +  I GT+  +P H ACS+++P
Sbjct  398   FSNIQVSEVQLPIVIDQFYCDKRKCKNQTSAVALSGITYENIRGTYTVKPVHFACSDALP  457

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L  I+L+P        +  CW ++G+ +    P     CL+ G     R  R ++
Sbjct  458   CMDVSLTTIELKPLQEQYHLYDPFCWQTFGELKTPTMPPIS--CLQIGKPSGNRPQRDYD  515



>emb|CDY54228.1| BnaC08g49850D [Brassica napus]
Length=528

 Score =   373 bits (958),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/421 (49%), Positives = 279/421 (66%), Gaps = 25/421 (6%)
 Frame = -3

Query  1489  PPP--SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
             PPP  S VF+++ FGAKGDG  DD+KA EAAW AACKV  + + IP +++FL+ PI+  G
Sbjct  111   PPPKGSKVFNVMDFGAKGDGRCDDTKAFEAAWAAACKVEASMMIIPPEYTFLVGPISFSG  170

Query  1315  P-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS  1139
             P C  ++V Q+DG ++AP +  SW K  +  WI+F  +    +QG G  DG+G  WW+  
Sbjct  171   PYCQANIVFQIDGTIIAPTDSKSWGKG-LMWWIDFTKLKGIKVQGKGVIDGRGSGWWQ--  227

Query  1138  QIHSLQEKKASKTIHVN-----------------MKPTALRFYESTNVTIHGISIVNSPQ  1010
             Q +   + +    + +N                 +KPTALRFY S  V + GI+I NSPQ
Sbjct  228   QDYPFIDGETKLIVPLNNSVPLPIRSEFDWKMPSIKPTALRFYGSVGVEVSGITIQNSPQ  287

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQN++DV IH ST+  GDDC+SIQTGCSN
Sbjct  288   CHLKFDNCVDVLVHDMAVSSPGDSPNTDGIHLQNTRDVLIHSSTLACGDDCISIQTGCSN  347

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V++H++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVGSVK +
Sbjct  348   VYIHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGI  407

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+  
Sbjct  408   LFSNIQLNEVQLPIVIDQFYCDHTTCKNQTSAVAVEGVTYEKIKGTYTVKPVHFACSDDF  467

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     R+   H
Sbjct  468   PCVDVQLSGIELKPVQERYHMYDPFCWQTFGELNSPTLPP-ID-CLQIGKPARNRVQSDH  525

Query  289   E  287
             +
Sbjct  526   D  526



>gb|AES96173.2| polygalacturonase [Medicago truncatula]
Length=534

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 277/431 (64%), Gaps = 31/431 (7%)
 Frame = -3

Query  1489  PPP-------SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINP  1331
             PPP       S+ F++L +GAKGDG +DD+KA +A W A CKV  +T+ IP+ + F + P
Sbjct  108   PPPKANNGVHSTFFNVLDYGAKGDGNTDDTKAFQATWAATCKVEASTMVIPANYIFYVGP  167

Query  1330  ITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPN  1154
             I+  GP C  ++V Q+DG ++AP N  +W   ++ QW+ F  +   TIQG G  DG+G  
Sbjct  168   ISFSGPYCKANIVFQLDGTIIAPTNPNAWSGVTL-QWLEFTKLEGITIQGNGVIDGRGSV  226

Query  1153  WWK-------LSQIHSL-----QEKKASKTIHVNM-------KPTALRFYESTNVTIHGI  1031
             WW+       +     L     Q +K    +   M       KPTALRFY S   T+ GI
Sbjct  227   WWQDFPYDNPIDDEEKLIVPLNQTQKPPMPVQNEMGRKMPSNKPTALRFYGSYGPTVTGI  286

Query  1030  SIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVS  851
             +I NSPQCHLKFDN  GV VH+++IS+P +SPNTDGIHLQNS+DV IH S +  GDDC+S
Sbjct  287   TIQNSPQCHLKFDNCNGVLVHDVSISSPGDSPNTDGIHLQNSKDVLIHSSKLACGDDCIS  346

Query  850   IQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGG  671
             IQTGCSNV+VH++NCGPGHGIS+G LGKD + ACVSNI V +V + +++ G RIKTWQGG
Sbjct  347   IQTGCSNVYVHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNIHDSMNGVRIKTWQGG  406

Query  670   VGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFH  491
              GSV+ V FS IQVS+V++PI+IDQ+YCDK  C N T AV++ G+ + +I GT+  +P H
Sbjct  407   SGSVQGVLFSNIQVSEVQLPIVIDQFYCDKRVCTNHTSAVSLAGINYERIKGTYTVKPVH  466

Query  490   LACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLV  311
              ACS+S+PC DV L  ++L+P        +  CW ++G+ +    P     CL+ G    
Sbjct  467   FACSDSLPCVDVSLTTVELKPIQEKYHLYDPFCWQTFGELRTPTVPPIG--CLQIGKPSN  524

Query  310   KRIARSHENIC  278
              RI   H+ IC
Sbjct  525   NRIQTDHD-IC  534



>ref|XP_008340054.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=521

 Score =   372 bits (956),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 201/420 (48%), Positives = 283/420 (67%), Gaps = 25/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG +DD+KA +AAW AACKV  + + +P+ + FL+ PI+  GP C  
Sbjct  103   SSTFNVLDFGAKGDGSTDDTKAFQAAWAAACKVEASNIIVPAGYQFLVGPISFSGPYCQK  162

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-------  1145
             +++ Q+DG +VAP +  SW K  +FQW+ F  ++  T+QG G  DG+G +WW+       
Sbjct  163   NILFQLDGTIVAPTDSESWGKG-LFQWLEFTKLNGITVQGKGVIDGRGSSWWQDTPYGDP  221

Query  1144  -------LSQIHSLQEKKASKTIHVNM-------KPTALRFYESTNVTIHGISIVNSPQC  1007
                    +  ++S  +++    I   +       KPTALRFY S NVT+ GI+I NSPQC
Sbjct  222   IDDDFKLIVPLNSSVQQRPPMPIRSQLSGKMPSIKPTALRFYGSFNVTVTGITIQNSPQC  281

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN +GV VH++++S+P +SPNTDGIHLQNSQ V IH +T+  GDDC+SIQTGC++V
Sbjct  282   HLKFDNCQGVLVHDMSVSSPGDSPNTDGIHLQNSQRVLIHTTTLACGDDCISIQTGCTDV  341

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             +VH++NCGPGHGIS+G LG+D + ACVSNI V +++M NT+ G R+KTWQGG GSV+ V 
Sbjct  342   YVHNVNCGPGHGISIGSLGRDNTKACVSNITVRDIIMHNTMNGVRVKTWQGGSGSVQGVM  401

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H ACS+S+P
Sbjct  402   FSNIQVSEVQLPIVIDQFYCDKSTCKNQTSAVALSGITYERIRGTYTVKPVHFACSDSLP  461

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C  V L  I L+P        +  CW ++G+ +    P     CL+ G     ++   H+
Sbjct  462   CVGVTLNGIDLKPLQEKYHLYDPFCWQTFGELRTPTVPPIG--CLQLGKPSSNKVNSDHD  519



>ref|NP_563875.6| pectin lyase-like protein [Arabidopsis thaliana]
 gb|AEE28612.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=532

 Score =   372 bits (956),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 195/420 (46%), Positives = 272/420 (65%), Gaps = 27/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KA EAAW AACK+  + + +P ++++L+ PI+  GP C  
Sbjct  116   SQVFNVMDFGAKGDGKCDDTKAFEAAWVAACKIEASVMLVPPEYTYLVGPISFSGPYCQA  175

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W K  +  WI+F  +    +QG G  DG+G  WW+  Q    
Sbjct  176   NIVFQLDGTIIAPTDSKTWGK-GLMWWIDFTKLKGIKVQGKGVIDGRGSGWWQ--QDSPF  232

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              +      + +N                     +KPTALRF  S  V + GI+I NSPQC
Sbjct  233   IDSDTKLIVPLNNSANQNPPMPIRSELDERMPSIKPTALRFSGSFGVEVTGITIQNSPQC  292

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFD+  GV VH+I +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSNV
Sbjct  293   HLKFDDCVGVVVHDIAVSSPGDSPNTDGIHLQNTKDVLIHSTTLACGDDCISIQTGCSNV  352

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
              VH++NCGPGHGIS+G LGK+ + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + 
Sbjct  353   FVHNVNCGPGHGISIGSLGKEGTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGII  412

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ++ V++PI I+Q+YCD   CKNQT AVA++GV + +I GT+  +P H ACS++ P
Sbjct  413   FSNIQLNQVQIPITINQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDNFP  472

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     ++   H+
Sbjct  473   CVDVQLSSIELKPVQEKYRMYDAYCWQTFGELNTPTLPP-ID-CLKIGKPPRNKVQSDHD  530



>emb|CDY20612.1| BnaC08g14460D [Brassica napus]
Length=531

 Score =   372 bits (956),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 276/417 (66%), Gaps = 24/417 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG+ DD+KA EAAW AACKV  + + IP +++FL+ PI+  GP C P
Sbjct  118   SQVFNVMDFGAKGDGIRDDTKAFEAAWAAACKVEASMMIIPPEYTFLVGPISFSGPYCQP  177

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  +  WI+F  +    +QG G  DG+G  WW+  Q +  
Sbjct  178   NIVFQLDGTIIAPTDSKSWGKG-LMWWIDFTKLIGIKVQGKGVIDGRGSGWWQ--QDYPF  234

Query  1123  QEKKASKTIHVN------------------MKPTALRFYESTNVTIHGISIVNSPQCHLK  998
              + +    + +N                  +KPTALRFY S  V + GI+I NSPQCHLK
Sbjct  235   IDGETKLIVPLNNSVNQNPPISEFDLKMPSIKPTALRFYGSIGVEVSGITIQNSPQCHLK  294

Query  997   FDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVH  818
             FDN   V VH++T+S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSNV++H
Sbjct  295   FDNCGDVVVHDMTVSSPGDSPNTDGIHLQNTRDVLIHSTTLSCGDDCISIQTGCSNVYIH  354

Query  817   HINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSG  638
              + CGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS 
Sbjct  355   TVTCGPGHGISIGSLGKDSTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFSN  414

Query  637   IQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTD  458
             IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+  PC D
Sbjct  415   IQLNEVQLPIVIDQFYCDHTTCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDDFPCVD  474

Query  457   VHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             V L+ I+L P        +  CW ++G+      P  +D CL+ G     R+   H+
Sbjct  475   VQLSAIELRPVQERYHMYDPFCWQTFGELNTPTLPP-ID-CLQIGKPARNRVQSDHD  529



>ref|XP_009118238.1| PREDICTED: polygalacturonase At1g48100-like [Brassica rapa]
Length=528

 Score =   372 bits (955),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 205/421 (49%), Positives = 279/421 (66%), Gaps = 25/421 (6%)
 Frame = -3

Query  1489  PPP--SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
             PPP  S VF+++ FGAKGDG  DD+KA EAAW AACKV  + + IP +++FL+ PI+  G
Sbjct  111   PPPKGSKVFNVMDFGAKGDGKCDDTKAFEAAWAAACKVEASMMIIPPEYTFLVGPISFSG  170

Query  1315  P-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS  1139
             P C  ++V Q+DG ++AP +  SW K  +  WI+F  +    +QG G  DG+G  WW+  
Sbjct  171   PYCQANIVFQLDGTIIAPTDSKSWGKG-LMWWIDFTKLKGIKVQGKGVIDGRGSGWWQ--  227

Query  1138  QIHSLQEKKASKTIHVN-----------------MKPTALRFYESTNVTIHGISIVNSPQ  1010
             Q +   + +    + +N                 +KPTALRFY S  V + GI+I NSPQ
Sbjct  228   QDYPFIDGETKLIVPLNNSVPMPIRSEFDWKMPSIKPTALRFYGSVGVEVSGITIQNSPQ  287

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN   V VH++ +S+P +SPNTDGIHLQN++DV IH ST+  GDDC+SIQTGCSN
Sbjct  288   CHLKFDNCVDVLVHDMAVSSPGDSPNTDGIHLQNTRDVLIHSSTLACGDDCISIQTGCSN  347

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V++H+INCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVG+VK +
Sbjct  348   VYIHNINCGPGHGISIGSLGKDSTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGAVKGI  407

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS+  
Sbjct  408   LFSNIQLNEVQLPIVIDQFYCDHTTCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDDF  467

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     R+   H
Sbjct  468   PCVDVQLSGIELKPVQERYHMYDPFCWQTFGELNSPTLPP-ID-CLQIGKPARNRVQSDH  525

Query  289   E  287
             +
Sbjct  526   D  526



>ref|XP_011071095.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=522

 Score =   371 bits (953),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 207/403 (51%), Positives = 269/403 (67%), Gaps = 27/403 (7%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             YP   +V  +L FGAKGDG +DD+KA +AAW AACKV  + + +P++  FL+ PI+  GP
Sbjct  102   YP---TVLSVLDFGAKGDGSTDDTKAFQAAWAAACKVEASVIDVPAKHVFLVGPISFSGP  158

Query  1312  -CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
              C  D+V Q+DG +VAP     W  S + QW+ F  +   TI+G GT DG G  WW+ + 
Sbjct  159   YCQHDIVFQLDGKIVAPTGSSHW-GSGLLQWLEFTKLVGLTIKGSGTIDGNGAVWWQSAP  217

Query  1135  IHSLQEKKASKTIH----------------------VNMKPTALRFYESTNVTIHGISIV  1022
                      +K I                        ++KPTALRFY S NVT+ GI+I 
Sbjct  218   YDDDPLDDQAKLIFPSNGTFGQKPPIPVRSSLGGKMPSIKPTALRFYGSFNVTVTGITIQ  277

Query  1021  NSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQT  842
             NSPQCHLKFDN  GV+V+N ++S+P +SPNTDGIHLQNS+DV I  S +  GDDCVSIQT
Sbjct  278   NSPQCHLKFDNCVGVSVYNFSVSSPGDSPNTDGIHLQNSKDVLIRSSNLACGDDCVSIQT  337

Query  841   GCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGS  662
             GC+NV++H++NCGPGHGIS+GGLGKD + ACVSNI V ++VM NT+ G RIKTWQGG GS
Sbjct  338   GCTNVYIHNVNCGPGHGISIGGLGKDNTKACVSNITVRDIVMHNTMNGVRIKTWQGGSGS  397

Query  661   VKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLAC  482
             V+ V FS IQVS+V++PI+IDQYYCDK  CKNQT AVA+ G+ +  I GT+  +P H AC
Sbjct  398   VQGVQFSNIQVSEVQLPIVIDQYYCDKTKCKNQTSAVALSGINYENIRGTYTIKPVHFAC  457

Query  481   SNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             S+S+PCTDV L +IQL+P        +  CW ++GK    + P
Sbjct  458   SDSLPCTDVTLTNIQLKPQQEQYHMYDPFCWQTFGKLYSPMIP  500



>gb|KFK43344.1| hypothetical protein AALP_AA1G112800 [Arabis alpina]
Length=536

 Score =   371 bits (953),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 277/420 (66%), Gaps = 27/420 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KA EAAW +ACK+  + + +P ++ FL+ PI+  GP C  
Sbjct  120   SQVFNVMDFGAKGDGKCDDTKAFEAAWASACKIEASMMIVPPEYIFLVGPISFSGPNCQA  179

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  ++ WI F  +    +QG G  DG+G  WW+  Q +  
Sbjct  180   NIVFQLDGTIIAPTDSKSWGKGLMW-WIEFTKLIGIKVQGKGVIDGRGSGWWQ--QDYPF  236

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              +++    + +N                     +KPTALRFY S    + GI+I NSPQC
Sbjct  237   NDEENKFLVPLNNSVQQHPPMPIRSELDERMPSIKPTALRFYGSFGAEVTGITIQNSPQC  296

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++ +S+P +SPNTDGIHLQN++DV IH +T+  GDDC+SIQTGCSNV
Sbjct  297   HLKFDNCVGVVVHDMVVSSPGDSPNTDGIHLQNTKDVLIHGTTLACGDDCISIQTGCSNV  356

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + 
Sbjct  357   YIHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVTMHNTMNGVRIKTWQGGVGSVKGIL  416

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQ+++V+ PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS++ P
Sbjct  417   FSNIQLNEVQCPIVIDQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDNFP  476

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L+ I+L+P P      +  CW ++G+      P  +D CL+ G     R+   H+
Sbjct  477   CVDVQLSSIELKPVPEKYHMSDAFCWQTFGELNTPTLPP-ID-CLQIGKPARNRVQSDHD  534



>ref|XP_006644412.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Oryza 
brachyantha]
Length=535

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 198/375 (53%), Positives = 269/375 (72%), Gaps = 9/375 (2%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDG+SDD+KA EAAW AACK   +TV +PSQ  FL+ PI+  GP C P+
Sbjct  134   AVFNVVDFGAKGDGISDDTKAFEAAWAAACKKGASTVFVPSQLEFLVGPISFSGPYCKPN  193

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q++G ++AP +  +W  S + QWI F  ++  +IQG G  +G+G  WW  S     +
Sbjct  194   ILFQLEGTIIAPTSAKAW-GSGLLQWIEFTKLNGISIQGNGIINGRGQQWWTYSDTDDNE  252

Query  1120  EKKASKTIHVN----MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITIS  953
             +      +       +KPTALRFY S NV + GI+IVNS QCHLKFD+ +GV VH++TIS
Sbjct  253   DDDTQYDVEFERMPQVKPTALRFYGSFNVVVSGITIVNSSQCHLKFDSCQGVMVHDLTIS  312

Query  952   APENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislggl  773
             +PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCS++++H++NCGPGHGIS+GGL
Sbjct  313   SPENSLNTDGIHLQNSKDVSIHHTNMACGDDCISIQTGCSDINIHNVNCGPGHGISIGGL  372

Query  772   GKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQY  593
             G+D + ACVSN+ V +V M  T+ G RIKTWQGG+G V++V FS IQVS+V+ PI+IDQ+
Sbjct  373   GRDNTKACVSNVTVRDVNMFRTMNGVRIKTWQGGLGLVQDVRFSNIQVSEVQTPIIIDQF  432

Query  592   YCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS--PG  419
             YCDK  C NQT AVA+ GV++  I GTF  +P H ACS+S PC+ + L  +QL P   P 
Sbjct  433   YCDKRTCSNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSSPCSGITLTGVQLRPVQIPH  492

Query  418   YRGFRNGQCWNSYGK  374
             YR   +  CW ++G+
Sbjct  493   YR-LNDPFCWQAFGE  506



>ref|XP_008389668.1| PREDICTED: polygalacturonase At1g48100 [Malus domestica]
Length=528

 Score =   370 bits (950),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 202/419 (48%), Positives = 285/419 (68%), Gaps = 25/419 (6%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             S +++L FGAKG+G +DD+KA +AAW AACKV  +++ +P+ + FL+ PI+  GP C  +
Sbjct  111   STYNVLDFGAKGNGDTDDTKAFQAAWAAACKVEASSIIVPAGYQFLVGPISFSGPYCQKN  170

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK--------  1145
             ++ Q+DG ++AP +  SW  + + QW+ F  ++  T+QG G  DG+G  WW+        
Sbjct  171   ILFQLDGTILAPTDSKSW-GNGLLQWLEFTKLNGITVQGKGVIDGRGSPWWQDTPYGDPI  229

Query  1144  ------LSQIHSLQEKKASKTIHVNM-------KPTALRFYESTNVTIHGISIVNSPQCH  1004
                   +  ++S  +++    I   +       KPTALRFY S NVT+ GI+I NSPQCH
Sbjct  230   DDDYKLIVPLNSSFQQRPPMPIRSELSGKMPSIKPTALRFYGSFNVTVTGITIQNSPQCH  289

Query  1003  LKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVH  824
             LKFDN +GV VH++++S+P +SPNTDGIHLQNSQ V IH +T+G GDDC+SIQTGCS+V+
Sbjct  290   LKFDNCQGVLVHDMSVSSPGDSPNTDGIHLQNSQRVLIHSTTLGCGDDCISIQTGCSDVY  349

Query  823   VHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSF  644
             +H++NCGPGHGIS+GGLGK  + ACVSNI V +++M NT+ G R+KTWQGG GSV+ V F
Sbjct  350   IHNVNCGPGHGISIGGLGKGNTKACVSNITVRDIMMHNTMNGVRVKTWQGGSGSVQGVLF  409

Query  643   SGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPC  464
             S IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + +I GT+  +P H ACS+S+PC
Sbjct  410   SNIQVSEVQLPIVIDQFYCDKTTCKNQTSAVALSGITYERIRGTYTVKPVHFACSDSLPC  469

Query  463   TDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
              DV L  IQL+P        N  CW ++G+ +    P     CLR G     +I  +H+
Sbjct  470   VDVTLNGIQLKPLQEKYHLYNPFCWQTFGELRTPTVPPIG--CLRLGKPSGNQINSNHD  526



>ref|XP_008443532.1| PREDICTED: polygalacturonase At1g48100 [Cucumis melo]
Length=477

 Score =   368 bits (945),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 215/458 (47%), Positives = 291/458 (64%), Gaps = 22/458 (5%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKN---RHAKKPRTPPPHKLKKGRSDYRRNF----papapapaqlpP  1502
             +F  +FS+ +  ARK    RH +  R    H    GRS                 +    
Sbjct  19    VFVWSFSLHNCHARKTVGYRHWQVHR----HHQGSGRSLRLTGSGHVGSEDVVGTSLASK  74

Query  1501  GNCYPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITL  1322
             G      S  F++L FGAKGDG +DD+KA ++AW +AC V G+ V++PS  +FL+ PI+ 
Sbjct  75    GRATNGGSGNFNVLDFGAKGDGETDDTKAFQSAWESACNVEGSVVEVPSGSNFLVGPISF  134

Query  1321  QGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK  1145
              GP C P+++ Q+DG ++AP +  +W  S I QWI F  +   T++G GT DGQG  WW 
Sbjct  135   SGPNCQPNIMFQLDGKIIAPTSPSAW-GSGILQWIEFTKLKGITVKGTGTIDGQGSVWWN  193

Query  1144  LSQIHSLQE----KKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
              S  ++  +    K++S     + KPTALRFY S  VT+ GI+I NS + HLKFD+   V
Sbjct  194   DSPTNNPTDENLDKESSGGKLPSTKPTALRFYGSDEVTVSGITIQNSQKAHLKFDSCTAV  253

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V ++TIS+P +SPNTDGIHLQNSQ+V I +S +  GDDC+SIQTG S V++H++NCGPG
Sbjct  254   QVSSLTISSPGDSPNTDGIHLQNSQNVIISNSNLACGDDCISIQTGSSGVYIHNVNCGPG  313

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HGIS+GGLG+D++ ACVSNI V +V ++NT+ G RIKTWQGG GSV+ + FS IQV+DV+
Sbjct  314   HGISIGGLGRDETKACVSNITVRDVKLQNTMNGVRIKTWQGGSGSVQGILFSNIQVTDVR  373

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
             +PIMIDQYYCD   C N + AVAI GV +  I GT+ + P   ACS+S+PCT V L  IQ
Sbjct  374   IPIMIDQYYCDGGRCHNGSSAVAISGVNYVNIRGTYTSTPVRFACSDSLPCTGVTLDTIQ  433

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             LE   G  G     CW +YG+ +    P  +D CL+SG
Sbjct  434   LE---GSDGSNEPFCWKAYGELKTSTVPP-VD-CLQSG  466



>ref|XP_006644413.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Oryza 
brachyantha]
Length=534

 Score =   370 bits (950),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 268/374 (72%), Gaps = 8/374 (2%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDG+SDD+KA EAAW AACK   +TV +PSQ  FL+ PI+  GP C P+
Sbjct  134   AVFNVVDFGAKGDGISDDTKAFEAAWAAACKKGASTVFVPSQLEFLVGPISFSGPYCKPN  193

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q++G ++AP +  +W  S + QWI F  ++  +IQG G  +G+G  WW  S     +
Sbjct  194   ILFQLEGTIIAPTSAKAW-GSGLLQWIEFTKLNGISIQGNGIINGRGQQWWTYSDTDDNE  252

Query  1120  EKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
             +          M   KPTALRFY S NV + GI+IVNS QCHLKFD+ +GV VH++TIS+
Sbjct  253   DDDTYDVEFERMPQVKPTALRFYGSFNVVVSGITIVNSSQCHLKFDSCQGVMVHDLTISS  312

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             PENS NTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCS++++H++NCGPGHGIS+GGLG
Sbjct  313   PENSLNTDGIHLQNSKDVSIHHTNMACGDDCISIQTGCSDINIHNVNCGPGHGISIGGLG  372

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +D + ACVSN+ V +V M  T+ G RIKTWQGG+G V++V FS IQVS+V+ PI+IDQ+Y
Sbjct  373   RDNTKACVSNVTVRDVNMFRTMNGVRIKTWQGGLGLVQDVRFSNIQVSEVQTPIIIDQFY  432

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS--PGY  416
             CDK  C NQT AVA+ GV++  I GTF  +P H ACS+S PC+ + L  +QL P   P Y
Sbjct  433   CDKRTCSNQTSAVAVSGVQYENIRGTFTIKPVHFACSDSSPCSGITLTGVQLRPVQIPHY  492

Query  415   RGFRNGQCWNSYGK  374
             R   +  CW ++G+
Sbjct  493   R-LNDPFCWQAFGE  505



>dbj|BAJ96167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score =   370 bits (949),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 206/409 (50%), Positives = 275/409 (67%), Gaps = 11/409 (3%)
 Frame = -3

Query  1489  PPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-  1313
             P   +VF +++FGA+GDGV+DD++A EAAW AACKV  +TV +P +  F++ PI+  GP 
Sbjct  125   PSQGAVFSVVNFGARGDGVTDDTQAFEAAWAAACKVEASTVLVPPELEFVVGPISFSGPN  184

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI  1133
             C P+++ Q+DG + A     +W  S + QW+ F  ++  +IQG G  +GQG  WW  S  
Sbjct  185   CKPNIIFQLDGTISAQTGARAW-GSGLLQWLEFTKLNGISIQGSGVINGQGKEWWTYSDS  243

Query  1132  HSLQEKKASKTIHV-----NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVH  968
             +   +   S T         +KPTALRFY STNV + GISIVNSPQCHLKFD+ +GV VH
Sbjct  244   NDDDDDMDSYTDQELEKMPQIKPTALRFYGSTNVRVTGISIVNSPQCHLKFDSCQGVMVH  303

Query  967   NITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgi  788
             N+TIS+PE SPNTDGIHLQNS+DV IHH+ +  GDDC+SIQTGCS+V++H++NCGPGHGI
Sbjct  304   NLTISSPETSPNTDGIHLQNSKDVNIHHTDLACGDDCISIQTGCSDVNIHNVNCGPGHGI  363

Query  787   slgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPI  608
             S+GGLG+  + ACVSNI V +V M  T+ G RIKTWQGG G V+ + FS I +S+V+ PI
Sbjct  364   SIGGLGRYNTKACVSNITVRDVNMFKTMTGVRIKTWQGGSGLVQGIRFSNIHMSEVQTPI  423

Query  607   MIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP  428
             MIDQ+YCDK AC NQT AVA+  V++  I GTF  +P H ACS+S PC+++ L  IQL P
Sbjct  424   MIDQFYCDKTACTNQTSAVAVSDVQYENIRGTFTIKPAHFACSDSSPCSEITLTGIQLRP  483

Query  427   --SPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
                P Y    +  CW ++G+      P     CL+ G     R+   H+
Sbjct  484   LIVPQYHMCSSPFCWQAFGELYTPTIPPI--SCLQLGKPAGNRVLSDHD  530



>emb|CBI34901.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   368 bits (945),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/403 (51%), Positives = 272/403 (67%), Gaps = 20/403 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG +DD+KA EAAW AAC+V G+T+ +PS   FL+ PIT  GP C P
Sbjct  70    SSTFNVLHFGAKGDGKADDTKAFEAAWAAACQVRGSTMMVPSGSVFLVKPITFSGPNCEP  129

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
             ++V Q+DG ++AP +  +W  S  +QW++F  +   TI+G GT DGQG  WW  S     
Sbjct  130   NIVFQLDGKIIAPRSSSAW-GSGFYQWLDFSKLQGITIRGKGTIDGQGSIWWNDSTDESE  188

Query  1138  --------QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFD  992
                      ++S ++   S  +   M   KPTALRFY S+ VT+ GI+I NSPQ HLKFD
Sbjct  189   SETPTAGDSLYSSKQDSISGELSAKMPSTKPTALRFYGSSVVTVTGITIQNSPQTHLKFD  248

Query  991   NSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHI  812
             +  GV V  +T+S+P +SPNTDGIHLQNSQ+V I+ + +  GDDCVSIQTGCSN+ VH++
Sbjct  249   DCTGVQVSGVTVSSPGDSPNTDGIHLQNSQNVVIYSTNLACGDDCVSIQTGCSNIFVHNV  308

Query  811   NCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQ  632
             NCGPGHGIS+GGLG+D + ACV N+ V ++ M++T+ G RIKTWQGG GSV  V FS IQ
Sbjct  309   NCGPGHGISIGGLGRDNTKACVKNVTVRDITMQDTMTGVRIKTWQGGSGSVSGVMFSNIQ  368

Query  631   VSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVH  452
             VS VK PIMIDQ+YCDK  C+N+T AVA+  + +  I GT+   P H ACS+S+PC+ V 
Sbjct  369   VSRVKTPIMIDQFYCDKSRCQNETKAVAVSDINYVNIRGTYTVNPVHFACSDSLPCSGVT  428

Query  451   LADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             L  IQL+P+          CW +YG+ +    P  +D CL+ G
Sbjct  429   LTTIQLKPAQEVSQSNGPFCWETYGQLKTNTIPP-ID-CLQRG  469



>emb|CDY37962.1| BnaC05g08120D [Brassica napus]
Length=532

 Score =   369 bits (948),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 204/418 (49%), Positives = 277/418 (66%), Gaps = 23/418 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KA EAAW AACKV  + + +P +++FL+ PI+  GP C  
Sbjct  116   SQVFNVMDFGAKGDGKCDDTKAFEAAWAAACKVEASMMTVPPEYTFLVGPISFSGPYCQA  175

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  ++ WI F  +    +QG G  DG+G  WW+       
Sbjct  176   NIVFQLDGTIIAPTDSKSWGKGLMW-WIEFTKLKGIKVQGKGVIDGRGSGWWQQDYPFID  234

Query  1123  QEKKA----SKTIHVN---------------MKPTALRFYESTNVTIHGISIVNSPQCHL  1001
              E K     + ++H N               +KPTALRFY S  V + GI+I NSPQCHL
Sbjct  235   GETKLIVPLNNSVHQNPPMPVRSELDWKMPSIKPTALRFYGSIGVEVSGITIQNSPQCHL  294

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN   V VH++++S+P +SPNTDGIHLQNS+DV IH +T+  GDDC+SIQTGCSNV V
Sbjct  295   KFDNCIDVEVHDMSVSSPGDSPNTDGIHLQNSRDVLIHSTTLACGDDCISIQTGCSNVFV  354

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS
Sbjct  355   HNVNCGPGHGISIGSLGKDSTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFS  414

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS++ PC 
Sbjct  415   NIQLNEVQLPIVIDQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDNFPCV  474

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     R+   H+
Sbjct  475   DVQLSAIELKPVQEKYHMSDPFCWQTFGELNTPTLPP-ID-CLQIGKPARNRVQSDHD  530



>ref|XP_002298533.2| hypothetical protein POPTR_0001s35180g [Populus trichocarpa]
 gb|EEE83338.2| hypothetical protein POPTR_0001s35180g [Populus trichocarpa]
Length=446

 Score =   366 bits (940),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 196/389 (50%), Positives = 262/389 (67%), Gaps = 23/389 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S  F++L FGAKGDG +DDS+A  A W AACKV  +T+ +PS + FL++ ++  GP C  
Sbjct  69    SKAFNVLEFGAKGDGKTDDSEAFGATWAAACKVEASTMIVPSGYVFLLHSVSFSGPGCEA  128

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             D+V Q+DG ++AP   G+W KS + QWI F  ++  TIQG G  DGQG  WW     ++L
Sbjct  129   DIVFQLDGKIIAPTTPGAW-KSGLLQWIEFTKLNGITIQGKGIIDGQGSVWWNNLPTNNL  187

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
             ++ +A            LRFY ST V + GI+I NSPQ HLKFD+   V V +   ++PE
Sbjct  188   EDSEA------------LRFYGSTRVIVTGITIQNSPQTHLKFDDCTTVQVSDFKAASPE  235

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             NSPNTDGIHL+NS DV I+ S +  GDDCVSIQTGCS V++H++NCGPGHGIS+GGLG+D
Sbjct  236   NSPNTDGIHLENSHDVLIYSSDLACGDDCVSIQTGCSQVYIHNVNCGPGHGISIGGLGRD  295

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              S ACVSN+ V +V M NTL G RIKTWQGG GSV+ V+FS IQVS VK PIMIDQ+YCD
Sbjct  296   NSKACVSNVTVRDVAMLNTLTGVRIKTWQGGSGSVQGVTFSNIQVSGVKTPIMIDQFYCD  355

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
             +  C+N++ AVA+  + +  I GT+A++P HLACS+ +PCT +  + I+L P        
Sbjct  356   RSKCQNESSAVAVSDINYINIKGTYASKPVHLACSDDLPCTGISFSAIELNPVQ-----E  410

Query  403   NGQ--CWNSYGKSQGQLFPASMDYCLRSG  323
             + Q  CWN++G+ +    P     CL+ G
Sbjct  411   DSQPFCWNTFGELRSTTVPPI--NCLKMG  437



>ref|XP_009148407.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
 emb|CDX93397.1| BnaA06g06510D [Brassica napus]
Length=533

 Score =   369 bits (947),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 203/418 (49%), Positives = 278/418 (67%), Gaps = 23/418 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF++++FGAKGDG  DD+KA EAAW AACKV  + + +P +++FL+ PI+  GP C  
Sbjct  117   SQVFNVMNFGAKGDGKCDDTKAFEAAWAAACKVEASMMTVPPEYTFLVGPISFSGPYCQA  176

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  SW K  ++ W+ F  +    +QG G  DG+G  WW+       
Sbjct  177   NIVFQLDGTIIAPTDSKSWGKGLMW-WLEFTKLKGIKVQGKGVIDGRGSGWWQQDYPFID  235

Query  1123  QEKKA----SKTIHVN---------------MKPTALRFYESTNVTIHGISIVNSPQCHL  1001
              E K     + ++H N               +KPTALRFY S  V + GI+I NSPQCHL
Sbjct  236   GETKLIVPLNNSVHQNPPMPERSELDWKMPSIKPTALRFYGSIGVEVSGITIQNSPQCHL  295

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFDN   V VH++++S+P +SPNTDGIHLQNS+DV IH +T+  GDDC+SIQTGCSNV V
Sbjct  296   KFDNCIDVEVHDMSVSSPGDSPNTDGIHLQNSRDVLIHSTTLACGDDCISIQTGCSNVFV  355

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGGVGSVK + FS
Sbjct  356   HNVNCGPGHGISIGSLGKDSTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGILFS  415

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQ+++V++PI+IDQ+YCD   CKNQT AVA++GV + +I GT+  +P H ACS++ PC 
Sbjct  416   NIQLNEVQLPIVIDQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDNFPCV  475

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             DV L+ I+L+P        +  CW ++G+      P  +D CL+ G     R+   H+
Sbjct  476   DVQLSAIELKPVQEKYHMSDPFCWQTFGELNTPTLPP-ID-CLQIGKPARNRVQSDHD  531



>ref|XP_006356424.1| PREDICTED: polygalacturonase At1g48100-like [Solanum tuberosum]
Length=511

 Score =   368 bits (944),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 206/422 (49%), Positives = 279/422 (66%), Gaps = 25/422 (6%)
 Frame = -3

Query  1486  PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-C  1310
             P +++FD+ +FGA GDG +DD+KA +AAW AACKV  +T+ +PS++ FL+ PI+  GP C
Sbjct  91    PSTNIFDVTNFGAVGDGKTDDTKAFQAAWAAACKVEDSTMIVPSKYVFLVGPISFSGPYC  150

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
               ++V Q+DG ++AP +  SW  S I QW+ F  +   T++G G  DG+G  WW  +   
Sbjct  151   QHNIVFQLDGTIIAPTDAKSW-GSGIMQWLEFTKLVGITVKGSGVIDGRGSVWWLDTPYD  209

Query  1129  SLQEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSP  1013
                + +    I +N                     +KPTALRFY S NVT+ GI+I NS 
Sbjct  210   DPLDDELKLIIPLNKTLLRHPPTPLNSSLSGKMPSIKPTALRFYGSFNVTVTGITIQNSQ  269

Query  1012  QCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCS  833
             QCHLKFDN  GV V+NIT+S+P +SPNTDGIHLQNS+D  I  S I  GDDCVSIQTGC+
Sbjct  270   QCHLKFDNCIGVLVNNITVSSPGDSPNTDGIHLQNSKDALIRSSNIACGDDCVSIQTGCT  329

Query  832   NVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKN  653
             NV+VH+INCGPGHGIS+G LGKD + ACVSNI V++V+M+NT+ G RIKTWQGG GSV+ 
Sbjct  330   NVYVHNINCGPGHGISIGSLGKDNTKACVSNITVKDVIMQNTMNGVRIKTWQGGSGSVQG  389

Query  652   VSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNS  473
             V FS IQ+++V++PI+IDQ+YCDK  CKNQT AVA+  + +  I GT+  +P HLACS+S
Sbjct  390   VFFSNIQMNEVQLPIVIDQFYCDKSRCKNQTAAVALSDINYAGIKGTYTVKPVHLACSDS  449

Query  472   VPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS  293
             +PC DV + +IQL+P        +  CW ++G+      P     CL+ G     +I   
Sbjct  450   MPCQDVTMMNIQLKPIQERYHMYDPFCWQTFGELYTPTQPPI--ECLQVGKPTSNKIQAD  507

Query  292   HE  287
             H+
Sbjct  508   HD  509



>ref|XP_004489256.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=423

 Score =   364 bits (935),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 201/387 (52%), Positives = 257/387 (66%), Gaps = 19/387 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG +DD+KA E AW AACK+  +T+ +PS   FL+ PI+  G  C  
Sbjct  40    SSTFNVLDFGAKGDGHTDDTKAFEDAWAAACKIEASTMVVPSGSVFLLKPISFSGSNCEL  99

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W  S   QW+ F  ++  TI+G G  DGQG  WW        
Sbjct  100   NIVFQLDGKIIAPTSASAW-GSGTLQWLEFTKLNKITIKGKGVIDGQGSVWWD-------  151

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                K  KT     KPTALRFY S  VT+ G++I NS Q HLKFD    V V +ITIS+P 
Sbjct  152   NTGKLPKT-----KPTALRFYGSNGVTVTGVTIQNSQQTHLKFDTCTNVQVFDITISSPG  206

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNSQDV I+ ST+G GDDCVS+QTGCSN+ VH++NCGPGHGIS+G LGK 
Sbjct  207   DSPNTDGIHLQNSQDVVIYSSTLGCGDDCVSVQTGCSNILVHNVNCGPGHGISIGSLGKM  266

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSN+ V +  + NTL G RIKTWQGG GSV N+ FS IQVSDV+ PI IDQYYCD
Sbjct  267   NTKACVSNVTVRDTTLHNTLTGVRIKTWQGGSGSVNNIMFSNIQVSDVETPITIDQYYCD  326

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
                C N+T AVAI G+ +  + GT+   P + ACS+S+PC  + L  I+LEPS   +   
Sbjct  327   GGKCHNETSAVAISGIHYVNVKGTYIKDPIYFACSDSLPCVGITLDTIKLEPS---QSSN  383

Query  403   NGQCWNSYGKSQGQLFPASMDYCLRSG  323
                CW +YG+ + Q  P  +D CL+ G
Sbjct  384   VPFCWEAYGELKTQTEPP-VD-CLQKG  408



>ref|XP_010420111.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=455

 Score =   365 bits (937),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 193/388 (50%), Positives = 257/388 (66%), Gaps = 13/388 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S+  ++L  GAKGDG SDD+KA E AW  ACKV+ +T+ +PS  +FL+ P++  G  C  
Sbjct  48    SATINVLDHGAKGDGTSDDTKAFEDAWEEACKVAASTLLVPSGSTFLVGPVSFLGKECKE  107

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W  S + QWI FK +   T++G G  DGQG  WW  S  +  
Sbjct  108   NIVFQLDGKIIAPTSSSAW-GSGLLQWIEFKSLKGITVKGKGIIDGQGSVWWNKSPDYDP  166

Query  1123  QEKKASKT--------IHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
              ++  S T        +   M   KPTALRFY S  VT++GI+I NSPQ HLKFDN   +
Sbjct  167   ADESQSITKNDMVKEQLGTKMPKTKPTALRFYGSNGVTVNGITIQNSPQTHLKFDNCMSI  226

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V + T S+P +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPG
Sbjct  227   QVSDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPG  286

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HGIS+GGLGKD + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVSDV 
Sbjct  287   HGISIGGLGKDNTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSDVA  346

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PI+IDQYYCD   C N+T AVA+  + +  I GT+  QP   ACS+S+PCT + L+ I+
Sbjct  347   NPIIIDQYYCDGGGCHNETSAVAVSNINYINIKGTYTKQPIRFACSDSLPCTGISLSTIE  406

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             L+P+       +  CW ++G+ + Q  P
Sbjct  407   LKPATEKASSLDPFCWEAHGELKTQTLP  434



>ref|XP_006399978.1| hypothetical protein EUTSA_v10013501mg [Eutrema salsugineum]
 gb|ESQ41431.1| hypothetical protein EUTSA_v10013501mg [Eutrema salsugineum]
Length=456

 Score =   365 bits (937),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 190/388 (49%), Positives = 257/388 (66%), Gaps = 13/388 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S   ++L +GAKGDG SDD+KA E AW  ACKV G+T+ +PS  +FL+ P++  G  C  
Sbjct  48    SGTINVLDYGAKGDGTSDDTKAFEDAWKEACKVEGSTLLVPSGSTFLVGPVSFLGKECKE  107

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q++G ++AP +  +W  S + QWI FK +   TI+G G  DG+G  WW  S  +  
Sbjct  108   NIVFQLEGKIIAPTSSSAW-GSGLLQWIEFKSLKGITIKGKGIIDGRGSVWWNKSPDYDP  166

Query  1123  QEKKASKTIHVNMK-----------PTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
              ++  S T +  MK           PTALRFY S  VT++GI+I NSPQ HLKFDN   +
Sbjct  167   VDESESITRNDMMKDQLSTKMPRTKPTALRFYGSNGVTVNGITIQNSPQTHLKFDNCISI  226

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V + T S+P +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPG
Sbjct  227   QVSDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPG  286

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HGIS+GGLGK+K+ ACVSNI V +V M  T  G RIK+WQGG GSVK + FS IQVS+V 
Sbjct  287   HGISIGGLGKEKTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQIMFSNIQVSEVA  346

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PI+IDQYYCD   C N T AVA+  + +  I GT+  +P   ACS S+PCT + L+ I+
Sbjct  347   NPIIIDQYYCDGGGCHNDTSAVAVSNINYINIKGTYTKEPVRFACSESLPCTGISLSTIE  406

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             L+P+      R+  CW ++G+ + +  P
Sbjct  407   LKPATEKASLRDPFCWEAHGELKTKTLP  434



>gb|KHG15884.1| hypothetical protein F383_10630 [Gossypium arboreum]
Length=557

 Score =   369 bits (946),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 215/464 (46%), Positives = 288/464 (62%), Gaps = 64/464 (14%)
 Frame = -3

Query  1489  PPP---------SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLI  1337
             PPP         S VFD+L FGAKGDG +DD+KA +AAW AACKV  +TV +P++F FL+
Sbjct  98    PPPQKGYGNGQQSKVFDVLHFGAKGDGKTDDTKAFQAAWAAACKVQASTVVVPAKFIFLV  157

Query  1336  NPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQG  1160
              PI+  GP C  ++V Q+DG ++AP +   W K  I QW+ F  +   T+QG G  DG+G
Sbjct  158   GPISFSGPYCQANIVFQLDGTIIAPTDSKPWGKG-ILQWLEFTKLKGITVQGKGIIDGRG  216

Query  1159  PNWWKLSQIHSLQEKKASKTIHVN---------------------MKPTALRFYESTNVT  1043
               WW  +      + +    I +N                     +KPTALRFY S NVT
Sbjct  217   SGWWLDAPYEDPYDDERKLIIPLNNTVQERPPMPARNELSGKMPSIKPTALRFYGSFNVT  276

Query  1042  IHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIG---  872
             + GI+I NSPQCHLKFDN  GV VH++++S+P +SPNTDGIHLQNS+DV IH +++    
Sbjct  277   VTGITIQNSPQCHLKFDNCIGVVVHDMSVSSPGDSPNTDGIHLQNSKDVLIHATSLACVW  336

Query  871   --------------------------SGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
                                       +GDDCVSIQTGCSNV++H++NCGPGHGIS+G LG
Sbjct  337   ISDTSRCPNQKKNPNSIGLDKKRERHAGDDCVSIQTGCSNVYIHNVNCGPGHGISIGSLG  396

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             KD + ACVSNI V +++M NT+ G RIKTWQGG G+V+ V FS IQVS+V++PI+IDQ+Y
Sbjct  397   KDNTKACVSNITVRDIMMHNTMNGVRIKTWQGGSGNVQGVLFSNIQVSEVQLPIVIDQFY  456

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CDK  CKNQT AVA+ G+ + +I GT+  +P HLACS+S+PC  V L+ IQL+P      
Sbjct  457   CDKRTCKNQTAAVALSGITYEKIRGTYTVKPVHLACSDSLPCIGVTLSAIQLKPMQERYH  516

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
               +  CW SYG+      P     CL+ G     R+ +S+ ++C
Sbjct  517   LYDPFCWQSYGELTTPTVPPIA--CLQIGKPPNNRV-QSNYDVC  557



>gb|KDP26627.1| hypothetical protein JCGZ_17785 [Jatropha curcas]
Length=412

 Score =   363 bits (932),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 211/329 (64%), Positives = 252/329 (77%), Gaps = 10/329 (3%)
 Frame = -3

Query  1714  MKRNKsssvvlsslvvlLIFCAAFSMMSVEARKNRHAKKPR-TPPPHKLKKGRSDYRRNF  1538
             MKRNK++S ++  + V++     F+++SVEARK+ + KK +     H+  K   +   N 
Sbjct  1     MKRNKNTSSLVFFIFVIVAAFTMFAIISVEARKHHNYKKNKHNYNKHQKDKSHGNGNHNA  60

Query  1537  papapapaqlpPG----NCYPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGAT  1370
             P PAPAPA  P        YP  S++FDILSFGAKGDGVSDDS+AL  AW AACKV  AT
Sbjct  61    PTPAPAPAPAPGSLPHYGSYPTQSTIFDILSFGAKGDGVSDDSQALVDAWKAACKVPRAT  120

Query  1369  VQIPSQFSFLINPITLQGPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTI  1190
             ++IP++  FLI PITLQGPCMP LVLQ+DG V+AP  V SWPKS++FQW NFKWVH FTI
Sbjct  121   IKIPAEIKFLIKPITLQGPCMPHLVLQIDGTVLAPPEVSSWPKSNLFQWFNFKWVHDFTI  180

Query  1189  QGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSP  1013
             QGPGT +GQG +WW  S I+ +Q+K      HV  MKPTALRFY S NVT+  I I+NSP
Sbjct  181   QGPGTVNGQGSDWWTPSNIYFIQKKSK----HVPYMKPTALRFYASYNVTVRDIEIINSP  236

Query  1012  QCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCS  833
             QCHLKFDNSKG+ V+NITIS+PENSPNTDGIHLQN+QDVEI HS I +GDDC+SIQTGCS
Sbjct  237   QCHLKFDNSKGIKVNNITISSPENSPNTDGIHLQNTQDVEIQHSNIATGDDCISIQTGCS  296

Query  832   NVHVHHINCgpghgislgglGKDKSVACV  746
             N+HVHHINCGPGHGIS+GGLGKDKSVACV
Sbjct  297   NIHVHHINCGPGHGISVGGLGKDKSVACV  325



>ref|NP_001267980.1| polygalacturonase precursor [Vitis vinifera]
 gb|ABW76153.1| polygalacturonase [Vitis vinifera]
Length=483

 Score =   365 bits (938),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 204/403 (51%), Positives = 270/403 (67%), Gaps = 20/403 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG +DD+KA EAAW AAC+V G+T+ +PS   FL+ PIT  GP C P
Sbjct  70    SSTFNVLHFGAKGDGKADDTKAFEAAWAAACQVRGSTMMVPSGSVFLVKPITFSGPNCEP  129

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
             ++V Q+DG ++AP +  +W  S  +QW++F  +   TI+G GT DGQG  WW  S     
Sbjct  130   NIVFQLDGKIIAPRSSSAW-GSGFYQWLDFSKLQGITIRGKGTIDGQGSIWWNDSTDESE  188

Query  1138  --------QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFD  992
                      ++S ++   S  +   M   KPTALRFY S+ VT+ GI+I NSPQ HLKFD
Sbjct  189   SETPTAGDSLYSSKQDSISGELSAKMPSTKPTALRFYGSSVVTVTGITIQNSPQTHLKFD  248

Query  991   NSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHI  812
             +  GV V  +T+S+P +SPNTDGIHLQNSQ+V I+ + +  GDDCVSIQTGCSN+ VH++
Sbjct  249   DCTGVQVSGVTVSSPGDSPNTDGIHLQNSQNVVIYSTNLACGDDCVSIQTGCSNIFVHNV  308

Query  811   NCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQ  632
             NCGPGHGIS+GGLG+D + ACV N+ V ++ M++T+ G RIKTWQGG GSV  V FS IQ
Sbjct  309   NCGPGHGISIGGLGRDNTKACVENVTVRDITMQDTMTGVRIKTWQGGSGSVSGVMFSNIQ  368

Query  631   VSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVH  452
             VS VK PIMIDQ+YCDK  C+N+T AVA+  + +  I GT+   P H ACS  +PC+ V 
Sbjct  369   VSRVKTPIMIDQFYCDKSRCQNETKAVAVSDINYVNIRGTYTVNPVHFACSARLPCSGVT  428

Query  451   LADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             L  IQL+P+          CW +YG+ +    P  +D CL+ G
Sbjct  429   LTPIQLKPAQEVSQSNGPFCWETYGQLKTNTIPP-ID-CLQRG  469



>ref|XP_004238649.1| PREDICTED: polygalacturonase At1g48100-like [Solanum lycopersicum]
Length=508

 Score =   366 bits (940),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 204/422 (48%), Positives = 279/422 (66%), Gaps = 25/422 (6%)
 Frame = -3

Query  1486  PPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-C  1310
             P +++FD+ +FGA GDG +DD+KA +AAW AACKV  +T+ +PS++ FL+ PI+  GP C
Sbjct  88    PSTNLFDVTNFGAVGDGKTDDTKAFQAAWAAACKVEDSTMIVPSKYVFLVGPISFSGPYC  147

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
               ++V Q+DG ++AP +  SW  S I QW+ F  +   T++G G  DG+G  WW+ +   
Sbjct  148   QHNIVFQLDGTIIAPTDAKSW-GSGIMQWLEFTKLVGITVKGSGVIDGRGSVWWQDTPYD  206

Query  1129  SLQEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSP  1013
                + +    I +N                     +KPTALRFY S NVT+ GI+I NS 
Sbjct  207   DPLDDELKLIIPLNKTLLRHPLTPINSSLSGKMPSIKPTALRFYGSFNVTVTGITIQNSQ  266

Query  1012  QCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCS  833
             QCHLKFDN  GV V+N T+S+P +SPNTDGIHLQNS+D  I  S I  GDDCVSIQTGC+
Sbjct  267   QCHLKFDNCIGVLVNNFTVSSPGDSPNTDGIHLQNSKDALIRSSNIACGDDCVSIQTGCT  326

Query  832   NVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKN  653
             NV+VH+INCGPGHGIS+G LGKD + ACVSNI V++++M+NT+ G RIKTWQGG GSV+ 
Sbjct  327   NVYVHNINCGPGHGISIGSLGKDNTKACVSNITVKDIIMKNTMNGVRIKTWQGGSGSVQG  386

Query  652   VSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNS  473
             V FS IQ+++V++PI+IDQ+YCDK  CKNQT AVA+  + +  I GT+  +P HLACS+S
Sbjct  387   VFFSNIQMNEVQLPIVIDQFYCDKSKCKNQTAAVALSDINYAGIKGTYTVKPVHLACSDS  446

Query  472   VPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARS  293
             +PC DV + +IQL+P        +  CW ++G+      P     CL+ G     +I   
Sbjct  447   MPCQDVTMMNIQLKPIQERYHMYDPFCWQTFGELYTPTQPPI--ECLQVGKPTSNKIQAD  504

Query  292   HE  287
             H+
Sbjct  505   HD  506



>ref|XP_004141101.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
 ref|XP_004158321.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
 gb|KGN59684.1| hypothetical protein Csa_3G838140 [Cucumis sativus]
Length=477

 Score =   365 bits (936),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 264/388 (68%), Gaps = 11/388 (3%)
 Frame = -3

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLV  1295
             F++L FGAKGDG +DD+KA ++AW +AC V G+ V++PS   FL+ PI+  GP C P+++
Sbjct  85    FNVLDFGAKGDGETDDTKAFQSAWESACNVEGSVVEVPSGSEFLVGPISFSGPNCQPNIM  144

Query  1294  LQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEK  1115
              Q+DG ++AP +  +W  S + QWI F  +   T++G GT DGQG  WW  S   +  +K
Sbjct  145   FQLDGKIIAPTSPSAW-GSGMLQWIEFTKLKGITVKGTGTIDGQGSVWWNDSPTDNPTDK  203

Query  1114  KASKTIHV----NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAP  947
                K        + KPTALRFY S  VT+ GI+I NS + HLKFD+   V V ++TIS+P
Sbjct  204   NLDKESSGGELPSTKPTALRFYGSDEVTVSGITIQNSQKAHLKFDSCTAVQVSSLTISSP  263

Query  946   ENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGK  767
              +SPNTDGIHLQNSQ+V I +S I  GDDC+SIQTG S V++H++NCGPGHGIS+GGLG+
Sbjct  264   GDSPNTDGIHLQNSQNVIISNSNIACGDDCISIQTGSSGVYIHNVNCGPGHGISIGGLGR  323

Query  766   DKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYC  587
             D + ACVSN+ V +V ++NT+ G RIKTWQGG G V+ + FS IQV+DV+ PIMIDQYYC
Sbjct  324   DDTKACVSNVTVRDVKLQNTMNGVRIKTWQGGSGLVQGILFSNIQVTDVQTPIMIDQYYC  383

Query  586   DKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGF  407
             D   C N + AVAI GV +  I GT+ + P H ACS+S+PCT V L  IQLE   G  G 
Sbjct  384   DGGRCHNGSSAVAISGVNYVNIRGTYTSTPVHFACSDSLPCTGVTLDTIQLE---GSSGS  440

Query  406   RNGQCWNSYGKSQGQLFPASMDYCLRSG  323
                 CW +YG+ +    P  +D CL+SG
Sbjct  441   NEPFCWKAYGELKTSTVPP-VD-CLQSG  466



>ref|XP_010492279.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=456

 Score =   364 bits (934),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 192/388 (49%), Positives = 256/388 (66%), Gaps = 13/388 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+  ++L  GAKGDG SDD+KA E AW  ACKV+ +T+ IPS  +FL+ P++  G  C  
Sbjct  48    SATINVLDHGAKGDGTSDDTKAFEDAWEEACKVAASTLLIPSDSTFLVGPVSFLGKGCKE  107

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W  S + QWI FK +   TI+G G  DG+G  WW  S  +  
Sbjct  108   NIVFQLDGKIIAPTSSSAW-GSGLLQWIEFKSLTGITIKGKGIIDGRGSVWWNKSPDYDP  166

Query  1123  QEKKASKTIHV-----------NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
              ++  S T +              KPTALRFY S  VT++GI+I NSPQ HLKFDN   +
Sbjct  167   ADESESTTTNDMVKEQLGTKMPKTKPTALRFYGSNGVTVNGITIQNSPQTHLKFDNCMSI  226

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V + T S+P +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPG
Sbjct  227   QVSDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPG  286

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HGIS+GGLGKD + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVS+V 
Sbjct  287   HGISIGGLGKDNTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSNVA  346

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PI+IDQYYCD   C N+T AVA+  + +  I GT+  QP   ACS+S+PCT + L+ I+
Sbjct  347   NPIIIDQYYCDGGGCHNETSAVAVSNINYINIKGTYTKQPIRFACSDSLPCTGISLSTIE  406

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             L+P+       +  CW ++G+ + Q  P
Sbjct  407   LKPATEKASSFDPFCWEAHGELKTQTIP  434



>ref|XP_002441571.1| hypothetical protein SORBIDRAFT_09g029500 [Sorghum bicolor]
 gb|EES20001.1| hypothetical protein SORBIDRAFT_09g029500 [Sorghum bicolor]
Length=537

 Score =   367 bits (941),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 267/374 (71%), Gaps = 8/374 (2%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VF+++ FGAKGDGV+DD++A EAAW AACKV  +TV +PS+  F++ PI+  GP C P+
Sbjct  137   TVFNVVDFGAKGDGVTDDTQAFEAAWAAACKVEASTVLVPSEHEFVVGPISFSGPYCKPN  196

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q+DG ++A  +   W  S + QW+ F  +    IQG G  +G+G  WW  S  +   
Sbjct  197   ILFQLDGTILAQTSARVW-GSGLLQWLEFTKLTGIAIQGSGVINGRGQQWWTYSDPNDDD  255

Query  1120  EKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
                A       M   KPTALRFY S+NVT+ GI+IVNS QCHLKFD+ +GV VH++TIS+
Sbjct  256   NDDAYYVELDKMPQIKPTALRFYGSSNVTVTGITIVNSSQCHLKFDSCQGVMVHDLTISS  315

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             PE+SPNTDGIHLQNS++V IHH+ +  GDDCVSIQTGCS+V++H++NCGPGHGIS+GGLG
Sbjct  316   PEHSPNTDGIHLQNSKEVSIHHTNLACGDDCVSIQTGCSDVNIHNVNCGPGHGISIGGLG  375

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +  + ACVSNI V +V M  T+ G RIKTWQGG G V+ + FS IQVS+V+ PI+IDQ+Y
Sbjct  376   RYNTKACVSNITVRDVKMFRTMTGVRIKTWQGGSGLVQGIRFSNIQVSEVQTPIIIDQFY  435

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--SPGY  416
             CDK  C+NQT AVA+ GV++  I GTF  +P H ACS+S PC+++ L  IQL+P   P Y
Sbjct  436   CDKTTCRNQTSAVAVSGVQYENIRGTFTIKPAHFACSDSSPCSEITLTGIQLKPLLVPQY  495

Query  415   RGFRNGQCWNSYGK  374
                 N  CW ++G+
Sbjct  496   H-LYNPFCWQAFGE  508



>ref|XP_009769210.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 245/368 (67%), Gaps = 13/368 (4%)
 Frame = -3

Query  1420  KALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWP  1244
             K  EAAW  ACKV G+T+ +PS + FL+ PI+  GP C  ++V  +DG ++AP N   W 
Sbjct  14    KTFEAAWIEACKVEGSTIVVPSDYDFLVGPISFSGPHCEENIVFLLDGRIIAPTNPKIW-  72

Query  1243  KSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHV---------  1091
              S + QW+ FK ++  +++G GT DGQG  WW+ + +    +     T+           
Sbjct  73    GSGLLQWLEFKKLNGISVKGKGTIDGQGSVWWQNTHLEDPDDDPNYTTLFALTSSTAKGK  132

Query  1090  --NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIH  917
                 +PTALRFY  +NV + GI+I NSP+ HLKFD+   + V  ITIS+PE+SPNTDGIH
Sbjct  133   MPRTRPTALRFYGCSNVVVTGITIQNSPKAHLKFDSCVTIQVSGITISSPEDSPNTDGIH  192

Query  916   LQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNI  737
             LQNSQ+V IH S +  GDDC+SIQTG S V +H + CGPGHG S+GGLG D + ACVSNI
Sbjct  193   LQNSQNVVIHSSDLACGDDCISIQTGTSAVFIHDVKCGPGHGFSIGGLGNDNTKACVSNI  252

Query  736   LVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTG  557
              V +  + NTL G RIKTWQGG GSV+ + FS IQVSDV+ PI+IDQ+YCDK  CKNQT 
Sbjct  253   TVRDSTLHNTLTGVRIKTWQGGSGSVQGIMFSNIQVSDVETPIIIDQFYCDKSKCKNQTS  312

Query  556   AVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYG  377
             AVAI GV +  I GT++ +P H ACS+SVPCT V LADIQL+PSP    F    CW +YG
Sbjct  313   AVAISGVSYQSIKGTYSYEPLHFACSDSVPCTGVSLADIQLKPSPKREHFYGPYCWQTYG  372

Query  376   KSQGQLFP  353
             + + +  P
Sbjct  373   ELKTKTTP  380



>emb|CDX69569.1| BnaA10g19180D [Brassica napus]
Length=439

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 188/384 (49%), Positives = 257/384 (67%), Gaps = 11/384 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S  F++L +GAKGDG SDD+KA E AW  ACKV+ +T+ +PS  +FL+ P++  G  C  
Sbjct  40    SGTFNVLDYGAKGDGTSDDTKAFEDAWNEACKVAASTLLVPSGSTFLVGPVSFLGKECKE  99

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS-  1127
             ++V Q+DG ++AP +  +W  S + QW+ FK +   TI+G G  DGQG  WW  S  +  
Sbjct  100   NIVFQLDGKIIAPTSSSAW-GSGLLQWMEFKSLTGITIKGKGVIDGQGSVWWNKSPDYDP  158

Query  1126  ------LQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHN  965
                   ++++K +K      KPTALRFY S  V ++GI+I NSPQ HLKFDN   + V +
Sbjct  159   ADENDMMKDRKGTKMPRT--KPTALRFYGSNGVMVNGITIQNSPQTHLKFDNCVNIQVSD  216

Query  964   ITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgis  785
              T S+P +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPGHGIS
Sbjct  217   FTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHGIS  276

Query  784   lgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIM  605
             +GGLGK+ + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVS+V  PI+
Sbjct  277   IGGLGKENTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSEVANPIV  336

Query  604   IDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS  425
             IDQYYCD   C N+T AVA+  + +  I GT+  +P   ACS+S+PCT + L+ I+L+P+
Sbjct  337   IDQYYCDGGGCHNETSAVAVSNINYINIKGTYTREPVRFACSDSLPCTGISLSTIELKPA  396

Query  424   PGYRGFRNGQCWNSYGKSQGQLFP  353
                       CW ++G+ + +  P
Sbjct  397   TDKASSSEPFCWEAHGELKTETLP  420



>ref|XP_004242881.1| PREDICTED: polygalacturonase At1g48100-like [Solanum lycopersicum]
Length=449

 Score =   363 bits (932),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 194/394 (49%), Positives = 257/394 (65%), Gaps = 23/394 (6%)
 Frame = -3

Query  1474  VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDL  1298
             VF++L +GAKGDG++ D+KA EA W  ACKV G+ + +PS + FL+ PIT  G  C  ++
Sbjct  42    VFNVLDYGAKGDGITYDTKAFEATWIEACKVEGSVMMVPSDYDFLVGPITFSGSHCEKNI  101

Query  1297  VLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI-----  1133
             V Q+DG ++AP N   W    + QW+ F  ++   ++G G  DGQG  WWK + +     
Sbjct  102   VFQLDGRIIAPTNPKVW---GVLQWLEFSKLNGIYVKGKGIIDGQGSVWWKNTPLLIEEY  158

Query  1132  -----HSLQEKKASKTIHVNMK---------PTALRFYESTNVTIHGISIVNSPQCHLKF  995
                     Q+  A K   +  K         P AL+F+ S NV + GI+I NSP+ HLKF
Sbjct  159   EGDYYSEEQDDYAPKIALITSKSKGKMPRTRPAALKFHGSFNVVVTGITIQNSPKAHLKF  218

Query  994   DNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHH  815
             D+   V V+ IT+S+P +SPNTDGIHL NSQ+V I+ S I  GDDC+SIQTG S V +H 
Sbjct  219   DHCVAVQVYGITVSSPGDSPNTDGIHLHNSQNVVINSSDIACGDDCISIQTGSSAVFIHD  278

Query  814   INCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGI  635
             +NCGPGHG S+GGLGKD + ACVSNI V++  ++NT+ G RIKTWQGG GSV  ++FS I
Sbjct  279   VNCGPGHGFSIGGLGKDNTKACVSNITVQDSTLQNTMTGVRIKTWQGGSGSVHGITFSNI  338

Query  634   QVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDV  455
              VSDVK+PIMIDQ+YCDK  C N T AVAI GV +  I GT++ +P H ACS+SVPCT V
Sbjct  339   HVSDVKIPIMIDQFYCDKRKCGNHTSAVAISGVSYQSIEGTYSYKPVHFACSDSVPCTGV  398

Query  454   HLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
              LADI+L+PS   + F    CW +YG+ +    P
Sbjct  399   SLADIKLKPSLEKKHFYGPYCWETYGELRTNTTP  432



>ref|NP_001238091.1| polygalacturonase PG1 precursor [Glycine max]
 gb|AAD46483.1| polygalacturonase PG1 [Glycine max]
Length=443

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 194/414 (47%), Positives = 271/414 (65%), Gaps = 22/414 (5%)
 Frame = -3

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLV  1295
             F++L +GAKGDG +DD+KA E AW AACKV G+T+ +PS   FL+ PI+  GP C P++V
Sbjct  46    FNVLDYGAKGDGHADDTKAFEDAWAAACKVEGSTMVVPSGSVFLVKPISFSGPNCEPNIV  105

Query  1294  LQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-LSQIHSLQE  1118
              Q+DG ++AP +  +W  S   QW+ F  +++ TI+G G  DGQG  WW   S  ++  E
Sbjct  106   FQLDGKIIAPTSSEAW-GSGTLQWLEFSKLNTITIRGKGVIDGQGSVWWNNDSPTYNPTE  164

Query  1117  KKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
                     + + KPTALRFY S  VT+ GI+I NS Q HLKFD+   V V  I++S+P +
Sbjct  165   VMLESNGRLPSTKPTALRFYGSDGVTVTGITIQNSQQTHLKFDSCTNVQVSGISVSSPGD  224

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQNSQ+V I+ ST+  GDDCVSIQTGCS+++VH++NCGPGHGIS+G LG++ 
Sbjct  225   SPNTDGIHLQNSQNVVIYSSTLACGDDCVSIQTGCSDIYVHNVNCGPGHGISIGSLGREN  284

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             + ACV N+ V +V ++NTL G RIKTWQGG GSV+N+ FS +QVS V+ PI IDQYYCD 
Sbjct  285   TKACVRNVTVRDVTIQNTLTGVRIKTWQGGSGSVQNIMFSNVQVSGVQTPISIDQYYCDG  344

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRN  401
               C+N++ AVA+ G+ +  + GT+  +P + ACS+++PC+ + L  IQLE +   +    
Sbjct  345   GRCRNESSAVAVSGIHYVNVKGTYTKEPIYFACSDNLPCSGITLDTIQLESAQETKNSNV  404

Query  400   GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENICL*PSSHGGLKSQV  239
               CW +YG+ +    P     CL+ G+                PS  GG+ S +
Sbjct  405   PFCWEAYGELKTTTVPPV--ECLQRGN----------------PSKEGGINSNI  440



>gb|KHN23520.1| Polygalacturonase [Glycine soja]
Length=438

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/414 (47%), Positives = 271/414 (65%), Gaps = 22/414 (5%)
 Frame = -3

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLV  1295
             F++L +GAKGDG +DD+KA E AW AACKV G+T+ +PS   FL+ PI+  GP C P++V
Sbjct  41    FNVLDYGAKGDGHADDTKAFEDAWAAACKVEGSTMVVPSGSVFLVKPISFSGPNCEPNIV  100

Query  1294  LQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-LSQIHSLQE  1118
              Q+DG ++AP +  +W  S   QW+ F  +++ TI+G G  DGQG  WW   S  ++  E
Sbjct  101   FQLDGKIIAPTSSEAW-GSGTLQWLEFSKLNTITIRGKGVIDGQGSVWWNNDSPTYNPTE  159

Query  1117  KKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
                     + + KPTALRFY S  VT+ GI+I NS Q HLKFD+   V V  I++S+P +
Sbjct  160   VMLESNGRLPSTKPTALRFYGSDGVTVTGITIQNSQQTHLKFDSCTNVQVSGISVSSPGD  219

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQNSQ+V I+ ST+  GDDCVSIQTGCS+++VH++NCGPGHGIS+G LG++ 
Sbjct  220   SPNTDGIHLQNSQNVVIYSSTLACGDDCVSIQTGCSDIYVHNVNCGPGHGISIGSLGREN  279

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             + ACV N+ V +V ++NTL G RIKTWQGG GSV+N+ FS +QVS V+ PI IDQYYCD 
Sbjct  280   TKACVRNVTVRDVTIQNTLTGVRIKTWQGGSGSVQNIMFSNVQVSGVQTPISIDQYYCDG  339

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRN  401
               C+N++ AVA+ G+ +  + GT+  +P + ACS+++PC+ + L  IQLE +   +    
Sbjct  340   GRCRNESSAVAVSGIHYVNVKGTYTKEPIYFACSDNLPCSGITLDTIQLESAQETKNSNV  399

Query  400   GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENICL*PSSHGGLKSQV  239
               CW +YG+ +    P     CL+ G+                PS  GG+ S +
Sbjct  400   PFCWEAYGELKTTTVPPVE--CLQRGN----------------PSKEGGINSNI  435



>ref|XP_010453593.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=455

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/388 (50%), Positives = 256/388 (66%), Gaps = 13/388 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S   ++L  GAKGDG SDD+KA E AW  ACKV+ +T+ +PS  +FL+ P++  G  C  
Sbjct  48    SPTVNVLDNGAKGDGTSDDTKAFEDAWREACKVAASTLLVPSGSTFLVGPVSFLGKECKE  107

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W  S + QWI FK +   TI+G G  DG+G  WW  S  +  
Sbjct  108   NIVFQLDGKIIAPTSSSAW-GSGLLQWIEFKSLTGITIKGKGIIDGRGSVWWNKSPDYDP  166

Query  1123  QEKKASKT--------IHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
              ++  S T        +   M   KPTALRFY S  VT++GI+I NSPQ HLKFDN   +
Sbjct  167   ADESESTTESDMVKEQLGTKMPKTKPTALRFYGSNGVTVNGITIQNSPQTHLKFDNCMSI  226

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V + T S+P +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPG
Sbjct  227   QVSDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPG  286

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HGIS+GGLGKD + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVSDV 
Sbjct  287   HGISIGGLGKDNTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSDVA  346

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PI+IDQYYCD   C N+T AVA+  + +  I GT+  QP   ACS+S+PCT + L+ I+
Sbjct  347   NPIIIDQYYCDGGGCHNETSAVAVSNINYINIKGTYTKQPIRFACSDSLPCTGISLSTIE  406

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             L+P+       +  CW ++G+ + Q  P
Sbjct  407   LKPATEKASSLDPFCWEAHGELKTQTLP  434



>gb|ACU24545.1| unknown [Glycine max]
Length=443

 Score =   362 bits (930),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/414 (47%), Positives = 271/414 (65%), Gaps = 22/414 (5%)
 Frame = -3

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLV  1295
             F++L +GAKGDG +DD+KA E AW AACKV G+T+ +PS   FL+ PI+  GP C P++V
Sbjct  46    FNVLDYGAKGDGHADDTKAFEDAWAAACKVEGSTMVVPSGSVFLVKPISFSGPNCEPNIV  105

Query  1294  LQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-LSQIHSLQE  1118
              Q+DG ++AP +  +W  S   QW+ F  +++ TI+G G  DGQG  WW   S  ++  E
Sbjct  106   FQLDGKIIAPTSSEAW-GSGTLQWLEFSKLNTITIRGKGVIDGQGSVWWNNDSPTYNPTE  164

Query  1117  KKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
                     + + KPTALRFY S  VT+ GI+I NS Q HLKFD+   V V  I++S+P +
Sbjct  165   VMLESNGRLPSTKPTALRFYGSDGVTVTGITIQNSQQTHLKFDSCTNVQVSGISVSSPGD  224

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQNSQ+V ++ ST+  GDDCVSIQTGCS+++VH++NCGPGHGIS+G LG++ 
Sbjct  225   SPNTDGIHLQNSQNVVVYSSTLACGDDCVSIQTGCSDIYVHNVNCGPGHGISIGSLGREN  284

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             + ACV N+ V +V ++NTL G RIKTWQGG GSV+N+ FS +QVS V+ PI IDQYYCD 
Sbjct  285   TKACVRNVTVRDVTIQNTLTGVRIKTWQGGSGSVQNIMFSNVQVSGVQTPISIDQYYCDG  344

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRN  401
               C+N++ AVA+ G+ +  + GT+  +P + ACS+++PC+ + L  IQLE +   +    
Sbjct  345   GRCRNESSAVAVSGIHYVNVKGTYTKEPIYFACSDNLPCSGITLDTIQLESAQETKNSNV  404

Query  400   GQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENICL*PSSHGGLKSQV  239
               CW +YG+ +    P     CL+ G+                PS  GG+ S +
Sbjct  405   PFCWEAYGELKTTTVPPV--ECLQRGN----------------PSKEGGINSNI  440



>gb|KDO66116.1| hypothetical protein CISIN_1g040454mg [Citrus sinensis]
Length=473

 Score =   363 bits (932),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 201/391 (51%), Positives = 265/391 (68%), Gaps = 11/391 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S++F++LS+GAKGDG +DD+KA EAAW AACK+ GAT+ +PS   FL+ PI+  GP C P
Sbjct  73    SAIFNVLSYGAKGDGRTDDTKAFEAAWAAACKIEGATMVVPSGSVFLVGPISFSGPTCQP  132

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWW-KLSQIHS  1127
             +++ Q+DG ++AP N G+W  S I QW+ F  +   T+ G G  DGQG  WW      + 
Sbjct  133   NILFQLDGKIIAPTNSGAW-GSGILQWLEFSKLKGITLTGKGIIDGQGSVWWHDAPSSYG  191

Query  1126  LQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               +  AS  +  NM   KPTALRFY S+ VT+ GI+I NS Q HLKFD+   V V + T 
Sbjct  192   TADDSASSELKGNMPGTKPTALRFYGSSGVTVTGITIQNSQQTHLKFDDCTAVQVSDFTA  251

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P +SPNTDGIHLQNSQDV I+ ST+  GDDCVSIQTGCSN+ VH++NCGPGHGIS+G 
Sbjct  252   SSPGDSPNTDGIHLQNSQDVTIYSSTLACGDDCVSIQTGCSNIDVHNVNCGPGHGISIGS  311

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKD + ACVS I V +V M NT+ G RIKTWQGG G V+ V+FS IQV++VK PI+IDQ
Sbjct  312   LGKDNTNACVSKITVRDVTMHNTMTGVRIKTWQGGSGLVQQVTFSNIQVNNVKSPIVIDQ  371

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYC+K +C N++ AV +  + +  I GT+  QP H ACS+ +PCT + L+ + L+P    
Sbjct  372   YYCEKSSCHNESSAVQVSNIAYVNIRGTYTEQPAHFACSDILPCTGISLSTVALKP---V  428

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             +      CW +YG+ +    P     CLR G
Sbjct  429   QSATQPFCWEAYGELKTATDPPI--NCLRRG  457



>ref|XP_004961120.1| PREDICTED: polygalacturonase At1g48100-like [Setaria italica]
Length=527

 Score =   365 bits (936),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 268/374 (72%), Gaps = 8/374 (2%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +V++++ FGAKGDGV+DD++A EAAW AACKV  +TV +PS+  F++ P++  GP C P+
Sbjct  127   TVYNVVDFGAKGDGVTDDTQAFEAAWAAACKVEASTVLVPSELEFVVGPVSFSGPYCKPN  186

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q+DG ++A  +   W  S + QW+ F  +    IQG G  +G+G  WW  S  +   
Sbjct  187   ILFQLDGTILAQTSARVW-GSGLLQWLEFTKLTGIAIQGSGVINGRGQGWWTYSDPNDDD  245

Query  1120  EKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
             +  A +     M   KPTALRFY S+NVT+ GI+IVNS QCHLKFD+ +GV VH++TIS+
Sbjct  246   DNDAFRVELDKMPQIKPTALRFYGSSNVTVTGITIVNSSQCHLKFDSCQGVMVHDLTISS  305

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             PENSPNTDGIHLQNS++V IHH+ +  GDDCVSIQTGCS++++H++NCGPGHGIS+GGLG
Sbjct  306   PENSPNTDGIHLQNSREVNIHHTNMACGDDCVSIQTGCSDINIHNVNCGPGHGISIGGLG  365

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             +  + ACVSN+ V +V M  T  G RIKTWQGG G V+ + FS IQVS+V+ PI+IDQ+Y
Sbjct  366   RYNTKACVSNVTVRDVNMVKTTNGVRIKTWQGGSGLVQGIRFSNIQVSEVQTPIIIDQFY  425

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--SPGY  416
             CDK  C+NQT AVA+ GV++  I GTF  +P H ACS+S PC+++ L  IQL+P   P +
Sbjct  426   CDKTTCRNQTSAVAVSGVQYENIRGTFTIKPAHFACSDSSPCSEITLTGIQLKPLIVPQF  485

Query  415   RGFRNGQCWNSYGK  374
                 N  CW ++G+
Sbjct  486   H-LYNPFCWQAFGE  498



>ref|XP_003613215.1| Polygalacturonase [Medicago truncatula]
Length=543

 Score =   365 bits (937),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 204/440 (46%), Positives = 277/440 (63%), Gaps = 40/440 (9%)
 Frame = -3

Query  1489  PPP-------SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINP  1331
             PPP       S+ F++L +GAKGDG +DD+KA +A W A CKV  +T+ IP+ + F + P
Sbjct  108   PPPKANNGVHSTFFNVLDYGAKGDGNTDDTKAFQATWAATCKVEASTMVIPANYIFYVGP  167

Query  1330  ITLQGP-CMPDLVLQ---------VDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGP  1181
             I+  GP C  ++V Q         +DG ++AP N  +W   ++ QW+ F  +   TIQG 
Sbjct  168   ISFSGPYCKANIVFQANNKVIFCQLDGTIIAPTNPNAWSGVTL-QWLEFTKLEGITIQGN  226

Query  1180  GTFDGQGPNWWK-------LSQIHSL-----QEKKASKTIHVNM-------KPTALRFYE  1058
             G  DG+G  WW+       +     L     Q +K    +   M       KPTALRFY 
Sbjct  227   GVIDGRGSVWWQDFPYDNPIDDEEKLIVPLNQTQKPPMPVQNEMGRKMPSNKPTALRFYG  286

Query  1057  STNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHST  878
             S   T+ GI+I NSPQCHLKFDN  GV VH+++IS+P +SPNTDGIHLQNS+DV IH S 
Sbjct  287   SYGPTVTGITIQNSPQCHLKFDNCNGVLVHDVSISSPGDSPNTDGIHLQNSKDVLIHSSK  346

Query  877   IGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYG  698
             +  GDDC+SIQTGCSNV+VH++NCGPGHGIS+G LGKD + ACVSNI V +V + +++ G
Sbjct  347   LACGDDCISIQTGCSNVYVHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNIHDSMNG  406

Query  697   ARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIV  518
              RIKTWQGG GSV+ V FS IQVS+V++PI+IDQ+YCDK  C N T AV++ G+ + +I 
Sbjct  407   VRIKTWQGGSGSVQGVLFSNIQVSEVQLPIVIDQFYCDKRVCTNHTSAVSLAGINYERIK  466

Query  517   GTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDY  338
             GT+  +P H ACS+S+PC DV L  ++L+P        +  CW ++G+ +    P     
Sbjct  467   GTYTVKPVHFACSDSLPCVDVSLTTVELKPIQEKYHLYDPFCWQTFGELRTPTVPPIG--  524

Query  337   CLRSGSLLVKRIARSHENIC  278
             CL+ G     RI   H+ IC
Sbjct  525   CLQIGKPSNNRIQTDHD-IC  543



>gb|KHN27445.1| Polygalacturonase [Glycine soja]
Length=439

 Score =   361 bits (927),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 192/417 (46%), Positives = 272/417 (65%), Gaps = 22/417 (5%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++ F++L +GAKGDG +DD+KA + AW AACKV G+T+ +PS   FL+ PI+  GP C P
Sbjct  39    ATTFNVLDYGAKGDGHADDTKAFQNAWVAACKVEGSTMVVPSGSVFLVKPISFSGPNCEP  98

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ--IH  1130
             ++V Q+DG ++AP    +W  S   QW+ F  ++  TI+G G  DGQG  WW       +
Sbjct  99    NIVFQLDGKIIAPTGSAAW-GSGTLQWLEFSKLNKITIRGKGVIDGQGSVWWNNDSPTYN  157

Query  1129  SLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
               +    S     + KPTALRFY S  VT+ GI+I NS Q HLKFD+   V V  I++S+
Sbjct  158   PTKVMLESNGRLPSTKPTALRFYGSDGVTVTGITIQNSQQTHLKFDSCTNVQVSGISVSS  217

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             P +SPNTDGIHLQNSQ+V I+ ST+  GDDC+SIQTGCS+++VH++NCGPGHGIS+G LG
Sbjct  218   PGDSPNTDGIHLQNSQNVVIYSSTLACGDDCISIQTGCSDIYVHNVNCGPGHGISIGSLG  277

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             ++ + ACV N+ V +V ++NTL G RIKTWQGG GSV+N+ FS +QVS V++PI+IDQYY
Sbjct  278   RENTKACVRNVTVRDVTIQNTLTGVRIKTWQGGSGSVQNIMFSNVQVSGVQIPILIDQYY  337

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CD   C+N++ AVA+  + +  I GT+  QP + ACS+++PCT + L  I+LE +   + 
Sbjct  338   CDGGKCRNESSAVAVSAIHYVNIKGTYTKQPIYFACSDNLPCTGITLDTIRLESAQETKN  397

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENICL*PSSHGGLKSQV  239
                  CW +YG+ + +  P     CL+ G+                PS  GG+ S++
Sbjct  398   SNVPFCWEAYGELKTKTVPPVE--CLQRGN----------------PSKAGGINSKI  436



>ref|XP_009121648.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Brassica rapa]
Length=439

 Score =   361 bits (927),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 188/384 (49%), Positives = 256/384 (67%), Gaps = 11/384 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S  F++L +GAKGDG SDD+KA E AW  ACKV+ +T+ +PS  +FL+ P++  G  C  
Sbjct  40    SGTFNVLDYGAKGDGTSDDTKAFEDAWNEACKVAASTLLVPSGSTFLVGPVSFLGKECKE  99

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS-  1127
             ++V Q+DG ++AP +   W  S + QW+ FK +   TI+G G  DGQG  WW  S  +  
Sbjct  100   NIVFQLDGKIIAPTSSSVW-GSGLLQWMEFKSLTGITIKGKGVIDGQGSVWWNKSPDYDP  158

Query  1126  ------LQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHN  965
                   ++++K +K      KPTALRFY S  V ++GI+I NSPQ HLKFDN   + V +
Sbjct  159   ADENDMMKDRKGTKM--PGTKPTALRFYGSNGVMVNGITIQNSPQTHLKFDNCVNIQVSD  216

Query  964   ITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgis  785
              T S+P +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPGHGIS
Sbjct  217   FTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHGIS  276

Query  784   lgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIM  605
             +GGLGK+ + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVS+V  PI+
Sbjct  277   IGGLGKENTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSEVANPIV  336

Query  604   IDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS  425
             IDQYYCD   C N+T AVA+  + +  I GT+  +P   ACS+S+PCT + L+ I+L+P+
Sbjct  337   IDQYYCDGGGCHNETSAVAVSNINYINIKGTYTREPVRFACSDSLPCTGISLSTIELKPA  396

Query  424   PGYRGFRNGQCWNSYGKSQGQLFP  353
                       CW ++G+ + +  P
Sbjct  397   TDKASSSEPFCWEAHGELKTETLP  420



>dbj|BAB20805.2| polygalacturonase [Zinnia elegans]
Length=443

 Score =   361 bits (927),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 195/406 (48%), Positives = 266/406 (66%), Gaps = 21/406 (5%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             Y   SS+F++L+FGAKGDG +DD+KA EAAW AACK+  +T+ +P    FLI PI+  GP
Sbjct  56    YGKTSSIFNVLNFGAKGDGTTDDTKAFEAAWLAACKLEASTMVVPKGSVFLIKPISFSGP  115

Query  1312  -CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
              C  ++V Q+DG ++AP   GSW +S + QW+ F  ++  TI+G G  DGQG  WW  S 
Sbjct  116   DCESNIVFQLDGKIIAPKRSGSW-ESGLLQWLEFTKLNGITIRGTGVIDGQGSGWWSDS-  173

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
                              KPTA+RFY ST+VT+ GI+I NS Q HLKFDN + V V  +T+
Sbjct  174   ---------------GTKPTAVRFYGSTDVTVTGITIQNSQQTHLKFDNCQSVQVFGVTV  218

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P +SPNTDGI+LQNSQDV IH + +  GDDC+SIQTGCS V++ +++CGPGHGIS+G 
Sbjct  219   SSPGDSPNTDGIYLQNSQDVTIHSTKLACGDDCISIQTGCSGVNIQNVDCGPGHGISIGS  278

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKD + ACVSNI V +  + +T+ G RIKTWQGG G+V+ V+FS IQVS V+  I+IDQ
Sbjct  279   LGKDNTRACVSNITVRDTKIHDTMTGVRIKTWQGGSGAVQGVTFSNIQVSKVETAIIIDQ  338

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             +YCD   C+N+T AV +  + +  I GT+   P   ACS S PCTDV+L  IQL P    
Sbjct  339   FYCDGGKCQNKTSAVGVSEISYQNIRGTYTQNPVRFACSQSTPCTDVNLDTIQLHPLQQN  398

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
                    C N+YG+ +    P  +D CL +  L +K  ++++ ++C
Sbjct  399   NDIGKPFCSNAYGELKTSTSPP-ID-CLMASKLAMKH-SQNNYDLC  441



>gb|AAF17670.1|AC009398_19 F20B24.8 [Arabidopsis thaliana]
Length=542

 Score =   364 bits (935),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 195/430 (45%), Positives = 272/430 (63%), Gaps = 37/430 (9%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S VF+++ FGAKGDG  DD+KA EAAW AACK+  + + +P ++++L+ PI+  GP C  
Sbjct  116   SQVFNVMDFGAKGDGKCDDTKAFEAAWVAACKIEASVMLVPPEYTYLVGPISFSGPYCQA  175

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W K  +  WI+F  +    +QG G  DG+G  WW+  Q    
Sbjct  176   NIVFQLDGTIIAPTDSKTWGKG-LMWWIDFTKLKGIKVQGKGVIDGRGSGWWQ--QDSPF  232

Query  1123  QEKKASKTIHVN---------------------MKPT----------ALRFYESTNVTIH  1037
              +      + +N                     +KPT          ALRF  S  V + 
Sbjct  233   IDSDTKLIVPLNNSANQNPPMPIRSELDERMPSIKPTVRNRYWHCEIALRFSGSFGVEVT  292

Query  1036  GISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDC  857
             GI+I NSPQCHLKFD+  GV VH+I +S+P +SPNTDGIHLQN++DV IH +T+  GDDC
Sbjct  293   GITIQNSPQCHLKFDDCVGVVVHDIAVSSPGDSPNTDGIHLQNTKDVLIHSTTLACGDDC  352

Query  856   VSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQ  677
             +SIQTGCSNV VH++NCGPGHGIS+G LGK+ + ACVSNI V +V M NT+ G RIKTWQ
Sbjct  353   ISIQTGCSNVFVHNVNCGPGHGISIGSLGKEGTKACVSNITVRDVAMHNTMTGVRIKTWQ  412

Query  676   GGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQP  497
             GGVGSVK + FS IQ++ V++PI I+Q+YCD   CKNQT AVA++GV + +I GT+  +P
Sbjct  413   GGVGSVKGIIFSNIQLNQVQIPITINQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKP  472

Query  496   FHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSL  317
              H ACS++ PC DV L+ I+L+P        +  CW ++G+      P  +D CL+ G  
Sbjct  473   VHFACSDNFPCVDVQLSSIELKPVQEKYRMYDAYCWQTFGELNTPTLPP-ID-CLKIGKP  530

Query  316   LVKRIARSHE  287
                ++   H+
Sbjct  531   PRNKVQSDHD  540



>ref|XP_006446532.1| hypothetical protein CICLE_v10015111mg [Citrus clementina]
 gb|ESR59772.1| hypothetical protein CICLE_v10015111mg [Citrus clementina]
Length=473

 Score =   362 bits (929),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 200/391 (51%), Positives = 265/391 (68%), Gaps = 11/391 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S++F++LS+GAKGDG +DD+KA EAAW AACK+ GAT+ +PS   FL+ PI+  GP C P
Sbjct  73    SAIFNVLSYGAKGDGRTDDTKAFEAAWAAACKIEGATMVVPSGSVFLVGPISFSGPTCQP  132

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWW-KLSQIHS  1127
             +++ Q+DG ++AP N G+W  S I QW+ F  +   T+ G G  DGQG  WW      + 
Sbjct  133   NILFQLDGKIIAPTNSGAW-GSGILQWLEFSKLKGITLTGKGIIDGQGSVWWHDAPSSYG  191

Query  1126  LQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
               +  AS  +  NM   KPTALRFY S+ VT+ GI+I NS Q HLKFD+   V V + T 
Sbjct  192   TADDSASSELKGNMPGTKPTALRFYGSSGVTVTGITIQNSQQTHLKFDDCTAVQVSDFTA  251

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P +SPNTDGIHLQNSQDV I+ ST+  GDDCVSIQTGCSN+ VH++NCGPGHGIS+G 
Sbjct  252   SSPGDSPNTDGIHLQNSQDVTIYSSTLACGDDCVSIQTGCSNIDVHNVNCGPGHGISIGS  311

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKD + ACVS I V +V M +T+ G RIKTWQGG G V+ V+FS IQV++VK PI+IDQ
Sbjct  312   LGKDNTKACVSKITVRDVTMHDTMTGVRIKTWQGGSGLVQQVTFSNIQVNNVKSPIVIDQ  371

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             YYC+K +C N++ AV +  + +  I GT+  QP H ACS+ +PCT + L+ + L+P    
Sbjct  372   YYCEKSSCHNESSAVQVSNIAYVNIRGTYTEQPAHFACSDILPCTGISLSTVALKP---V  428

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             +      CW +YG+ +    P     CLR G
Sbjct  429   QSATQPFCWEAYGELKTATDPPI--NCLRRG  457



>emb|CDY09873.1| BnaC09g42880D [Brassica napus]
Length=439

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 257/384 (67%), Gaps = 11/384 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S  F++L +GAKGDG SDD+KA E AW  ACKV+ +T+ +PS  +FL+ P++  G  C  
Sbjct  40    SGTFNVLDYGAKGDGTSDDTKAFEDAWNEACKVAASTLLVPSGSTFLVGPVSFLGKECKE  99

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHS-  1127
             ++V Q+DG ++AP +  +W  S + QWI FK +   TI+G G  DGQG  WW  S  +  
Sbjct  100   NIVFQLDGKIIAPKSSRAW-GSGLLQWIEFKSLIGITIKGKGVIDGQGSVWWNKSPDYDP  158

Query  1126  ------LQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHN  965
                   ++++K +K      KPTALRFY S  V ++GI+I NSPQ HLKFDN   + V +
Sbjct  159   ADDNDMMKDQKGTKM--PGAKPTALRFYGSNGVMVNGITIQNSPQTHLKFDNCVNIQVSD  216

Query  964   ITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgis  785
              T S+P +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPGHGIS
Sbjct  217   FTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHGIS  276

Query  784   lgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIM  605
             +GGLGK+ + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVS+V  PI+
Sbjct  277   IGGLGKENTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSEVANPIV  336

Query  604   IDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS  425
             IDQYYCD   C N+T AVA+  + +  I GT+  +P   ACS+S+PCT + L+ I+L+P+
Sbjct  337   IDQYYCDGGGCHNETSAVAVSNINYINIKGTYTREPVRFACSDSLPCTGISLSTIELKPA  396

Query  424   PGYRGFRNGQCWNSYGKSQGQLFP  353
                       CW ++G+ + +  P
Sbjct  397   TDKASSSEPFCWEAHGELKTETLP  420



>ref|XP_007031503.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY02429.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=532

 Score =   363 bits (933),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 199/377 (53%), Positives = 255/377 (68%), Gaps = 11/377 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L +GA+GDG +DD+KA  AAW AACKV  +TV +PS   FL+ PI+  GP C P
Sbjct  130   SATFNVLDYGARGDGRTDDTKAFVAAWAAACKVEASTVMVPSGSVFLVGPISFSGPNCQP  189

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP + G+W  S + QWI F  +   TI+G GT DGQG  WW  S   + 
Sbjct  190   NIVFQLDGKIIAPTSSGAW-GSGLLQWIEFTKLKGITIRGKGTIDGQGSVWWNDSP--TF  246

Query  1123  QEKKASKTIHVNM-------KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHN  965
               K    TI   +       KPTALRFY S  V + GI+I NS Q HLKFD    V V  
Sbjct  247   DPKAEDGTISTELGGKMPGTKPTALRFYGSDGVIVTGITIQNSAQTHLKFDACTSVQVSG  306

Query  964   ITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgis  785
              + S+P NSPNTDGIHLQNSQDV I  +T+  GDDCVSIQ GCSN+++H +NCGPGHGIS
Sbjct  307   FSASSPGNSPNTDGIHLQNSQDVVISSTTLACGDDCVSIQAGCSNIYIHDVNCGPGHGIS  366

Query  784   lgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIM  605
             +GGLG+D S ACVSNI V +  M+NTL G RIKTWQGG G+V+ V FS IQVS+V+ PIM
Sbjct  367   IGGLGRDNSKACVSNITVRDATMQNTLTGVRIKTWQGGSGAVQQVMFSNIQVSEVETPIM  426

Query  604   IDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPS  425
             IDQ+YCDK +CKNQ+ AVA+ G+ +  I GT+  QP H ACS+S+PC+ V L+ I+L+  
Sbjct  427   IDQFYCDKGSCKNQSSAVAVSGINYVNIRGTYTVQPVHFACSDSLPCSGVTLSTIELKSV  486

Query  424   PGYRGFRNGQCWNSYGK  374
                       CW +YG+
Sbjct  487   QENHRLGGPFCWETYGE  503



>ref|NP_196969.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 emb|CAB87632.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AED92058.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=435

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 252/377 (67%), Gaps = 12/377 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S   ++L  GAKGDG SDD+KA E AW  ACKV+ +T+ +PS  +FL+ P++  G  C  
Sbjct  48    SGTINVLDHGAKGDGTSDDTKAFEDAWQVACKVAASTLLVPSGSTFLVGPVSFLGKECKE  107

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
              +V Q++G ++AP +  +W  S + QWI FK +   TI+G G  DG+G  WW     + +
Sbjct  108   KIVFQLEGKIIAPTSASAW-GSGLLQWIEFKALQGITIKGKGIIDGRGSVWW-----NDM  161

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                K  +T     KPTALRFY S  VT+ GI+I NSPQ HLKFDN   + V + T S+P 
Sbjct  162   MGTKMPRT-----KPTALRFYGSNGVTVSGITIQNSPQTHLKFDNCISIQVSDFTTSSPG  216

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPGHGIS+GGLGKD
Sbjct  217   DSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNINIHDVDCGPGHGISIGGLGKD  276

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVS+V  PI+IDQYYCD
Sbjct  277   NTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSNVANPIIIDQYYCD  336

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
                C N+T AVA+  + +  I GT+  +P   ACS+S+PCT + L+ I+L+P+ G     
Sbjct  337   GGGCHNETSAVAVSNINYINIKGTYTKEPVRFACSDSLPCTGISLSTIELKPATGKASSL  396

Query  403   NGQCWNSYGKSQGQLFP  353
             +  CW ++G+ + +  P
Sbjct  397   DPFCWKAHGELKTKTLP  413



>ref|XP_011034123.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Populus euphratica]
Length=517

 Score =   362 bits (930),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 201/398 (51%), Positives = 272/398 (68%), Gaps = 23/398 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L FGAKG+G SDD+KA +AAW AACKV+ +T+ +P++ +FL+ PI+  GP C  
Sbjct  99    STTFNVLDFGAKGNGKSDDTKAFQAAWAAACKVAASTLIVPAEHAFLVGPISFSGPYCQA  158

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP N  +W +  + QW+ F  +   TIQG GT DG G  WW+       
Sbjct  159   NIVFQLDGTIIAPSNANAWGRG-LLQWLEFTKLVGITIQGKGTIDGSGSVWWQDYPFEDP  217

Query  1123  QEKKASKTIHVN---------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
              + ++   I +N                     +KPTALRFY S NVT+ GI+I NSPQC
Sbjct  218   IDSESELIIPLNNTVQQHPPMPIRNELNGKMPSIKPTALRFYGSFNVTVTGITIQNSPQC  277

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++ +S+P +SPNTDGIHLQNS+DV IH + +  GDDCVSIQTGCSNV
Sbjct  278   HLKFDNCVGVVVHDMRVSSPGDSPNTDGIHLQNSKDVLIHSTYLACGDDCVSIQTGCSNV  337

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             ++H++NCGPGHGIS+GGLGKD + ACVSNI V +VVM  T+ G R+KTWQGG GSV+ V 
Sbjct  338   YIHNVNCGPGHGISIGGLGKDNTKACVSNITVRDVVMHGTMTGVRVKTWQGGSGSVQGVL  397

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ +  I GT+  +P H ACS+++P
Sbjct  398   FSNIQVSEVQLPIVIDQFYCDKRKCKNQTTAVALSGITYENIRGTYTVKPVHFACSDALP  457

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFP  353
             C DV L  I+L+P        +  CW ++G+ +    P
Sbjct  458   CMDVSLTTIELKPLQKQYHLYDPFCWQTFGELKTPTMP  495



>gb|AAT39158.1| putative polygalacturonase [Oryza sativa Japonica Group]
 gb|AAU10689.1| putative polygalacturonase [Oryza sativa Japonica Group]
Length=571

 Score =   364 bits (934),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 196/426 (46%), Positives = 274/426 (64%), Gaps = 57/426 (13%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++VF+++ FGA+GDGV+DD++A E AW AACKV  +TV +PS+  F++ PI+  GP C P
Sbjct  131   NTVFNVVDFGARGDGVTDDTQAFEEAWAAACKVEASTVLVPSELEFVVGPISFSGPYCKP  190

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ----  1136
             +++ Q+DG ++A  +   W  S + QW+ F  +   +IQG G  +G+G  WW  S     
Sbjct  191   NILFQLDGTILAQTSTRVW-GSGLLQWLEFTKLSGISIQGSGVINGRGQEWWTYSDPNDD  249

Query  1135  ------IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVN  974
                    ++++ +K  +     +KPTALRFY S+NVT+ GI+IVNS QCHLKFD+ +GV 
Sbjct  250   DNDDVDAYNVELEKMPQ-----IKPTALRFYGSSNVTVTGITIVNSSQCHLKFDSCQGVM  304

Query  973   VHNITISAPENSPNTDGIHLQNSQDVEIHHSTIG--------------------------  872
             VH++TIS+PENSPNTDGIHLQNS+ V IHHS +                           
Sbjct  305   VHDLTISSPENSPNTDGIHLQNSKQVSIHHSNLACGNALINSIKAKPTGFRTKGKLKTLV  364

Query  871   -----------SGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVEN  725
                        +GDDCVSIQTGCS++++H++NCGPGHGIS+GGLG+  + ACVSN+ V +
Sbjct  365   QVSEVIFALCDAGDDCVSIQTGCSDINIHNVNCGPGHGISIGGLGRYNTKACVSNVTVRD  424

Query  724   VVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAI  545
             V M  T+ G RIKTWQGG G V+ + FS IQVS+V+ PI+IDQ+YCD+  C+NQT AVA+
Sbjct  425   VNMFKTMTGVRIKTWQGGSGLVQGIRFSNIQVSEVQTPIIIDQFYCDRTTCRNQTSAVAV  484

Query  544   QGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--SPGYRGFRNGQCWNSYGKS  371
              GV++  I GTF  +P H ACS+S PC+++ L  IQL+P   P Y    N  CW ++G+ 
Sbjct  485   LGVQYENIRGTFTIKPAHFACSDSSPCSEITLTGIQLKPLIVPQYH-LYNPFCWQAFGEL  543

Query  370   QGQLFP  353
                  P
Sbjct  544   STPTIP  549



>ref|XP_009121649.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Brassica rapa]
Length=442

 Score =   358 bits (919),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/385 (49%), Positives = 255/385 (66%), Gaps = 10/385 (3%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S  F++L +GAKGDG SDD+KA E AW  ACKV+ +T+ +PS  +FL+ P++  G  C  
Sbjct  40    SGTFNVLDYGAKGDGTSDDTKAFEDAWNEACKVAASTLLVPSGSTFLVGPVSFLGKECKE  99

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +   W  S + QW+ FK +   TI+G G  DGQG  WW  S  +  
Sbjct  100   NIVFQLDGKIIAPTSSSVW-GSGLLQWMEFKSLTGITIKGKGVIDGQGSVWWNKSPDYDP  158

Query  1123  QEKKA-----SKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVH  968
              ++       S ++   M   KPTALRFY S  V ++GI+I NSPQ HLKFDN   + V 
Sbjct  159   ADENDMVILNSISLGTKMPGTKPTALRFYGSNGVMVNGITIQNSPQTHLKFDNCVNIQVS  218

Query  967   NITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgi  788
             + T S+P +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPGHGI
Sbjct  219   DFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHGI  278

Query  787   slgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPI  608
             S+GGLGK+ + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVS+V  PI
Sbjct  279   SIGGLGKENTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSEVANPI  338

Query  607   MIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP  428
             +IDQYYCD   C N+T AVA+  + +  I GT+  +P   ACS+S+PCT + L+ I+L+P
Sbjct  339   VIDQYYCDGGGCHNETSAVAVSNINYINIKGTYTREPVRFACSDSLPCTGISLSTIELKP  398

Query  427   SPGYRGFRNGQCWNSYGKSQGQLFP  353
             +          CW ++G+ + +  P
Sbjct  399   ATDKASSSEPFCWEAHGELKTETLP  423



>gb|EMT04942.1| Polygalacturonase [Aegilops tauschii]
Length=421

 Score =   357 bits (916),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/386 (50%), Positives = 258/386 (67%), Gaps = 11/386 (3%)
 Frame = -3

Query  1420  KALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWP  1244
             +A EAAW AACKV  +TV +P +  F++ PI+  GP C P+++ Q+DG + A     +W 
Sbjct  37    QAFEAAWTAACKVEASTVLLPPELEFVVGPISFSGPNCKPNIIFQLDGTISAKTGARAW-  95

Query  1243  KSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHV-----NMKP  1079
              S + QW+ F  ++  +IQG G  +GQG  WW  S  +   +   S T         +KP
Sbjct  96    GSGLLQWLEFTKLNGISIQGSGVINGQGKEWWTYSDSNDDDDDTDSYTDQELEKMPQIKP  155

Query  1078  TALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQD  899
             TALRFY S+NV + GISI+NSPQCHLKFD+ +GV VHN+TIS+PENSPNTDGIHLQNS+D
Sbjct  156   TALRFYGSSNVRVTGISIINSPQCHLKFDSCQGVMVHNLTISSPENSPNTDGIHLQNSKD  215

Query  898   VEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVV  719
             V IHH+ +  GDDC+SIQTGCS+V++H++NCGPGHGIS+GGLG+  + ACVSNI V +V 
Sbjct  216   VSIHHTDLACGDDCISIQTGCSDVNIHNVNCGPGHGISIGGLGRYNTKACVSNITVRDVN  275

Query  718   MENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQG  539
             M  T+ G RIKTWQGG G V+ + FS I +S+V+ PIMIDQ+YCDK +C NQ+ AVA+ G
Sbjct  276   MFKTMTGVRIKTWQGGSGLVQGIRFSNIHMSEVQTPIMIDQFYCDKTSCTNQSSAVAVSG  335

Query  538   VKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--SPGYRGFRNGQCWNSYGKSQG  365
             V++  I GTF  +P H ACS+S PC+++ L  IQL P   P Y    +  CW ++G+   
Sbjct  336   VQYENIRGTFTFKPAHFACSDSSPCSEITLTGIQLRPLTVPQYHICSSPFCWQAFGELYT  395

Query  364   QLFPASMDYCLRSGSLLVKRIARSHE  287
                P     CL+ G     R+   H+
Sbjct  396   PTIPPI--SCLQLGKPAGNRVLSDHD  419



>ref|XP_010924275.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Elaeis 
guineensis]
Length=380

 Score =   355 bits (910),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 257/372 (69%), Gaps = 8/372 (2%)
 Frame = -3

Query  1390  CKVSGATVQIPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINF  1214
             CKV  +T+ +P++F FL+ PI+  GP C P++V Q+DG ++AP +  +W  S + QW+ F
Sbjct  13    CKVEASTMVVPAEFRFLVRPISFSGPYCQPNIVFQLDGTIIAPTSSKAW-GSGLLQWLEF  71

Query  1213  KWVHSFTIQGPGTFDGQGPNWWKLSQ--IHSLQEKKASKTIHVNMKPTALRFYESTNVTI  1040
               +   TI G G  +G+G  WW  S+  +  +  K ++K   +  KPTALRFY S NVT+
Sbjct  72    TKLKGITISGCGIIEGRGSVWWTNSESDVDPIHAKLSAKMPEI--KPTALRFYGSYNVTV  129

Query  1039  HGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDD  860
              GI+I NSPQCHLKFD    V V NITIS+P +S NTDGIHLQNS+DV IHH+ +G GDD
Sbjct  130   TGITIQNSPQCHLKFDFCDAVQVFNITISSPGSSLNTDGIHLQNSKDVSIHHTDLGCGDD  189

Query  859   CVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTW  680
             C+SIQTGCSN+++H++NCGPGHGIS+GGLG+D + ACVSNI V +V M NT+ G R+KTW
Sbjct  190   CISIQTGCSNINIHNVNCGPGHGISIGGLGRDNTKACVSNITVRDVNMHNTMNGVRVKTW  249

Query  679   QGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQ  500
             QGG GSV+++ FS I+VS+V+ PI+IDQ+YCD+ +CKNQT AVA+  + +  I GTF  Q
Sbjct  250   QGGSGSVQSIRFSNIKVSEVQTPIVIDQFYCDRRSCKNQTSAVALSSIAYENIKGTFTVQ  309

Query  499   PFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGS  320
             P  LACS+S+PC+ + L +++L+P   +       CW +YG+      P  +  CL++G 
Sbjct  310   PVRLACSDSLPCSGISLTEVELKPLQEHYHMYEPFCWQAYGELYTPTVPPIV--CLQTGK  367

Query  319   LLVKRIARSHEN  284
                 RI   H++
Sbjct  368   PTSNRIQSDHDS  379



>ref|XP_010936703.1| PREDICTED: polygalacturonase At1g48100-like [Elaeis guineensis]
Length=484

 Score =   358 bits (918),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 198/398 (50%), Positives = 270/398 (68%), Gaps = 12/398 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             + FD+L FGAKGDG +DD+KA +AAW AAC+V  + V +PS++ FL+ P++  GP C  +
Sbjct  86    TAFDVLDFGAKGDGTTDDTKAFQAAWAAACEVEASRVVVPSKYEFLVGPVSFDGPTCQDN  145

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             +V Q+DG ++AP +   W  S + QW+ F+ +   TIQG G  +GQG  WW      SL 
Sbjct  146   IVFQLDGTIIAPTDPKPW-GSGLLQWLEFRKLRGLTIQGQGIIEGQGNAWWSNK---SLF  201

Query  1120  EKKASKTIHVNMK-----PTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
             +  A  +  ++ K     PTALR Y S NVT+ GI+I NSPQCHLKFD+   V V +ITI
Sbjct  202   DDNAQPSNELSGKMPHTTPTALRLYGSNNVTVTGITIRNSPQCHLKFDSCDTVEVSDITI  261

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgg  776
             S+P +SPNTDGIHLQ+S +V IH   +G GDDC+SIQTGCS++++H+INCGPGHGIS+GG
Sbjct  262   SSPGDSPNTDGIHLQDSLNVFIHDVDLGCGDDCISIQTGCSSIYMHNINCGPGHGISIGG  321

Query  775   lGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQ  596
             LGKD + A VSNI V+   M+NTL   RIKTWQGG G VKN+ F+ ++VS+V+ PI+IDQ
Sbjct  322   LGKDNAEATVSNITVQGANMDNTLTAVRIKTWQGGSGYVKNIRFANVKVSEVQTPIIIDQ  381

Query  595   YYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGY  416
             +YCD   CKNQ+ AVA+  + +  I GT+  QP HLACS+++PC+++HL DI+LE    +
Sbjct  382   FYCDSGRCKNQSSAVALSEITYEGIRGTYTVQPVHLACSDNIPCSNIHLNDIELELLNQH  441

Query  415   RGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRI  302
                    CW +YG+ Q    P     CL S  L + +I
Sbjct  442   EHVYEPFCWQAYGELQSPTEPPI--NCLHSEKLKINQI  477



>ref|XP_009398937.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   357 bits (917),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 192/383 (50%), Positives = 262/383 (68%), Gaps = 5/383 (1%)
 Frame = -3

Query  1474  VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLV  1295
             +F +L +GA GDGV+DD++A +AAW AAC  + + V +PS F FL+ PI+  GPC  ++V
Sbjct  91    MFIVLDYGADGDGVTDDTEAFQAAWEAACHGAPSKVIVPSNFEFLVGPISFSGPCKSNVV  150

Query  1294  LQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEK  1115
              QVDG ++AP +      S + QW+ F+ +    I+G G  +GQG  WW  S   SL   
Sbjct  151   FQVDGKIIAPSSGRKAWSSGLLQWLEFRVLKGIRIEGRGIIEGQGSAWW--SNSSSLLGS  208

Query  1114  KASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSP  935
             + S  +  ++KPTALRFY S++VT+ GI++ NSPQ HLKFD+ + V V  +TIS+P +SP
Sbjct  209   EVSGQLP-HVKPTALRFYGSSDVTVSGITVRNSPQVHLKFDSCQAVEVTGVTISSPGDSP  267

Query  934   NTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSV  755
             NTDGIHLQNS +V IH++ +  GDDC+SIQTGCSN+ V ++NCGPGHGIS+GGLGK  + 
Sbjct  268   NTDGIHLQNSVNVFIHNTDLSCGDDCISIQTGCSNILVQNVNCGPGHGISIGGLGKADTQ  327

Query  754   ACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHA  575
             A VSN+ V+N  +  T+ G RIKTWQGG G VK + F+ I+VS+VK PI+IDQ+YCD   
Sbjct  328   ASVSNVTVQNANIVGTMIGVRIKTWQGGSGFVKCIRFAKIKVSNVKTPIVIDQFYCDHSE  387

Query  574   CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQ  395
             CKNQT AVA+  + +  IVGT+  QP +LACS+S PC ++HL+DIQL+         +  
Sbjct  388   CKNQTSAVALSDITYDGIVGTYTVQPVYLACSDSKPCRNIHLSDIQLQLLKQRGRTDDPF  447

Query  394   CWNSYGKSQGQLFPASMDYCLRS  326
             CW +YG  QG + P     CLRS
Sbjct  448   CWQAYGDLQGPIEPPIT--CLRS  468



>ref|XP_006483884.1| PREDICTED: polygalacturonase At1g48100-like [Citrus sinensis]
Length=527

 Score =   359 bits (922),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 210/415 (51%), Positives = 277/415 (67%), Gaps = 29/415 (7%)
 Frame = -3

Query  1489  PPPS---SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQ  1319
             PPPS   SVF++  FGAKG+GVSDD+KA EAAW AACKV  + + +P++  FL+ P++  
Sbjct  101   PPPSHHSSVFNVKDFGAKGNGVSDDTKAFEAAWAAACKVEASIMVVPAESVFLVGPMSFS  160

Query  1318  GP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-  1145
             GP C  +++ Q+DG ++AP     W K  +  W++F  +   TIQG G  DG+G  WW+ 
Sbjct  161   GPYCQANIIFQLDGTIIAPTGSKDWGK-GLLWWLDFTKLKGITIQGKGIIDGRGSVWWQD  219

Query  1144  -LSQIHSLQEKKASKTIHVN--------------------MKPTALRFYESTNVTIHGIS  1028
                      E K    +H N                    +KPTALRFY S NVT+ GI+
Sbjct  220   YPYDDPIDDESKLIIPLHNNTLPDKPPTPIRSELSGKMPSIKPTALRFYGSFNVTVTGIT  279

Query  1027  IVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSI  848
             I NSPQCHLKFDN  GV VH++++S+P +SPNTDGIHLQNS+DV IH S +  GDDCVSI
Sbjct  280   IQNSPQCHLKFDNCIGVVVHDVSVSSPGDSPNTDGIHLQNSKDVLIHTSNLACGDDCVSI  339

Query  847   QTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGV  668
             QTGCSNV+VH++NCGPGHGIS+G LGKD + ACVSNI V +V+M NT+ G RIKTWQGG 
Sbjct  340   QTGCSNVYVHNVNCGPGHGISIGSLGKDNTKACVSNITVRDVMMHNTMNGVRIKTWQGGS  399

Query  667   GSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHL  488
             GSV+ V FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + ++ GT+  +P H 
Sbjct  400   GSVQGVLFSNIQVSEVQLPIVIDQFYCDKSTCKNQTSAVALSGITYERVKGTYTVKPVHF  459

Query  487   ACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             ACS+S+PC DV L+ I+L+P        +  CW ++G+S     P     CL+ G
Sbjct  460   ACSDSLPCVDVTLSVIELKPVQERYHMYDPYCWQAFGESTTPTHPPIA--CLQKG  512



>gb|KDO82378.1| hypothetical protein CISIN_1g009748mg [Citrus sinensis]
Length=527

 Score =   359 bits (921),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 210/415 (51%), Positives = 277/415 (67%), Gaps = 29/415 (7%)
 Frame = -3

Query  1489  PPPS---SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQ  1319
             PPPS   SVF++  FGAKG+GVSDD+KA EAAW AACKV  + + +P++  FL+ P++  
Sbjct  101   PPPSHHSSVFNVKDFGAKGNGVSDDTKAFEAAWAAACKVEASIMVVPAESVFLVGPMSFS  160

Query  1318  GP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-  1145
             GP C  +++ Q+DG ++AP     W K  +  W++F  +   TIQG G  DG+G  WW+ 
Sbjct  161   GPYCQANIIFQLDGTIIAPTGSKDWGK-GLLWWLDFTKLKGITIQGKGIIDGRGSVWWQD  219

Query  1144  -LSQIHSLQEKKASKTIHVN--------------------MKPTALRFYESTNVTIHGIS  1028
                      E K    +H N                    +KPTALRFY S NVT+ GI+
Sbjct  220   YPYDDPIDDESKLIIPLHNNTLPYKPPTPIRSELSGKMPSIKPTALRFYGSFNVTVTGIT  279

Query  1027  IVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSI  848
             I NSPQCHLKFDN  GV VH++++S+P +SPNTDGIHLQNS+DV IH S +  GDDCVSI
Sbjct  280   IQNSPQCHLKFDNCIGVVVHDVSVSSPGDSPNTDGIHLQNSKDVLIHTSNLACGDDCVSI  339

Query  847   QTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGV  668
             QTGCSNV+VH++NCGPGHGIS+G LGKD + ACVSNI V +V+M NT+ G RIKTWQGG 
Sbjct  340   QTGCSNVYVHNVNCGPGHGISIGSLGKDNTKACVSNITVRDVMMHNTMNGVRIKTWQGGS  399

Query  667   GSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHL  488
             GSV+ V FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + ++ GT+  +P H 
Sbjct  400   GSVQGVLFSNIQVSEVQLPIVIDQFYCDKSTCKNQTSAVALSGITYERVKGTYTVKPVHF  459

Query  487   ACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             ACS+S+PC DV L+ I+L+P        +  CW ++G+S     P     CL+ G
Sbjct  460   ACSDSLPCVDVTLSVIELKPVQERYHMYDPYCWQAFGESTTPTHPPIA--CLQKG  512



>gb|AAO24262.1| putative style polygalacturonase [Turnera subulata]
Length=473

 Score =   357 bits (916),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 204/399 (51%), Positives = 265/399 (66%), Gaps = 24/399 (6%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             Y  PSS F++L +GAKGDG +DD+KA    W  A KV+ + + +P+   F + P++  G 
Sbjct  82    YGKPSS-FNVLDYGAKGDGHTDDTKA----WTDAGKVARSKILVPAGSVFFVGPVSFLGS  136

Query  1312  -CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-LS  1139
              C  ++ LQ+DG ++AP++   W  S + QWI FK ++ FTIQG GT DG+G  WW  L 
Sbjct  137   GCGANIELQLDGTILAPVSSKIW-GSGLLQWIEFKELNGFTIQGKGTIDGRGSVWWNDLP  195

Query  1138  QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVH  968
                S  E +    +   M   KPTALRFY ST VT+ GI+I NSPQ HLKFD+  GV V 
Sbjct  196   SYGSEWESEVGNQLDGKMPSTKPTALRFYGSTGVTVTGITIQNSPQTHLKFDSCTGVQVS  255

Query  967   NITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgi  788
             + T S+P NSPNTDGIHLQNSQ+V I+ S +  GDDC+SIQTGCSNV +H++NCGPGHGI
Sbjct  256   DFTTSSPGNSPNTDGIHLQNSQNVLIYSSDLACGDDCISIQTGCSNVFIHNVNCGPGHGI  315

Query  787   slgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPI  608
             S+GGLGKD + ACVSN+ V +V M NTL G RIKTWQGG GSV+ ++FS +QVS V  PI
Sbjct  316   SIGGLGKDNTKACVSNVTVRDVSMHNTLTGVRIKTWQGGSGSVQGITFSNVQVSGVGTPI  375

Query  607   MIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQL--  434
             MIDQ+YCD   CKN + AVA+ G+ +  I GT+  +P H ACS+S+PC  V L+ I+L  
Sbjct  376   MIDQFYCDGSKCKNDSSAVALTGINYLGIKGTYTEKPIHFACSDSMPCVGVSLSTIELTA  435

Query  433   --EPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
               E SP         CWN+YG  +    P  +D CLR+G
Sbjct  436   SEEDSPPL-------CWNAYGTVKTTTLPP-VD-CLRTG  465



>ref|XP_006290192.1| hypothetical protein CARUB_v10003877mg [Capsella rubella]
 gb|EOA23090.1| hypothetical protein CARUB_v10003877mg [Capsella rubella]
Length=440

 Score =   356 bits (913),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 254/377 (67%), Gaps = 6/377 (2%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+  ++L++GAKGDG SDD+KA E AW  ACKV+G+T+ +PS  +FL+ P++  G  C  
Sbjct  47    SATINVLNYGAKGDGTSDDTKAFENAWVEACKVAGSTLLVPSGSTFLVGPVSFLGKGCKE  106

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
              +V Q+DG ++AP +  +W  S + QWI FK +   TI+G G  DG+G  WW  S  +  
Sbjct  107   KIVFQLDGKIIAPTSSSAW-GSGLLQWIEFKTLTGITIKGKGIIDGRGSVWWNKSPAYDP  165

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
              ++  S    +  K  ALRFY S  VT++GI+I NSPQ HLKFD+   + V + T S+P 
Sbjct  166   ADESES----ITKKDMALRFYGSNGVTVNGITIQNSPQTHLKFDSCVNIQVSDFTTSSPG  221

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNS+D  I+ ST+  GDDC+SIQTGCSN+++H ++CGPGHGIS+GGLGK 
Sbjct  222   DSPNTDGIHLQNSKDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHGISIGGLGKY  281

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVS+V  PI+IDQYYCD
Sbjct  282   NTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSNVANPIIIDQYYCD  341

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
                C N+T AVA+  + +  I GT+  QP   ACS+S+PCT + L++I L+P+       
Sbjct  342   GGGCHNETSAVAVSNINYINIKGTYTKQPIRFACSDSLPCTGLSLSNIALKPATDKARSL  401

Query  403   NGQCWNSYGKSQGQLFP  353
             +  CW ++G+ + Q  P
Sbjct  402   DPFCWEAHGEVKTQTLP  418



>ref|NP_001238104.1| polygalacturonase PG2 precursor [Glycine max]
 gb|AAD46484.1| polygalacturonase PG2 [Glycine max]
Length=439

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 263/389 (68%), Gaps = 6/389 (2%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++ F++L +GAK  G +DD+KA + AW AACKV G+T+ +PS   FL+ PI+  GP C P
Sbjct  39    ATTFNVLDYGAKDGGHADDTKAFQNAWVAACKVEGSTMVVPSGSVFLVKPISFSGPNCEP  98

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-LSQIHS  1127
             ++V Q+DG ++AP    +W  S   QW+ F  ++  TI+G G  DGQG  WW   S  ++
Sbjct  99    NIVFQLDGKIIAPTGSAAW-GSGTLQWLEFSKLNKITIRGKGVIDGQGSVWWNNDSPTYN  157

Query  1126  LQEKKASKTIHV-NMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
               E        + + KPTALRFY S  VT+ GI+I NS Q HLKFD+   V V  I++S+
Sbjct  158   PTEVMLESNGRLPSTKPTALRFYGSDGVTVTGITIQNSQQTHLKFDSCTNVQVSGISVSS  217

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglG  770
             P +SPNTDGIHLQNSQ+V I+ ST+  GDDC+SIQTGCS+++VH++NCGPGHGIS+G LG
Sbjct  218   PGDSPNTDGIHLQNSQNVVIYSSTLACGDDCISIQTGCSDIYVHNVNCGPGHGISIGSLG  277

Query  769   KDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYY  590
             ++ + ACV N+ V +V ++NTL G RIKTWQGG GSV+N+ FS +QVS V++PI+IDQYY
Sbjct  278   RENTKACVRNVTVRDVTIQNTLTGVRIKTWQGGSGSVQNIMFSNVQVSGVQIPILIDQYY  337

Query  589   CDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             CD   C+N++ AVA+  + +  I GT+  QP + ACS+++PCT + L  I+LE +   + 
Sbjct  338   CDGGKCRNESSAVAVSAIHYVNIKGTYTKQPIYFACSDNLPCTGITLDTIRLESAQETKN  397

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
                  CW +YG+ + +  P     CL+ G
Sbjct  398   SNVPFCWEAYGELKTKTVPPV--ECLQRG  424



>ref|XP_008782487.1| PREDICTED: polygalacturonase At1g48100 [Phoenix dactylifera]
Length=484

 Score =   357 bits (915),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 260/382 (68%), Gaps = 12/382 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             + FD+L FGAKGDG++DD+KA +AAW AACKV  + + +PS++ FL+ PI+  GP C  +
Sbjct  86    TTFDVLDFGAKGDGITDDTKAFQAAWAAACKVEASKIIVPSKYEFLVGPISFDGPNCGDN  145

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWW--KLSQIHS  1127
             +V ++DG ++AP +   W  S + QW+ FK +   TI+G G  +G G  WW  K      
Sbjct  146   IVFELDGEIIAPTDPKPW-GSGLLQWLEFKKLRGLTIRGKGIIEGHGNAWWSNKSQFDDD  204

Query  1126  LQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAP  947
              Q          N++PTALRFY S NVT+ GI+I NSPQ HLKFD+ + V V +I +S+P
Sbjct  205   AQPSNELSGKMPNVRPTALRFYGSNNVTVTGITIQNSPQFHLKFDSCEAVEVSDIVVSSP  264

Query  946   ENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGK  767
              +SPNTDGIHLQNS DV IH   +G GDDC+SIQTGCSNV +H+INCGPGHGIS+GGLGK
Sbjct  265   GDSPNTDGIHLQNSVDVSIHDVDLGCGDDCISIQTGCSNVFLHNINCGPGHGISIGGLGK  324

Query  766   DKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYC  587
             D + A VSNI V++  ++NT+ G RIKTWQGG G  KN+ F  + VS V+ PI+IDQ+YC
Sbjct  325   DDTEATVSNITVQDANIKNTMTGVRIKTWQGGSGYAKNIRFENVIVSGVQTPIIIDQFYC  384

Query  586   DKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQL----EPSPG  419
             D+  CKNQ+ AVA+  + +  I GT+  QP HLACS+SVPC+++HL DI+L    E    
Sbjct  385   DRSRCKNQSSAVALSEITYEGIKGTYTYQPVHLACSDSVPCSNIHLNDIELKLLNEDEHA  444

Query  418   YRGFRNGQCWNSYGKSQGQLFP  353
             Y  F    CW +YG+ QG   P
Sbjct  445   YEPF----CWQAYGELQGPTEP  462



>ref|XP_007151017.1| hypothetical protein PHAVU_004G011800g [Phaseolus vulgaris]
 gb|ESW23011.1| hypothetical protein PHAVU_004G011800g [Phaseolus vulgaris]
Length=427

 Score =   355 bits (910),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 256/377 (68%), Gaps = 14/377 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L +GAKGDG +DD++A   AW A CKV G+T+ +PS   FL+ P++  GP C  
Sbjct  43    SATFNVLDYGAKGDGHADDTQAFAEAWEATCKVEGSTMVVPSGSVFLVKPVSFSGPNCEQ  102

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W  S   QW+ F  +   TI+G G  DGQG  WW  S    L
Sbjct  103   NIVFQLDGKIIAPTSSEAW-GSGTLQWLEFSKLKKITIRGKGVIDGQGSVWWNDSPNGKL  161

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                        + KPTALRFY S  VT+ GI+I NS Q HLKFD+S  + V +I +S+P 
Sbjct  162   P----------STKPTALRFYGSDGVTVTGITIQNSQQTHLKFDSSTNIQVFDINVSSPG  211

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNSQ+V I+ +T+  GDDC+SIQTGCS+V+VH++NCGPGHGIS+G LGK+
Sbjct  212   DSPNTDGIHLQNSQNVVIYSTTLACGDDCISIQTGCSDVYVHNVNCGPGHGISIGSLGKE  271

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACV NI V +V ++NTL G RIKTWQGG GSV+N+ FS +QVS V+ PI IDQYYCD
Sbjct  272   NTKACVRNITVRDVTIQNTLTGVRIKTWQGGSGSVQNIMFSNVQVSGVETPISIDQYYCD  331

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
                C+N++ AVA+ G+ +  I GT+  +P + ACS+++PCT + L  IQL+ S  +   R
Sbjct  332   GGKCRNESSAVAVSGIHYVNIKGTYTKEPIYFACSDNLPCTGITLDTIQLQSSQNHD--R  389

Query  403   NGQCWNSYGKSQGQLFP  353
                CW S+G+ + +  P
Sbjct  390   VPFCWESFGELKTKTVP  406



>ref|XP_006438345.1| hypothetical protein CICLE_v10031220mg [Citrus clementina]
 gb|ESR51585.1| hypothetical protein CICLE_v10031220mg [Citrus clementina]
Length=527

 Score =   358 bits (919),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 209/415 (50%), Positives = 278/415 (67%), Gaps = 29/415 (7%)
 Frame = -3

Query  1489  PPPS---SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQ  1319
             PPPS   SVF++  FGAKG+GVSDD+KA EAAW AACKV  + + +P++  FL+ P++  
Sbjct  101   PPPSHHSSVFNVKDFGAKGNGVSDDTKAFEAAWAAACKVEASIMVVPAESVFLVGPMSFS  160

Query  1318  GP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-  1145
             GP C  +++ Q+DG ++AP     W K  +  W++F  +   TIQG G  DG+G  WW+ 
Sbjct  161   GPYCQANIIFQLDGTIIAPTGSKDWGK-GLLWWLDFTKLKGITIQGKGIIDGRGSVWWQD  219

Query  1144  -LSQIHSLQEKKASKTIHVN--------------------MKPTALRFYESTNVTIHGIS  1028
                      E K    +H N                    +KPTALRFY S NVT+ GI+
Sbjct  220   YPYDDPIDDESKLIIPLHNNTLPDKPPTPIRSELSGKMPSIKPTALRFYGSFNVTVTGIT  279

Query  1027  IVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSI  848
             I NSPQCHLKFDN  GV VH++++S+P +SPNTDGIHLQNS+DV IH S +  GDDCVSI
Sbjct  280   IQNSPQCHLKFDNCIGVVVHDVSVSSPGDSPNTDGIHLQNSKDVLIHTSNLACGDDCVSI  339

Query  847   QTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGV  668
             QTGCSNV+VH++NCGPGHGIS+G LGK+ + ACVSNI V +V+M NT+ G RIKTWQGG 
Sbjct  340   QTGCSNVYVHNVNCGPGHGISIGSLGKENTKACVSNITVRDVMMHNTMNGVRIKTWQGGS  399

Query  667   GSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHL  488
             GSV+ V FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA+ G+ + ++ GT+  +P H 
Sbjct  400   GSVQGVLFSNIQVSEVQLPIVIDQFYCDKSTCKNQTSAVALSGITYERVKGTYTVKPVHF  459

Query  487   ACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             ACS+S+PC DV L+ I+L+P        +  CW ++G+S     P     CL++G
Sbjct  460   ACSDSLPCVDVTLSVIELKPVQERYHMYDPYCWQAFGESTTPTHPPIA--CLQTG  512



>ref|XP_009375163.1| PREDICTED: polygalacturonase At1g48100-like [Pyrus x bretschneideri]
 ref|XP_009377200.1| PREDICTED: polygalacturonase At1g48100-like [Pyrus x bretschneideri]
Length=486

 Score =   357 bits (915),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 200/398 (50%), Positives = 272/398 (68%), Gaps = 15/398 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+VF++L +GAKGDG +DD+KA EAAW AACKV  +T+ +PS   FL+ PI+  GP C  
Sbjct  77    SNVFNVLDYGAKGDGKADDTKAFEAAWAAACKVQSSTMSVPSGSVFLVKPISFSGPNCEA  136

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
             ++V Q+DG ++AP + G W  S + QWI F  +   +I+G G  DGQG  WW  S     
Sbjct  137   NIVFQLDGKIIAPTSSGDW-GSGLLQWIEFTKLKGISIKGSGVIDGQGSVWWSDSPKYNP  195

Query  1138  ---QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
                  +S  +  A+++    M   KPTALRFY S  V++ GI++ NSPQ HLKFD+   V
Sbjct  196   ANEATYSSLDDSATESNSGEMPSTKPTALRFYGSDGVSVTGITLQNSPQAHLKFDDCTNV  255

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V +I+IS+P NSPNTDGIHLQNSQ+  I  ++I  GDDC+SIQTGCSNV++H++NCGPG
Sbjct  256   QVSDISISSPGNSPNTDGIHLQNSQNAVISATSISCGDDCISIQTGCSNVNIHNVNCGPG  315

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HG+S+GGLGKD + ACVSN+ V +V M NTL G RIKTWQGG GSV+N+ FS IQ+++V+
Sbjct  316   HGVSIGGLGKDNTKACVSNVTVRDVQMHNTLTGVRIKTWQGGSGSVRNIMFSNIQLTEVE  375

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PI+IDQ+YCDK  C+NQ+ AVA+ GV +  I GT+ ++P   ACS+S PCT V L  I+
Sbjct  376   TPIVIDQFYCDKSNCQNQSSAVAVSGVNYVNIQGTYTSEPVRFACSDSSPCTGVSLDTIE  435

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             L+     +   +  CW +YG  +    P  +D CL++G
Sbjct  436   LKSVDEGKQLSDPFCWEAYGVLKTSTVP-QID-CLKNG  471



>ref|XP_009334144.1| PREDICTED: polygalacturonase At1g48100-like [Pyrus x bretschneideri]
Length=487

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 203/398 (51%), Positives = 268/398 (67%), Gaps = 15/398 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+VF++L +GAKGDG +DD+KA EAAW AACKV  +T+ +PS   FL+ PI+  GP C  
Sbjct  78    SNVFNVLDYGAKGDGKADDTKAFEAAWAAACKVQASTISVPSGSVFLVKPISFSGPNCEA  137

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
             ++V Q+DG ++AP + G W  S + QWI F  +   +I+G G  DGQG  WW  S     
Sbjct  138   NIVFQLDGKIIAPTSSGDW-GSGLLQWIEFTKLKGISIKGTGVIDGQGSVWWNDSPKDNP  196

Query  1138  ---QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
                   S  +  A+++    M   KPTALRFY S  V++ GI++ NSPQ HLKFD    V
Sbjct  197   ANETTDSSLDDSATESYSGKMPSTKPTALRFYGSDIVSVTGITLQNSPQAHLKFDACTNV  256

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V  I+IS+P NSPNTDGIHLQNSQ+  I  S+I  GDDCVSIQTGCSNV++H++NCGPG
Sbjct  257   QVSGISISSPGNSPNTDGIHLQNSQNAVISASSIACGDDCVSIQTGCSNVYIHNVNCGPG  316

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVK  617
             HG+S+GGLGKD + ACVSN+ V +V M +TL G RIKTWQGG GSV+N+ FS IQ+++V+
Sbjct  317   HGVSIGGLGKDNTKACVSNVTVRDVKMHSTLTGVRIKTWQGGSGSVQNIMFSNIQLTEVE  376

Query  616   VPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQ  437
              PIMIDQ+YCDK  C+NQ+ AVAI GV +  I GT+ ++  H ACS+S PCT V L  I+
Sbjct  377   TPIMIDQFYCDKSKCQNQSSAVAISGVNYVNIQGTYTSKAVHFACSDSSPCTGVSLDTIE  436

Query  436   LEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             L+     +   +  CW +YG  +    P  +D CL+ G
Sbjct  437   LKSVDEGKHLYDPFCWQAYGVLKTSTVP-RID-CLKKG  472



>gb|ABD62081.1| putative style polygalacturonase [Turnera subulata]
Length=473

 Score =   355 bits (910),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 203/399 (51%), Positives = 264/399 (66%), Gaps = 24/399 (6%)
 Frame = -3

Query  1492  YPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP  1313
             Y  PSS F++L +GAKGDG +DD+ A    W  A KV+ + + +P+   F + P++  G 
Sbjct  82    YGKPSS-FNVLDYGAKGDGHTDDTNA----WTDAGKVARSKILVPAGSVFFVGPVSFLGS  136

Query  1312  -CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWK-LS  1139
              C  ++ LQ+DG ++AP++   W  S + QWI FK ++ FTIQG GT DG+G  WW  L 
Sbjct  137   GCGANIELQLDGTILAPVSSKIW-GSGLLQWIEFKELNGFTIQGKGTIDGRGSVWWNDLP  195

Query  1138  QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVH  968
                S  E +    +   M   KPTALRFY ST VT+ GI+I NSPQ HLKFD+  GV V 
Sbjct  196   SYGSEWESEVGNQLDGKMPSTKPTALRFYGSTGVTVTGITIQNSPQTHLKFDSCTGVQVS  255

Query  967   NITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgi  788
             + T S+P NSPNTDGIHLQNSQ+V I+ S +  GDDC+SIQTGCSNV +H++NCGPGHGI
Sbjct  256   DFTTSSPGNSPNTDGIHLQNSQNVLIYSSDLACGDDCISIQTGCSNVFIHNVNCGPGHGI  315

Query  787   slgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPI  608
             S+GGLGKD + ACVSN+ V +V M NTL G RIKTWQGG GSV+ ++FS +QVS V  PI
Sbjct  316   SIGGLGKDNTKACVSNVTVRDVSMHNTLTGVRIKTWQGGSGSVQGITFSNVQVSGVGTPI  375

Query  607   MIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQL--  434
             MIDQ+YCD   CKN + AVA+ G+ +  I GT+  +P H ACS+S+PC  V L+ I+L  
Sbjct  376   MIDQFYCDGSICKNDSSAVALTGINYLGIKGTYTEKPIHFACSDSMPCVGVSLSTIELTA  435

Query  433   --EPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
               E SP         CWN+YG  +    P  +D CLR+G
Sbjct  436   SEEDSPPL-------CWNAYGTVKTTTLPP-VD-CLRTG  465



>ref|XP_010033292.1| PREDICTED: polygalacturonase At1g48100-like [Eucalyptus grandis]
Length=501

 Score =   355 bits (911),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 202/400 (51%), Positives = 264/400 (66%), Gaps = 17/400 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++  +GAKGDG +DD +A  AAW AACKV  +T+ +PS   FL++PI+  GP C P
Sbjct  91    STTFNVQDYGAKGDGHTDDMQAFLAAWAAACKVESSTILVPSGSVFLLSPISFAGPNCKP  150

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
              +  Q+DG ++AP +  +W  S + QWI F  +    I+G G  DGQG  WW  S +++ 
Sbjct  151   KITFQLDGKIIAPTSAKAW-GSGLLQWIEFTKLTEIIIKGEGIIDGQGAVWWNNSSVYAG  209

Query  1123  QE-------KKASKTIHVNM------KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSK  983
              +        + +K I   +      KPTALRFY S++VT+ GI+I NSPQ HLKFD+  
Sbjct  210   TDSIGQNRTNELNKMISAELSKMPTTKPTALRFYGSSDVTVTGITIQNSPQMHLKFDSCT  269

Query  982   GVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCg  803
              V V  I+IS+P +SPNTDGIHL NSQ+V IH   +  GDDCVSIQTGCSN+++H INCG
Sbjct  270   NVQVFYISISSPGDSPNTDGIHLHNSQNVLIHSCNLACGDDCVSIQTGCSNIYIHDINCG  329

Query  802   pghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSD  623
             PGHGIS+GGLGKD + ACVSN+ V N VM NT+ G RIKTWQGG GS  N+ FS IQVS+
Sbjct  330   PGHGISIGGLGKDNTRACVSNVTVRNTVMRNTMTGVRIKTWQGGSGSANNIMFSDIQVSE  389

Query  622   VKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLAD  443
             V+ PI+IDQYYCDK  CKNQT AVA+ G+ +  I GT+  QP + ACS+S PCT + LA 
Sbjct  390   VETPIVIDQYYCDKEICKNQTSAVAVSGINYANIKGTYTVQPVYFACSDSSPCTGISLAT  449

Query  442   IQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
             IQL+P           CW +YG+ +    P  +  CL+ G
Sbjct  450   IQLKPHQTSHHLYGPFCWETYGELKTSTMP--LIDCLQKG  487



>ref|XP_006293340.1| hypothetical protein CARUB_v100189191mg, partial [Capsella rubella]
 gb|EOA26238.1| hypothetical protein CARUB_v100189191mg, partial [Capsella rubella]
Length=327

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 220/274 (80%), Gaps = 7/274 (3%)
 Frame = -3

Query  1489  PPPSS---VFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQ  1319
             P PS+   VF+ILSFGAKGDG+SDDSKAL  AW AACKV+G  V++P    F++  +TLQ
Sbjct  58    PYPSTHDGVFNILSFGAKGDGLSDDSKALVGAWKAACKVAGGKVEVPGGKEFMVKAVTLQ  117

Query  1318  GPCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS  1139
             GPCM + V+Q++G +VAP  +GSWPKSS+FQW+NFKWV   TIQG GT +G+G NWW L 
Sbjct  118   GPCMEETVIQIEGTLVAPEKIGSWPKSSLFQWLNFKWVSHVTIQGSGTLNGRGSNWWNLD  177

Query  1138  QIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNIT  959
                + Q +  +K I   MKPTALRFY S NVT+  ISIVNSP CHLKFD+S GV ++N+T
Sbjct  178   ---TYQTQTRNKYIP-PMKPTALRFYASDNVTVRDISIVNSPLCHLKFDDSDGVKINNVT  233

Query  958   ISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislg  779
             IS+PENSPNTDGIHLQN+++VEI HS I  GDDCVSIQTG SNVH+HHI+CGPGHGIS+G
Sbjct  234   ISSPENSPNTDGIHLQNTRNVEIQHSNIACGDDCVSIQTGSSNVHIHHISCGPGHGISIG  293

Query  778   glGKDKSVACVSNILVENVVMENTLYGARIKTWQ  677
             GLGKDKSVACVS+I+VE++ ++NTL G RIKTWQ
Sbjct  294   GLGKDKSVACVSDIIVEDISIQNTLAGVRIKTWQ  327



>ref|XP_010251154.1| PREDICTED: polygalacturonase At1g48100-like [Nelumbo nucifera]
Length=308

 Score =   344 bits (882),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 180/290 (62%), Positives = 215/290 (74%), Gaps = 12/290 (4%)
 Frame = -3

Query  1660  IFCAAFSMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRN-----FpapapapaqlpPGN  1496
             +   AFS +SV+A+KN H +K +    H+ +K R     +       +P+  P   P   
Sbjct  1     MILLAFSTISVDAKKN-HKRKSKA---HRNQKQRGSENGDNSPGPVHSPSREPDPAPSSG  56

Query  1495  CYPPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG  1316
              Y   SS+FD+LSFGAKGDGVSDDSKA +AAW AACKV GATV+IPS+F FLI PIT QG
Sbjct  57    SYRTHSSIFDVLSFGAKGDGVSDDSKAFQAAWKAACKVPGATVEIPSEFKFLIRPITFQG  116

Query  1315  PCMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQ  1136
             PCMP LVLQ+DG ++AP  + +WPKS++FQWINFKWVH+FTIQG G  DGQG  WW LSQ
Sbjct  117   PCMPHLVLQIDGTLLAPPKISAWPKSTLFQWINFKWVHNFTIQGTGIVDGQGSAWWNLSQ  176

Query  1135  IHSLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITI  956
             I+ +Q  K SK I  N+KPTALRFY S +VT+  I IVNSPQCHLKFD+S  + V +ITI
Sbjct  177   INLIQ--KRSKCI-PNVKPTALRFYSSYDVTVRDIMIVNSPQCHLKFDSSGRIKVKDITI  233

Query  955   SAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINC  806
             S+P  SPNTDGIHLQN+QDVEI HS IG GDDCVSIQTGCSNVH+HHINC
Sbjct  234   SSPATSPNTDGIHLQNTQDVEIQHSHIGCGDDCVSIQTGCSNVHIHHINC  283



>ref|XP_010029152.1| PREDICTED: polygalacturonase At1g48100-like [Eucalyptus grandis]
Length=502

 Score =   350 bits (898),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 203/406 (50%), Positives = 272/406 (67%), Gaps = 24/406 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++ F++L +GAKGDG +DD+KA EAAW AAC V+ +T+ +PS   F++ PI+  GP C P
Sbjct  89    TTTFNVLDYGAKGDGHADDTKAFEAAWAAACPVAASTLVVPSGSVFMVKPISFSGPNCKP  148

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
              +V Q+DG ++AP +  +W  S + QWI F  + +  IQG G  DGQG  WW  S     
Sbjct  149   GIVFQLDGKIIAPTSSQAW-GSGLLQWIEFTKLTTIKIQGKGIIDGQGSVWWNDSPTVNP  207

Query  1138  --QIHSLQEKKASKT------IHVNM------KPTALRFYESTNVTIHGISIVNSPQCHL  1001
               ++ S+     S T      I  N+      KPTALRFY ST+VT++GI+I NSPQ HL
Sbjct  208   TDELDSISSTAQSPTNSSNDMISTNLSGMPSTKPTALRFYGSTDVTVNGITIQNSPQAHL  267

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFD+   V V  +TI++P NSPNTDGIHLQNSQ++ I+ + I  GDDCVSIQTGCSNV++
Sbjct  268   KFDSCTDVQVFGVTITSPGNSPNTDGIHLQNSQNMLIYSTNIACGDDCVSIQTGCSNVYI  327

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+GGLGKD + ACVSNI V +  +  TL G RIKTWQGG GS +++ FS
Sbjct  328   HNVNCGPGHGISIGGLGKDNTKACVSNITVRDTTITGTLTGVRIKTWQGGSGSAQDIMFS  387

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQVS+V+ PI+IDQ+YCDK  C+N+T AVA+ G+ +  I GT+  QP H ACS+S+PC 
Sbjct  388   NIQVSEVQTPIVIDQFYCDKGKCQNETAAVAVSGINYMNIKGTYTVQPVHFACSDSLPCI  447

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
              V L  IQL+P  G   + +  CW +YG+ +    P     CL+ G
Sbjct  448   GVSLTTIQLKPVQGSHWY-DPFCWETYGELKTATEPPI--SCLQKG  490



>gb|KCW55998.1| hypothetical protein EUGRSUZ_I01777 [Eucalyptus grandis]
Length=555

 Score =   351 bits (901),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 203/406 (50%), Positives = 272/406 (67%), Gaps = 24/406 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             ++ F++L +GAKGDG +DD+KA EAAW AAC V+ +T+ +PS   F++ PI+  GP C P
Sbjct  142   TTTFNVLDYGAKGDGHADDTKAFEAAWAAACPVAASTLVVPSGSVFMVKPISFSGPNCKP  201

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
              +V Q+DG ++AP +  +W  S + QWI F  + +  IQG G  DGQG  WW  S     
Sbjct  202   GIVFQLDGKIIAPTSSQAW-GSGLLQWIEFTKLTTIKIQGKGIIDGQGSVWWNDSPTVNP  260

Query  1138  --QIHSLQEKKASKT------IHVNM------KPTALRFYESTNVTIHGISIVNSPQCHL  1001
               ++ S+     S T      I  N+      KPTALRFY ST+VT++GI+I NSPQ HL
Sbjct  261   TDELDSISSTAQSPTNSSNDMISTNLSGMPSTKPTALRFYGSTDVTVNGITIQNSPQAHL  320

Query  1000  KFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHV  821
             KFD+   V V  +TI++P NSPNTDGIHLQNSQ++ I+ + I  GDDCVSIQTGCSNV++
Sbjct  321   KFDSCTDVQVFGVTITSPGNSPNTDGIHLQNSQNMLIYSTNIACGDDCVSIQTGCSNVYI  380

Query  820   HHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFS  641
             H++NCGPGHGIS+GGLGKD + ACVSNI V +  +  TL G RIKTWQGG GS +++ FS
Sbjct  381   HNVNCGPGHGISIGGLGKDNTKACVSNITVRDTTITGTLTGVRIKTWQGGSGSAQDIMFS  440

Query  640   GIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCT  461
              IQVS+V+ PI+IDQ+YCDK  C+N+T AVA+ G+ +  I GT+  QP H ACS+S+PC 
Sbjct  441   NIQVSEVQTPIVIDQFYCDKGKCQNETAAVAVSGINYMNIKGTYTVQPVHFACSDSLPCI  500

Query  460   DVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
              V L  IQL+P  G   + +  CW +YG+ +    P     CL+ G
Sbjct  501   GVSLTTIQLKPVQGSHWY-DPFCWETYGELKTATEPPI--SCLQKG  543



>gb|ACN27989.1| unknown [Zea mays]
 gb|AFW81233.1| hypothetical protein ZEAMMB73_645258 [Zea mays]
Length=421

 Score =   346 bits (887),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 244/343 (71%), Gaps = 5/343 (1%)
 Frame = -3

Query  1390  CKVSGATVQIPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINF  1214
             CKV  +TV +PS   F++ PI+  GP C P+++ Q+DG ++A  +  +W  + + QW+ F
Sbjct  50    CKVEASTVLVPSGLEFVVGPISFSGPYCKPNILFQLDGTILAQTSARAWGSAGLLQWLEF  109

Query  1213  KWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHG  1034
               +    +QG G  +G+G +WW  +  +   ++     +    KPTALRFY S+NVT+ G
Sbjct  110   TKLTGIAVQGSGVINGRGQDWWTYADPNDADDESVEMLLP-RTKPTALRFYGSSNVTVAG  168

Query  1033  ISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCV  854
             I+IVNS QCHLKFD+ +GV VH++++S+PE+SPNTDGIHLQNS+ V+IHH+T+  GDDC+
Sbjct  169   ITIVNSSQCHLKFDSCEGVMVHDLSVSSPEDSPNTDGIHLQNSRGVDIHHATLACGDDCI  228

Query  853   SIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQG  674
             SIQTGCS+V++H +NCGPGHGIS+GGLG+  + ACVSN+ V +V M  T  G RIKTWQG
Sbjct  229   SIQTGCSDVNIHSVNCGPGHGISIGGLGRFNTKACVSNVTVRDVKMFRTTTGVRIKTWQG  288

Query  673   GVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPF  494
             G G V+ V FS IQV++V+ PIMIDQ+YCD+  C+NQT AVA+ GV++  + GTF  +P 
Sbjct  289   GSGLVQGVRFSNIQVTEVQTPIMIDQFYCDRATCRNQTSAVAVSGVQYEDVRGTFTVRPA  348

Query  493   HLACSNSVPCTDVHLADIQLEPSPGYRGFR---NGQCWNSYGK  374
             HLACS+S PC+ + LA IQL+P P  +  R   +  CW ++G+
Sbjct  349   HLACSDSSPCSGITLAGIQLQPLPLPQHRRLSYDPFCWQAFGE  391



>ref|XP_002871625.1| hypothetical protein ARALYDRAFT_488306 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47884.1| hypothetical protein ARALYDRAFT_488306 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   345 bits (886),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/377 (49%), Positives = 245/377 (65%), Gaps = 26/377 (7%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQG-PCMP  1304
             S   ++L  GAKGDG SDD+KA E AW  ACKV+ +T+ +PS  +FL+ PI+  G  C  
Sbjct  48    SGTINVLDHGAKGDGKSDDTKAFEDAWKVACKVAASTLLVPSGSTFLVGPISFLGKECKE  107

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +              FK +   TI+G G  DG+G  WW  +++   
Sbjct  108   NIVFQIDGKIIAPTSA------------KFKSLKGITIKGKGIIDGRGSVWWNNAKMP--  153

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                          KPTALRFY S  VT+ GI+I NSPQ HLKFDN K + V + T S+P 
Sbjct  154   -----------RTKPTALRFYGSNGVTVSGITIQNSPQTHLKFDNCKSIQVSDFTTSSPG  202

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNSQD  I+ ST+  GDDC+SIQTGCSN+++H ++CGPGHGIS+GGLGKD
Sbjct  203   DSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNINIHDVDCGPGHGISIGGLGKD  262

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSNI V +V M  T  G RIK+WQGG GSVK V FS IQVS+V  PI+IDQYYCD
Sbjct  263   NTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSNVANPIIIDQYYCD  322

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
                C N+T AVA+  + +  I GT+  +P   ACS+S+PCT + L+ I+L+P+ G     
Sbjct  323   GGGCHNETSAVAVSNINYINIKGTYTKEPVRFACSDSLPCTGISLSTIELKPATGKASSL  382

Query  403   NGQCWNSYGKSQGQLFP  353
             +  CW ++G+ + +  P
Sbjct  383   DPFCWKAHGELKTKTLP  399



>ref|XP_010248489.1| PREDICTED: polygalacturonase At1g48100 [Nelumbo nucifera]
Length=526

 Score =   348 bits (893),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 198/392 (51%), Positives = 271/392 (69%), Gaps = 25/392 (6%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VFD+L FGAKGDG +DD+KA +AAW AACKV  +T+ +P++  FL+ PI+  GP C  +
Sbjct  107   AVFDVLHFGAKGDGKTDDTKAFQAAWAAACKVEASTMVVPAKLVFLVGPISFSGPYCESN  166

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             ++ Q++G ++AP +  +W  S + QW+ F  +   TI+G G  DGQG  WW+ S      
Sbjct  167   IIFQLEGTIIAPTSSDAW-GSGLLQWLEFTKLRGITIKGGGIIDGQGSVWWQDSPFDDST  225

Query  1120  EKKASKTIHV-----------------------NMKPTALRFYESTNVTIHGISIVNSPQ  1010
             + +A   + +                       ++KPTALRFY S NVT+ GI+I NSPQ
Sbjct  226   DSEARLIVPITDEPPTTVNPRIPINSTLGRKMPSIKPTALRFYGSYNVTVTGITIQNSPQ  285

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN  GV V+N+T ++P +S NTDGIHLQNS+DV IH + +  GDDCVSIQTGCSN
Sbjct  286   CHLKFDNCIGVQVYNMTTNSPGDSLNTDGIHLQNSKDVLIHSTNLACGDDCVSIQTGCSN  345

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V++H++NCGPGHGIS+GGLG+D + ACVSNI V +++M NT+ G RIKTWQGG GSV+ V
Sbjct  346   VYIHNVNCGPGHGISIGGLGRDNTKACVSNITVRDIMMHNTMTGVRIKTWQGGSGSVQGV  405

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQVS+V++PI+IDQ+YCDK  CKNQT AV++ G+ + +I GT+  +P HLACS+S+
Sbjct  406   LFSNIQVSEVQLPIVIDQFYCDKSTCKNQTSAVSLSGITYERIRGTYTVKPVHLACSDSL  465

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGK  374
             PC DV L  IQL+P        +  CW ++G+
Sbjct  466   PCIDVTLTAIQLKPIQERYHLYDPFCWQTFGE  497



>ref|XP_011034122.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Populus euphratica]
Length=546

 Score =   348 bits (894),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 272/427 (64%), Gaps = 52/427 (12%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+ F++L FGAKG+G SDD+KA +AAW AACKV+ +T+ +P++ +FL+ PI+  GP C  
Sbjct  99    STTFNVLDFGAKGNGKSDDTKAFQAAWAAACKVAASTLIVPAEHAFLVGPISFSGPYCQA  158

Query  1303  DLVLQV-----------------------------DGNVVAPLNVGSWPKSSIFQWINFK  1211
             ++V QV                             DG ++AP N  +W +  + QW+ F 
Sbjct  159   NIVFQVSIKYRICVQRKRQQFMLMNDDTMIFFSQLDGTIIAPSNANAWGRG-LLQWLEFT  217

Query  1210  WVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVN-------------------  1088
              +   TIQG GT DG G  WW+        + ++   I +N                   
Sbjct  218   KLVGITIQGKGTIDGSGSVWWQDYPFEDPIDSESELIIPLNNTVQQHPPMPIRNELNGKM  277

Query  1087  --MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHL  914
               +KPTALRFY S NVT+ GI+I NSPQCHLKFDN  GV VH++ +S+P +SPNTDGIHL
Sbjct  278   PSIKPTALRFYGSFNVTVTGITIQNSPQCHLKFDNCVGVVVHDMRVSSPGDSPNTDGIHL  337

Query  913   QNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNIL  734
             QNS+DV IH + +  GDDCVSIQTGCSNV++H++NCGPGHGIS+GGLGKD + ACVSNI 
Sbjct  338   QNSKDVLIHSTYLACGDDCVSIQTGCSNVYIHNVNCGPGHGISIGGLGKDNTKACVSNIT  397

Query  733   VENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGA  554
             V +VVM  T+ G R+KTWQGG GSV+ V FS IQVS+V++PI+IDQ+YCDK  CKNQT A
Sbjct  398   VRDVVMHGTMTGVRVKTWQGGSGSVQGVLFSNIQVSEVQLPIVIDQFYCDKRKCKNQTTA  457

Query  553   VAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGK  374
             VA+ G+ +  I GT+  +P H ACS+++PC DV L  I+L+P        +  CW ++G+
Sbjct  458   VALSGITYENIRGTYTVKPVHFACSDALPCMDVSLTTIELKPLQKQYHLYDPFCWQTFGE  517

Query  373   SQGQLFP  353
              +    P
Sbjct  518   LKTPTMP  524



>ref|XP_010251222.1| PREDICTED: polygalacturonase At1g48100 [Nelumbo nucifera]
Length=528

 Score =   347 bits (889),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 206/422 (49%), Positives = 283/422 (67%), Gaps = 27/422 (6%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +VFD+L FGAKGDG + D+KA +AAW AACKV  +TV +P+ + FL+ PI+  GP C  +
Sbjct  109   AVFDVLDFGAKGDGETYDTKAFQAAWAAACKVEASTVVVPADYVFLVGPISFSGPYCESN  168

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             +V Q++G ++AP    +W  S + QW+ F  +   TIQG G  DG+G  WW+ S      
Sbjct  169   IVFQLEGTIIAPTISSAW-GSGLLQWLEFTKLRGITIQGGGIIDGRGSVWWQDSPFDEPI  227

Query  1120  EKK--------------ASKTIHVN---------MKPTALRFYESTNVTIHGISIVNSPQ  1010
             + +              A+  I +N         +KPTALRFY S NVT+ GI+I NSPQ
Sbjct  228   DSETRLIIPITDEPPTAANSRIPINSTLGGKMPSIKPTALRFYGSYNVTVTGITIQNSPQ  287

Query  1009  CHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSN  830
             CHLKFDN  GV V+N+T ++P +S NTDGIHLQNS+DV IH + +  GDDCVSIQTGCSN
Sbjct  288   CHLKFDNCVGVEVYNMTTNSPGDSLNTDGIHLQNSKDVLIHSTNLACGDDCVSIQTGCSN  347

Query  829   VHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNV  650
             V++H++NCGPGHGIS+GGLG+D + ACV+NI V +++M NT+ G RIKTWQGG GSV+ V
Sbjct  348   VYIHNVNCGPGHGISIGGLGRDNTKACVTNITVRDIMMHNTMTGVRIKTWQGGSGSVQGV  407

Query  649   SFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSV  470
              FS IQVS+V++PI+IDQ+YCDK  CKNQ+ AVA+ G+ + +I GT+  +P H ACS+S+
Sbjct  408   LFSNIQVSEVQLPIVIDQFYCDKSTCKNQSSAVALSGITYEKIKGTYTVKPVHFACSDSL  467

Query  469   PCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSH  290
             PC DV L++I+L+P        N  CW ++G+      P  +D CL+ G     RI   +
Sbjct  468   PCIDVTLSNIELQPIQERYHMYNPFCWQTFGELSTPTVP-QID-CLQIGKPSSNRIQSDY  525

Query  289   EN  284
             ++
Sbjct  526   DS  527



>emb|CAN65317.1| hypothetical protein VITISV_006410 [Vitis vinifera]
Length=388

 Score =   341 bits (875),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 185/388 (48%), Positives = 255/388 (66%), Gaps = 25/388 (6%)
 Frame = -3

Query  1381  SGATVQIPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWV  1205
             + +T+ +PS++ FL+ PI+  GP C  ++V Q+DG ++AP N  +W  S +  WI F  +
Sbjct  3     NASTIVVPSEYVFLVGPISFSGPYCEANIVFQLDGTIIAPTNAKAW-GSGLLWWIEFTKL  61

Query  1204  HSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVN---------------------  1088
                TI+G G  DG+G  WW+ S      + +A   I +N                     
Sbjct  62    RGITIRGNGVIDGKGSVWWQDSPFDDPVDDEAKLIIPLNRTAKENSPIPINSKLGSKMPS  121

Query  1087  MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQN  908
              KPTALRFY S NVT+ GI+I NSPQCHLKFDN  GV+V+ +++S+P +S NTDGIHLQN
Sbjct  122   TKPTALRFYGSFNVTVTGITIQNSPQCHLKFDNCMGVSVYEMSVSSPGDSVNTDGIHLQN  181

Query  907   SQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVE  728
             S+DV IH + +  GDDCVSIQTGCSNV++H++NCGPGHGIS+GGLG+D + ACVSNI V 
Sbjct  182   SKDVLIHATNLACGDDCVSIQTGCSNVYIHNVNCGPGHGISIGGLGRDGTKACVSNITVR  241

Query  727   NVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVA  548
             +++M NT+ G RIKTWQGG GSV+ V FS IQVS+V++PI+IDQ+YCDK  CKNQT AVA
Sbjct  242   DIIMHNTMNGVRIKTWQGGSGSVQGVLFSNIQVSEVELPIVIDQFYCDKGKCKNQTSAVA  301

Query  547   IQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQ  368
             + G+ + +I GT+  +P H ACS+++PC DV L  I+L+P        +  CW ++G+  
Sbjct  302   LSGITYEKIKGTYTVKPVHFACSDNLPCMDVTLTGIELKPLQERYHMYDPFCWQTFGELT  361

Query  367   GQLFPASMDYCLRSGSLLVKRIARSHEN  284
                 P  +D CL+ G     RI   H++
Sbjct  362   TPTVPP-ID-CLQIGKPSSNRIQSDHDS  387



>ref|XP_009388828.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=454

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 189/383 (49%), Positives = 258/383 (67%), Gaps = 7/383 (2%)
 Frame = -3

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDLVL  1292
             F++L +GAKGDGV+DD+KA +AAW AAC+ S ++V +P+   FL+ PI+  GPC  +++ 
Sbjct  76    FNVLDYGAKGDGVTDDTKAFQAAWAAACEGSPSSVLVPADSDFLVGPISFSGPCKSNILF  135

Query  1291  QVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKK  1112
             Q+DG ++AP   G    S + QW+ F+ +    IQG G  +GQG  WW       L  + 
Sbjct  136   QLDGKIIAP--GGKAWGSGLLQWLEFRLLKGIRIQGQGIIEGQGNAWWSRDDPQ-LGTEL  192

Query  1111  ASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPN  932
             + +  HV  KP+A+RFY S++VT+ GI+I NSPQCHLKFD+S  + V  +T+S+P +SPN
Sbjct  193   SGRLPHV--KPSAVRFYGSSDVTVTGITIQNSPQCHLKFDSSHDIQVFGVTVSSPGDSPN  250

Query  931   TDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVA  752
             TDGIHLQNS  V IH + +G GDDC+SIQTGCSN+ V ++NCGPGHGIS+GGLGK  + A
Sbjct  251   TDGIHLQNSVGVSIHDTNLGCGDDCISIQTGCSNIMVQNVNCGPGHGISIGGLGKGNTQA  310

Query  751   CVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHAC  572
              VSN+ V+N  M  T  G RIKTWQGG G VKN+ FS I++S V  PI+IDQ+YCD+  C
Sbjct  311   SVSNVTVQNANMVGTTTGVRIKTWQGGSGYVKNIRFSKIKLSRVATPIVIDQFYCDQSKC  370

Query  571   KNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQC  392
             +NQT AVA+  + +  +VGT+  QP +LACS++ PC  +HL  IQLE         +  C
Sbjct  371   RNQTSAVALSDITYDGVVGTYTVQPVYLACSDTEPCRSIHLDGIQLELLKQRGASYDPFC  430

Query  391   WNSYGKSQGQLFPASMDYCLRSG  323
             W +YG  QG   P     CL++G
Sbjct  431   WQAYGDLQGPTEPPIT--CLQNG  451



>ref|XP_008379788.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase At1g48100 [Malus 
domestica]
Length=464

 Score =   342 bits (876),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 196/381 (51%), Positives = 257/381 (67%), Gaps = 14/381 (4%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             S+VF++L +GAKGDG +DD+KA EAAW AACKV  +T+ +PS   FL+ PI+  GP C  
Sbjct  78    SNVFNVLDYGAKGDGKADDTKAFEAAWAAACKVQASTISVPSGSVFLVKPISFSGPNCEE  137

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLS-----  1139
             ++V Q+DG ++AP + G W  S + QWI F  +   +I+G G  DGQG  WW  S     
Sbjct  138   NIVFQLDGKIIAPTSSGDW-GSGLLQWIEFTKLKGISIKGTGVIDGQGSVWWNDSPKYNP  196

Query  1138  ---QIHSLQEKKASKTIHVNM---KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGV  977
                   S  +  A+++    M   KPTALRFY S  V++ GI++ NSPQ HLKFD    V
Sbjct  197   ANESTDSSLDBLATESYSGKMPSTKPTALRFYGSDLVSVTGITLQNSPQAHLKFDACTNV  256

Query  976   NVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpg  797
              V  I+IS+P NSPNTDGIHLQNSQ+  I  S+I  GDDCVSIQTGCSNV++H++NCGPG
Sbjct  257   QVSGISISSPGNSPNTDGIHLQNSQNAVISASSIACGDDCVSIQTGCSNVYIHNVNCGPG  316

Query  796   hgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSV-KNVSFSGIQVSDV  620
             HG+S+GGLGKD + ACVSN+ V +V M +TL G RIKTWQGG GSV K+     IQ+++V
Sbjct  317   HGVSIGGLGKDNTKACVSNVTVRDVKMHSTLTGVRIKTWQGGSGSVQKHNVLXNIQLTEV  376

Query  619   KVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADI  440
             + PIMIDQ+YCDK  C+NQ+ AVAI GV +  I GT+ ++  H ACS+S PCT V L  I
Sbjct  377   ETPIMIDQFYCDKSKCQNQSSAVAISGVNYVNIQGTYTSKAVHFACSDSSPCTGVSLDTI  436

Query  439   QLEPSPGYRGFRNGQCWNSYG  377
             +L+     +   +  CW +YG
Sbjct  437   ELKSVDEGKHLYDPFCWEAYG  457



>ref|XP_004971921.1| PREDICTED: polygalacturonase At1g48100-like [Setaria italica]
Length=375

 Score =   336 bits (862),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 186/388 (48%), Positives = 245/388 (63%), Gaps = 60/388 (15%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
             S+   +LSFGA  DGV+DD+                                        
Sbjct  30    STTLSVLSFGAAADGVTDDA----------------------------------------  49

Query  1300  LVLQVDGNVVAPLNVGSWPK-SSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
                +VDG V+AP ++ SWPK     QW+NFKW++ FTIQG GT DGQ         I SL
Sbjct  50    ---EVDGTVLAPPDMDSWPKPRRPLQWLNFKWLNGFTIQGAGTVDGQ--------SITSL  98

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
             Q    +        P  +RFY S NVT+  I I NSPQCHLKFD+S  + V N+TIS+P 
Sbjct  99    QNSSPANA------PQLVRFYSSFNVTVRNIRISNSPQCHLKFDSSGSIKVKNVTISSPG  152

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +S NTDGIHLQN++DVEI  S+IG GDDCVSIQTGCSNVH+ ++ C PGHGIS+GGLGKD
Sbjct  153   DSLNTDGIHLQNTRDVEIRSSSIGCGDDCVSIQTGCSNVHMKNVVCNPGHGISVGGLGKD  212

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              S+ACVS+++ EN+ ++N LY  RIKTWQGGVGSV+N++FS ++V++V  PI IDQ+YCD
Sbjct  213   NSLACVSDVVAENINVQNALYAVRIKTWQGGVGSVRNITFSNVRVANVATPIAIDQFYCD  272

Query  583   KHA--CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRG  410
             +    C N+TGAVAI GV + ++VGT++ QP  LACS++ PCT V + D++L P+ G  G
Sbjct  273   RGGARCANRTGAVAIAGVAYRRVVGTYSFQPARLACSDARPCTGVTMVDVRLSPAAGAPG  332

Query  409   FRNGQCWNSYGKSQGQLFPASMDYCLRS  326
                  CWNSYG+++G + P  +    RS
Sbjct  333   TVAPLCWNSYGEARGTMEPLGVGCLQRS  360



>ref|XP_002892586.1| hypothetical protein ARALYDRAFT_471186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68845.1| hypothetical protein ARALYDRAFT_471186 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   336 bits (861),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 249/379 (66%), Gaps = 23/379 (6%)
 Frame = -3

Query  1363  IPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQ  1187
             +P ++++L+ PI+  GP C  ++V Q+DG ++AP +  +W K  ++ WI+F  +    +Q
Sbjct  4     VPPEYTYLVGPISFSGPYCQANIVFQLDGTIIAPTDSKTWGKGLMW-WIDFTKLKGIKVQ  62

Query  1186  GPGTFDGQGPNWWKLSQIHSLQEKKA----SKTIHVN---------------MKPTALRF  1064
             G G  DG+G  WW+     S  E K     + ++H N                KPTALRF
Sbjct  63    GKGVIDGRGSGWWQQDDPFSDGETKLIIPLNNSVHQNPPMPIRSELDGRMPSTKPTALRF  122

Query  1063  YESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHH  884
               S  V + GI+I NSPQCHLKFD+  GV VH+I +S+P +SPNTDGIHLQN++DV IH 
Sbjct  123   SGSLGVEVTGITIQNSPQCHLKFDDCLGVVVHDIAVSSPGDSPNTDGIHLQNTRDVLIHS  182

Query  883   STIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTL  704
             +T+  GDDC+SIQTGCSNV+VH++NCGPGHGIS+G LGK+ + ACVSNI V +V M NT+
Sbjct  183   TTLACGDDCISIQTGCSNVYVHNVNCGPGHGISIGSLGKEGTKACVSNITVRDVAMHNTM  242

Query  703   YGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQ  524
              G RIKTWQGGVGSVK + FS IQ+++V++PIMIDQ+YCD   CKNQT AVA++GV + +
Sbjct  243   TGVRIKTWQGGVGSVKGIIFSNIQLNEVQIPIMIDQFYCDHSKCKNQTSAVAVEGVTYER  302

Query  523   IVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASM  344
             I GT+  +P H ACS++ PC DV L+ I+L+P        +  CW ++G+      P  +
Sbjct  303   IKGTYTVKPVHFACSDNFPCVDVQLSSIELKPVQEKYRMSDAYCWQTFGELNTPTLPP-I  361

Query  343   DYCLRSGSLLVKRIARSHE  287
             D CL+ G     ++   H+
Sbjct  362   D-CLQIGKPPRNKVQSDHD  379



>ref|XP_010046047.1| PREDICTED: polygalacturonase At1g48100-like [Eucalyptus grandis]
Length=459

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 188/399 (47%), Positives = 254/399 (64%), Gaps = 23/399 (6%)
 Frame = -3

Query  1489  PPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-  1313
             P  S+ F++L FGAKGDG +DD+KA + AW A+C V  +T+ +P+   FL+ P++  G  
Sbjct  42    PSNSTTFNVLDFGAKGDGNTDDTKAFQDAWAASCNVEASTMVVPANHVFLVGPVSFVGEH  101

Query  1312  CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQI  1133
             C  +++LQ+DG VVAP +   W       W++F  +  FT+QG GT DG+G  WW+ SQ 
Sbjct  102   CQENIILQLDGTVVAPTDPQVWGGE---HWLHFDKLSRFTLQGSGTVDGRGSVWWRCSQS  158

Query  1132  ---------------HSLQEKKASKTIHV--NMKPTALRFYESTNVTIHGISIVNSPQCH  1004
                            H +  + A+  +      KPTA+RF    NVT  GI I NSP  H
Sbjct  159   EDLKDDLLDVDNDAGHGMDYEDANTQLSSMPRNKPTAMRFDHCLNVTFSGIKIQNSPNFH  218

Query  1003  LKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVH  824
             L FD+S GV V +++IS+P +SPNTDGIHL NSQDV IH +T+  GDDC+SI +GCSN+H
Sbjct  219   LTFDHSVGVLVRDMSISSPADSPNTDGIHLGNSQDVTIHDATLACGDDCISIVSGCSNIH  278

Query  823   VHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSF  644
             +H ++CGPGHGIS+G LGKD S ACV NI VE+V ++ T  G RIK+WQGG GSV  V F
Sbjct  279   IHDVHCGPGHGISIGSLGKDHSKACVHNITVEDVDLQGTTNGVRIKSWQGGSGSVYGVKF  338

Query  643   SGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPC  464
             S I+VS+V+ PI+IDQYYCD   C NQ+ AV ++ V +  I GT+  +P  LACS+SVPC
Sbjct  339   SNIRVSEVRWPIIIDQYYCDHATCTNQSSAVTVRDVAYEHISGTYTERPVDLACSDSVPC  398

Query  463   TDVHLADIQLEPSPGY-RGFRNGQ-CWNSYGKSQGQLFP  353
              D+ L+ I L PS        NG  CW ++G+    + P
Sbjct  399   EDITLSAIDLRPSSQKPPSHDNGPFCWQTFGQLTTPISP  437



>gb|EAY74476.1| hypothetical protein OsI_02367 [Oryza sativa Indica Group]
Length=382

 Score =   333 bits (855),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 185/408 (45%), Positives = 254/408 (62%), Gaps = 58/408 (14%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
             + F + SFGA G+G++DDS                                         
Sbjct  25    TTFSVSSFGAAGNGIADDS-----------------------------------------  43

Query  1297  VLQVDGNVVAPLNVGSWPKSSI-FQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
               ++DG+V+AP  +G WPK+    QW+NFKW+  FTIQG GT DGQ       + + S+ 
Sbjct  44    --EIDGDVLAPPGMGYWPKARRPLQWLNFKWLDGFTIQGTGTVDGQS------TLLRSVS  95

Query  1120  EKKASKTIHVN-MKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                 S+  +++ +KPT +RFY S NV++  I I NSPQCHLKFD+S G+ V NITIS+P 
Sbjct  96    PANVSQHWYISGVKPTLIRFYSSFNVSVRNIRITNSPQCHLKFDSSGGIKVKNITISSPG  155

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +S NTDGIHLQN++DV+I  S+IG GDDC+SIQTGCSNVH+ +INC PGHGISLGGLGKD
Sbjct  156   DSLNTDGIHLQNTRDVDIRSSSIGCGDDCISIQTGCSNVHMKNINCNPGHGISLGGLGKD  215

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              S+ACVS++  E++ +EN LYG RIKTWQGG G+V+NV+FS ++V++V  PI IDQ+YCD
Sbjct  216   NSLACVSDVFAEHINVENALYGVRIKTWQGGKGTVRNVTFSNVRVANVATPIAIDQFYCD  275

Query  583   KHA----CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--SP  422
                    C N++ AV I GV + ++ GT+  QP  LACS++ PCT V +AD++L P  + 
Sbjct  276   AGGGGARCGNRSDAVGITGVAYRRVAGTYTYQPVRLACSDARPCTGVSMADVRLSPASAT  335

Query  421   GYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             G  G R   CW SYG++ G + P  +  CL+  +  V  + +     C
Sbjct  336   GAGGLRQPLCWKSYGEAMGMIEPTGI-ACLQRSNGFVMPLTKPFNYTC  382



>gb|KCW86703.1| hypothetical protein EUGRSUZ_B03312 [Eucalyptus grandis]
Length=385

 Score =   333 bits (855),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 236/351 (67%), Gaps = 23/351 (7%)
 Frame = -3

Query  1363  IPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQ  1187
             IP+++ F + PI+  GP C  ++++QVDG +VAP    +W K  + QW+ F  +   TIQ
Sbjct  4     IPAKYVFFVGPISFSGPFCQANILVQVDGTIVAPTENKAWGKG-LLQWLEFTKLRGITIQ  62

Query  1186  GPGTFDGQGPNWWK--------------LSQIHSLQEKKASKTIHVNM-------KPTAL  1070
             G GT DG+G  WW+              L  ++S  E+     +   +       KPTAL
Sbjct  63    GQGTIDGRGSVWWEDYPFDEPIDDETQLLIPLNSTVERSPPMPVRNELGAKMPSIKPTAL  122

Query  1069  RFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEI  890
             RFY S NVT+ GI+I NSPQ HLKFDN  GV VH++++S+P NSPNTDGIHLQNS+DV I
Sbjct  123   RFYGSFNVTVTGITIRNSPQFHLKFDNCMGVLVHDMSVSSPGNSPNTDGIHLQNSKDVLI  182

Query  889   HHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMEN  710
             H + +  GDDC+SIQTGCSNV++H++NCGPGHGIS+G LG+D + ACVSNI V +V + N
Sbjct  183   HSTDLACGDDCISIQTGCSNVYIHNVNCGPGHGISIGSLGRDHTKACVSNITVRDVNIHN  242

Query  709   TLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKF  530
             T+ G RIKTWQGG GSV+ V FS +QVS+V+ PI+IDQYYCDK  C NQ+ AVA+ G+ +
Sbjct  243   TMTGVRIKTWQGGSGSVQGVMFSNVQVSEVQFPIIIDQYYCDKSTCMNQSSAVALSGITY  302

Query  529   GQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYG  377
              +I GT+  +P H ACS+S+PC DV L  IQL+P        N  CW ++G
Sbjct  303   ERIRGTYTVRPVHFACSDSLPCVDVTLTAIQLKPVQEQYHLYNPFCWQTFG  353



>gb|ACR36869.1| unknown [Zea mays]
Length=421

 Score =   334 bits (857),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 239/347 (69%), Gaps = 13/347 (4%)
 Frame = -3

Query  1390  CKVSGATVQIPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINF  1214
             CKV  +TV +PS   F++ PI+  GP C P+++ Q+DG ++A  +  +W  + + QW+ F
Sbjct  50    CKVEASTVLVPSGLEFVVGPISFSGPYCKPNILFQLDGTILAQTSARAWGSAGLLQWLEF  109

Query  1213  KWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVNMKPTALRFYESTNVTIHG  1034
               +    +QG G  +G+G +WW  +  +   ++   + +    KPTALRFY S+NVT+ G
Sbjct  110   TKLTGIAVQGSGVINGRGQDWWTYADPNDADDESV-EMLLPRTKPTALRFYGSSNVTVAG  168

Query  1033  ISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCV  854
             I+IVNS QCHLKFD+ +GV VH++++S+PE+SPNTDGIHLQNS+ V+IHH+T+  GDDC+
Sbjct  169   ITIVNSSQCHLKFDSCEGVMVHDLSVSSPEDSPNTDGIHLQNSRGVDIHHATLACGDDCI  228

Query  853   SIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQG  674
             SIQTGCS+V++H +NCGPGHGIS+GGLG+  + ACVSN+ V +V M  T  G RIKTWQG
Sbjct  229   SIQTGCSDVNIHSVNCGPGHGISIGGLGRFNTKACVSNVTVRDVKMFRTTTGVRIKTWQG  288

Query  673   GVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPF  494
             G G V+ V FS IQV++V+ PIMIDQ+YCD+  C+NQT AVA+ GV++  + GTF  +P 
Sbjct  289   GSGLVQGVRFSNIQVTEVQTPIMIDQFYCDRATCRNQTSAVAVSGVQYEDVRGTFTVRPA  348

Query  493   HLACSNSVPCTDVHLADI-------QLEPSPGYRGFRNGQCWNSYGK  374
             HLACS+S PC+ + LA I              Y  F    CW ++G+
Sbjct  349   HLACSDSSPCSGITLAGIQLQPLPLPQPRRLSYDPF----CWQAFGE  391



>ref|XP_004306351.1| PREDICTED: polygalacturonase At1g48100-like [Fragaria vesca subsp. 
vesca]
Length=477

 Score =   334 bits (857),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 190/376 (51%), Positives = 249/376 (66%), Gaps = 12/376 (3%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMPD  1301
             +V+++L +GAKGDG +DD+KA  AAW AACKV  +TV +PS   FL+ PI+  GP C P 
Sbjct  87    AVYNVLDYGAKGDGKADDTKAFVAAWAAACKVQASTVTVPSGSVFLVKPISFSGPNCQPH  146

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             +V Q+DG ++AP   G+W  S + QW+ F  +   TI+G G  DGQG  WW      S  
Sbjct  147   IVFQLDGKIIAPTGAGAW-GSGLLQWLEFTKLQRLTIRGKGVIDGQGAVWWN----DSYN  201

Query  1120  EKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
              K  S       KPTALRFY S  VT+ GI+I NSPQ HLKFD+   V V  +TIS+P +
Sbjct  202   GKMPS------TKPTALRFYGSNGVTVTGITIQNSPQAHLKFDSCTNVQVSAVTISSPGD  255

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             SPNTDGIHLQNSQDV I  +++  G+   S      N+ +H++NCGPGHG+S+GGLGKD 
Sbjct  256   SPNTDGIHLQNSQDVAISGASLACGNFQHSSIKSRGNLALHNVNCGPGHGVSIGGLGKDG  315

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             + ACVSNI V +V ++NTL G RIKTWQGG GSVKNV F+ IQVS+V+ PIMIDQ+YCDK
Sbjct  316   TKACVSNITVRDVKLQNTLNGVRIKTWQGGSGSVKNVMFANIQVSEVEFPIMIDQFYCDK  375

Query  580   HACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRN  401
               C N+T AVA+ G+ +  I GT+ ++P H ACS+S+PCT V L  I L+     +   +
Sbjct  376   GHCANKTSAVAVSGINYVNIQGTYTSKPAHFACSDSIPCTGVSLDTIHLKSVQSGKRLYD  435

Query  400   GQCWNSYGKSQGQLFP  353
               CW +YG+ +    P
Sbjct  436   PFCWEAYGELKTNTVP  451



>ref|XP_006645987.1| PREDICTED: polygalacturonase At1g48100-like [Oryza brachyantha]
Length=380

 Score =   330 bits (845),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/324 (53%), Positives = 230/324 (71%), Gaps = 19/324 (6%)
 Frame = -3

Query  1291  QVDGNVVAPLNVGSWPKSSI-FQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQEK  1115
             ++DG+V+AP  +G WP++    QW+NFKW++ FTIQG GT DGQ  +    S  +  Q  
Sbjct  56    EIDGDVLAPPGMGYWPRARRPLQWLNFKWLNGFTIQGTGTVDGQSTSLTNHSPANVSQ--  113

Query  1114  KASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSP  935
                           +RFY S NV++  I + NSPQCHLKFD+S G+ V NITIS+P +S 
Sbjct  114   -------------LIRFYSSFNVSVRNIRVTNSPQCHLKFDSSGGITVKNITISSPGDSL  160

Query  934   NTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSV  755
             NTDGIHLQN++DV+I  S+IG GDDC+SIQTGCSNVH+ +INC PGHGISLGGLGKD S+
Sbjct  161   NTDGIHLQNTRDVDIRSSSIGCGDDCISIQTGCSNVHMKNINCNPGHGISLGGLGKDNSL  220

Query  754   ACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHA  575
             ACVS++L +++ +EN LYG RIKTWQGG G+V+NV+FS ++V++V  PI IDQ+YCD   
Sbjct  221   ACVSDVLADHINVENALYGVRIKTWQGGKGTVRNVTFSNVRVANVATPIAIDQFYCDAGR  280

Query  574   CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYR--GFRN  401
             C N+T AV I GV + ++VGT+  QP HLACS++ PCT V +AD++L P+ G      R 
Sbjct  281   CGNRTDAVEITGVAYRRVVGTYTYQPVHLACSDARPCTGVSMADVRLSPASGSAAGALRR  340

Query  400   GQCWNSYGKSQGQLFPASMDYCLR  329
               CW SYG++ G + PA++  CL+
Sbjct  341   PLCWKSYGEAAGMIEPAAIG-CLQ  363



>dbj|BAD88046.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
 dbj|BAD88298.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
Length=372

 Score =   325 bits (833),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 183/407 (45%), Positives = 247/407 (61%), Gaps = 66/407 (16%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
             + F + SFGA G+G++DDS                                         
Sbjct  25    TTFSVSSFGAAGNGIADDS-----------------------------------------  43

Query  1297  VLQVDGNVVAPLNVGSWPKSSI-FQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
               ++DG+V+AP  +G WPK+    QW+NFKW+  FTIQG GT DGQ       + + S+ 
Sbjct  44    --EIDGDVLAPPGMGYWPKARRPLQWLNFKWLDGFTIQGTGTVDGQS------TLLRSVS  95

Query  1120  EKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPEN  941
                 S+ I         RFY S NV++  I I NSPQCHLKFD+S G+ V NITIS+P +
Sbjct  96    PANVSQLI---------RFYSSFNVSVRNIRITNSPQCHLKFDSSGGIKVKNITISSPGD  146

Query  940   SPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDK  761
             S NTDGIHLQN++DV+I  S+IG GDDC+SIQTGCSNVH+ +INC PGHGISLGGLGKD 
Sbjct  147   SLNTDGIHLQNTRDVDIRSSSIGCGDDCISIQTGCSNVHMKNINCNPGHGISLGGLGKDN  206

Query  760   SVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDK  581
             S+ACVS++  E++ +EN LYG RIKTWQGG G+V+NV+FS ++V++V  PI IDQ+YCD 
Sbjct  207   SLACVSDVFAEHINVENALYGVRIKTWQGGKGTVRNVTFSNVRVANVATPIAIDQFYCDA  266

Query  580   HA----CKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEP--SPG  419
                   C N++ AV I GV + ++ GT+  QP  LACS++ PCT V +AD++L P  + G
Sbjct  267   GGGGARCGNRSDAVGITGVAYRRVAGTYTYQPVRLACSDARPCTGVSMADVRLSPASATG  326

Query  418   YRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
               G R   CW SYG++ G + P  +  CL+  +  V  + +     C
Sbjct  327   AGGLRQPLCWKSYGEAMGMIEPTGI-ACLQRSNGFVMPLTKPFNYTC  372



>ref|XP_008353865.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=466

 Score =   328 bits (841),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 200/473 (42%), Positives = 279/473 (59%), Gaps = 35/473 (7%)
 Frame = -3

Query  1660  IFCAAF---SMMSVEARKNRHAKKPRTPPPHKLKKGRSDYRRNFpapapapaqlpPGNCY  1490
             +FC +F    +MS +AR + H K       HK    +S+  +   +     +        
Sbjct  10    VFCISFFCFLLMSTQARXHNHTK-------HKHSHKQSNISQPPSSSPEPASPPEEPPTN  62

Query  1489  PPPSS-VFDILSFGAKGDGVSDDSKALEAAWGAACKV--SGATVQIPSQFSFLINPITLQ  1319
             P  SS  FD+ SFGA GDG +DD+ A + AW  AC+   S A + +P  FSF I      
Sbjct  63    PHHSSGAFDVRSFGAVGDGQTDDTAAFKMAWDTACQSDESAARILVPQGFSFXIQSTIFT  122

Query  1318  GPCMPDLVLQVDGNVVAPLNVGSWPKS-SIFQWINFKWVHSFTIQGPGTFDGQGPNWWKL  1142
             GPC+  LVLQVDG +V P    SWPK+ S  QW+ F  V+  ++QG G  DG+G  WW L
Sbjct  123   GPCLGGLVLQVDGTLVPPDGPESWPKNISRHQWLVFYRVNEMSLQGGGVIDGRGEKWWNL  182

Query  1141  SQIHSLQEKKASKTIHVNM------KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKG  980
                      K  + I+          P ALRF+ S+N+T+ G+ I NSP+ H +FDN K 
Sbjct  183   -------PCKPHRGINGTTLPGPCDSPIALRFFMSSNLTVQGLRIKNSPKFHFRFDNCKN  235

Query  979   VNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgp  800
             V++ +I+ISAP  SPNTDGIH++N+ DV+I++S I +GDDC+SI +GC +V + +I CGP
Sbjct  236   VHIESISISAPAKSPNTDGIHIENTNDVQIYNSVISNGDDCISIGSGCYDVDIRNITCGP  295

Query  799   ghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDV  620
             GHGIS+G LG   S ACVSNI V + +++ T  G RIKTWQGG GSV  V+FS I + +V
Sbjct  296   GHGISIGSLGNHNSRACVSNITVRDSIIKGTDNGVRIKTWQGGSGSVSAVTFSNIHMDNV  355

Query  619   KVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQ--PFHLACSNSVPCTDVHLA  446
             + PIMIDQYYC    C NQT AV +  + +  I GT+  +  P H ACS+++PCT++ L+
Sbjct  356   RNPIMIDQYYCLTKGCTNQTSAVFVSDILYSNIKGTYDVRSSPMHFACSDALPCTNLTLS  415

Query  445   DIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG---SLLVKRIAR  296
             +++L P+ G +   +  CWN+YG+ Q    P     CL  G   SLL K + R
Sbjct  416   EVELLPAVGDK-VSDPYCWNAYGELQTLTIPPVS--CLLDGVPRSLLDKYVER  465



>gb|KEH24801.1| polygalacturonase [Medicago truncatula]
Length=402

 Score =   326 bits (835),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 185/405 (46%), Positives = 248/405 (61%), Gaps = 48/405 (12%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGP-CMP  1304
             SS F++L FGAKGDG SDD+KA E AW AACK+  +T+ +PS   FL+ PI+  GP C P
Sbjct  42    SSTFNVLDFGAKGDGHSDDTKAFEDAWAAACKMEASTMVVPSGSVFLVKPISFSGPNCEP  101

Query  1303  DLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSL  1124
             ++V Q+DG ++AP +  +W  S   QW+ F  ++  TI+G G  DGQG  WW  S+    
Sbjct  102   NIVFQLDGKIIAPTSPSAW-GSGTLQWLEFTKLNKITIKGKGVIDGQGSVWWNDSE----  156

Query  1123  QEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPE  944
                K  KT     KPTALRFY S  V++ GI+I NS Q HLKFD+   V V +IT S+P 
Sbjct  157   ---KLPKT-----KPTALRFYGSDGVSVSGITIQNSQQTHLKFDSCTNVQVFDITTSSPG  208

Query  943   NSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKD  764
             +SPNTDGIHLQNSQDV I  ST+  G               H I+        +G LGK+
Sbjct  209   DSPNTDGIHLQNSQDVVISGSTLSCG---------------HGIS--------IGSLGKE  245

Query  763   KSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCD  584
              + ACVSN+ V +V ++NTL G RIKTWQGG GSV+N+ FS IQVSDVK PIMIDQ+YCD
Sbjct  246   NTKACVSNVTVRDVTLQNTLTGVRIKTWQGGSGSVQNIMFSNIQVSDVKTPIMIDQFYCD  305

Query  583   KHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFR  404
                C+N T AVA+  + +  + GT+  +P + ACS+S+PC  + L  I+LE S      +
Sbjct  306   GGKCRNVTSAVAVSSIHYTNVHGTYTKEPIYFACSDSLPCKGITLDTIKLESS------Q  359

Query  403   NGQ---CWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHENIC  278
             N     CW +YG+ + ++ P  +D CL+ G+     I  + E+ C
Sbjct  360   NSNVPFCWKAYGELKTEIVPP-VD-CLQRGNPSSGGITSNKESSC  402



>ref|XP_006602385.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Glycine 
max]
Length=494

 Score =   328 bits (841),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 188/420 (45%), Positives = 252/420 (60%), Gaps = 68/420 (16%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPD  1301
             ++ F++L FGAKGDG SDD+K                                       
Sbjct  119   ATTFNVLDFGAKGDGKSDDTK---------------------------------------  139

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
                 +DG +VAP +  +W K  + QW+ F  +   TIQG G  DG+G  WW+ +Q     
Sbjct  140   ----LDGTIVAPTSPKAWGKG-LLQWLEFSKLVGITIQGNGIIDGRGSVWWQDNQYDDPI  194

Query  1120  EKKASKTIHVN----------------------MKPTALRFYESTNVTIHGISIVNSPQC  1007
             + +    + +N                      +KPTALRFY S N T+ GI+I NSPQC
Sbjct  195   DDEEKLIVPLNHTVGSPSPPLPIQSEMGGKMPSVKPTALRFYGSFNPTVTGITIQNSPQC  254

Query  1006  HLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNV  827
             HLKFDN  GV VH++TIS+P +SPNTDGIHLQNS+DV I+ S++  GDDC+SIQTGCSN+
Sbjct  255   HLKFDNCNGVMVHDVTISSPGDSPNTDGIHLQNSKDVLIYSSSMACGDDCISIQTGCSNI  314

Query  826   HVHHINCgpghgislgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVS  647
             +VH++NCGPGHGIS+G LGKD + ACVSNI V +V M NT+ G RIKTWQGG GSV+ V 
Sbjct  315   YVHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNMHNTMNGVRIKTWQGGSGSVQGVL  374

Query  646   FSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQPFHLACSNSVP  467
             FS IQVS+V++PI+IDQ+YCDK  CKNQT AV++ G+ + +I GT+  +P H ACS+++P
Sbjct  375   FSNIQVSEVELPIVIDQFYCDKRTCKNQTSAVSLAGINYERIRGTYTVKPVHFACSDNLP  434

Query  466   CTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSGSLLVKRIARSHE  287
             C DV L  ++L+P        N  CW +YG+ +    P  +D CL+ G     RI   H+
Sbjct  435   CVDVSLTSVELKPIQEQYHLYNPFCWQTYGELKTPTVPP-ID-CLQIGKPTNNRIQTDHD  492



>ref|XP_010544140.1| PREDICTED: polygalacturonase At1g48100 [Tarenaya hassleriana]
Length=457

 Score =   327 bits (837),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 242/387 (63%), Gaps = 13/387 (3%)
 Frame = -3

Query  1471  FDILSFGAKGDGVSDDSKALEAAWGAACKVSG---ATVQIPSQFSFLINPITLQGPCMPD  1301
             FD+ SFGA GD V+DD+ A + AW +AC+ S    + V +P  F FL+NP    GPC   
Sbjct  61    FDVTSFGAVGDCVADDTSAFKMAWDSACERSSPELSVVLVPYSFCFLVNPAIFNGPCNSQ  120

Query  1300  LVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             LVLQ+DG +V P    SWP ++  QW+ F  VH  ++QG G  +G+G  WW L       
Sbjct  121   LVLQIDGIIVPPEGPESWPWNNKRQWLMFYRVHGLSLQGSGVINGRGQKWWDLP---CKP  177

Query  1120  EKKASKTIHVNM--KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAP  947
              K  + TI       P A+RF++S+N+TI G+S  +SPQ H++FDN   V V ++ I AP
Sbjct  178   HKGINGTIQTGSCDSPVAVRFFQSSNLTIRGLSFKDSPQFHVRFDNCSDVLVDSVAIKAP  237

Query  946   ENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGK  767
              +SPNTDGIH++N+ +V+IH+S I SGDDC+SI   C NV + +I CGP HGIS+G LG 
Sbjct  238   ASSPNTDGIHIENTNNVQIHNSVISSGDDCISIGARCFNVDIQNITCGPSHGISIGSLGV  297

Query  766   DKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYC  587
               S ACVSNI V N  + ++  G RIKTWQGG G+V  + FS I + +V+ PI+IDQYYC
Sbjct  298   HNSRACVSNITVTNSTIRDSDNGVRIKTWQGGSGTVSRIVFSNILMDNVRNPIIIDQYYC  357

Query  586   DKHACKNQTGAVAIQGVKFGQIVGTFAAQ--PFHLACSNSVPCTDVHLADIQLEPSPGYR  413
                 C NQT AV +  V +  I GT+  +  P H ACS+SVPCTD+ LAD++L PS G +
Sbjct  358   QTKNCTNQTSAVLVSDVLYAHIKGTYNLKSPPMHFACSDSVPCTDLKLADVELFPSKG-Q  416

Query  412   GFRNGQCWNSYGKSQGQLFPASMDYCL  332
                N  CWN+YG  Q    P    YCL
Sbjct  417   ILANPFCWNAYGSVQTLTIPPV--YCL  441



>gb|AAK63956.1| At1g10640/F20B24_8 [Arabidopsis thaliana]
 gb|AAN28898.1| At1g10640/F20B24_8 [Arabidopsis thaliana]
Length=380

 Score =   324 bits (830),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/381 (45%), Positives = 243/381 (64%), Gaps = 27/381 (7%)
 Frame = -3

Query  1363  IPSQFSFLINPITLQGP-CMPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQ  1187
             +P ++++L+ PI+  GP C  ++V Q+DG ++AP +  +W K  +  WI+F  +    +Q
Sbjct  3     VPPEYTYLVGPISFSGPYCQANIVFQLDGTIIAPTDSKTWGKG-LMWWIDFTKLKGIKVQ  61

Query  1186  GPGTFDGQGPNWWKLSQIHSLQEKKASKTIHVN---------------------MKPTAL  1070
             G G  DG+G  WW+  Q     +      + +N                     +KPTAL
Sbjct  62    GKGVIDGRGSGWWQ--QDSPFIDSDTKLIVPLNNSANQNPPMPIRSELDERMPSIKPTAL  119

Query  1069  RFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISAPENSPNTDGIHLQNSQDVEI  890
             RF  S  V + GI+I NSPQCHLKFD+  GV VH+I +S+P +SPNTDGIHLQN++DV I
Sbjct  120   RFSGSFGVEVTGITIQNSPQCHLKFDDCVGVVVHDIAVSSPGDSPNTDGIHLQNTKDVLI  179

Query  889   HHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislgglGKDKSVACVSNILVENVVMEN  710
             H +T+  GDDC+SIQTGCSNV VH++NCGPGHGIS+G LGK+ + ACVSNI V +V M N
Sbjct  180   HSTTLACGDDCISIQTGCSNVFVHNVNCGPGHGISIGSLGKEGTKACVSNITVRDVAMHN  239

Query  709   TLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMIDQYYCDKHACKNQTGAVAIQGVKF  530
             T+ G RIKTWQGGVGSVK + FS IQ++ V++PI I+Q+YCD   CKNQT AVA++GV +
Sbjct  240   TMTGVRIKTWQGGVGSVKGIIFSNIQLNQVQIPITINQFYCDHSKCKNQTSAVAVEGVTY  299

Query  529   GQIVGTFAAQPFHLACSNSVPCTDVHLADIQLEPSPGYRGFRNGQCWNSYGKSQGQLFPA  350
              +I GT+  +P H ACS++ PC DV L+ I+L+P        +  CW ++G+      P 
Sbjct  300   ERIKGTYTVKPVHFACSDNFPCVDVQLSSIELKPVQEKYRMYDAYCWQTFGELNTPTLPP  359

Query  349   SMDYCLRSGSLLVKRIARSHE  287
              +D CL+ G     ++   H+
Sbjct  360   -ID-CLKIGKPPRNKVQSDHD  378



>gb|KCW59788.1| hypothetical protein EUGRSUZ_H025371, partial [Eucalyptus grandis]
Length=239

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -3

Query  1489  PPPSSVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPC  1310
             P  SS+F++LSFGAKGDGVSDDSKA  AAW AAC+V  AT+ IP    FL+ PI+ +GPC
Sbjct  9     PAESSMFNVLSFGAKGDGVSDDSKAFSAAWKAACQVPSATLVIPQGLKFLVKPISFKGPC  68

Query  1309  MPDLVLQVDGNVVAPLNVGSWPKSSIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
             MP+LVLQ+DG V AP  VGSW KSS+FQW+NFKWV +FT+QG GT DGQG  WW LSQ+ 
Sbjct  69    MPNLVLQIDGIVQAPPKVGSWKKSSLFQWLNFKWVQNFTVQGTGTVDGQGSEWWSLSQM-  127

Query  1129  SLQEKKASKTIHVNMKPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNITISA  950
              L     SK + + MKPTALRFY S NV++ GISIVNSP CHLKFDNS+G+ + NI IS+
Sbjct  128   -LPYNSTSKHV-LGMKPTALRFYSSCNVSVRGISIVNSPLCHLKFDNSRGIKISNIAISS  185

Query  949   PENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINC  806
             P++SPNTDGIHLQNSQ VEI HS IG GDDC+S+QTGCS+V++HHINC
Sbjct  186   PKDSPNTDGIHLQNSQHVEIEHSNIGCGDDCISVQTGCSDVYIHHINC  233



>ref|XP_009363098.1| PREDICTED: polygalacturonase At1g48100-like [Pyrus x bretschneideri]
Length=467

 Score =   326 bits (836),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 184/409 (45%), Positives = 257/409 (63%), Gaps = 24/409 (6%)
 Frame = -3

Query  1480  SSVFDILSFGAKGDGVSDDSKALEAAWGAACKV--SGATVQIPSQFSFLINPITLQGPCM  1307
             S +FD+ SFGA GDG +DD+ A + AW  AC+   S A + +P  FSF+I      GPC+
Sbjct  68    SGIFDVRSFGAVGDGQTDDTTAFKMAWDTACQSDESAARILVPQGFSFMIQSTIFTGPCL  127

Query  1306  PDLVLQVDGNVVAPLNVGSWPKS-SIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIH  1130
               LVLQVDG +V P   GSWPK  S  QW+ F  ++  ++QG G  DG+G  WW L    
Sbjct  128   GGLVLQVDGALVPPDGPGSWPKHISRHQWLVFYRINEMSLQGGGVIDGKGEKWWNL----  183

Query  1129  SLQEKKASKTIHVNM------KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVH  968
                  K  + I+          P A+RF+ S+N+T+ G+ I NSPQ H +FD+ + V++ 
Sbjct  184   ---PCKPHRGINGTTLPGPCDSPIAIRFFMSSNLTVQGLRIKNSPQFHFRFDSCRNVHIE  240

Query  967   NITISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgi  788
             +I+IS+P  SPNTDGIH++ + DV+I++S I +GDDCVSI +GC +V++ ++ CGPGHGI
Sbjct  241   SISISSPAKSPNTDGIHIEKTYDVQIYNSVISNGDDCVSIGSGCYDVNIRNLTCGPGHGI  300

Query  787   slgglGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPI  608
             S+G LG   S ACVSNI V + +M+ T  G RIKTWQGG GSV  V+FS I + +V+ PI
Sbjct  301   SIGSLGNHNSRACVSNITVRDSIMKGTDNGVRIKTWQGGSGSVSGVTFSNIHMDNVRNPI  360

Query  607   MIDQYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQ--PFHLACSNSVPCTDVHLADIQL  434
             MIDQYYC    C NQT AV +  + +  I GT+  +  P H ACS+++PCT++ L++++L
Sbjct  361   MIDQYYCLTKRCTNQTSAVFVSDILYSNIKGTYDVRSSPMHFACSDALPCTNLTLSEVEL  420

Query  433   EPSPGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG---SLLVKRIAR  296
              P+ GY+   +  CWN+YG+ Q    P     CL  G   SLL   I R
Sbjct  421   LPAVGYK-VSDPYCWNAYGELQTPTIPPVS--CLLDGVPRSLLGHEIER  466



>ref|XP_010276514.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Nelumbo 
nucifera]
Length=455

 Score =   325 bits (833),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 179/394 (45%), Positives = 248/394 (63%), Gaps = 19/394 (5%)
 Frame = -3

Query  1477  SVFDILSFGAKGDGVSDDSKALEAAWGAACKVSGATVQIPSQFSFLINPITLQGPCMPDL  1298
             +VFD+LSFGA GDGV+DD+ A + AW AAC+   AT+ +P+ +SF+I      GPC    
Sbjct  59    AVFDVLSFGAIGDGVTDDTPAFKMAWDAACQAESATLLVPNGYSFMIQSTIFTGPCENGF  118

Query  1297  VLQVDGNVVAPLNVGSWPKS-SIFQWINFKWVHSFTIQGPGTFDGQGPNWWKLSQIHSLQ  1121
             V Q++G ++ P    +WPK+ S  QW+ F  ++  T+QG G  DG+G  WW L       
Sbjct  119   VFQIEGTLMPPDGPDAWPKNNSRRQWLVFYRINGLTMQGGGLIDGRGEKWWNL-------  171

Query  1120  EKKASKTIHVNM------KPTALRFYESTNVTIHGISIVNSPQCHLKFDNSKGVNVHNIT  959
               K  K ++          P ALRF+ S+N+TI G++I NSPQ H +FDN + V V  IT
Sbjct  172   PCKPHKGVNGTTLPGPCDSPVALRFFLSSNLTIQGLAIRNSPQFHFRFDNCRNVYVDTIT  231

Query  958   ISAPENSPNTDGIHLQNSQDVEIHHSTIGSGDDCVSIQTGCSNVHVHHINCgpghgislg  779
             I AP  SPNTDGIH++N+  V I++S I +GDDC+SI +GC +V +++I CGP HGIS+G
Sbjct  232   IRAPSLSPNTDGIHIENTDSVRIYNSLISNGDDCISIGSGCYDVDINNITCGPSHGISIG  291

Query  778   glGKDKSVACVSNILVENVVMENTLYGARIKTWQGGVGSVKNVSFSGIQVSDVKVPIMID  599
              LG   S ACVSNI + N V++++  G RIKTWQGG GSV  V FS I +  V+ PI+ID
Sbjct  292   SLGNRNSRACVSNITLSNSVIKHSDNGVRIKTWQGGSGSVSGVKFSNIHMDAVRNPIIID  351

Query  598   QYYCDKHACKNQTGAVAIQGVKFGQIVGTFAAQ--PFHLACSNSVPCTDVHLADIQLEPS  425
             Q+YC   AC NQT AV +  + +  I GT+  +  P H ACS+SVPCT++ L+D++L P+
Sbjct  352   QFYCLSRACANQTSAVYVSDISYTNIKGTYDVRSPPMHFACSDSVPCTNLTLSDVELLPA  411

Query  424   PGYRGFRNGQCWNSYGKSQGQLFPASMDYCLRSG  323
              G     +  CWN+YG S+    P    +CL  G
Sbjct  412   QG-EIVLDPFCWNAYGASETLTIPPV--FCLLDG  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5074203830354