BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6844_g1_i1 len=925 path=[903:0-924]

Length=925
                                                                      Score     E

ref|XP_006339139.1|  PREDICTED: casparian strip membrane protein ...    196   1e-57   
ref|XP_004249431.1|  PREDICTED: casparian strip membrane protein 1      196   1e-57   
ref|XP_009767267.1|  PREDICTED: casparian strip membrane protein 1      195   2e-57   
ref|XP_009601005.1|  PREDICTED: casparian strip membrane protein 1      193   2e-56   
sp|Q1W3A5.1|CASP1_STRAF  RecName: Full=Casparian strip membrane p...    185   1e-53   Striga asiatica [witchweed]
ref|XP_006341077.1|  PREDICTED: casparian strip membrane protein ...    184   4e-53   
ref|XP_004246481.1|  PREDICTED: casparian strip membrane protein ...    182   2e-52   
sp|P0DI63.1|CASP1_STRHE  RecName: Full=Casparian strip membrane p...    179   2e-51   
sp|P0DI31.1|CASP1_TRIPD  RecName: Full=Casparian strip membrane p...    179   2e-51   
ref|XP_009591857.1|  PREDICTED: casparian strip membrane protein ...    178   1e-50   
ref|XP_011077838.1|  PREDICTED: casparian strip membrane protein 1      167   9e-47   
emb|CDP10637.1|  unnamed protein product                                167   1e-46   
ref|XP_009801668.1|  PREDICTED: casparian strip membrane protein ...    167   2e-46   
ref|XP_002530531.1|  conserved hypothetical protein                     165   7e-46   Ricinus communis
sp|P0DI52.1|CASP1_ERYGU  RecName: Full=Casparian strip membrane p...    165   8e-46   
gb|KDP36189.1|  hypothetical protein JCGZ_08833                         164   1e-45   
ref|XP_006299322.1|  hypothetical protein CARUB_v10015479mg             163   5e-45   
ref|XP_011004682.1|  PREDICTED: casparian strip membrane protein 2      162   1e-44   
ref|XP_011004684.1|  PREDICTED: casparian strip membrane protein ...    162   1e-44   
ref|XP_006289845.1|  hypothetical protein CARUB_v10003455mg             161   2e-44   
gb|KFK38524.1|  hypothetical protein AALP_AA3G125100                    161   3e-44   
gb|KEH41982.1|  casparian strip membrane protein                        160   3e-44   
emb|CDY62471.1|  BnaC01g44860D                                          159   1e-43   
ref|XP_011094537.1|  PREDICTED: casparian strip membrane protein ...    159   2e-43   
ref|XP_004303525.1|  PREDICTED: casparian strip membrane protein ...    158   3e-43   
ref|XP_004516298.1|  PREDICTED: casparian strip membrane protein ...    158   3e-43   
sp|P0DI62.1|CASP1_CYNCS  RecName: Full=Casparian strip membrane p...    158   4e-43   
emb|CDX73869.1|  BnaA03g31780D                                          158   4e-43   
ref|XP_002871203.1|  predicted protein                                  157   1e-42   
ref|XP_010497100.1|  PREDICTED: casparian strip membrane protein ...    157   1e-42   
ref|XP_010486824.1|  PREDICTED: casparian strip membrane protein 2      157   1e-42   
ref|XP_002530532.1|  nitrate, fromate, iron dehydrogenase, putative     156   2e-42   Ricinus communis
ref|XP_010464871.1|  PREDICTED: casparian strip membrane protein ...    156   2e-42   
ref|NP_196238.1|  uncharacterized protein                               156   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882736.1|  integral membrane family protein                   156   2e-42   
ref|XP_009124886.1|  PREDICTED: casparian strip membrane protein ...    156   2e-42   
ref|XP_009135174.1|  PREDICTED: casparian strip membrane protein ...    156   3e-42   
gb|EYU35527.1|  hypothetical protein MIMGU_mgv1a014031mg                156   3e-42   
gb|AEJ82297.1|  casparian strip protein 4                               156   3e-42   
ref|XP_010423379.1|  PREDICTED: casparian strip membrane protein 4      155   4e-42   
sp|P0DI32.1|CASP1_TARKO  RecName: Full=Casparian strip membrane p...    155   6e-42   
ref|NP_187762.1|  uncharacterized protein                               155   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007027844.1|  Casparian strip membrane protein RCOM_1259260      154   8e-42   
sp|P0DI43.1|CASP1_THECC  RecName: Full=Casparian strip membrane p...    154   9e-42   
gb|AEJ82299.1|  casparian strip protein 2                               155   9e-42   
ref|XP_008462597.1|  PREDICTED: casparian strip membrane protein 1      154   2e-41   
ref|XP_010452535.1|  PREDICTED: casparian strip membrane protein ...    153   3e-41   
gb|KFK25022.1|  hypothetical protein AALP_AA8G056700                    153   4e-41   
ref|XP_003519133.1|  PREDICTED: casparian strip membrane protein ...    152   4e-41   
ref|NP_001237259.1|  casparian strip membrane protein 3                 152   6e-41   
ref|XP_010491169.1|  PREDICTED: casparian strip membrane protein ...    152   6e-41   
ref|XP_007144399.1|  hypothetical protein PHAVU_007G153000g             152   7e-41   
sp|P0DI51.1|CASP2_ERYGU  RecName: Full=Casparian strip membrane p...    152   1e-40   
gb|KHN02602.1|  Casparian strip membrane protein 4                      151   2e-40   
ref|XP_004143331.1|  PREDICTED: casparian strip membrane protein ...    151   2e-40   
sp|P0DI39.1|CASP2_VIGUN  RecName: Full=Casparian strip membrane p...    150   2e-40   
ref|XP_004168080.1|  PREDICTED: casparian strip membrane protein ...    152   2e-40   
ref|XP_007144398.1|  hypothetical protein PHAVU_007G152900g             150   3e-40   
ref|XP_004516297.1|  PREDICTED: casparian strip membrane protein ...    150   3e-40   
ref|NP_001237549.1|  casparian strip membrane protein 1                 150   4e-40   
ref|XP_009372531.1|  PREDICTED: casparian strip membrane protein ...    150   5e-40   
ref|XP_008391938.1|  PREDICTED: casparian strip membrane protein ...    150   5e-40   
ref|XP_009349510.1|  PREDICTED: casparian strip membrane protein ...    150   6e-40   
ref|XP_009373039.1|  PREDICTED: casparian strip membrane protein ...    149   1e-39   
ref|XP_003519136.1|  PREDICTED: casparian strip membrane protein ...    149   1e-39   
ref|XP_008359498.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...    149   2e-39   
gb|KEH41980.1|  casparian strip membrane protein                        148   2e-39   
emb|CDX84579.1|  BnaA03g16510D                                          148   3e-39   
gb|KHN02600.1|  Casparian strip membrane protein 1                      147   3e-39   
sp|P0DI40.1|CASP1_VIGUN  RecName: Full=Casparian strip membrane p...    147   3e-39   
ref|XP_004300108.1|  PREDICTED: casparian strip membrane protein ...    148   5e-39   
emb|CDX79653.1|  BnaC03g19890D                                          147   5e-39   
ref|XP_007015764.1|  Casparian strip membrane protein 3, putative       147   7e-39   
gb|KFK36497.1|  hypothetical protein AALP_AA4G132200                    147   9e-39   
ref|XP_009133064.1|  PREDICTED: casparian strip membrane protein 1      146   2e-38   
ref|NP_001242417.1|  casparian strip membrane protein 2                 145   2e-38   
gb|KDP39843.1|  hypothetical protein JCGZ_04188                         145   4e-38   
gb|KEH41983.1|  casparian strip membrane protein                        144   4e-38   
ref|XP_004149191.1|  PREDICTED: casparian strip membrane protein ...    144   5e-38   
ref|XP_006481869.1|  PREDICTED: casparian strip membrane protein ...    144   5e-38   
emb|CDY01034.1|  BnaC05g41660D                                          144   5e-38   
emb|CDX75071.1|  BnaA05g08170D                                          144   7e-38   
emb|CDX84159.1|  BnaC04g09210D                                          144   9e-38   
sp|P0DI45.1|CASP1_RAPSA  RecName: Full=Casparian strip membrane p...    144   9e-38   
sp|P0DI47.1|CASP3_RAPSA  RecName: Full=Casparian strip membrane p...    144   1e-37   
ref|XP_004515966.1|  PREDICTED: casparian strip membrane protein ...    143   1e-37   
sp|P0DI57.1|CASP5_LOTJA  RecName: Full=Casparian strip membrane p...    143   2e-37   
ref|XP_006407435.1|  hypothetical protein EUTSA_v10021542mg             143   2e-37   
ref|XP_010509510.1|  PREDICTED: casparian strip membrane protein ...    143   2e-37   
ref|XP_010245909.1|  PREDICTED: casparian strip membrane protein ...    144   2e-37   
ref|XP_008387040.1|  PREDICTED: casparian strip membrane protein ...    143   2e-37   
ref|XP_010093771.1|  hypothetical protein L484_019174                   142   2e-37   
ref|XP_006430137.1|  hypothetical protein CICLE_v10013511mg             142   3e-37   
ref|XP_009146708.1|  PREDICTED: casparian strip membrane protein 2      142   3e-37   
ref|NP_181154.1|  casparian strip membrane protein 1                    142   4e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08514.1|  BnaA05g27500D                                          142   4e-37   
gb|AEJ82293.1|  casparian strip protein 1                               142   4e-37   
sp|P0DI46.1|CASP2_RAPSA  RecName: Full=Casparian strip membrane p...    142   4e-37   
ref|XP_002309415.1|  integral membrane family protein                   142   5e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004292551.1|  PREDICTED: casparian strip membrane protein ...    142   7e-37   
ref|XP_009372532.1|  PREDICTED: casparian strip membrane protein ...    141   8e-37   
ref|XP_011004683.1|  PREDICTED: casparian strip membrane protein 3      141   9e-37   
gb|AFK35638.1|  unknown                                                 140   1e-36   
ref|XP_006361147.1|  PREDICTED: casparian strip membrane protein ...    141   2e-36   
ref|XP_009789373.1|  PREDICTED: casparian strip membrane protein ...    140   2e-36   
ref|XP_009143616.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...    140   4e-36   
ref|XP_009609007.1|  PREDICTED: casparian strip membrane protein ...    140   4e-36   
gb|KHN23088.1|  Casparian strip membrane protein 3                      139   6e-36   
sp|P0DI55.1|CASP4_LOTJA  RecName: Full=Casparian strip membrane p...    139   6e-36   
ref|XP_002323410.1|  integral membrane family protein                   139   9e-36   Populus trichocarpa [western balsam poplar]
sp|P0DI49.1|CASP1_RAPRA  RecName: Full=Casparian strip membrane p...    138   1e-35   
ref|XP_002523839.1|  conserved hypothetical protein                     139   1e-35   Ricinus communis
ref|XP_007203160.1|  hypothetical protein PRUPE_ppa024449mg             138   2e-35   
ref|XP_006410783.1|  hypothetical protein EUTSA_v10017240mg             138   2e-35   
ref|XP_010534404.1|  PREDICTED: casparian strip membrane protein 2      137   2e-35   
ref|XP_006424191.1|  hypothetical protein CICLE_v10030236mg             138   2e-35   
ref|XP_008442871.1|  PREDICTED: casparian strip membrane protein ...    137   3e-35   
ref|XP_006487914.1|  PREDICTED: casparian strip membrane protein ...    137   3e-35   
emb|CDX84158.1|  BnaC04g09200D                                          137   3e-35   
sp|B9HQ42.2|CASP4_POPTR  RecName: Full=Casparian strip membrane p...    138   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006410782.1|  hypothetical protein EUTSA_v10017241mg             137   3e-35   
emb|CDX75070.1|  BnaA05g08160D                                          137   4e-35   
ref|XP_003535799.1|  PREDICTED: casparian strip membrane protein 3      137   4e-35   
ref|XP_004242111.1|  PREDICTED: casparian strip membrane protein ...    137   5e-35   
ref|XP_002323409.1|  hypothetical protein POPTR_0016s07610g             136   6e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011004187.1|  PREDICTED: casparian strip membrane protein 1      136   9e-35   
ref|XP_011043429.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...    136   1e-34   
gb|ACU14340.1|  unknown                                                 135   1e-34   Glycine max [soybeans]
ref|XP_006295518.1|  hypothetical protein CARUB_v10024622mg             135   1e-34   
gb|KFK28903.1|  hypothetical protein AALP_AA7G063100                    136   1e-34   
ref|XP_010104281.1|  hypothetical protein L484_005384                   135   1e-34   
ref|XP_011043416.1|  PREDICTED: casparian strip membrane protein ...    135   2e-34   
ref|NP_001236338.1|  casparian strip membrane protein 5                 135   2e-34   
ref|XP_003535780.1|  PREDICTED: casparian strip membrane protein ...    135   2e-34   
ref|XP_009360780.1|  PREDICTED: casparian strip membrane protein ...    135   3e-34   
ref|XP_011046927.1|  PREDICTED: casparian strip membrane protein ...    135   3e-34   
ref|XP_002880911.1|  integral membrane family protein                   135   3e-34   
ref|XP_006408711.1|  hypothetical protein EUTSA_v10002094mg             135   4e-34   
ref|XP_006399087.1|  hypothetical protein EUTSA_v10015967mg             134   4e-34   
ref|XP_010557426.1|  PREDICTED: casparian strip membrane protein 3      135   4e-34   
sp|P0DI60.1|CASP1_HELAN  RecName: Full=Casparian strip membrane p...    134   4e-34   
ref|XP_008237717.1|  PREDICTED: casparian strip membrane protein ...    134   5e-34   
ref|XP_010037287.1|  PREDICTED: casparian strip membrane protein ...    134   6e-34   
ref|XP_007201619.1|  hypothetical protein PRUPE_ppa019901mg             134   7e-34   
sp|P0DI48.1|CASP4_RAPSA  RecName: Full=Casparian strip membrane p...    134   8e-34   
ref|XP_002881427.1|  hypothetical protein ARALYDRAFT_482586             133   9e-34   
ref|XP_002313609.1|  hypothetical protein POPTR_0009s16160g             133   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010271592.1|  PREDICTED: casparian strip membrane protein ...    134   1e-33   
ref|NP_180305.1|  uncharacterized protein                               134   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001242085.1|  casparian strip membrane protein 4                 133   1e-33   
gb|AEJ82303.1|  casparian strip protein 3                               134   1e-33   
ref|XP_008361038.1|  PREDICTED: casparian strip membrane protein ...    133   2e-33   
ref|XP_010683665.1|  PREDICTED: casparian strip membrane protein 2      133   2e-33   
ref|XP_010672773.1|  PREDICTED: casparian strip membrane protein ...    132   2e-33   
gb|KHN36486.1|  Casparian strip membrane protein 5                      133   2e-33   
ref|XP_010417897.1|  PREDICTED: casparian strip membrane protein 3      133   2e-33   
ref|XP_006295716.1|  hypothetical protein CARUB_v10024835mg             133   2e-33   
gb|ACU20464.1|  unknown                                                 132   3e-33   Glycine max [soybeans]
ref|XP_003596846.1|  hypothetical protein MTR_2g086740                  132   3e-33   
ref|XP_009377816.1|  PREDICTED: casparian strip membrane protein ...    132   4e-33   
ref|XP_010505142.1|  PREDICTED: casparian strip membrane protein 1      132   4e-33   
emb|CDX77114.1|  BnaC04g39090D                                          132   5e-33   
ref|XP_009140798.1|  PREDICTED: casparian strip membrane protein ...    132   5e-33   
ref|XP_008243654.1|  PREDICTED: casparian strip membrane protein ...    131   5e-33   
ref|XP_009141561.1|  PREDICTED: casparian strip membrane protein ...    131   6e-33   
ref|XP_010473135.1|  PREDICTED: casparian strip membrane protein ...    132   6e-33   
ref|XP_010510780.1|  PREDICTED: casparian strip membrane protein ...    131   1e-32   
ref|XP_011089204.1|  PREDICTED: LOW QUALITY PROTEIN: casparian st...    130   1e-32   
emb|CDY43748.1|  BnaAnng07630D                                          130   2e-32   
sp|P0DI56.1|CASP3_LOTJA  RecName: Full=Casparian strip membrane p...    130   2e-32   
ref|XP_010102014.1|  hypothetical protein L484_016304                   130   3e-32   
ref|XP_011016793.1|  PREDICTED: casparian strip membrane protein ...    128   4e-32   
ref|XP_009133899.1|  PREDICTED: casparian strip membrane protein ...    129   4e-32   
emb|CDY31172.1|  BnaC03g47190D                                          129   4e-32   
ref|XP_008229074.1|  PREDICTED: casparian strip membrane protein ...    129   4e-32   
ref|XP_010516820.1|  PREDICTED: casparian strip membrane protein ...    129   5e-32   
ref|XP_010534401.1|  PREDICTED: casparian strip membrane protein ...    129   5e-32   
emb|CDP06886.1|  unnamed protein product                                128   1e-31   
ref|XP_007150053.1|  hypothetical protein PHAVU_005G122200g             127   3e-31   
ref|XP_004487484.1|  PREDICTED: casparian strip membrane protein ...    126   9e-31   
ref|XP_010258295.1|  PREDICTED: casparian strip membrane protein 3      125   1e-30   
ref|XP_010059483.1|  PREDICTED: casparian strip membrane protein ...    125   1e-30   
ref|XP_002436759.1|  hypothetical protein SORBIDRAFT_10g008220          124   1e-30   Sorghum bicolor [broomcorn]
ref|XP_007206803.1|  hypothetical protein PRUPE_ppa025691mg             125   1e-30   
ref|XP_002276085.1|  PREDICTED: casparian strip membrane protein 1      124   3e-30   Vitis vinifera
ref|XP_010046723.1|  PREDICTED: casparian strip membrane protein ...    124   4e-30   
sp|P0DI41.1|CASP3_VIGUN  RecName: Full=Casparian strip membrane p...    124   4e-30   
gb|KCW87345.1|  hypothetical protein EUGRSUZ_B03828                     123   5e-30   
ref|XP_004955209.1|  PREDICTED: casparian strip membrane protein ...    123   6e-30   
ref|XP_002278569.1|  PREDICTED: casparian strip membrane protein 3      122   7e-30   Vitis vinifera
ref|XP_004293125.1|  PREDICTED: casparian strip membrane protein ...    122   1e-29   
ref|XP_010520695.1|  PREDICTED: casparian strip membrane protein ...    121   2e-29   
ref|XP_002533115.1|  conserved hypothetical protein                     120   4e-29   Ricinus communis
gb|AFW85233.1|  membrane protein 2                                      120   7e-29   
gb|KDP36190.1|  hypothetical protein JCGZ_08834                         120   1e-28   
ref|XP_010029309.1|  PREDICTED: casparian strip membrane protein 1      119   1e-28   
ref|XP_002273638.1|  PREDICTED: casparian strip membrane protein 2      120   1e-28   Vitis vinifera
ref|XP_006827304.1|  hypothetical protein AMTR_s00010p00265970          119   1e-28   
ref|XP_007032593.1|  Casparian strip membrane protein 5, putative       119   2e-28   
ref|XP_004141446.1|  PREDICTED: casparian strip membrane protein ...    117   8e-28   
ref|XP_004965049.1|  PREDICTED: casparian strip membrane protein ...    117   9e-28   
gb|AFK48530.1|  unknown                                                 115   1e-27   
ref|XP_008459331.1|  PREDICTED: CASP-like protein 1                     117   1e-27   
emb|CDP00357.1|  unnamed protein product                                116   2e-27   
ref|NP_001148957.1|  casparian strip membrane protein 1                 116   2e-27   Zea mays [maize]
ref|XP_002318369.1|  integral membrane family protein                   116   2e-27   Populus trichocarpa [western balsam poplar]
gb|EYU26727.1|  hypothetical protein MIMGU_mgv1a013858mg                117   2e-27   
ref|NP_001174676.1|  Os06g0231050                                       116   2e-27   
sp|P0DI53.1|CASP3_ERYGU  RecName: Full=Casparian strip membrane p...    116   2e-27   
ref|XP_010088133.1|  hypothetical protein L484_013577                   116   2e-27   
sp|P0DI33.1|CASP1_PANVG  RecName: Full=Casparian strip membrane p...    115   2e-27   
sp|P0DI30.1|CASP2_TRIPD  RecName: Full=Casparian strip membrane p...    116   3e-27   
ref|XP_009411946.1|  PREDICTED: casparian strip membrane protein ...    116   3e-27   
ref|XP_010683143.1|  PREDICTED: casparian strip membrane protein 3      115   4e-27   
ref|XP_011001927.1|  PREDICTED: casparian strip membrane protein 6      114   6e-27   
ref|XP_008379370.1|  PREDICTED: CASP-like protein 1                     113   2e-26   
ref|XP_009376287.1|  PREDICTED: CASP-like protein 1                     113   2e-26   
ref|XP_003555157.1|  PREDICTED: casparian strip membrane protein ...    114   2e-26   
ref|XP_009393394.1|  PREDICTED: casparian strip membrane protein ...    114   2e-26   
ref|XP_006655941.1|  PREDICTED: casparian strip membrane protein ...    113   2e-26   
ref|XP_009789554.1|  PREDICTED: casparian strip membrane protein ...    112   4e-26   
sp|Q6Z2U5.2|CASP4_ORYSJ  RecName: Full=Casparian strip membrane p...    113   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009610092.1|  PREDICTED: casparian strip membrane protein 1      112   4e-26   
ref|XP_004304287.1|  PREDICTED: CASP-like protein 1-like                112   4e-26   
ref|XP_008230985.1|  PREDICTED: CASP-like protein 1                     112   5e-26   
ref|XP_009360608.1|  PREDICTED: CASP-like protein 1                     112   6e-26   
ref|XP_004490091.1|  PREDICTED: CASP-like protein MTR_5g041900-like     111   8e-26   
ref|XP_006344265.1|  PREDICTED: CASP-like protein SDM1_58t00016-like    111   1e-25   
ref|XP_004237043.1|  PREDICTED: casparian strip membrane protein ...    111   1e-25   
gb|KHN12189.1|  CASP-like protein 1                                     111   1e-25   
emb|CDY00740.1|  BnaC03g37240D                                          110   1e-25   
ref|XP_006665081.1|  PREDICTED: casparian strip membrane protein ...    110   2e-25   
gb|EYU34055.1|  hypothetical protein MIMGU_mgv1a020210mg                110   2e-25   
ref|XP_010554941.1|  PREDICTED: casparian strip membrane protein ...    111   2e-25   
sp|P0DI54.1|CASP1_MALDO  RecName: Full=Casparian strip membrane p...    110   2e-25   
ref|XP_003564046.1|  PREDICTED: casparian strip membrane protein 3      110   3e-25   
ref|XP_010265175.1|  PREDICTED: casparian strip membrane protein ...    110   4e-25   
ref|XP_010066899.1|  PREDICTED: casparian strip membrane protein ...    109   4e-25   
ref|XP_008669320.1|  PREDICTED: casparian strip membrane protein ...    109   5e-25   
gb|KDP27167.1|  hypothetical protein JCGZ_19866                         109   6e-25   
ref|XP_008663281.1|  PREDICTED: casparian strip membrane protein 2      109   6e-25   
sp|P0DI42.1|CASP2_WHEAT  RecName: Full=Casparian strip membrane p...    109   6e-25   
ref|XP_010042237.1|  PREDICTED: casparian strip membrane protein ...    109   7e-25   
gb|KDO72617.1|  hypothetical protein CISIN_1g045471mg                   109   7e-25   
ref|XP_011098775.1|  PREDICTED: casparian strip membrane protein ...    108   8e-25   
ref|NP_001236648.1|  CASP-like protein 7                                108   9e-25   
ref|XP_009602468.1|  PREDICTED: casparian strip membrane protein ...    108   9e-25   
ref|XP_009763947.1|  PREDICTED: casparian strip membrane protein 1      108   1e-24   
ref|XP_006482625.1|  PREDICTED: casparian strip membrane protein ...    108   2e-24   
ref|NP_001052990.2|  Os04g0460400                                       107   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006851480.1|  hypothetical protein AMTR_s00040p00135930          108   2e-24   
gb|KHN01253.1|  CASP-like protein 1                                     107   3e-24   
ref|XP_007153553.1|  hypothetical protein PHAVU_003G045200g             107   3e-24   
emb|CDP02250.1|  unnamed protein product                                107   4e-24   
ref|XP_010550038.1|  PREDICTED: casparian strip membrane protein ...    107   4e-24   
gb|KEH38986.1|  plant integral membrane protein                         105   6e-24   
gb|AFK37802.1|  unknown                                                 106   7e-24   
ref|XP_008646251.1|  PREDICTED: casparian strip membrane protein ...    106   7e-24   
ref|XP_011085855.1|  PREDICTED: casparian strip membrane protein ...    106   7e-24   
ref|XP_008341761.1|  PREDICTED: CASP-like protein 1                     106   7e-24   
emb|CDX78624.1|  BnaA03g05360D                                          106   8e-24   
gb|AFK48532.1|  unknown                                                 106   9e-24   
sp|P0DI35.1|CASP1_LACSI  RecName: Full=Casparian strip membrane p...    105   1e-23   
ref|XP_009131457.1|  PREDICTED: casparian strip membrane protein ...    105   1e-23   
ref|XP_002446616.1|  hypothetical protein SORBIDRAFT_06g018970          105   1e-23   Sorghum bicolor [broomcorn]
ref|XP_010551838.1|  PREDICTED: casparian strip membrane protein ...    105   1e-23   
ref|XP_004233369.1|  PREDICTED: casparian strip membrane protein 1      105   2e-23   
sp|P0DI29.1|CSPL1_TRIPD  RecName: Full=CASP-like protein 1              104   2e-23   
emb|CDY43749.1|  BnaAnng07640D                                          104   3e-23   
sp|P0DI44.1|CASP1_SOLTU  RecName: Full=Casparian strip membrane p...    104   3e-23   
ref|XP_006363407.1|  PREDICTED: casparian strip membrane protein ...    104   3e-23   
ref|XP_004975856.1|  PREDICTED: casparian strip membrane protein ...    104   5e-23   
sp|P0DI34.1|CASP2_PANVG  RecName: Full=Casparian strip membrane p...    104   5e-23   
ref|XP_004972397.1|  PREDICTED: CASP-like protein Sb07g000300-like      104   7e-23   
emb|CDX70605.1|  BnaC03g06890D                                          103   8e-23   
ref|XP_009121585.1|  PREDICTED: casparian strip membrane protein ...    103   9e-23   
ref|XP_011075520.1|  PREDICTED: casparian strip membrane protein ...    103   9e-23   
ref|XP_004238811.1|  PREDICTED: casparian strip membrane protein 2      102   2e-22   
sp|P0DI59.1|CASP1_LACSA  RecName: Full=Casparian strip membrane p...    102   2e-22   
ref|XP_010420188.1|  PREDICTED: casparian strip membrane protein ...    102   3e-22   
ref|XP_010453663.1|  PREDICTED: casparian strip membrane protein 5      102   3e-22   
ref|XP_006431199.1|  hypothetical protein CICLE_v10013539mg             101   3e-22   
ref|XP_006400049.1|  hypothetical protein EUTSA_v10015485mg             101   3e-22   
emb|CDX69534.1|  BnaA10g18830D                                          101   4e-22   
ref|NP_197033.1|  casparian strip membrane protein 5                    101   5e-22   
ref|XP_006355125.1|  PREDICTED: CASP-like protein SDM1_58t00016-like    100   6e-22   
ref|XP_006289591.1|  hypothetical protein CARUB_v10003142mg             100   8e-22   
ref|XP_008806111.1|  PREDICTED: casparian strip membrane protein ...    101   8e-22   
ref|XP_010943808.1|  PREDICTED: casparian strip membrane protein ...    101   8e-22   
sp|Q60D27.1|CASP1_SOLDE  RecName: Full=Casparian strip membrane p...    100   1e-21   
sp|Q5NRN4.1|CASP2_SOLDE  RecName: Full=Casparian strip membrane p...    100   1e-21   
ref|XP_010492362.1|  PREDICTED: casparian strip membrane protein ...  99.8    2e-21   
gb|AFK48217.1|  unknown                                               98.6    2e-21   
sp|D7M7B3.2|CASP5_ARALL  RecName: Full=Casparian strip membrane p...  99.4    2e-21   
ref|XP_003613862.1|  hypothetical protein MTR_5g041900                99.4    2e-21   
ref|XP_009606201.1|  PREDICTED: casparian strip membrane protein 2    98.6    4e-21   
ref|XP_006438724.1|  hypothetical protein CICLE_v10033634mg           98.2    7e-21   
gb|EMT03852.1|  hypothetical protein F775_25649                       98.2    1e-20   
ref|XP_003621263.1|  hypothetical protein MTR_7g011090                97.4    1e-20   
ref|XP_004135448.1|  PREDICTED: CASP-like protein RCOM_0837390-like   97.1    2e-20   
ref|XP_009360778.1|  PREDICTED: casparian strip membrane protein ...  97.1    2e-20   
gb|KDO82981.1|  hypothetical protein CISIN_1g044764mg                 96.7    2e-20   
dbj|BAD16116.1|  integral membrane family protein-like                97.4    3e-20   
ref|XP_004297290.1|  PREDICTED: CASP-like protein 2-like              96.3    3e-20   
sp|Q7XPU9.1|CASP1_ORYSJ  RecName: Full=Casparian strip membrane p...  97.1    3e-20   
ref|XP_009794323.1|  PREDICTED: casparian strip membrane protein ...  96.3    3e-20   
ref|XP_008446384.1|  PREDICTED: casparian strip membrane protein ...  96.3    3e-20   
ref|NP_001235823.1|  CASP-like protein 6                              95.9    4e-20   
ref|XP_006648782.1|  PREDICTED: CASP-like protein Os02g0578333-like   95.5    6e-20   
gb|KHN25032.1|  CASP-like protein 2                                   95.5    6e-20   
sp|P0DI58.1|CSPL2_LOTJA  RecName: Full=CASP-like protein 2; Short...  95.1    7e-20   
ref|XP_004233676.1|  PREDICTED: casparian strip membrane protein ...  94.7    9e-20   
ref|XP_006338436.1|  PREDICTED: casparian strip membrane protein ...  94.7    9e-20   
ref|XP_003556790.1|  PREDICTED: CASP-like protein 2-like              94.0    2e-19   
ref|XP_002871659.1|  integral membrane family protein                 94.0    2e-19   
ref|XP_009609035.1|  PREDICTED: casparian strip membrane protein ...  93.2    3e-19   
gb|EYU28778.1|  hypothetical protein MIMGU_mgv1a014587mg              93.2    3e-19   
ref|XP_007225906.1|  hypothetical protein PRUPE_ppa011955mg           93.2    4e-19   
gb|EYU34645.1|  hypothetical protein MIMGU_mgv1a015926mg              91.7    4e-19   
ref|XP_008221595.1|  PREDICTED: CASP-like protein 1                   92.8    6e-19   
gb|EEC73995.1|  hypothetical protein OsI_08910                        93.2    6e-19   
ref|XP_003607732.1|  hypothetical protein MTR_4g081880                92.4    7e-19   
ref|XP_002443685.1|  hypothetical protein SORBIDRAFT_07g000300        93.2    8e-19   
ref|XP_009760874.1|  PREDICTED: casparian strip membrane protein 2    92.0    1e-18   
ref|XP_008339880.1|  PREDICTED: CASP-like protein 1                   92.0    1e-18   
ref|XP_011017493.1|  PREDICTED: casparian strip membrane protein 5    92.0    1e-18   
ref|NP_001151404.1|  casparian strip membrane protein 2               92.8    1e-18   
ref|XP_002311310.2|  hypothetical protein POPTR_0008s08820g           91.3    1e-18   
ref|XP_003580136.1|  PREDICTED: casparian strip membrane protein 1    92.4    1e-18   
gb|AFK45120.1|  unknown                                               91.3    2e-18   
ref|XP_002522462.1|  conserved hypothetical protein                   90.5    2e-18   
ref|XP_011098776.1|  PREDICTED: casparian strip membrane protein ...  91.3    2e-18   
gb|KGN51938.1|  hypothetical protein Csa_5G606300                     90.5    3e-18   
sp|P0DH80.1|CASP1_PINTA  RecName: Full=Casparian strip membrane p...  90.5    3e-18   
sp|Q6Z1Y7.1|CASP2_ORYSJ  RecName: Full=Casparian strip membrane p...  91.7    3e-18   
sp|A2YQB8.1|CASP2_ORYSI  RecName: Full=Casparian strip membrane p...  91.3    3e-18   
sp|B9S8Z3.2|CASP4_RICCO  RecName: Full=Casparian strip membrane p...  90.1    5e-18   
ref|XP_003571287.1|  PREDICTED: casparian strip membrane protein 2    90.5    5e-18   
ref|XP_002447351.1|  hypothetical protein SORBIDRAFT_06g033470        90.5    7e-18   
ref|XP_011090486.1|  PREDICTED: casparian strip membrane protein ...  89.0    9e-18   
gb|EYU34054.1|  hypothetical protein MIMGU_mgv1a026542mg              89.0    9e-18   
ref|XP_010108691.1|  hypothetical protein L484_015678                 88.6    1e-17   
tpg|DAA35281.1|  TPA: putative protein kinase superfamily protein     93.6    1e-17   
sp|Q6EP58.1|CASP7_ORYSJ  RecName: Full=Casparian strip membrane p...  89.0    1e-17   
gb|AEX12490.1|  hypothetical protein 2_4221_02                        86.7    3e-17   
ref|XP_007046043.1|  Casparian strip membrane protein 5, putative...  88.6    3e-17   
gb|EEE57797.1|  hypothetical protein OsJ_08354                        87.8    3e-17   
ref|XP_007046042.1|  Casparian strip membrane protein 5, putative...  87.8    4e-17   
sp|P0DKC2.1|CASP1_LOTJA  RecName: Full=Casparian strip membrane p...  87.0    4e-17   
gb|KDO70521.1|  hypothetical protein CISIN_1g045229mg                 84.3    1e-16   
gb|EEE57248.1|  hypothetical protein OsJ_07255                        88.6    1e-16   
gb|EEC73471.1|  hypothetical protein OsI_07795                        88.2    2e-16   
ref|XP_008381732.1|  PREDICTED: casparian strip membrane protein ...  82.8    4e-16   
gb|KHN01909.1|  Casparian strip membrane protein 5                    82.4    9e-16   
ref|XP_006659729.1|  PREDICTED: CASP-like protein OsI_27482-like      82.8    2e-15   
tpg|DAA37454.1|  TPA: hypothetical protein ZEAMMB73_440640            80.9    3e-15   
ref|XP_006417050.1|  hypothetical protein EUTSA_v10008800mg           81.6    4e-15   
ref|XP_002309414.1|  hypothetical protein POPTR_0006s22500g           79.3    5e-15   
ref|XP_002892791.1|  integral membrane family protein                 81.3    7e-15   
ref|XP_008679497.1|  PREDICTED: CASP-like protein Sb07g000300         80.9    1e-14   
ref|XP_006306344.1|  hypothetical protein CARUB_v10012228mg           80.9    1e-14   
ref|XP_009117933.1|  PREDICTED: CASP-like protein ARALYDRAFT_888790   80.1    1e-14   
ref|XP_010458896.1|  PREDICTED: casparian strip membrane protein 6    80.1    2e-14   
ref|XP_010495793.1|  PREDICTED: casparian strip membrane protein ...  80.1    2e-14   
ref|NP_172868.1|  uncharacterized protein                             79.3    4e-14   
ref|XP_010476448.1|  PREDICTED: casparian strip membrane protein ...  79.3    4e-14   
ref|XP_010523465.1|  PREDICTED: CASP-like protein 1A1 isoform X2      76.6    4e-13   
sp|E6Y2A0.1|CASP1_WHEAT  RecName: Full=Casparian strip membrane p...  76.3    6e-13   
emb|CDP02251.1|  unnamed protein product                              66.6    7e-10   
gb|KDP41223.1|  hypothetical protein JCGZ_15630                       66.2    9e-10   
emb|CAJ86161.1|  H0913C04.2                                           65.9    9e-10   
ref|XP_008808838.1|  PREDICTED: casparian strip membrane protein ...  66.2    1e-09   
ref|XP_002312974.2|  hypothetical protein POPTR_0009s13390g           60.8    2e-08   
gb|EYU38661.1|  hypothetical protein MIMGU_mgv1a007267mg              65.1    2e-08   
sp|P0DH81.1|CASP1_PICGL  RecName: Full=Casparian strip membrane p...  57.8    1e-06   
ref|XP_010523464.1|  PREDICTED: casparian strip membrane protein ...  56.6    2e-06   
ref|XP_010943799.1|  PREDICTED: casparian strip membrane protein ...  55.8    2e-06   
ref|XP_006844549.1|  hypothetical protein AMTR_s00016p00177260        50.8    2e-04   



>ref|XP_006339139.1| PREDICTED: casparian strip membrane protein 1-like [Solanum tuberosum]
Length=212

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 147/183 (80%), Gaps = 3/183 (2%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALN---VASDNKAAPVAGGGYKKGLAIFDLILRI  289
            MEKSESTKIDV E+++E+KGKAPLLG      VA+        GGG K+G+AIFDLILRI
Sbjct  1    MEKSESTKIDVVETNREKKGKAPLLGTAAPAIVAAVGHDGHAKGGGAKRGIAIFDLILRI  60

Query  290  VSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFS  469
             + A+A+ ATV MAT EETLPFFTQFFQFEASYDDLP F+FFV+ MGIV  YLVLS+PFS
Sbjct  61   AAFASALGATVAMATTEETLPFFTQFFQFEASYDDLPAFTFFVVGMGIVVAYLVLSVPFS  120

Query  470  IVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDF  649
            IVCI R +AV PR+ LII DTV I LAT AAGSS AIVYLAH GN DANWLAICQQFGDF
Sbjct  121  IVCIVRPHAVVPRLLLIIFDTVIIALATGAAGSSTAIVYLAHNGNQDANWLAICQQFGDF  180

Query  650  CER  658
            C+R
Sbjct  181  CQR  183



>ref|XP_004249431.1| PREDICTED: casparian strip membrane protein 1 [Solanum lycopersicum]
Length=212

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 149/183 (81%), Gaps = 3/183 (2%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAG---GGYKKGLAIFDLILRI  289
            MEKSESTKIDV E++KE+KGKAPLLG     +   A    G   GG K+G+AIFDLILRI
Sbjct  1    MEKSESTKIDVVETNKEKKGKAPLLGTAAAPAIVAAVGHDGHAKGGAKRGIAIFDLILRI  60

Query  290  VSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFS  469
             + A+A+ ATV MAT EETLPFFTQFFQFEASYDDLPTFSFFV+ MGIV  YLVLS+PFS
Sbjct  61   AAFASALGATVAMATTEETLPFFTQFFQFEASYDDLPTFSFFVVGMGIVVAYLVLSVPFS  120

Query  470  IVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDF  649
            IVCI RS+AV PR+ LII DTV I LAT AAGSSAAIVYLAH GN DANWLAICQQFGDF
Sbjct  121  IVCIVRSHAVVPRLLLIIFDTVIIALATGAAGSSAAIVYLAHNGNQDANWLAICQQFGDF  180

Query  650  CER  658
            C+R
Sbjct  181  CQR  183



>ref|XP_009767267.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana sylvestris]
 sp|P0DI50.1|CASP1_TOBAC RecName: Full=Casparian strip membrane protein 1; Short=NtCASP1 
[Nicotiana tabacum]
Length=209

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 146/180 (81%), Gaps = 1/180 (1%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEKSESTKIDV E++KERKGKAPLLG   V +        GGG K+G+AIFDLILRI + 
Sbjct  1    MEKSESTKIDVVETNKERKGKAPLLGKAPVVAAAVVH-AKGGGAKRGIAIFDLILRIAAF  59

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A+A+ A V MAT EETLPFFTQFFQFEASYDDLPTF+FFV++M IV  YLVLS+PFSIVC
Sbjct  60   ASALGAAVAMATTEETLPFFTQFFQFEASYDDLPTFTFFVVAMAIVVAYLVLSVPFSIVC  119

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +AV PR+ LII DTV I L T AAGSSAAIVYLAH GN DANWLAICQQFGDFC+R
Sbjct  120  IVRPHAVVPRLLLIIFDTVIIALTTGAAGSSAAIVYLAHNGNQDANWLAICQQFGDFCQR  179



>ref|XP_009601005.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana tomentosiformis]
Length=210

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEKSESTKIDV E++KERKGKAPLLG   V +   A   A GG  +G+AIFDLILRI + 
Sbjct  1    MEKSESTKIDVVETNKERKGKAPLLGTAPVVAAAGAVEHAKGGANRGIAIFDLILRIAAF  60

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A+A+ A V M T EETLPFFTQFFQFEASYDDLPTF+FFV +M IV  YLVLS+PFSIVC
Sbjct  61   ASALGAAVAMGTTEETLPFFTQFFQFEASYDDLPTFTFFVAAMAIVVAYLVLSVPFSIVC  120

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +AV PR+ LII DTV I L T AAGSSAAIVYLAH GN DANWLAICQQFGDFC+R
Sbjct  121  IVRPHAVVPRLLLIIFDTVIIALTTGAAGSSAAIVYLAHNGNQDANWLAICQQFGDFCQR  180



>sp|Q1W3A5.1|CASP1_STRAF RecName: Full=Casparian strip membrane protein 1; Short=SaCASP1, 
partial [Striga asiatica]
 gb|ABD98039.1| unknown [Striga asiatica]
Length=189

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 144/180 (80%), Gaps = 7/180 (4%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEK+ES+ I++AESSKERKGKAPLL A  V  D  A      GYK+G++IFDLILRI + 
Sbjct  1    MEKNESSAIEIAESSKERKGKAPLLAA-AVGHDRAA------GYKRGVSIFDLILRISAA  53

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AAT+ M T E+TLPFFTQFFQF A YDDLPTF+FFV+ M IV+GYL+LS+P SIVC
Sbjct  54   TAALAATIVMGTTEQTLPFFTQFFQFRAQYDDLPTFTFFVVGMAIVTGYLILSVPLSIVC  113

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            IAR  A+GPR  LI+ DTV   LAT+AAGSSAAIVYLAH GN+DANWLAICQQF DFC+R
Sbjct  114  IARPVAIGPRFLLIVCDTVTAVLATSAAGSSAAIVYLAHNGNSDANWLAICQQFNDFCQR  173



>ref|XP_006341077.1| PREDICTED: casparian strip membrane protein 1-like [Solanum tuberosum]
Length=215

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 148/189 (78%), Gaps = 14/189 (7%)
 Frame = +2

Query  119  MEKSESTKIDVAESSK-ERK-GKAPLLGA--------LNVASDNKAAPVAGGGYKKGLAI  268
            M+KSESTKI++ ESSK ERK GKAPLLG+        + + S+NK      G YKKG++I
Sbjct  1    MDKSESTKIEMGESSKLERKLGKAPLLGSPSHAISSSVPIVSNNKKV----GNYKKGISI  56

Query  269  FDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYL  448
            FDLILRI SVAT+I A V MATA ETLPFFTQFFQFEA YDDLPTF+FFVI+M IV  YL
Sbjct  57   FDLILRIASVATSIGAAVGMATAGETLPFFTQFFQFEAGYDDLPTFTFFVIAMSIVVAYL  116

Query  449  VLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAI  628
            VLS+PFSIVCIARS+ V PR+ LII DT  ITL T+AAG+S AIVYLAH GN DANWLA 
Sbjct  117  VLSIPFSIVCIARSHVVAPRLLLIIFDTAIITLTTSAAGASTAIVYLAHNGNQDANWLAF  176

Query  629  CQQFGDFCE  655
            C QFGDFC+
Sbjct  177  CNQFGDFCQ  185



>ref|XP_004246481.1| PREDICTED: casparian strip membrane protein 1-like [Solanum lycopersicum]
Length=215

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 148/185 (80%), Gaps = 6/185 (3%)
 Frame = +2

Query  119  MEKSESTKIDVAESSK-ERK-GKAPLLGALNVASDNKAAPVAG----GGYKKGLAIFDLI  280
            M+KSESTKI++ ESSK ERK GKAPLLG+ + A  +    VA     G YKKG++IFDLI
Sbjct  1    MDKSESTKIEMGESSKLERKLGKAPLLGSPSNAISSSDPKVATNKKVGNYKKGISIFDLI  60

Query  281  LRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSL  460
            LRI SVAT+I A V MATA ETLPFFTQFFQFEA YDDLPTF+FFVI+M IV  YLVLS+
Sbjct  61   LRIASVATSIGAAVGMATAGETLPFFTQFFQFEAGYDDLPTFTFFVIAMSIVVAYLVLSI  120

Query  461  PFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQF  640
            PFSIVCIARSY V PR+ LII DT  ITL T+AAG+SAAIVYLAH GN DANWLA C QF
Sbjct  121  PFSIVCIARSYVVVPRLLLIIFDTAMITLTTSAAGASAAIVYLAHNGNEDANWLAFCNQF  180

Query  641  GDFCE  655
            GDFC+
Sbjct  181  GDFCQ  185



>sp|P0DI63.1|CASP1_STRHE RecName: Full=Casparian strip membrane protein 1; Short=ShCASP1 
[Striga hermonthica]
Length=202

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 142/180 (79%), Gaps = 7/180 (4%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEK++ST I++AESSKE KGKAPLL A  V  D  A      GYK+G++IFDL LRI + 
Sbjct  1    MEKNKSTAIEIAESSKESKGKAPLLAA-AVGHDRAA------GYKRGVSIFDLFLRISAA  53

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AAT+ M T E+TLPFFTQFFQF A YDDLPTF+FFV+ M IV+GYL+LS+PFSIVC
Sbjct  54   TAALAATIVMGTTEQTLPFFTQFFQFRAQYDDLPTFTFFVVGMAIVTGYLILSVPFSIVC  113

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            IAR  A+GPR  LI+ DT+   LAT+AAGSSAAIVYLAH GN+DANWL ICQQF DFC+R
Sbjct  114  IARPVAIGPRFLLIVGDTLKAVLATSAAGSSAAIVYLAHNGNSDANWLDICQQFNDFCQR  173



>sp|P0DI31.1|CASP1_TRIPD RecName: Full=Casparian strip membrane protein 1; Short=TpCASP1 
[Triphysaria pusilla]
Length=202

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 144/180 (80%), Gaps = 7/180 (4%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEKSES+ I +AESSK+RKGKAPLL         +AA     GYK+G+AIFDLILRI + 
Sbjct  1    MEKSESSTIQIAESSKDRKGKAPLLPP--PVHHERAA-----GYKRGVAIFDLILRISAA  53

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AAT+ M T E+TLPFFTQFFQF ASYDDLPTF+FFVI+M IV+GYL+LS+PFSIVC
Sbjct  54   TAALAATIVMGTTEQTLPFFTQFFQFRASYDDLPTFTFFVIAMAIVTGYLILSVPFSIVC  113

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            IAR     PR+ LI+ DT+ +TLAT+AAG+SAAIVYLAH G +DANWLAICQQF DFC+R
Sbjct  114  IARPVVAAPRILLILCDTLTVTLATSAAGASAAIVYLAHNGXSDANWLAICQQFNDFCQR  173



>ref|XP_009591857.1| PREDICTED: casparian strip membrane protein 1-like [Nicotiana 
tomentosiformis]
Length=211

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 143/181 (79%), Gaps = 2/181 (1%)
 Frame = +2

Query  119  MEKS-ESTKIDVAESSK-ERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIV  292
            MEKS EST I++ ESSK ER+GKAPLLG+    S         G  K+G+AIFDLILRI 
Sbjct  1    MEKSHESTTIEMGESSKLERRGKAPLLGSTPAISAVVGHDKGAGNPKRGIAIFDLILRIA  60

Query  293  SvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSI  472
            +VAT+I A V M TA ETLPFFTQFFQFEA YDDLPTF+FFV++M IV GYLVLS+PFSI
Sbjct  61   AVATSIGAAVGMGTAGETLPFFTQFFQFEAGYDDLPTFTFFVVAMSIVVGYLVLSIPFSI  120

Query  473  VCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFC  652
            VCIARS+AV PR+ LII DT  +TL TAAAG+SAAIVYLAH GN DANWLA C QFGDFC
Sbjct  121  VCIARSHAVVPRLLLIIFDTAFVTLTTAAAGASAAIVYLAHNGNQDANWLAFCNQFGDFC  180

Query  653  E  655
            +
Sbjct  181  Q  181



>ref|XP_011077838.1| PREDICTED: casparian strip membrane protein 1 [Sesamum indicum]
Length=205

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEKSE+T I+VAE+S+ERKGKAPLL A  V +D+ A      G K+G+AIFDLILRI + 
Sbjct  1    MEKSEATTIEVAETSRERKGKAPLLAA-PVPADHHAK---AAGNKRGVAIFDLILRISAA  56

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A A+ AT+ M TAE+TLPFFTQFFQF+ASYDDLPTFSFFVI+M IV+ YLVLS+PFSIVC
Sbjct  57   AAALGATIAMGTAEQTLPFFTQFFQFQASYDDLPTFSFFVIAMAIVTAYLVLSVPFSIVC  116

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R  A  PR+ LI+ DT+A+TLAT+A G++AAIVYLAH GN+DANWLAICQQF DFC+R
Sbjct  117  IVRPVAAAPRLLLILCDTLAVTLATSAGGAAAAIVYLAHNGNSDANWLAICQQFTDFCQR  176



>emb|CDP10637.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 150/180 (83%), Gaps = 4/180 (2%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEKSES KID+AE+ +ERKGKAPLLG  +  ++   A    GGYK+G+AIFDLILR+ + 
Sbjct  1    MEKSESAKIDIAETGRERKGKAPLLGGRSGPAERAKA----GGYKRGIAIFDLILRVSAA  56

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A A+ ATV+M TAE+TLPFFTQFFQF+ASYDDLPTFSFFVI M IV  YL LS+PFSIVC
Sbjct  57   AAALGATVSMGTAEQTLPFFTQFFQFQASYDDLPTFSFFVIGMAIVCAYLALSIPFSIVC  116

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            IAR +AV PR+ LII DT+A+TLAT+A+ ++AA+VYLAH GN++ANWLAICQQF DFC++
Sbjct  117  IARPHAVAPRLLLIIFDTLALTLATSASAAAAAMVYLAHQGNSNANWLAICQQFTDFCQK  176



>ref|XP_009801668.1| PREDICTED: casparian strip membrane protein 1-like [Nicotiana 
sylvestris]
Length=211

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 143/181 (79%), Gaps = 2/181 (1%)
 Frame = +2

Query  119  MEKS-ESTKIDVAESSK-ERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIV  292
            MEKS EST I++ ESSK ERKGKAPLLG+    +        GG  KKG+AI DLILRI 
Sbjct  1    MEKSQESTTIEMGESSKLERKGKAPLLGSTPAIAAVVGHNKGGGKNKKGIAIVDLILRIA  60

Query  293  SvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSI  472
            +VAT+I A V M TA ETLPFFTQFFQFEA YDDLPTF+FFV++M IV GYLVLS+PFSI
Sbjct  61   AVATSIGAAVGMGTAGETLPFFTQFFQFEAGYDDLPTFTFFVVAMSIVVGYLVLSIPFSI  120

Query  473  VCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFC  652
            VCIARS+AV PR+ LII DT  +TL TAAAG+SAAIVYLAH GN DANWLA C QFGDFC
Sbjct  121  VCIARSHAVVPRLLLIIFDTAFVTLTTAAAGASAAIVYLAHNGNQDANWLAFCNQFGDFC  180

Query  653  E  655
            +
Sbjct  181  Q  181



>ref|XP_002530531.1| conserved hypothetical protein [Ricinus communis]
 sp|B9SX12.1|CASP1_RICCO RecName: Full=Casparian strip membrane protein 1; Short=RcCASP1 
[Ricinus communis]
 gb|EEF31863.1| conserved hypothetical protein [Ricinus communis]
Length=200

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 139/176 (79%), Gaps = 7/176 (4%)
 Frame = +2

Query  134  STKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            ST I++ AESS   KGKAPL+GA + + + K      GGYKKG+AIFD ILR+ +V +A+
Sbjct  2    STTIEIPAESSAVAKGKAPLIGASSSSYEKK------GGYKKGIAIFDFILRLGAVISAL  55

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            +A  TM T++ETLPFFTQFFQFEA YDD PTF FFVI+MG V GYLVLSLPFS+V I R 
Sbjct  56   SAAATMGTSDETLPFFTQFFQFEAGYDDFPTFQFFVIAMGFVGGYLVLSLPFSVVAIIRP  115

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +AVG R+ L+I DTVA+TL TAAA ++AAIVYLAH GN  ANWLA+CQQFGDFC++
Sbjct  116  HAVGIRLLLLILDTVALTLNTAAAAAAAAIVYLAHNGNQSANWLAVCQQFGDFCQK  171



>sp|P0DI52.1|CASP1_ERYGU RecName: Full=Casparian strip membrane protein 1; Short=MgCASP1 
[Erythranthe guttata]
 gb|EYU38660.1| hypothetical protein MIMGU_mgv1a013782mg [Erythranthe guttata]
Length=210

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 148/185 (80%), Gaps = 9/185 (5%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLG-----ALNVASDNKAAPVAGGGYKKGLAIFDLIL  283
            MEKSE+T IDVAE+S+E KGKAPLL              +AAP     YK+G+AIFDLIL
Sbjct  1    MEKSEATTIDVAETSRESKGKAPLLRDPPAWVPAAVERQRAAP----AYKRGVAIFDLIL  56

Query  284  RIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLP  463
            RI +   A+AAT+TM T E+TLPFFTQFFQF+ASYDDLPTF+FFVI+M IV+GYLVLS+P
Sbjct  57   RISAATAALAATITMGTTEQTLPFFTQFFQFQASYDDLPTFTFFVIAMSIVTGYLVLSVP  116

Query  464  FSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFG  643
            FSIVCIAR  A  PR+ LI+ DT+A+TL T+AAG+SAAIVYLAH GN+DANWLAICQQF 
Sbjct  117  FSIVCIARPVAAAPRLLLILCDTLAVTLNTSAAGASAAIVYLAHNGNSDANWLAICQQFN  176

Query  644  DFCER  658
            DFC+R
Sbjct  177  DFCQR  181



>gb|KDP36189.1| hypothetical protein JCGZ_08833 [Jatropha curcas]
Length=203

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 135/176 (77%), Gaps = 5/176 (3%)
 Frame = +2

Query  134  STKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            STKID+ AESS   KGKAPL+G ++ +S         GG+KKG+AI D +LRI ++ TA+
Sbjct  2    STKIDIPAESSAAAKGKAPLIGMVSSSSSTNEK----GGFKKGIAILDFLLRIGAIVTAL  57

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            +A  TM  + ETLPFFTQFFQFEA YDDLP   FFV++M +V GYLVLSLPFSIV I R 
Sbjct  58   SAAGTMGASGETLPFFTQFFQFEAGYDDLPALQFFVVAMAVVGGYLVLSLPFSIVTIIRP  117

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +AVGPR+ L+I DTVA+TL T+AA ++ AIVYLAH GN DANWLAIC QFGDFC++
Sbjct  118  HAVGPRLLLLIFDTVALTLNTSAAAAATAIVYLAHNGNEDANWLAICVQFGDFCQQ  173



>ref|XP_006299322.1| hypothetical protein CARUB_v10015479mg [Capsella rubella]
 gb|EOA32220.1| hypothetical protein CARUB_v10015479mg [Capsella rubella]
Length=204

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 132/179 (74%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KGKAPL+G   VA D+ A     GGYK+GLAIFD +LR+ ++ 
Sbjct  2    KNESTFIDVPAESSSAMKGKAPLIG---VARDHTAT--GSGGYKRGLAIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+ A  TM T++ETLPFFTQF QFEASYDDLPTF FFVI+M +V GYLVLSLP S+V I
Sbjct  57   AALVAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L  AAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  LRPLATAPRLLLLVLDTGILGLNMAAASSAAAISYLAHNGNQNTNWLPICQQFGDFCQK  175



>ref|XP_011004682.1| PREDICTED: casparian strip membrane protein 2 [Populus euphratica]
Length=199

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 11/176 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPV-AGGGYKKGLAIFDLILRIVSvatai  310
            ST+ID+ ESS   KGKAPL+          AAP+   GGYKKG+AIFDLILR+ ++ TA+
Sbjct  5    STEIDMPESSSVSKGKAPLI----------AAPMNENGGYKKGIAIFDLILRLAAIVTAL  54

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA  +M T++ETLPFFTQ FQF+ASYDDLPTF FFVI+M IV GYLVLSLPFSIV I R 
Sbjct  55   AAAASMGTSDETLPFFTQSFQFQASYDDLPTFQFFVIAMAIVGGYLVLSLPFSIVAIVRP  114

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+ LII DTVA++L TAA  ++AAIVYLAH GN+  NWLAIC Q+GDFC +
Sbjct  115  HAAGPRLLLIILDTVALSLNTAAGAAAAAIVYLAHNGNSSTNWLAICLQYGDFCRK  170



>ref|XP_011004684.1| PREDICTED: casparian strip membrane protein 2-like [Populus euphratica]
Length=198

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 11/176 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPV-AGGGYKKGLAIFDLILRIVSvatai  310
            ST+ID+ ESS   KGKAPL+          AAP+   GGYKKG+AIFDLILR+ ++ TA+
Sbjct  4    STEIDMPESSSVSKGKAPLI----------AAPMNENGGYKKGIAIFDLILRLAAIVTAL  53

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA  +M T++ETLPFFTQ FQF+ASYDDLPTF FFVI+M IV GYLVLSLPFSIV I R 
Sbjct  54   AAAASMGTSDETLPFFTQSFQFQASYDDLPTFQFFVIAMAIVGGYLVLSLPFSIVAIVRP  113

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+ LII DTVA++L TAA  ++AAIVYLAH GN+  NWLAIC Q+GDFC +
Sbjct  114  HAAGPRLLLIILDTVALSLNTAAGAAAAAIVYLAHNGNSSTNWLAICLQYGDFCRK  169



>ref|XP_006289845.1| hypothetical protein CARUB_v10003455mg [Capsella rubella]
 gb|EOA22743.1| hypothetical protein CARUB_v10003455mg [Capsella rubella]
Length=202

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 137/179 (77%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV AESS   KGKAPLLG   +A D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPAESSSAIKGKAPLLG---LARDHTGS----GGYKRGLSIFDFLLRLAAIV  54

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+ A  TM T++ETLPFFTQF QFEASYDDLPTF FFVI++ IV+ YLVLSLPFS+V I
Sbjct  55   AALVAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAIAIVAAYLVLSLPFSVVTI  114

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  AV PR+ L++ DT A+ L TAAA ++AAIVYLAH GNT+ NWL ICQQFGDFC++
Sbjct  115  VRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQK  173



>gb|KFK38524.1| hypothetical protein AALP_AA3G125100 [Arabis alpina]
Length=201

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 127/179 (71%), Gaps = 9/179 (5%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV  ESS   KGKAPL+G         A     GGYK+GL IFD +LR+ ++ 
Sbjct  2    KNESTTIDVHGESSSAMKGKAPLIGL--------ATSAGSGGYKRGLTIFDFLLRLAAII  53

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             +  A  TM T++ETLPFFTQF QFEA YDDLPTF FFVI+M +V+GYLVLSLPFS+V I
Sbjct  54   ASAVAAATMFTSDETLPFFTQFLQFEAGYDDLPTFQFFVIAMSMVAGYLVLSLPFSVVTI  113

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L +AAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  114  VRPLATAPRLLLLVLDTAVLVLNSAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQK  172



>gb|KEH41982.1| casparian strip membrane protein [Medicago truncatula]
Length=195

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 10/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            STKID+ ESSK+ KGKA L+          AAP   GG+KKG+AI D ILR+ ++A A+A
Sbjct  2    STKIDIQESSKDTKGKAVLV----------AAPARPGGWKKGIAIMDFILRLGAIAAALA  51

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  +M T++++LPFFTQFFQFEASYD  P F FF+I+M IV+GYLVLSLPFSIV I R +
Sbjct  52   AAASMGTSDQSLPFFTQFFQFEASYDSFPAFQFFLIAMAIVAGYLVLSLPFSIVAIIRPH  111

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A GPR+FLII DTV +TLATA+A S+A+IVYLAH GN D NWLAIC QFGDFC +
Sbjct  112  ATGPRLFLIILDTVFLTLATASAASAASIVYLAHNGNQDTNWLAICNQFGDFCAQ  166



>emb|CDY62471.1| BnaC01g44860D [Brassica napus]
Length=204

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 131/179 (73%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KG APL+G   VA D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KNESTVIDVPAESSSAMKGSAPLIG---VARDHTTSD--SGGYKRGLSIFDFLLRLAAII  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QFEA YDDLPTF FFVI+M ++SGYL+LSLPFS+V I
Sbjct  57   AASVAAGTMFTSDETLPFFTQFLQFEAGYDDLPTFQFFVIAMSMISGYLLLSLPFSVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT A+    AAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  VRPLATAPRLLLLVLDTAAMAFNMAAASSAAAIGYLAHNGNQNTNWLPICQQFGDFCQK  175



>ref|XP_011094537.1| PREDICTED: casparian strip membrane protein 1-like [Sesamum indicum]
Length=202

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 147/180 (82%), Gaps = 8/180 (4%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEKS++T I++ E+S+ERKGKAPLLGA   A + +AA     GY++G+AIFDLILR+ + 
Sbjct  1    MEKSDATTIEIGETSRERKGKAPLLGA---AENARAA-----GYRRGVAIFDLILRVSAA  52

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AAT+TM T E+TLPFFTQFFQF+ASYDDLPTF+FFVI+M I +GYLVLS+PFSIVC
Sbjct  53   VAALAATITMGTTEQTLPFFTQFFQFQASYDDLPTFTFFVIAMSIATGYLVLSVPFSIVC  112

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            IAR     PR+ LI+ DT+ +TL T+AA +SAAIVYLAH GN+ ANWLAICQQF DFC+R
Sbjct  113  IARPQVTAPRLLLILCDTLTLTLTTSAAAASAAIVYLAHNGNSGANWLAICQQFTDFCQR  172



>ref|XP_004303525.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Fragaria vesca subsp. vesca]
Length=200

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 136/180 (76%), Gaps = 9/180 (5%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M+  E+T IDV E+S   KGKAP+L    V    K      GG K+GLAI DLI+RI ++
Sbjct  1    MKSGEATTIDVPEASGATKGKAPVL---MVPRKEK------GGMKRGLAIIDLIIRIGAM  51

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I+M IV+GYLVLSLPFSIV 
Sbjct  52   VAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFEFFLIAMSIVAGYLVLSLPFSIVA  111

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +A GPR+ L+I D  A+TLAT+AA ++ +IVYLAH GN+++NWLAIC QFGDFC++
Sbjct  112  IVRPHAGGPRLLLLIVDIAALTLATSAAAAATSIVYLAHNGNSNSNWLAICNQFGDFCQK  171



>ref|XP_004516298.1| PREDICTED: casparian strip membrane protein 1-like [Cicer arietinum]
Length=195

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST ID+ ES+KE KGKA L+          A+P   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STNIDIQESTKETKGKAALI----------ASPARPGGWKKGIAIMDFILRLGAIAAALG  51

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  +M T+++TLPFFTQFFQFEASYD   TF FFVI+M IV+GYLVLSLPFSIV I R +
Sbjct  52   AAASMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMAIVAGYLVLSLPFSIVAIIRPH  111

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A GPR+FLII D+V +TLATA+A S+A+IVYLAH GN D NWLAIC QFGDFC +
Sbjct  112  APGPRLFLIILDSVFLTLATASAASAASIVYLAHNGNQDTNWLAICNQFGDFCAQ  166



>sp|P0DI62.1|CASP1_CYNCS RecName: Full=Casparian strip membrane protein 1; Short=CsCASP1 
[Cynara cardunculus var. scolymus]
Length=207

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 135/182 (74%), Gaps = 6/182 (3%)
 Frame = +2

Query  125  KSESTKIDVAESSKERKGKAPLLGALNVASDNK----AAPVAGGGYKKGLAIFDLILRIV  292
            +++ST I+V E+ KERKGKAPLL A   +S  K     AP   GGYK+GLA+FD++LR+ 
Sbjct  2    EADSTTINVTETPKERKGKAPLLAAPPASSGVKRVLQKAP--KGGYKRGLAVFDVVLRLA  59

Query  293  SvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSI  472
             +ATA+ A + M + ++TLPFFTQFFQF+A +DDLP F+FFVI+  I + YL L++P SI
Sbjct  60   GIATALGAAIAMGSTDQTLPFFTQFFQFKAEFDDLPAFTFFVIANAITAAYLALTIPISI  119

Query  473  VCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFC  652
            VCI R + V PR+ LI  DTV + L TAAAG +A+IVYLAH GN+DANW AICQQF D C
Sbjct  120  VCIIRPHLVAPRVLLIFLDTVMVALTTAAAGGTASIVYLAHNGNSDANWPAICQQFNDXC  179

Query  653  ER  658
            ++
Sbjct  180  QK  181



>emb|CDX73869.1| BnaA03g31780D [Brassica napus]
Length=204

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 130/179 (73%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST I+V AESS   KGKAPL+G   VA D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KNESTVINVPAESSSAMKGKAPLIG---VAKDHTTS--GSGGYKRGLSIFDFLLRLAAII  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QFEA YDDLPT+ FFVI+M IVSGYL+LSLP S+V I
Sbjct  57   AASVAAGTMFTSDETLPFFTQFLQFEAGYDDLPTYQFFVIAMSIVSGYLLLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT A+    AAA S+AAI YLAH GN + NWL ICQQFGDFC +
Sbjct  117  VRPLATAPRLLLLVLDTAALAFNMAAASSAAAISYLAHNGNQNTNWLPICQQFGDFCLK  175



>ref|XP_002871203.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7LZ50.1|CASP4_ARALL RecName: Full=Casparian strip membrane protein 4; Short=AlCASP4 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH47462.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=202

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 139/179 (78%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV AESS   KGKAPLLG   +A D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPAESSSAIKGKAPLLG---LARDHTGS----GGYKRGLSIFDFLLRLAAIV  54

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFV+++ IV+GYLVLSLPFS+V I
Sbjct  55   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVTGYLVLSLPFSVVTI  114

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  AV PR+ L++ DT A+ L TAAA ++AAIVYLAH GNT+ NWL ICQQFGDFC++
Sbjct  115  VRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQK  173



>ref|XP_010497100.1| PREDICTED: casparian strip membrane protein 2-like [Camelina 
sativa]
Length=204

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 132/179 (74%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K E+T IDV AESS   KGKAPL+G   VA D+ A     GGYK+GLAIFD +LR+ ++ 
Sbjct  2    KHEATIIDVPAESSSAMKGKAPLIG---VARDHTAT--GSGGYKRGLAIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI+M +V GYLVLSLP S+V I
Sbjct  57   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L  AAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  LRPLATAPRLLLLVLDTGVLALNMAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQK  175



>ref|XP_010486824.1| PREDICTED: casparian strip membrane protein 2 [Camelina sativa]
Length=204

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 132/179 (74%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K E+T IDV AESS   KGKAPL+G   VA D+ A     GGYK+GLAIFD +LR+ ++ 
Sbjct  2    KHEATIIDVPAESSSAMKGKAPLIG---VARDHTAT--GSGGYKRGLAIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI+M +V GYLVLSLP S+V I
Sbjct  57   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L  AAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  LRPLATAPRLLLLVLDTGVLALNMAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQK  175



>ref|XP_002530532.1| nitrate, fromate, iron dehydrogenase, putative [Ricinus communis]
 sp|B9SX13.1|CASP2_RICCO RecName: Full=Casparian strip membrane protein 2; Short=RcCASP2 
[Ricinus communis]
 gb|EEF31864.1| nitrate, fromate, iron dehydrogenase, putative [Ricinus communis]
Length=200

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 128/180 (71%), Gaps = 9/180 (5%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M KS+S  IDV ESS   K KAP +   N+  +N       GGYKKGLAIFD ILR+ ++
Sbjct  1    MMKSDSVAIDVPESSSVAKRKAPFMA--NIRDEN-------GGYKKGLAIFDFILRLGAI  51

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A A+ A  TM T++ETLPFFTQFFQF A YDD PTF FFVI+M +V+GYLVLSLPFSIV 
Sbjct  52   AAALGAASTMGTSDETLPFFTQFFQFNAGYDDFPTFQFFVIAMAMVAGYLVLSLPFSIVS  111

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +A GPR+ L I DTVA+TL  AA  ++A IVYLAH GN   NWLAIC QFGDFC  
Sbjct  112  ICRPHAAGPRILLFILDTVALTLNAAAGAAAADIVYLAHNGNQTTNWLAICLQFGDFCRE  171



>ref|XP_010464871.1| PREDICTED: casparian strip membrane protein 2-like [Camelina 
sativa]
Length=204

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 131/179 (73%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K E+T IDV AESS   KGKAPL+G   VA D+ A     GGYK+GLAIFD +LR+ ++ 
Sbjct  2    KHEATIIDVPAESSSAMKGKAPLIG---VARDHTAT--GSGGYKRGLAIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI+M +V GYLVLSLP S+V I
Sbjct  57   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L   AA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  LRPLATAPRLLLLVLDTGVLALNMGAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQK  175



>ref|NP_196238.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FFZ7.1|CASP4_ARATH RecName: Full=Casparian strip membrane protein 4; Short=AtCASP4 
[Arabidopsis thaliana]
 dbj|BAB09685.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED90983.1| uncharacterized protein AT5G06200 [Arabidopsis thaliana]
 gb|AEJ82283.1| casparian strip protein 4 [Cloning vector p35S::CASP4:GFP]
Length=202

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 139/179 (78%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV AESS   KGKAPLLG   +A D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPAESSSVIKGKAPLLG---LARDHTGS----GGYKRGLSIFDFLLRLAAIV  54

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFV+++ IV+GYLVLSLPFS+V I
Sbjct  55   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTI  114

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  AV PR+ L++ DT A+ L TAAA ++AAIVYLAH GNT+ NWL ICQQFGDFC++
Sbjct  115  VRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQK  173



>ref|XP_002882736.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7LAP2.1|CASP2_ARALL RecName: Full=Casparian strip membrane protein 2; Short=AlCASP2 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH58995.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KGKAPL+G   VA D+  +    GGY +GL+IFD +LR+ ++ 
Sbjct  2    KNESTTIDVPAESSSAMKGKAPLIG---VARDHTTS--GSGGYNRGLSIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI+M +V GYLVLSLP S+V I
Sbjct  57   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L TAAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  LRPLATAPRLLLLVLDTAVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQK  175



>ref|XP_009124886.1| PREDICTED: casparian strip membrane protein 2-like [Brassica 
rapa]
Length=204

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 130/179 (73%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KG APL+G   VA D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KNESTVIDVPAESSSAMKGSAPLIG---VARDHTTSD--SGGYKRGLSIFDFLLRLAAII  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF Q EA YDDLPTF FFVI+M ++SGYL+LSLPFS+V I
Sbjct  57   AASVAAGTMFTSDETLPFFTQFLQCEAGYDDLPTFQFFVIAMSMISGYLLLSLPFSVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT A+    AAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  VRPLATAPRLLLLVLDTAAMAFNMAAASSAAAIGYLAHNGNQNTNWLPICQQFGDFCQK  175



>ref|XP_009135174.1| PREDICTED: casparian strip membrane protein 2-like [Brassica 
rapa]
Length=204

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 129/179 (72%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST I+V AESS   KGKAPL+G   VA D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KNESTVINVPAESSSAMKGKAPLIG---VAKDHTTS--GSGGYKRGLSIFDFLLRLAAII  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QFEA YDDLPT+ FFVI+M IVSGYL+LSLP  +V I
Sbjct  57   AASVAAGTMFTSDETLPFFTQFLQFEAGYDDLPTYQFFVIAMSIVSGYLLLSLPIPVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT A+    AAA S+AAI YLAH GN + NWL ICQQFGDFC +
Sbjct  117  VRPLATAPRLLLLVLDTAALAFNMAAASSAAAISYLAHNGNQNTNWLPICQQFGDFCLK  175



>gb|EYU35527.1| hypothetical protein MIMGU_mgv1a014031mg [Erythranthe guttata]
Length=203

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 144/180 (80%), Gaps = 6/180 (3%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEKSE+T I++ E+S+E KGK PLL  +   +         G Y++G+AIFDLILR+ + 
Sbjct  1    MEKSEATTIEIGETSRESKGKTPLLAEVEQTART------AGSYRRGVAIFDLILRVSAA  54

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
             +A+AAT+TM T E+TLPFFTQFFQF+ASYDDLP F+FFVI++ IV+GYLVLS+PFS+VC
Sbjct  55   TSALAATITMGTTEQTLPFFTQFFQFQASYDDLPAFTFFVIALSIVTGYLVLSVPFSVVC  114

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            IA+  A  PR+ LI+ DT+ +TLATAAA SSAAIVYLAH GN DANWLAICQQFGDFC+R
Sbjct  115  IAQPLAAVPRLLLIVCDTLTVTLATAAASSSAAIVYLAHNGNADANWLAICQQFGDFCQR  174



>gb|AEJ82297.1| casparian strip protein 4 [Cloning vector pScarecrow::CASP4:mCherry]
Length=210

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 139/179 (78%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV AESS   KGKAPLLG   +A D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPAESSSVIKGKAPLLG---LARDHTGS----GGYKRGLSIFDFLLRLAAIV  54

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFV+++ IV+GYLVLSLPFS+V I
Sbjct  55   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTI  114

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  AV PR+ L++ DT A+ L TAAA ++AAIVYLAH GNT+ NWL ICQQFGDFC++
Sbjct  115  VRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQK  173



>ref|XP_010423379.1| PREDICTED: casparian strip membrane protein 4 [Camelina sativa]
Length=202

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 138/179 (77%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV AESS   KGKAPLLG   +A D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPAESSSAIKGKAPLLG---LARDHTGS----GGYKRGLSIFDFLLRLAAIV  54

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI++ IV+ YLVLSLPFS+V I
Sbjct  55   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAIAIVAAYLVLSLPFSVVTI  114

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  AV PR+ L++ DT A+ L TAAA ++AAIVYLAH GNT+ NWL ICQQFGDFC++
Sbjct  115  VRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQK  173



>sp|P0DI32.1|CASP1_TARKO RecName: Full=Casparian strip membrane protein 1; Short=TkCASP1 
[Taraxacum kok-saghyz]
Length=207

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 6/182 (3%)
 Frame = +2

Query  125  KSESTKIDVAESSKERKGKAPLLGALNVASDNKA----APVAGGGYKKGLAIFDLILRIV  292
            + EST +++ E+ KERKGKAPLL     +   K     AP   GGYK+GLA+FD++LRI 
Sbjct  2    EGESTAVNITETPKERKGKAPLLAPPPASGGIKTIVQKAP--KGGYKRGLAVFDVVLRIA  59

Query  293  SvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSI  472
             +A A+ A + M + ++TLPFFTQFFQF+A +DDLP F+FFVI+  I + YL LS+P SI
Sbjct  60   GIAAALGAVIAMGSTDQTLPFFTQFFQFKAEFDDLPVFTFFVIANAITAAYLALSIPISI  119

Query  473  VCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFC  652
            VCI R + VGPR+ L   DTV + L TAAAG +A+IVYLAH GN+DANW AICQQF DFC
Sbjct  120  VCIIRPHLVGPRVLLTFLDTVMVGLTTAAAGGAASIVYLAHNGNSDANWPAICQQFNDFC  179

Query  653  ER  658
            + 
Sbjct  180  QE  181



>ref|NP_187762.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9CAX3.1|CASP2_ARATH RecName: Full=Casparian strip membrane protein 2; Short=AtCASP2 
[Arabidopsis thaliana]
 gb|AAG51441.1|AC008153_14 unknown protein; 80797-81587 [Arabidopsis thaliana]
 gb|AAR24210.1| At3g11550 [Arabidopsis thaliana]
 gb|AAT06431.1| At3g11550 [Arabidopsis thaliana]
 gb|AEE75062.1| uncharacterized protein AT3G11550 [Arabidopsis thaliana]
 gb|AEJ82281.1| casparian strip protein 2 [Cloning vector pCASP2::CASP2:GFP]
 gb|AEJ82291.1| casparian strip protein 2 [Cloning vector p35S::CASP2:GFP]
Length=204

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KGKAPL+G   VA D+  +    GGY +GLAIFD +LR+ ++ 
Sbjct  2    KNESTFIDVPAESSSAMKGKAPLIG---VARDHTTS--GSGGYNRGLAIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI+M +V GYLVLSLP S+V I
Sbjct  57   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L TAAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  LRPLATAPRLLLLVLDTGVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQK  175



>ref|XP_007027844.1| Casparian strip membrane protein RCOM_1259260 [Theobroma cacao]
 gb|EOY08346.1| Casparian strip membrane protein RCOM_1259260 [Theobroma cacao]
Length=200

 Score =   154 bits (390),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 131/180 (73%), Gaps = 9/180 (5%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M+  +   IDV ESS   KGKAPL+       + K+      G+KKGL IFD +LR+ ++
Sbjct  1    MKSGDHAAIDVPESSAVAKGKAPLIAT---PREQKS------GFKKGLGIFDFLLRLGAI  51

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AA  TM T++ETLPFFTQFFQFEASYDDLPTF FFVI+M ++ GYLVLSLPFSIV 
Sbjct  52   IAALAAAATMGTSDETLPFFTQFFQFEASYDDLPTFMFFVIAMALIGGYLVLSLPFSIVT  111

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +AV PR+ L I D VA+TL TAA  ++AAIVYLAH GN + NWLAICQQFGDFC+ 
Sbjct  112  IVRPHAVAPRLLLFILDIVALTLTTAAGAAAAAIVYLAHNGNPNTNWLAICQQFGDFCQE  171



>sp|P0DI43.1|CASP1_THECC RecName: Full=Casparian strip membrane protein 1; Short=TcCASP1 
[Theobroma cacao]
Length=200

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 131/180 (73%), Gaps = 9/180 (5%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M+  +   IDV ESS   KGKAPL+       + K+      G+KKGL IFD +LR+ ++
Sbjct  1    MKSGDHAAIDVPESSAVAKGKAPLIAT---PREQKS------GFKKGLGIFDFLLRLGAI  51

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AA  TM T++ETLPFFTQFFQFEASYDDLPTF FFVI+M ++ GYLVLSLPFSIV 
Sbjct  52   IAALAAAATMGTSDETLPFFTQFFQFEASYDDLPTFMFFVIAMALIGGYLVLSLPFSIVT  111

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +AV PR+ L I D VA+TL TAA  ++AAIVYLAH GN + NWLAICQQFGDFC+ 
Sbjct  112  IVRPHAVAPRLLLFILDIVALTLTTAAGAAAAAIVYLAHNGNPNTNWLAICQQFGDFCQE  171



>gb|AEJ82299.1| casparian strip protein 2 [Cloning vector pScarecrow::CASP2:mCherry]
Length=212

 Score =   155 bits (391),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KGKAPL+G   VA D+  +    GGY +GLAIFD +LR+ ++ 
Sbjct  2    KNESTFIDVPAESSSAMKGKAPLIG---VARDHTTS--GSGGYNRGLAIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI+M +V GYLVLSLP S+V I
Sbjct  57   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L TAAA S+AAI YLAH GN + NWL ICQQFGDFC++
Sbjct  117  LRPLATAPRLLLLVLDTGVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQK  175



>ref|XP_008462597.1| PREDICTED: casparian strip membrane protein 1 [Cucumis melo]
 sp|P0DI61.1|CASP1_CUCME RecName: Full=Casparian strip membrane protein 1; Short=CmCASP1 
[Cucumis melo]
Length=209

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 137/189 (72%), Gaps = 19/189 (10%)
 Frame = +2

Query  119  MEKSESTKIDVAESSK------ERKGKAPLLGALNVASDNKAAPVAGGG---YKKGLAIF  271
            M+  EST ID+A  +       ++K   PLL          AAPV   G    K+GLAIF
Sbjct  1    MKTGESTAIDIAPETNNSGPIGKKKSTTPLL----------AAPVPDRGTHRMKRGLAIF  50

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LRI  +A+A+AA   M T+E+TLPFFTQFFQFEASYDDLPTF FFV++M +V+GY+V
Sbjct  51   DFVLRIGVLASALAAAAAMGTSEQTLPFFTQFFQFEASYDDLPTFQFFVVAMAVVAGYVV  110

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LS+PFSIVCI R +A GPR+ L+I D+VA+TL TAAAG++AA+V LAH GN+  NWLAIC
Sbjct  111  LSIPFSIVCIIRPHAAGPRVLLLILDSVALTLNTAAAGAAAAVVSLAHSGNSSTNWLAIC  170

Query  632  QQFGDFCER  658
             QFGDFC++
Sbjct  171  NQFGDFCQQ  179



>ref|XP_010452535.1| PREDICTED: casparian strip membrane protein 4-like [Camelina 
sativa]
Length=202

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 137/179 (77%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV AESS   KGKAPLLG   +A D+ A+    G YK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPAESSSAIKGKAPLLG---LARDHTAS----GSYKRGLSIFDFLLRLAAIV  54

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI++ IV+ YLVLSLP S+V I
Sbjct  55   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAIAIVAAYLVLSLPLSVVTI  114

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  AV PR+ L++ DT A+ L TAAA ++AAIVYLAH GNT+ NWL ICQQFGDFC++
Sbjct  115  VRPIAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQK  173



>gb|KFK25022.1| hypothetical protein AALP_AA8G056700 [Arabis alpina]
Length=202

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 138/179 (77%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV A+SS   KGKAPLLG   +A D+  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPADSSAAIKGKAPLLG---LARDHSGS----GGYKRGLSIFDFLLRLAAII  54

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI++ +V+GYLVLSLPFS++ I
Sbjct  55   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAVALVAGYLVLSLPFSVITI  114

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  AV PR+ L++ DT A+ L TAAA ++AAIVYLAH GN + NWL ICQQFGDFC++
Sbjct  115  IRPLAVAPRLLLLVLDTAALVLITAAASAAAAIVYLAHNGNQNTNWLPICQQFGDFCQK  173



>ref|XP_003519133.1| PREDICTED: casparian strip membrane protein 4-like [Glycine max]
 gb|KHN23087.1| Casparian strip membrane protein 4 [Glycine soja]
Length=194

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 129/175 (74%), Gaps = 11/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST IDV ESS   K K  L           AAP   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIDVPESSNVAKEKVVL-----------AAPSRSGGWKKGVAIMDFILRLGAIAAALG  50

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V+GYLVLSLPFSIV I R +
Sbjct  51   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVAGYLVLSLPFSIVAIIRPH  110

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            AVGPR+FLII DTV +TLATA+  S+AAIVYLAH GN D+NWLAIC QFGDFC +
Sbjct  111  AVGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQ  165



>ref|NP_001237259.1| casparian strip membrane protein 3 [Glycine max]
 sp|C6T1K6.1|CASP3_SOYBN RecName: Full=Casparian strip membrane protein 3; Short=GmCASP3 
[Glycine max]
 gb|ACU15456.1| unknown [Glycine max]
Length=195

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 130/175 (74%), Gaps = 10/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST IDV ES+   K K  LLGA       +  P   GG+KKG+AI D ILR+ ++A A  
Sbjct  2    STTIDVPESNNVAKEKVLLLGA-------RPRP---GGWKKGVAIMDFILRLGAIAAAPG  51

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V+GYLVLSLPFSIV I R +
Sbjct  52   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVAGYLVLSLPFSIVVIIRPH  111

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            AVGPR+FLII DTV +TLATA+  S+AAIVYLAH GN D+NWLAIC QFGDFC +
Sbjct  112  AVGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQ  166



>ref|XP_010491169.1| PREDICTED: casparian strip membrane protein 4-like [Camelina 
sativa]
Length=202

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 137/179 (77%), Gaps = 8/179 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV AESS   KGKAPLLG   +A ++  +    GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPAESSSAIKGKAPLLG---LAKEHTGS----GGYKRGLSIFDFLLRLAAIV  54

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QFEASYDDLPTF FFVI++ IV+ YLVLSLPFS+V I
Sbjct  55   AALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAIAIVAAYLVLSLPFSVVTI  114

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  AV PR+ L++ DT A+ L TAAA ++AAIVYLAH GNT+ NW  ICQQFGDFC++
Sbjct  115  VRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWFPICQQFGDFCQK  173



>ref|XP_007144399.1| hypothetical protein PHAVU_007G153000g [Phaseolus vulgaris]
 gb|ESW16393.1| hypothetical protein PHAVU_007G153000g [Phaseolus vulgaris]
Length=194

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 132/175 (75%), Gaps = 11/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST ID+ ESSK  KGKA ++           AP+  GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIDIPESSKVAKGKAVVV-----------APLRPGGWKKGVAIMDFILRLGAIAAALG  50

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V GYLVLSLPFS+V I R +
Sbjct  51   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVGGYLVLSLPFSVVAIVRPH  110

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            AVGPR+FLII DTV +TLATA+A S+AA+VYLAH G+ D NWLAIC QFGDFC +
Sbjct  111  AVGPRLFLIILDTVFLTLATASAASAAAVVYLAHNGDQDTNWLAICNQFGDFCAQ  165



>sp|P0DI51.1|CASP2_ERYGU RecName: Full=Casparian strip membrane protein 2; Short=MgCASP2 
[Erythranthe guttata]
Length=221

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 143/179 (80%), Gaps = 6/179 (3%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            MEKSE+T I++ E+S+E KGK PLL  +   +         G Y++G+AIFDLILR+ + 
Sbjct  1    MEKSEATTIEIGETSRESKGKTPLLAEVEQTART------AGSYRRGVAIFDLILRVSAA  54

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
             +A+AAT+TM T E+TLPFFTQFFQF+ASYDDLP F+FFVI++ IV+GYLVLS+PFS+VC
Sbjct  55   TSALAATITMGTTEQTLPFFTQFFQFQASYDDLPAFTFFVIALSIVTGYLVLSVPFSVVC  114

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
            IA+  A  PR+ LI+ DT+ +TLATAAA SSAAIVYLAH GN DANWLAICQQFGDFC+
Sbjct  115  IAQPLAAVPRLLLIVCDTLTVTLATAAASSSAAIVYLAHNGNADANWLAICQQFGDFCQ  173



>gb|KHN02602.1| Casparian strip membrane protein 4 [Glycine soja]
Length=195

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 131/175 (75%), Gaps = 10/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST IDV ES+   K K  LLGA       +  P   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIDVPESNNVAKEKVLLLGA-------RPRP---GGWKKGVAIMDFILRLGAIAAALG  51

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V+GYLVLSLPFSIV I R +
Sbjct  52   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVAGYLVLSLPFSIVVIIRPH  111

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            AVGPR+FLII DTV +TLATA+  S+AAIVYLAH GN D+NWLAIC QFGDFC +
Sbjct  112  AVGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQ  166



>ref|XP_004143331.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus]
 gb|KGN48281.1| hypothetical protein Csa_6G453800 [Cucumis sativus]
Length=211

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 137/189 (72%), Gaps = 17/189 (9%)
 Frame = +2

Query  119  MEKSESTKIDVAESSK------ERKGKAPLLGALNVASDNKAAPVAGGG---YKKGLAIF  271
            M+  EST ID+A  +       ++K   PLL A          PV   G    K+GL+IF
Sbjct  1    MKTGESTSIDIAPETNNSGPIGKKKSTTPLLAA--------PVPVTDRGTHRMKRGLSIF  52

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LRI  +A+A+AA  TM T+++TLPFFTQFFQFEASYDDLPTF FFV++M +V+GY+V
Sbjct  53   DFVLRIGVLASALAAAATMGTSDQTLPFFTQFFQFEASYDDLPTFQFFVVAMAVVAGYVV  112

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LS+PFSIVCI R +A GPR+ L+I D+VA+TL TAAAG++AA+V LAH GN+  NWLA+C
Sbjct  113  LSIPFSIVCIIRPHAAGPRVLLLILDSVALTLNTAAAGAAAAVVSLAHSGNSSTNWLAVC  172

Query  632  QQFGDFCER  658
             QFGDFC++
Sbjct  173  NQFGDFCQQ  181



>sp|P0DI39.1|CASP2_VIGUN RecName: Full=Casparian strip membrane protein 2; Short=VuCASP2 
[Vigna unguiculata]
Length=194

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 131/175 (75%), Gaps = 11/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST ID+ ESSK  KGK  +           AAP+  GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIDIPESSKVVKGKGVV-----------AAPLRPGGWKKGVAIMDFILRLGAIAAALG  50

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V GYLVLSLPFS+V I R +
Sbjct  51   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVGGYLVLSLPFSVVAIIRPH  110

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            AVGPR+FLII DTV +TLATA+A S+AA+VYLAH G+ D NWLAIC QFGDFC +
Sbjct  111  AVGPRLFLIILDTVFLTLATASAASAAAVVYLAHNGDQDTNWLAICNQFGDFCAQ  165



>ref|XP_004168080.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus]
Length=230

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 137/189 (72%), Gaps = 17/189 (9%)
 Frame = +2

Query  119  MEKSESTKIDVAESSK------ERKGKAPLLGALNVASDNKAAPVAGGG---YKKGLAIF  271
            M+  EST ID+A  +       ++K   PLL A          PV   G    K+GL+IF
Sbjct  1    MKTGESTSIDIAPETNNSGPIGKKKSTTPLLAA--------PVPVTDRGTHRMKRGLSIF  52

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LRI  +A+A+AA  TM T+++TLPFFTQFFQFEASYDDLPTF FFV++M +V+GY+V
Sbjct  53   DFVLRIGVLASALAAAATMGTSDQTLPFFTQFFQFEASYDDLPTFQFFVVAMAVVAGYVV  112

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LS+PFSIVCI R +A GPR+ L+I D+VA+TL TAAAG++AA+V LAH GN+  NWLA+C
Sbjct  113  LSIPFSIVCIIRPHAAGPRVLLLILDSVALTLNTAAAGAAAAVVSLAHSGNSSTNWLAVC  172

Query  632  QQFGDFCER  658
             QFGDFC++
Sbjct  173  NQFGDFCQQ  181



>ref|XP_007144398.1| hypothetical protein PHAVU_007G152900g [Phaseolus vulgaris]
 gb|ESW16392.1| hypothetical protein PHAVU_007G152900g [Phaseolus vulgaris]
Length=195

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 148/204 (73%), Gaps = 10/204 (5%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST +DV ESS   KGKA  +          A P  GGG KKG AI D ILR+ +VA ++ 
Sbjct  2    STTVDVPESSNVGKGKAIAV----------APPRPGGGLKKGAAIMDFILRLGAVAASLG  51

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V+GYLVLSLPFSIV I R +
Sbjct  52   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVAGYLVLSLPFSIVAIIRLH  111

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCERassav  673
              GPR+FLI  DTV +TLATA+  S+AAIVYLAH GN DANWLAIC QFGDFC + S AV
Sbjct  112  VAGPRLFLITLDTVFLTLATASGASAAAIVYLAHNGNQDANWLAICNQFGDFCAQTSGAV  171

Query  674  vvgfvtvvilivmvllsaCALRRR  745
            V   V VVIL+++V++SA ALRRR
Sbjct  172  VSSLVAVVILLLLVIMSALALRRR  195



>ref|XP_004516297.1| PREDICTED: casparian strip membrane protein 1-like [Cicer arietinum]
Length=195

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 127/177 (72%), Gaps = 12/177 (7%)
 Frame = +2

Query  128  SESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvata  307
            S ST IDV ESS   KGK  L+           AP   GG+KKG+AI D ILR+ ++A A
Sbjct  2    STSTTIDVPESS-NIKGKTTLV-----------APPRPGGWKKGMAIMDFILRLGAIAAA  49

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            + A  +M T+++TLPFFTQFFQFEASYD   TF FFVISM IV GYLVLSLPFSIV I R
Sbjct  50   LGAAASMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVISMAIVGGYLVLSLPFSIVAIIR  109

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             +A GPR+FLII DTV +TLAT+   S+A+IVYLAH GN D NWLAIC QFGDFC +
Sbjct  110  PHAKGPRLFLIILDTVFLTLATSCGASAASIVYLAHNGNQDTNWLAICNQFGDFCAQ  166



>ref|NP_001237549.1| casparian strip membrane protein 1 [Glycine max]
 sp|C6T2E7.1|CASP1_SOYBN RecName: Full=Casparian strip membrane protein 1; Short=GmCASP1 
[Glycine max]
 gb|ACU15802.1| unknown [Glycine max]
 gb|KHN42578.1| Casparian strip membrane protein 2 [Glycine soja]
Length=195

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 127/175 (73%), Gaps = 10/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST I++ ESSK  KGKA  +           AP   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIEIPESSKVAKGKAVAV----------VAPARPGGWKKGVAIMDFILRLGAIAAALG  51

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V GYLVLSLPFSIV I R +
Sbjct  52   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMSLVGGYLVLSLPFSIVAIVRPH  111

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            AVGPR+FLII DT  +TLATA   S+AAIVYLAH G+ D NWLAIC QFGDFC +
Sbjct  112  AVGPRLFLIILDTAFLTLATAGGASAAAIVYLAHNGDQDTNWLAICNQFGDFCAQ  166



>ref|XP_009372531.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Pyrus x bretschneideri]
Length=203

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 129/176 (73%), Gaps = 8/176 (5%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            +ST IDV E     KGK P+L   +V  +        GG K+G+AI DL+LRI ++  A+
Sbjct  6    DSTTIDV-EVRSASKGKGPVLAVHHVKEEK-------GGMKRGMAIIDLVLRIGAIVAAL  57

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I+M IV+GYLVLSLPFSIV I R 
Sbjct  58   AAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSIVAGYLVLSLPFSIVSIVRP  117

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+ L+I D VA+TL T+AAG++ +IVYLAH GN  +NWLAIC QFGDFC  
Sbjct  118  HASGPRLLLLILDLVALTLVTSAAGAATSIVYLAHNGNASSNWLAICNQFGDFCRN  173



>ref|XP_008391938.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057 
[Malus domestica]
Length=205

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 133/176 (76%), Gaps = 8/176 (5%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST ID+ E+    KGK P++   +V  +        GG ++G+AI DL+LRI ++  A+
Sbjct  8    ESTTIDI-EARSASKGKGPVMAVHHVKKEK-------GGMERGMAIIDLVLRIGAIVAAL  59

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I+M +V+GYLVLSLPFS+VCI R 
Sbjct  60   AAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVAGYLVLSLPFSVVCIVRP  119

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+ L+I D VA+TLAT+AAG++ +IVYLAH GN+ +NWLAIC QFGDFC  
Sbjct  120  HASGPRLLLLILDLVALTLATSAAGAATSIVYLAHNGNSSSNWLAICNQFGDFCRN  175



>ref|XP_009349510.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Pyrus x bretschneideri]
 ref|XP_009349562.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Pyrus x bretschneideri]
Length=204

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 133/176 (76%), Gaps = 8/176 (5%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST ID+ E+    KGK P++   +V  +        GG +KG+AI DL+LRI ++  A+
Sbjct  7    ESTTIDI-EARSASKGKGPVMAVHHVKEEK-------GGMQKGMAIIDLVLRIGAIMAAL  58

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I+M +V+GYLVLSLPFS+VCI R 
Sbjct  59   AAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVAGYLVLSLPFSVVCIVRP  118

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+ L+I D VA+TLAT+AAG++ +IVYLAH GN  +NWLAIC QFGDFC+ 
Sbjct  119  HASGPRLLLLILDLVALTLATSAAGAATSIVYLAHNGNASSNWLAICNQFGDFCKN  174



>ref|XP_009373039.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Pyrus x bretschneideri]
Length=204

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 132/176 (75%), Gaps = 8/176 (5%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST ID+ E+    KGK P++   +V  +        GG ++G+AI DL+LRI ++  A+
Sbjct  7    ESTTIDI-EARSASKGKGPVMAVHHVKEEK-------GGMQRGMAIIDLVLRIGAIMAAL  58

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA   M T+++ LPFFTQFFQFEASYDD+P+F FF+I+M +V+GYLVLSLPFS+VCI R 
Sbjct  59   AAAAIMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVAGYLVLSLPFSVVCIVRP  118

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+ L+I D VA+TLAT+AAG++ +IVYLAH GN  +NWLAIC QFGDFC+ 
Sbjct  119  HASGPRLLLLILDLVALTLATSAAGAATSIVYLAHNGNASSNWLAICNQFGDFCKN  174



>ref|XP_003519136.1| PREDICTED: casparian strip membrane protein 1-like [Glycine max]
 gb|KHN42577.1| Casparian strip membrane protein 1 [Glycine soja]
Length=194

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 128/175 (73%), Gaps = 11/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST IDV ESS   KGKA L           AAP   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIDVPESSNVAKGKAVL-----------AAPPRPGGWKKGVAIMDFILRLGAIAAALG  50

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   +F FFVI+M +V GYLVLSLPFS V I R +
Sbjct  51   AAATMGTSDQTLPFFTQFFQFEASYDSFTSFQFFVITMALVGGYLVLSLPFSFVAIIRPH  110

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A GPR+FLII DTV +TLATA+  S+AAIVYLAH GN D+NWLAIC QFGDFC +
Sbjct  111  AAGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQ  165



>ref|XP_008359498.1| PREDICTED: LOW QUALITY PROTEIN: casparian strip membrane protein 
POPTRDRAFT_763057-like [Malus domestica]
Length=203

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 131/176 (74%), Gaps = 8/176 (5%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            +ST IDV E+    KGK P+L   +V  +        GG K+G+AI DL+LRI ++  A+
Sbjct  6    DSTTIDV-EARSPSKGKGPVLAVHHVKEEK-------GGMKRGMAIIDLVLRIGAIVAAL  57

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I+M IV+GYLVLSLPFSIV I R 
Sbjct  58   AAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSIVAGYLVLSLPFSIVSIVRP  117

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+ L+I D VA+TLAT+AAG++ +IVYLAH GN  +NWLAIC QFGDFC  
Sbjct  118  HASGPRLLLLILDLVALTLATSAAGAATSIVYLAHNGNASSNWLAICNQFGDFCRN  173



>gb|KEH41980.1| casparian strip membrane protein [Medicago truncatula]
Length=196

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 11/176 (6%)
 Frame = +2

Query  134  STKIDVAESSKER-KGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            ST ID+AESS      KA L+GA          P   GG+KKG+AI D +LR+ ++A ++
Sbjct  2    STTIDMAESSNAHVNEKAALIGA----------PARPGGWKKGIAIMDFVLRLGAIAASL  51

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AAT+TMAT+++ LPFFTQF QFEASYD   TF FFVI+M  V GYLVLSLPFSIV I R 
Sbjct  52   AATITMATSDQILPFFTQFLQFEASYDSFSTFQFFVIAMAFVGGYLVLSLPFSIVTIIRP  111

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+FLII DTV +TLATA+  S+AA+V LAH GN D+NWLAIC QFGDFC +
Sbjct  112  HAPGPRLFLIILDTVFLTLATASGASAAAMVSLAHNGNQDSNWLAICNQFGDFCAQ  167



>emb|CDX84579.1| BnaA03g16510D [Brassica napus]
Length=206

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST ID+ E S   K  +     ++    +     AGGGYK+GL IFD +LR+ ++   I
Sbjct  4    ESTTIDIGEPSTVTKSTSH--AVVDEKKKSFVTAAAGGGYKRGLTIFDFLLRLAAIGITI  61

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A+  M TAEETLPFFTQF QF+A YDD PTF FFVI++ IV+ YLVLSLPFSIV I R 
Sbjct  62   GASSVMFTAEETLPFFTQFLQFQAGYDDFPTFQFFVIAIAIVASYLVLSLPFSIVTIVRP  121

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             AV PR+ L+I+DTV +TL TAAA ++A+IVYLAH GNT+ NWL ICQQFGDFC+
Sbjct  122  LAVAPRLILLISDTVVLTLTTAAAAAAASIVYLAHNGNTNTNWLPICQQFGDFCQ  176



>gb|KHN02600.1| Casparian strip membrane protein 1 [Glycine soja]
Length=194

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 127/175 (73%), Gaps = 11/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST IDV ESS   KGKA L+           AP   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIDVPESSNVAKGKAVLV-----------APPRPGGWKKGVAIMDFILRLGAIAAALG  50

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   +F FFVI+M +V GYLVLSLPFS V I R +
Sbjct  51   AAATMGTSDQTLPFFTQFFQFEASYDSFTSFQFFVITMALVGGYLVLSLPFSFVAIIRPH  110

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A GPR+FLII DTV +TL TA+  S+AAIVYLAH GN D+NWLAIC QFGDFC +
Sbjct  111  AAGPRLFLIILDTVFLTLTTASGASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQ  165



>sp|P0DI40.1|CASP1_VIGUN RecName: Full=Casparian strip membrane protein 1; Short=VuCASP1 
[Vigna unguiculata]
Length=192

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 126/175 (72%), Gaps = 13/175 (7%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST +DV ESS   KGKA              A    GG+KKGLAI D ILR+  +A ++ 
Sbjct  2    STTVDVPESSNVAKGKA-------------IAVARPGGWKKGLAIMDFILRLGGIAASLG  48

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V+GYLVLSLPFS+V I R +
Sbjct  49   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVAGYLVLSLPFSVVAIIRPH  108

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A GPR+FLII DTV +TLATA+  S+AAIVYLAH GN D+NWLAIC QFGDFC +
Sbjct  109  APGPRLFLIILDTVFLTLATASGASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQ  163



>ref|XP_004300108.1| PREDICTED: casparian strip membrane protein RCOM_1259250-like 
[Fragaria vesca subsp. vesca]
Length=215

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 138/186 (74%), Gaps = 6/186 (3%)
 Frame = +2

Query  119  MEKSESTKI--DVAESSKERKGKAPLLGALNV----ASDNKAAPVAGGGYKKGLAIFDLI  280
            M +S+S  +    AESS  R+  A    A +V    A+D K     G G+KKG+A+ D I
Sbjct  1    MNRSDSAPMISTHAESSSSRRKAAHKDEAYHVMRVLAADPKHDHNKGAGWKKGVAVLDFI  60

Query  281  LRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSL  460
            LR+ + A A+ ATVTMA++E+TLPFFTQFFQF A YDD+PTF+FFVI+M IVSGYLVLSL
Sbjct  61   LRLGATAAALGATVTMASSEQTLPFFTQFFQFSAGYDDMPTFTFFVIAMAIVSGYLVLSL  120

Query  461  PFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQF  640
            PFSIV I R   V PR+ L+I DTVA+TL T+AA ++AAIVYLAH G++DANWLAICQQF
Sbjct  121  PFSIVSIVRPKLVAPRLLLLIFDTVALTLNTSAAAAAAAIVYLAHNGSSDANWLAICQQF  180

Query  641  GDFCER  658
             DFC++
Sbjct  181  TDFCQQ  186



>emb|CDX79653.1| BnaC03g19890D [Brassica napus]
Length=206

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST ID+ E+S   K  +  L          AAP  GGGYK+GL IFD +LR+ ++   I
Sbjct  4    ESTTIDIGETSTVTKSTSHALVDEKKKGFVTAAP--GGGYKRGLTIFDFLLRLAAIGITI  61

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A+  M TAEETLPFFTQF QF+A YDD PTF FFVI++ IV+ YLVLSLPFSIV I R 
Sbjct  62   GASSVMFTAEETLPFFTQFLQFQAGYDDFPTFQFFVIAIAIVASYLVLSLPFSIVTIVRP  121

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             AV PR+ L+I+DTV +TL TAAA ++A+IVYLAH GN + NWL ICQQFGDFC+
Sbjct  122  LAVAPRLILLISDTVVLTLTTAAAAAAASIVYLAHNGNANTNWLPICQQFGDFCQ  176



>ref|XP_007015764.1| Casparian strip membrane protein 3, putative [Theobroma cacao]
 gb|EOY33383.1| Casparian strip membrane protein 3, putative [Theobroma cacao]
Length=207

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 6/179 (3%)
 Frame = +2

Query  122  EKSESTKIDVAESSKER-KGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            ++S  T I++   +K   KGKAP+     V S  KA     GG KKG+AI D +LR+ ++
Sbjct  4    DRSGETAINIIPGTKANGKGKAPV-----VVSSTKAVEQPKGGLKKGIAICDFLLRLCAI  58

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+ AT TM T  ETLPFFTQF QF+A Y+D+P F FFVI+  IV+GYL+LSLPFSI+C
Sbjct  59   GAALGATATMGTTAETLPFFTQFLQFQAQYNDIPAFQFFVIANAIVAGYLLLSLPFSIIC  118

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
            I R YA  PR+ L+I DTV   L  A+A +SA+IVYLAH GN + NWLAICQQFGDFC 
Sbjct  119  IIRPYATAPRLLLVIFDTVMAGLTIASASASASIVYLAHYGNPNTNWLAICQQFGDFCR  177



>gb|KFK36497.1| hypothetical protein AALP_AA4G132200 [Arabis alpina]
Length=205

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST IDV E S   K  + ++         ++  VA  G K+GLAIFD +LR+ +++  +
Sbjct  4    ESTTIDVGEPSNVTKSSSHIVVD---GKKKRSFVVANAGGKRGLAIFDFLLRLAAISATL  60

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA++ M +AEETLPFFTQF QF+ASYDDLPTF FFVI++ IV+ YLVLSLPFSIV I R 
Sbjct  61   AASIVMFSAEETLPFFTQFLQFQASYDDLPTFQFFVIAVAIVASYLVLSLPFSIVTIVRP  120

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             AV PR+ L+I DT+ +TL TAAA SSAAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  121  LAVAPRLVLLIFDTLVVTLNTAAAASSAAIVYLAHNGNQNTNWLPICQQFGDFCQ  175



>ref|XP_009133064.1| PREDICTED: casparian strip membrane protein 1 [Brassica rapa]
Length=206

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST ID+ E S   K  +     ++    +     AGGGYK+GL IFD +LR+ ++   I
Sbjct  4    ESTTIDIGEPSTVTKSTSH--AVVDEKKKSFVTAAAGGGYKRGLTIFDFLLRLAAIGITI  61

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A+  M TAEETLPFFTQF QF+A YDD PTF FFVI++ IV+ YLVLSLPFSIV I R 
Sbjct  62   GASSVMFTAEETLPFFTQFLQFQAGYDDFPTFQFFVIAIAIVASYLVLSLPFSIVTIVRP  121

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             AV PR+ L+I+DTV +TL TAAA ++A+IVYLAH GN + NWL ICQQFGDFC+
Sbjct  122  LAVAPRLILLISDTVVLTLTTAAAAAAASIVYLAHNGNANTNWLPICQQFGDFCQ  176



>ref|NP_001242417.1| casparian strip membrane protein 2 [Glycine max]
 sp|C6TFL9.1|CASP2_SOYBN RecName: Full=Casparian strip membrane protein 2; Short=GmCASP2 
[Glycine max]
 gb|ACU20621.1| unknown [Glycine max]
Length=194

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 126/175 (72%), Gaps = 11/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST IDV ESS   KGKA L+           AP   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIDVPESSNVAKGKAVLV-----------APPRPGGWKKGVAIMDFILRLGAIAAALG  50

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQF QFEASYD   +F FFVI+M +V GYLVLSLPFS V I R +
Sbjct  51   AAATMGTSDQTLPFFTQFLQFEASYDSFTSFQFFVITMALVGGYLVLSLPFSFVAIIRPH  110

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A GPR+FLII DTV +TL TA+  S+AAIVYLAH GN D+NWLAIC QFGDFC +
Sbjct  111  AAGPRLFLIILDTVFLTLTTASGASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQ  165



>gb|KDP39843.1| hypothetical protein JCGZ_04188 [Jatropha curcas]
Length=213

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 144/210 (69%), Gaps = 2/210 (1%)
 Frame = +2

Query  122  EKS-ESTKIDVAESSKERKGKA-PLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVS  295
            EKS E   I + ++  + K K   + GA  + +         GG+KKG AIFD +LR+ +
Sbjct  4    EKSGEEATITIQDTKTDPKSKGKAIAGATGLVTSKATYMQQKGGWKKGAAIFDFVLRLCA  63

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            +   +AAT  M T E++LPFFTQFFQF A YDD+ TF FF  + GI SGYLVLSLPFSIV
Sbjct  64   ITAGLAATSIMGTTEQSLPFFTQFFQFHAEYDDIETFRFFTFANGIASGYLVLSLPFSIV  123

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
            CI R YA GPR+FLII D+VA+ L  AAA ++ AI YLAH GN+DANW AIC QF DFC+
Sbjct  124  CIVRPYATGPRLFLIIFDSVAMALIVAAASAATAIAYLAHNGNSDANWNAICNQFTDFCQ  183

Query  656  RassavvvgfvtvvilivmvllsaCALRRR  745
             +SSA+V  F+  V+L+ +++LSA ALRR 
Sbjct  184  SSSSAIVASFIAAVMLLFLIILSAVALRRN  213



>gb|KEH41983.1| casparian strip membrane protein [Medicago truncatula]
Length=194

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 126/175 (72%), Gaps = 11/175 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST IDV ESS   K K  L+           AP   GG+KKG AI D ILR+ ++A AIA
Sbjct  2    STTIDVPESSNINKEKTILV-----------APARPGGWKKGTAIMDFILRLGAIAAAIA  50

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  +M T+++TLPFFTQFFQFEASYD   TF FFVISM I + YLVLSLPFSIV I R +
Sbjct  51   AAASMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVISMAIAASYLVLSLPFSIVAIIRPH  110

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A GPR+FLII DTV +TLAT++A ++A+IVYLAH GN D NWLAIC QFGDFC +
Sbjct  111  APGPRLFLIILDTVFLTLATSSAAAAASIVYLAHNGNQDTNWLAICNQFGDFCAQ  165



>ref|XP_004149191.1| PREDICTED: casparian strip membrane protein RCOM_1259250-like 
[Cucumis sativus]
 ref|XP_004161216.1| PREDICTED: casparian strip membrane protein RCOM_1259250-like 
[Cucumis sativus]
 gb|KGN59158.1| hypothetical protein Csa_3G777660 [Cucumis sativus]
Length=203

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 131/180 (73%), Gaps = 10/180 (6%)
 Frame = +2

Query  122  EKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAP-VAGGGYKKGLAIFDLILRIVSv  298
               +ST IDV  ++   K KA +         + AAP  A GG K+GL+IFD +LR+ ++
Sbjct  3    NSGDSTVIDVPPTAASSKKKAVV---------STAAPGQASGGVKRGLSIFDFVLRLGAL  53

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+ A   M T++ETLPFFTQFFQFEASYDDLPTF FF+I+MGIV+GYL LSLPFSIVC
Sbjct  54   GAALGAAAAMGTSDETLPFFTQFFQFEASYDDLPTFQFFLIAMGIVAGYLALSLPFSIVC  113

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R  AVG R+ L+I DTV +TLAT+AA ++AAIVYLAH GNT  NWLAIC QF DFC++
Sbjct  114  IVRPRAVGLRLLLLILDTVVLTLATSAAAAAAAIVYLAHDGNTSTNWLAICDQFDDFCQK  173



>ref|XP_006481869.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Citrus sinensis]
Length=198

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 134/177 (76%), Gaps = 9/177 (5%)
 Frame = +2

Query  128  SESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvata  307
            S+S  +DV ESS   KGKAPL+G   V    KA      GYKKG+AIFD ILRI ++   
Sbjct  2    SDSATVDVPESSSAAKGKAPLIG---VPRREKA------GYKKGIAIFDFILRIGALVCT  52

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            +AA   M T++ETLPFFTQFFQF+ASYDDLPTF +FVI+M +V GYLVLSLPFSIV I R
Sbjct  53   LAAATAMGTSDETLPFFTQFFQFQASYDDLPTFQYFVIAMALVGGYLVLSLPFSIVTIVR  112

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             +AVGPR+ L+I DTV +T ATAAA ++AAIVYLAH GN + NW AICQQFGDFC++
Sbjct  113  PHAVGPRLLLLILDTVTLTFATAAAAAAAAIVYLAHNGNQNTNWFAICQQFGDFCQK  169



>emb|CDY01034.1| BnaC05g41660D [Brassica napus]
Length=204

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 130/179 (73%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KGKAPL+G   VA D+  +    GGY +GL+IFD +LR+ ++ 
Sbjct  2    KNESTFIDVPAESSSAMKGKAPLIG---VAKDHTTS--GSGGYNRGLSIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QFEA YDDLPTF FFVI+M +V+GY+VLSLP S+V I
Sbjct  57   AASVAAGTMFTSDETLPFFTQFLQFEAGYDDLPTFQFFVIAMSMVAGYIVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L  AAA S+AAI Y+AH GN + NWL ICQQFGDFC++
Sbjct  117  VRPLAAAPRLLLLVLDTAIMGLTMAAASSAAAISYVAHNGNQNTNWLPICQQFGDFCQK  175



>emb|CDX75071.1| BnaA05g08170D [Brassica napus]
Length=206

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK----AAPVAGGGYKKGLAIFDLILRIVSv  298
            EST I+V E S   K  +      +V  D K     A  AGGGYK+GLAIFD +LR+ ++
Sbjct  4    ESTTIEVGEPSTVTKSTS------HVVVDEKKKGFVAATAGGGYKRGLAIFDFLLRLAAI  57

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
             T I A+  M TAEETLPFFTQF QF+A YDD  TF FFVI++ +V+ YLVLSLPFSIV 
Sbjct  58   VTTITASSVMYTAEETLPFFTQFLQFQAGYDDFATFQFFVIAIAMVASYLVLSLPFSIVT  117

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
            + R  AV PR+ L+I+DTVA+TLAT+AA ++AAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  VIRPLAVAPRLILLISDTVAVTLATSAAAAAAAIVYLAHNGNPNTNWLPICQQFGDFCQ  176



>emb|CDX84159.1| BnaC04g09210D [Brassica napus]
Length=207

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 124/180 (69%), Gaps = 11/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            EST I+V E S   K  +      +V  D K         AGGGYK+GLAIFD +LR+ +
Sbjct  4    ESTTIEVGEPSTMTKSTS------HVVVDEKKKKGFVVATAGGGYKRGLAIFDFLLRLAA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
              T I A+  M TAEETLPFFTQF QF+A YDD  TF FFVI++ +V+ YLVLSLPFSIV
Sbjct  58   TVTTITASSVMYTAEETLPFFTQFLQFQAGYDDFATFQFFVIAIAMVASYLVLSLPFSIV  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  A  PR+ L+++DTV +TL T+AA ++AAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  TIIRPLAAAPRLILLVSDTVVVTLTTSAAAAAAAIVYLAHNGNPNTNWLPICQQFGDFCQ  177



>sp|P0DI45.1|CASP1_RAPSA RecName: Full=Casparian strip membrane protein 1; Short=RsCASP1 
[Raphanus sativus]
Length=213

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 128/180 (71%), Gaps = 10/180 (6%)
 Frame = +2

Query  128  SESTKIDVAESSKERKGKAPLLGALNVASDNK----AAPVAGGGYKKGLAIFDLILRIVS  295
            +EST I++ ESS   K  +      +V  D K     A  AGGGYK+GLAIFD +LR+ +
Sbjct  3    NESTTIEIGESSTMTKRTS------HVVVDEKKKGFVAATAGGGYKRGLAIFDFLLRLAA  56

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            + T I A+  M TAEETLPFFTQF QF+A YDD  TF FFVIS+ +V+ YLVLSLPFSIV
Sbjct  57   IVTTITASSVMYTAEETLPFFTQFLQFQAGYDDFATFQFFVISIAMVASYLVLSLPFSIV  116

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  A  PR+ L+I+DTV +TL TAAA ++AAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  117  SIIRPLAAAPRLILLISDTVVVTLTTAAAAAAAAIVYLAHNGNPNTNWLPICQQFGDFCQ  176



>sp|P0DI47.1|CASP3_RAPSA RecName: Full=Casparian strip membrane protein 3; Short=RsCASP3 
[Raphanus sativus]
Length=204

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 131/179 (73%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV A+SS   KGKAPL+G   VA D+ A+    GGY +GL+IFD +LR+ ++ 
Sbjct  2    KNESTFIDVPADSSSAMKGKAPLIG---VAKDHTAS--GSGGYNRGLSIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QF+A YDDLPTF FFVISM +VSGY+VLSLP S+V I
Sbjct  57   AASVAAGTMFTSDETLPFFTQFLQFQAGYDDLPTFQFFVISMSLVSGYIVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L  AAA S+AAI Y+AH GN + NWL ICQQFGDFC++
Sbjct  117  VRPLAAAPRLLLLVLDTAVMGLTMAAASSAAAISYVAHNGNQNTNWLPICQQFGDFCQK  175



>ref|XP_004515966.1| PREDICTED: casparian strip membrane protein 2-like [Cicer arietinum]
Length=192

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 13/175 (7%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST I+V ESS E   KA L+          A+P   GG+KKG+AI D ILR+ ++A+++A
Sbjct  2    STIINVGESSNE---KAALI----------ASPARPGGWKKGIAIMDFILRLGAIASSLA  48

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A +TMAT+++ LPFFTQFFQFEASYD   TF FFVI+M  V GYLVLSLPFSIV I R +
Sbjct  49   AAITMATSDQILPFFTQFFQFEASYDSFSTFQFFVITMAFVGGYLVLSLPFSIVTIIRPH  108

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A+GPR+FLII D V +TLATA+  S+AAIVYLAH GN D+NWLAIC QF DFC +
Sbjct  109  AIGPRLFLIILDIVFLTLATASGASAAAIVYLAHNGNQDSNWLAICNQFEDFCSQ  163



>sp|P0DI57.1|CASP5_LOTJA RecName: Full=Casparian strip membrane protein 5; Short=LjCASP5 
[Lotus japonicus]
 gb|AFK37522.1| unknown [Lotus japonicus]
Length=197

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 124/175 (71%), Gaps = 9/175 (5%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST ID+  SSK  K   P+L            P   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIDMPGSSKAAKAGKPVL---------VTTPSRPGGWKKGVAIMDFILRLGAIAAALG  52

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM  +++TLPFFTQFFQFEASYD   TF FFVI+M +V+GYLVLSLP SIV + R +
Sbjct  53   AAATMGLSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVAGYLVLSLPLSIVAVVRPH  112

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A GPR+FLII DTV +TLATA+  S+A+IVYLAH GN D NW+AIC QFGDFC +
Sbjct  113  AAGPRLFLIILDTVFLTLATASGASAASIVYLAHNGNQDTNWIAICNQFGDFCAQ  167



>ref|XP_006407435.1| hypothetical protein EUTSA_v10021542mg [Eutrema salsugineum]
 gb|ESQ48888.1| hypothetical protein EUTSA_v10021542mg [Eutrema salsugineum]
Length=204

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 130/179 (73%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KGKAPL+G   V+ D+  A    GGYK+G++IFD +LR+ ++ 
Sbjct  2    KNESTIIDVPAESSSAMKGKAPLIG---VSRDH--ATTGSGGYKRGISIFDFLLRLAAII  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QF+A YDDLP+F FFVI+M ++ GYLVLSLP S+V I
Sbjct  57   AASVAAATMFTSDETLPFFTQFLQFQAGYDDLPSFQFFVIAMSMIVGYLVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  +   TAA  S+AAIVYLAH GN + NWL ICQQFGDFC++
Sbjct  117  VRPLAAAPRLLLLVLDTAVLAFNTAAGSSAAAIVYLAHNGNQNTNWLPICQQFGDFCQK  175



>ref|XP_010509510.1| PREDICTED: casparian strip membrane protein 1-like [Camelina 
sativa]
Length=207

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 124/181 (69%), Gaps = 11/181 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            EST IDV E S   K  +      +V  D K      A   GGG K+GLAIFD +LR+ +
Sbjct  4    ESTTIDVGEPSTVTKSSS------HVVVDGKKKKGFVATATGGGAKRGLAIFDFLLRLGA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            +A  I A   M TAEETLPFFTQF QF+A YDDLP F FFVI++ IV+ YLVLSLPFSI+
Sbjct  58   IAVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQFFVIAVAIVASYLVLSLPFSII  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  AV PR+ L+I DT+ +TL T+AA ++A+IVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  AIIRPLAVAPRLVLLICDTLVVTLNTSAAAAAASIVYLAHNGNPNTNWLPICQQFGDFCQ  177

Query  656  R  658
             
Sbjct  178  N  178



>ref|XP_010245909.1| PREDICTED: casparian strip membrane protein 2-like [Nelumbo nucifera]
Length=222

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 130/192 (68%), Gaps = 12/192 (6%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKE-----RKGKAP-------LLGALNVASDNKAAPVAGGGYKKGL  262
            M+  ++T I+++E S E      KGK+                +  KA  +A GG+KKGL
Sbjct  1    MKSGDATAINISEPSSESKVSDTKGKSTTAETKGKAAAGAPAVATTKATKIARGGWKKGL  60

Query  263  AIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSG  442
            AIFD ILRI+++   + A ++M T ++TLP FTQFFQF+ASY DLP F+FFVI+  I +G
Sbjct  61   AIFDFILRILAIGATLGAAISMGTTDQTLPIFTQFFQFQASYSDLPAFTFFVIANAIAAG  120

Query  443  YLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWL  622
            YLVLS+PFSIV I R   VG R+ L+I DTV + L  A AGS+AAIVYLAH GN+ ANW+
Sbjct  121  YLVLSIPFSIVGIVRPNIVGARLLLLIFDTVMVALTAAGAGSAAAIVYLAHTGNSSANWV  180

Query  623  AICQQFGDFCER  658
            AICQQF DFC++
Sbjct  181  AICQQFDDFCQQ  192



>ref|XP_008387040.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_576556-like 
[Malus domestica]
Length=205

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 130/180 (72%), Gaps = 14/180 (8%)
 Frame = +2

Query  131  ESTKIDVA--ESSKERKGKAPLLGALNVASDNKAAPV--AGGGYKKGLAIFDLILRIVSv  298
            +ST IDV   E S   KGK P+L            PV    GG K+G+AI DL+LR  ++
Sbjct  6    DSTTIDVVAHEGSGTSKGKGPIL----------MVPVKEGKGGMKRGMAIIDLVLRSGAI  55

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
             +A+AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I+M +V+GYLVLS+PF+IV 
Sbjct  56   VSALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVAGYLVLSIPFAIVS  115

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +A GPR+ L+I D VA+TLAT+AAG++ +IVYLAH GN  +NWLAIC QFGDFC  
Sbjct  116  IVRPHASGPRLLLLILDVVALTLATSAAGAATSIVYLAHNGNASSNWLAICNQFGDFCRN  175



>ref|XP_010093771.1| hypothetical protein L484_019174 [Morus notabilis]
 gb|EXB54604.1| hypothetical protein L484_019174 [Morus notabilis]
Length=194

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 11/172 (6%)
 Frame = +2

Query  143  IDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatv  322
            IDVAE S   KGKA ++ A + A            +KKG AI D +LR+ ++A+A+AA  
Sbjct  5    IDVAEPSSSAKGKAVIVAAPHPAK-----------WKKGTAIIDFVLRLGAIASALAAAA  53

Query  323  tmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVG  502
            TM T++E+LPFFTQFFQFEASYDD+PTF FF+I M  VSGYLVLSLPFSIV I R +AVG
Sbjct  54   TMGTSDESLPFFTQFFQFEASYDDMPTFQFFLIGMAFVSGYLVLSLPFSIVAIVRPHAVG  113

Query  503  PRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R+FLII DTVA+TLAT+A  ++AAIVYLAH GN+ +NWLAIC QF DFC++
Sbjct  114  IRLFLIIMDTVALTLATSAGAAAAAIVYLAHNGNSSSNWLAICNQFTDFCQK  165



>ref|XP_006430137.1| hypothetical protein CICLE_v10013511mg [Citrus clementina]
 gb|ESR43377.1| hypothetical protein CICLE_v10013511mg [Citrus clementina]
Length=198

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 133/177 (75%), Gaps = 9/177 (5%)
 Frame = +2

Query  128  SESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvata  307
            S+S  +DV ESS   KGKAPL+G   V    KA      GYKKG+AIFD ILRI ++   
Sbjct  2    SDSATVDVPESSSAAKGKAPLIG---VPRREKA------GYKKGIAIFDFILRIGALVCT  52

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            +AA   M T++ETLPFFTQFFQF+ASYDDLPTF +FVI+M +V GYLVLSLP SIV I R
Sbjct  53   LAAATAMGTSDETLPFFTQFFQFQASYDDLPTFQYFVIAMALVGGYLVLSLPISIVTIVR  112

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             +AVGPR+ L+I DTV +T ATAAA ++AAIVYLAH GN + NW AICQQFGDFC++
Sbjct  113  PHAVGPRLLLLILDTVTLTFATAAAAAAAAIVYLAHNGNQNTNWFAICQQFGDFCQK  169



>ref|XP_009146708.1| PREDICTED: casparian strip membrane protein 2 [Brassica rapa]
Length=201

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 149/208 (72%), Gaps = 9/208 (4%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KGK+PL+G   VA D+       GGY +GL+IFD +LR+ ++ 
Sbjct  2    KNESTFIDVPAESSSAMKGKSPLIG---VAKDHTT-----GGYNRGLSIFDFLLRLAAIV  53

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QFEA YDDLPTF FFVI+M +V+GY+VLSLP S+V I
Sbjct  54   AASVAAGTMFTSDETLPFFTQFLQFEAGYDDLPTFQFFVIAMSMVAGYIVLSLPISVVTI  113

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCERa  661
             R  A  PR+ L++ DT  + L  AAA S+AAI Y+AH GN + NWL ICQQFGDFC++ 
Sbjct  114  VRPLAAAPRLLLLVLDTAIMGLTMAAASSAAAISYVAHNGNQNTNWLPICQQFGDFCQKT  173

Query  662  ssavvvgfvtvvilivmvllsaCALRRR  745
            S AVV  FV VV  +++V+LS  AL+RR
Sbjct  174  SGAVVSSFVAVVFFMILVVLSGVALKRR  201



>ref|NP_181154.1| casparian strip membrane protein 1 [Arabidopsis thaliana]
 sp|Q9SIH4.1|CASP1_ARATH RecName: Full=Casparian strip membrane protein 1; Short=AtCASP1 
[Arabidopsis thaliana]
 gb|AAD26967.1| unknown protein [Arabidopsis thaliana]
 gb|AAO24545.1| At2g36100 [Arabidopsis thaliana]
 dbj|BAF00084.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09206.1| casparian strip membrane protein 1 [Arabidopsis thaliana]
 gb|AEJ82277.1| casparian strip protein 1 [Cloning vector pCASP1::CASP1:GFP]
 gb|AEJ82287.1| casparian strip protein 1 [Cloning vector p35S::CASP1:GFP]
Length=206

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 123/180 (68%), Gaps = 10/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK----AAPVAGGGYKKGLAIFDLILRIVSv  298
            EST IDV E S   K  +      +V  D K     A  + GG K+GLAIFD +LR+ ++
Sbjct  4    ESTTIDVGEPSTVTKSSS------HVVKDAKKKGFVAVASRGGAKRGLAIFDFLLRLAAI  57

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A  I A   M TAEETLPFFTQF QF+A YDDLP F +FVI++ +V+ YLVLSLPFSIV 
Sbjct  58   AVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVASYLVLSLPFSIVS  117

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +AV PR+ L+I DT+ +TL T+AA ++A+I YLAH GN   NWL ICQQFGDFC+ 
Sbjct  118  IVRPHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNWLPICQQFGDFCQN  177



>emb|CDY08514.1| BnaA05g27500D [Brassica napus]
Length=201

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 129/179 (72%), Gaps = 9/179 (5%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV AESS   KGK+PL+G   VA D+       GGY +GL+IFD +LR+ ++ 
Sbjct  2    KNESTFIDVPAESSSAMKGKSPLIG---VAKDHTT-----GGYNRGLSIFDFLLRLAAIV  53

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QFEA YDDLPTF FFVI+M +V+GY+VLSLP S+V I
Sbjct  54   AASVAAGTMFTSDETLPFFTQFLQFEAGYDDLPTFQFFVIAMSMVAGYIVLSLPISVVTI  113

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L  AAA S+AAI Y+AH GN + NWL ICQQFGDFC++
Sbjct  114  VRPLAAAPRLLLLVLDTAIMGLTMAAASSAAAISYVAHNGNQNTNWLPICQQFGDFCQK  172



>gb|AEJ82293.1| casparian strip protein 1 [Cloning vector pCASP1::CASP1:mTurquoise]
Length=207

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 123/180 (68%), Gaps = 10/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK----AAPVAGGGYKKGLAIFDLILRIVSv  298
            EST IDV E S   K  +      +V  D K     A  + GG K+GLAIFD +LR+ ++
Sbjct  4    ESTTIDVGEPSTVTKSSS------HVVKDAKKKGFVAVASRGGAKRGLAIFDFLLRLAAI  57

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A  I A   M TAEETLPFFTQF QF+A YDDLP F +FVI++ +V+ YLVLSLPFSIV 
Sbjct  58   AVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVASYLVLSLPFSIVS  117

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +AV PR+ L+I DT+ +TL T+AA ++A+I YLAH GN   NWL ICQQFGDFC+ 
Sbjct  118  IVRPHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNWLPICQQFGDFCQN  177



>sp|P0DI46.1|CASP2_RAPSA RecName: Full=Casparian strip membrane protein 2; Short=RsCASP2 
[Raphanus sativus]
Length=204

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 130/179 (73%), Gaps = 6/179 (3%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            K+EST IDV A+SS   KGKAPL+G   VA D+ A+    GGY +GL+IFD +LR+ ++ 
Sbjct  2    KNESTFIDVPADSSSAMKGKAPLIG---VAKDHTAS--GSGGYNRGLSIFDFLLRLAAIV  56

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A  A  TM T++ETLPFFTQF QFEA YDDLPTF FFVI+M +VSGY+VLSLP S+V I
Sbjct  57   AASVAAGTMFTSDETLPFFTQFLQFEAGYDDLPTFQFFVIAMSLVSGYIVLSLPISVVTI  116

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A  PR+ L++ DT  + L  AAA S+AAI Y+AH GN + NWL ICQQF DFC++
Sbjct  117  VRPLAAAPRLLLLVLDTAVMGLTMAAASSAAAISYVAHNGNQNTNWLPICQQFFDFCQK  175



>ref|XP_002309415.1| integral membrane family protein [Populus trichocarpa]
 sp|B9HBX2.1|CASP1_POPTR RecName: Full=Casparian strip membrane protein 1; Short=PtCASP1 
[Populus trichocarpa]
 gb|EEE92938.1| integral membrane family protein [Populus trichocarpa]
Length=199

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 140/178 (79%), Gaps = 9/178 (5%)
 Frame = +2

Query  125  KSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvat  304
            KSES  ID+ ESS   KGKAPL+    V+ + K      GGY+KG+AIFD ILR+ ++AT
Sbjct  2    KSESAAIDIPESSSVAKGKAPLIA---VSRNEK------GGYRKGIAIFDFILRLAAIAT  52

Query  305  aiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIA  484
            A+AA   M T++ETLPFFTQFFQF+ASYDDLPTF FFVI++ IV GYLVLSLPFSIV I 
Sbjct  53   ALAAAAAMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAIAIVGGYLVLSLPFSIVAIV  112

Query  485  RSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            R +AVGPR+ LII D VA+TL TAA  ++AAIVYLAH GN++ NWLAICQQ+GDFC++
Sbjct  113  RPHAVGPRLLLIILDAVALTLNTAAGAAAAAIVYLAHNGNSNTNWLAICQQYGDFCQK  170



>ref|XP_004292551.1| PREDICTED: casparian strip membrane protein 1-like [Fragaria 
vesca subsp. vesca]
Length=217

 Score =   142 bits (358),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 137/185 (74%), Gaps = 6/185 (3%)
 Frame = +2

Query  122  EKSESTKIDVA-ESSKERKGKAPLLG-ALNV----ASDNKAAPVAGGGYKKGLAIFDLIL  283
             +S+ST I++  ESS  R  +A   G A  V    ASD K     G G KKG+A+ D IL
Sbjct  4    SRSDSTAINIQPESSSSRSKQAAAKGEAYQVMRVLASDPKHDHDKGAGVKKGVAVLDFIL  63

Query  284  RIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLP  463
            R+ + A A+ ATV MA++E+TLPFFTQFFQF A YDDLPTF+FFVI+M IVSGYLVLSLP
Sbjct  64   RLGATAAALGATVAMASSEQTLPFFTQFFQFSAGYDDLPTFTFFVIAMAIVSGYLVLSLP  123

Query  464  FSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFG  643
            FSIV I R   V PR+ L+I DT+A+TL T+AA ++AAIVYLAH GN+DANWLAICQQFG
Sbjct  124  FSIVTIVRPLLVAPRLLLLIFDTLAVTLNTSAASAAAAIVYLAHNGNSDANWLAICQQFG  183

Query  644  DFCER  658
            DFC +
Sbjct  184  DFCRQ  188



>ref|XP_009372532.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_576556-like 
[Pyrus x bretschneideri]
Length=205

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 130/180 (72%), Gaps = 14/180 (8%)
 Frame = +2

Query  131  ESTKIDVA--ESSKERKGKAPLLGALNVASDNKAAPV--AGGGYKKGLAIFDLILRIVSv  298
            +ST IDV   E S   KGK P+L            PV    GG K+G+AI DL+LR  ++
Sbjct  6    DSTSIDVVAHEGSGTSKGKGPIL----------TVPVKEGKGGMKRGMAIIDLVLRSGAI  55

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
             +A+AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I+M +V+GYLVLS+PFSIV 
Sbjct  56   VSALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVAGYLVLSVPFSIVS  115

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +A GPR+ L+I D VA+TLAT+AAG++ +IVYLAH GN  +NWLAIC QFGDFC  
Sbjct  116  IVRPHASGPRLLLLILDLVALTLATSAAGAATSIVYLAHNGNASSNWLAICNQFGDFCRN  175



>ref|XP_011004683.1| PREDICTED: casparian strip membrane protein 3 [Populus euphratica]
Length=197

 Score =   141 bits (356),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 158/205 (77%), Gaps = 10/205 (5%)
 Frame = +2

Query  134  STKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            S ++D+ A++S   KG APL+ A         +    GGYKKGLAIFDL+LR+ +V TA+
Sbjct  2    SARVDIPADTSAAAKGTAPLIAA---------STHVNGGYKKGLAIFDLVLRLGAVVTAL  52

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA   M T+E+TLPFFTQFFQF+ASYDDLPTF F VI+M IVSGYLVLSLPFSIV I R 
Sbjct  53   AAAAAMGTSEQTLPFFTQFFQFQASYDDLPTFQFHVIAMAIVSGYLVLSLPFSIVAIVRP  112

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCERassa  670
            +A GPR+ LII DTVA+TL TAAA ++AAIVYLAH GN+ ANWLAICQQFGDFC +AS A
Sbjct  113  HATGPRLLLIILDTVALTLNTAAAAAAAAIVYLAHNGNSSANWLAICQQFGDFCRKASGA  172

Query  671  vvvgfvtvvilivmvllsaCALRRR  745
            VV  F+  V+L+ ++++SA ALR+R
Sbjct  173  VVASFIAAVLLLFLIVISALALRKR  197



>gb|AFK35638.1| unknown [Lotus japonicus]
Length=197

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 12/177 (7%)
 Frame = +2

Query  131  ESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvata  307
             ST IDV AESS   KGKA L+          AAP   GG+KKG+AI D +LR+ +VA A
Sbjct  3    SSTTIDVPAESSNVAKGKAVLV----------AAP-RPGGWKKGIAIVDFVLRLGAVAAA  51

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            + A  TMATA++TLPFFTQFFQFEASYD   TF FFVI+M +V GYLVLSLP SIV I R
Sbjct  52   LGAATTMATADQTLPFFTQFFQFEASYDSFTTFQFFVITMALVGGYLVLSLPLSIVSIIR  111

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             +A+GP++FLII DTV +TLATA+A S+AA+VY+AH GN D+NWLAIC QF DFC +
Sbjct  112  PHALGPKLFLIILDTVFLTLATASAASAAAVVYVAHNGNQDSNWLAICNQFADFCAQ  168



>ref|XP_006361147.1| PREDICTED: casparian strip membrane protein 3-like [Solanum tuberosum]
Length=211

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 127/182 (70%), Gaps = 8/182 (4%)
 Frame = +2

Query  122  EKSESTKIDVAESS---KERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIV  292
              S  T I+++E+    ++    AP++      S N+      GG+++G++IFD ILR+ 
Sbjct  5    STSYETAINMSETESIKQKSSSAAPIIATTKTISHNQ-----KGGWRRGVSIFDFILRLC  59

Query  293  SvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSI  472
            ++ T +AA  TM T EETLP FTQFFQF+ASYDDLP FS+FV++  I S Y+VLSLPFSI
Sbjct  60   ALVTTLAAATTMGTTEETLPLFTQFFQFQASYDDLPAFSYFVVANAIASAYVVLSLPFSI  119

Query  473  VCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFC  652
            VCI R + VG ++ L+I DTV +   TAAA ++AAIVYLAH GN+   W+AICQQFGDFC
Sbjct  120  VCIVRPHLVGAKLVLLILDTVMVAFTTAAASAAAAIVYLAHNGNSTTQWVAICQQFGDFC  179

Query  653  ER  658
            +R
Sbjct  180  QR  181



>ref|XP_009789373.1| PREDICTED: casparian strip membrane protein 2-like [Nicotiana 
sylvestris]
Length=209

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 125/179 (70%), Gaps = 5/179 (3%)
 Frame = +2

Query  125  KSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPV-AGGGYKKGLAIFDLILRIVSva  301
             S  T I+++E+ +  KGK+    A  + +  KA P    GG+ +G+AIFD ILR+  + 
Sbjct  6    HSHETAINISET-ESNKGKST---AATIVATTKAIPHNHKGGWLRGVAIFDFILRLCGLV  61

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T +ETLP FTQFFQFEASYDDLP FS+FV++  I SGYLVLSLPFSIVCI
Sbjct  62   AALAAATTMGTTDETLPLFTQFFQFEASYDDLPAFSYFVVANAIASGYLVLSLPFSIVCI  121

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R + VG R+ L+I DTV +   TA A ++AAIVYLA  GN+   WL ICQQFGDFC+R
Sbjct  122  VRPHLVGARLLLLILDTVMVAFTTAGAAAAAAIVYLAENGNSTTQWLEICQQFGDFCQR  180



>ref|XP_009143616.1| PREDICTED: LOW QUALITY PROTEIN: casparian strip membrane protein 
1-like [Brassica rapa]
Length=207

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 126/180 (70%), Gaps = 11/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            EST I+V E S   K  +      +V  D K      A  AGGGYK+GLAIFD +LR+ +
Sbjct  4    ESTTIEVGEPSTVTKSTS------HVVVDEKKKKGFVAATAGGGYKRGLAIFDFLLRLAA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            + T I ++  M TAEETLPFFTQF QF+A YDD  TF FFVI++ +V+ YLVLSLPFSIV
Sbjct  58   IVTTITSSSVMYTAEETLPFFTQFLQFQAGYDDFATFQFFVIAIAMVASYLVLSLPFSIV  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  A  PR+ L+I+DTV +TLAT+AA ++AAIVYLAH GN + N L ICQQFGDFC+
Sbjct  118  TIIRPLAAAPRLILLISDTVVVTLATSAAAAAAAIVYLAHNGNPNTNXLPICQQFGDFCQ  177



>ref|XP_009609007.1| PREDICTED: casparian strip membrane protein 2-like [Nicotiana 
tomentosiformis]
Length=213

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 124/179 (69%), Gaps = 1/179 (1%)
 Frame = +2

Query  125  KSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPV-AGGGYKKGLAIFDLILRIVSva  301
            KS  T I+++E+   +        A  + +  KA P    GG+++G+AIFD ILR+  + 
Sbjct  6    KSHETAINISETESNKGKSTAAAPAATIVATTKAIPHNQKGGWRRGVAIFDFILRLCGLV  65

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T +ETLP FTQFFQFEASYDDLP FS+FV++  I SGYLVLSLPFSIVCI
Sbjct  66   AALAAATTMGTTDETLPLFTQFFQFEASYDDLPAFSYFVVANAIASGYLVLSLPFSIVCI  125

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R + VG R+ L+I DTV +   TA A ++AAIVYLAH GN+   W AICQQFGDFC++
Sbjct  126  VRPHLVGARLVLLILDTVMVAFTTAGAAAAAAIVYLAHNGNSTTQWQAICQQFGDFCQQ  184



>gb|KHN23088.1| Casparian strip membrane protein 3 [Glycine soja]
Length=200

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = +2

Query  134  STKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            ST IDV AESSK          A  +     A P   GG+KKG+AI D ILR+ ++A+A+
Sbjct  2    STTIDVPAESSKINSI------ANGIRKVPGAPPRPEGGWKKGVAILDFILRLGAIASAL  55

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A  TMAT++ETLPFFTQFFQFEASYD   TF FFVI+M  V GYLVLSLPFSIV I R 
Sbjct  56   GAAATMATSDETLPFFTQFFQFEASYDSFSTFQFFVIAMAFVGGYLVLSLPFSIVTIIRP  115

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+FLII DTV +TLAT++A ++ AIVYLAH GN D+NWLAIC QFGDFC+ 
Sbjct  116  HAAGPRLFLIILDTVFLTLATSSAAAATAIVYLAHNGNQDSNWLAICNQFGDFCQE  171



>sp|P0DI55.1|CASP4_LOTJA RecName: Full=Casparian strip membrane protein 4; Short=LjCASP4 
[Lotus japonicus]
Length=197

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 12/177 (7%)
 Frame = +2

Query  131  ESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvata  307
             ST IDV AESS   KGKA L+          AAP   GG+KKG+AI D +LR+ +VA A
Sbjct  3    SSTTIDVPAESSNVAKGKAVLV----------AAP-RPGGWKKGIAIVDFVLRLGAVAAA  51

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            + A  TMATA++TLPFFTQFFQFEASYD   TF FFVI+M +V  YLVLSLP SIV I R
Sbjct  52   LGAATTMATADQTLPFFTQFFQFEASYDSFTTFQFFVITMALVGCYLVLSLPLSIVSIIR  111

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             +A+GP++FLII DTV +TLATA+A S+AA+VY+AH GN D+NWLAIC QFGDFC +
Sbjct  112  PHALGPKLFLIILDTVFLTLATASAASAAAVVYVAHNGNQDSNWLAICNQFGDFCAQ  168



>ref|XP_002323410.1| integral membrane family protein [Populus trichocarpa]
 sp|B9IIR5.1|CASP2_POPTR RecName: Full=Casparian strip membrane protein 2; Short=PtCASP2 
[Populus trichocarpa]
 gb|EEF05171.1| integral membrane family protein [Populus trichocarpa]
Length=199

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 139/176 (79%), Gaps = 11/176 (6%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVA-GGGYKKGLAIFDLILRIVSvatai  310
            ST+ID+ ESS   KG APL+          AAP+   GGYKKG+AIFD ILR+ ++ATA+
Sbjct  5    STEIDMPESSSVSKGTAPLI----------AAPMKEKGGYKKGIAIFDFILRLAAIATAL  54

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA  +M T++ETLPFFTQFFQF+ASYDDLPTF FFVI+M IV+GYLVLSLPFSIV I R 
Sbjct  55   AAAASMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAMAIVAGYLVLSLPFSIVAIVRP  114

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A GPR+ LII DTVA+TL TAA  ++AAIVYLAH GN+  NWLAICQQFGDFC++
Sbjct  115  HAAGPRLLLIILDTVALTLNTAAGAAAAAIVYLAHNGNSSTNWLAICQQFGDFCQK  170



>sp|P0DI49.1|CASP1_RAPRA RecName: Full=Casparian strip membrane protein 1; Short=RrCASP1 
[Raphanus raphanistrum]
Length=207

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 128/180 (71%), Gaps = 11/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            EST IDV E +   K  +      +V  D K      A  AGGGYK+GLA+FD +LR+ +
Sbjct  4    ESTTIDVGEPNTMTKSTS------HVVVDEKKKKGFVAAAAGGGYKRGLAVFDFLLRLAA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            +   I A+  M TAEETLPFFTQF QF+A YDD PTF FFVI++ IV+ YLVLSLPFSIV
Sbjct  58   IGITIGASSVMFTAEETLPFFTQFLQFQAGYDDFPTFQFFVIAIAIVASYLVLSLPFSIV  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  AV PR+ L+I+DTV +TL TAAA ++A+IVYLAH GNT+ NWL ICQQFGDFC+
Sbjct  118  TIVRPLAVAPRLILLISDTVVLTLTTAAAAAAASIVYLAHNGNTNTNWLPICQQFGDFCQ  177



>ref|XP_002523839.1| conserved hypothetical protein [Ricinus communis]
 sp|B9SCX0.1|CASP3_RICCO RecName: Full=Casparian strip membrane protein 3; Short=RcCASP3 
[Ricinus communis]
 gb|EEF38565.1| conserved hypothetical protein [Ricinus communis]
Length=215

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 130/184 (71%), Gaps = 6/184 (3%)
 Frame = +2

Query  122  EKSESTKIDVAE-SSKERKGK----APLLGALNVASDNKAAPVAGGGYKKGLAIFDLILR  286
            EK+   KI + E  + + KGK    AP    + V +      +  GG+KKG+AIFD ++R
Sbjct  4    EKTGEAKITIQEPKAADPKGKGIADAPPPPVV-VTTAKAIQKLPRGGWKKGVAIFDFVVR  62

Query  287  IVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPF  466
            + ++AT +AAT  M T E+TLPFFTQFFQF A Y+DLPTF FFV + GI SGYL+LSLPF
Sbjct  63   LCAIATGLAATGIMGTTEQTLPFFTQFFQFHAEYNDLPTFMFFVFANGIASGYLILSLPF  122

Query  467  SIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGD  646
            SIVCI R  A+ PR+ LII DTV + L  AAA ++AAIVYLAH GN++ANW AICQQF D
Sbjct  123  SIVCIVRPLAIVPRLLLIIFDTVVMALTIAAASAAAAIVYLAHNGNSNANWNAICQQFND  182

Query  647  FCER  658
            FC++
Sbjct  183  FCQQ  186



>ref|XP_007203160.1| hypothetical protein PRUPE_ppa024449mg [Prunus persica]
 gb|EMJ04359.1| hypothetical protein PRUPE_ppa024449mg [Prunus persica]
Length=205

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 130/183 (71%), Gaps = 12/183 (7%)
 Frame = +2

Query  119  MEKSESTKIDV----AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILR  286
            M+  +ST IDV    A      KGK  +L           A    GG ++G+AI DL+LR
Sbjct  1    MKSGDSTTIDVPHHEASGGAASKGKGAIL--------TVPARQEKGGMRRGMAIIDLVLR  52

Query  287  IVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPF  466
            I ++  A+AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I+M +V+GYLVLS+PF
Sbjct  53   IGAIVAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLIAMSLVAGYLVLSVPF  112

Query  467  SIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGD  646
            SIV I R +A G R+ L+I D VA+TLAT+AAG++ AIVYLAH GN+ +NWLAIC QFGD
Sbjct  113  SIVSIVRPHASGIRLLLLILDVVALTLATSAAGAATAIVYLAHNGNSSSNWLAICNQFGD  172

Query  647  FCE  655
            FC+
Sbjct  173  FCQ  175



>ref|XP_006410783.1| hypothetical protein EUTSA_v10017240mg [Eutrema salsugineum]
 gb|ESQ52236.1| hypothetical protein EUTSA_v10017240mg [Eutrema salsugineum]
Length=207

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 128/180 (71%), Gaps = 11/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            EST IDV E S   K  +      +V  D K      A  AGGGYK+GLAIFD +LR+ +
Sbjct  4    ESTTIDVGEPSTVTKSSS------HVVVDAKKKKGFVAAAAGGGYKRGLAIFDFLLRLAA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            +   IAA+  M TAEETLPFFTQF QF+A YDD PTF FFVI+  IV+GYL+LSLPFSIV
Sbjct  58   IGITIAASSLMFTAEETLPFFTQFLQFQAGYDDDPTFQFFVIATAIVAGYLLLSLPFSIV  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  AV PR+ L+I+DTV +TL TAAA ++AAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  TIVRPQAVAPRLILLISDTVVVTLNTAAAAAAAAIVYLAHNGNANTNWLPICQQFGDFCQ  177



>ref|XP_010534404.1| PREDICTED: casparian strip membrane protein 2 [Tarenaya hassleriana]
Length=196

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 123/180 (68%), Gaps = 13/180 (7%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M KSE+T IDV ESS   KGKAPL+G      + +  P   GGYK+GL+IFD ++R+ ++
Sbjct  1    MMKSETTTIDVPESSSVAKGKAPLIG------EVREHP--SGGYKRGLSIFDFLIRVAAI  52

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AA  TM T++ETLPFFTQFFQF+ASYDDLPTF FFVI+M IV+GYLVLSLPFS+V 
Sbjct  53   VAALAAAATMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAMAIVAGYLVLSLPFSVVT  112

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R  A  PR+       + +  A     ++AA    AH    + NWLAICQQFGDFC++
Sbjct  113  IVRPLATAPRLL-----LLVLDTAVLTLNTAAASAAAAHSWKPNTNWLAICQQFGDFCQK  167



>ref|XP_006424191.1| hypothetical protein CICLE_v10030236mg [Citrus clementina]
 gb|ESR37431.1| hypothetical protein CICLE_v10030236mg [Citrus clementina]
 gb|KDO39724.1| hypothetical protein CISIN_1g042128mg [Citrus sinensis]
Length=211

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 131/168 (78%), Gaps = 0/168 (0%)
 Frame = +2

Query  242  GGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVI  421
            GG+KKG+AIFD +LR+ ++  A+ AT TM TA+E LPFFTQFFQFEA YDD   F FFVI
Sbjct  43   GGWKKGVAIFDFVLRLAAIGAALGATATMGTADEILPFFTQFFQFEAQYDDFEVFMFFVI  102

Query  422  SMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVG  601
            + G+VS YLVLSLPFSI+CI R +AVGPR+ L+I DTV + L   AA ++A++VYLAH G
Sbjct  103  ANGLVSAYLVLSLPFSILCIVRPHAVGPRLLLLIGDTVMMALTIGAAAAAASVVYLAHSG  162

Query  602  NTDANWLAICQQFGDFCERassavvvgfvtvvilivmvllsaCALRRR  745
            N +ANWL ICQQFGDFC+  SSAVV   +   +L+++++LSA ALRRR
Sbjct  163  NPNANWLPICQQFGDFCQSTSSAVVASLIAAALLLILIVLSAFALRRR  210



>ref|XP_008442871.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_576556-like 
[Cucumis melo]
Length=204

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 129/177 (73%), Gaps = 9/177 (5%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPV-AGGGYKKGLAIFDLILRIVSvata  307
            +ST IDV  ++     K  ++        + AAP  A GG K+GL+IFD ++R+ ++  A
Sbjct  6    DSTVIDVPPTAGSSSKKKAVV--------STAAPQQASGGVKRGLSIFDFVIRLGALGAA  57

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            + A   M T++ETLPFFTQFFQFEASYDDLPTF FF+I+MGIV+GYL LSLPFSIVCI R
Sbjct  58   LGAAAAMGTSDETLPFFTQFFQFEASYDDLPTFQFFLIAMGIVAGYLALSLPFSIVCIVR  117

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
              AVG R+ L+I DTV +TLAT+AA ++AAIVYLAH GN+  NWLAIC QF DFC+ 
Sbjct  118  PGAVGLRLLLLILDTVVLTLATSAAAAAAAIVYLAHDGNSSTNWLAICDQFEDFCQN  174



>ref|XP_006487914.1| PREDICTED: casparian strip membrane protein 5-like [Citrus sinensis]
Length=203

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 131/168 (78%), Gaps = 0/168 (0%)
 Frame = +2

Query  242  GGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVI  421
            GG+KKG+AIFD +LR+ ++  A+ AT TM TA+E LPFFTQFFQFEA YDD   F FFVI
Sbjct  35   GGWKKGVAIFDFVLRLAAIGAALGATATMGTADEILPFFTQFFQFEAQYDDFEVFMFFVI  94

Query  422  SMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVG  601
            + G+VS YLVLSLPFSI+CI R +AVGPR+ L+I DTV + L   AA ++A++VYLAH G
Sbjct  95   ANGLVSAYLVLSLPFSILCIVRPHAVGPRLLLLIGDTVMMALTIGAAAAAASVVYLAHSG  154

Query  602  NTDANWLAICQQFGDFCERassavvvgfvtvvilivmvllsaCALRRR  745
            N +ANWL ICQQFGDFC+  SSAVV   +   +L+++++LSA ALRRR
Sbjct  155  NPNANWLPICQQFGDFCQSTSSAVVASLIAAALLLILIVLSAFALRRR  202



>emb|CDX84158.1| BnaC04g09200D [Brassica napus]
Length=206

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 127/179 (71%), Gaps = 10/179 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK----AAPVAGGGYKKGLAIFDLILRIVSv  298
            EST ID+ E S   K  +      +VA D K     A  AGGGYK+GL IFD +LR+ ++
Sbjct  4    ESTTIDIGEPSTVTKSSS------HVAVDEKKKGFVAAAAGGGYKRGLTIFDFLLRLAAI  57

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
               I A+  M TAEETLPFFTQF QF+A YDD PTF FFVIS+ IV+ YLVLSLPFSIV 
Sbjct  58   GITIGASSVMFTAEETLPFFTQFLQFQAGYDDFPTFQFFVISIAIVASYLVLSLPFSIVS  117

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
            I R  AV PR+ L+I+DTV +TL TAAA ++AAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  IVRPLAVVPRLILLISDTVVLTLTTAAAAAAAAIVYLAHNGNANTNWLPICQQFGDFCQ  176



>sp|B9HQ42.2|CASP4_POPTR RecName: Full=Casparian strip membrane protein 4; Short=PtCASP4 
[Populus trichocarpa]
Length=243

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 140/218 (64%), Gaps = 15/218 (7%)
 Frame = +2

Query  14   YITPFHASNHQSSI*AFNQLEKQKHHRIILIKVSIMEKS-ESTKIDVAESSKERKGKAPL  190
            +I P+H+          N+L    H+   L+ + + +KS E+TKI + E   + KGK  +
Sbjct  8    HILPWHSIT--------NKLSSPDHY---LLAMDVSDKSGEATKITIQEPKADTKGKG-I  55

Query  191  LGALNVASDNKAAPV--AGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQ  364
             GAL       A        G+KKG AIFDL LR+ ++A   AAT  MAT ++TLPFFTQ
Sbjct  56   AGALTAPVVVAAKAAQRPRKGWKKGAAIFDLTLRLSAIAAGFAATSLMATTDQTLPFFTQ  115

Query  365  FFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvait  544
            FFQF A Y DLPTF  F+I   I SGYLVLSLPFSIVCI R+ A GPR+ LII D+V + 
Sbjct  116  FFQFHAQYTDLPTFLSFMIVNAITSGYLVLSLPFSIVCIVRARAAGPRLLLIILDSVMMA  175

Query  545  lataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            L T+AA +SAAIVYLAH GN+ +NW A CQQF ++C++
Sbjct  176  LTTSAASASAAIVYLAHNGNSSSNWNAFCQQFNNYCQQ  213



>ref|XP_006410782.1| hypothetical protein EUTSA_v10017241mg [Eutrema salsugineum]
 gb|ESQ52235.1| hypothetical protein EUTSA_v10017241mg [Eutrema salsugineum]
Length=207

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 129/180 (72%), Gaps = 11/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            +ST IDV E S   K ++      +V  D K      A  AGGGYK+GLAIFD +LR+ +
Sbjct  4    DSTTIDVGEPSNVTKSRS------HVVVDAKKKKGFVAAAAGGGYKRGLAIFDFLLRLAA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            +   IAA+  M TAEETLPFFTQF QF+A YDD PTF FFVI+  IV+GYL+LSLPFSIV
Sbjct  58   IGITIAASSLMFTAEETLPFFTQFLQFQAGYDDDPTFQFFVIATAIVAGYLLLSLPFSIV  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  AV PR+ L+I+DTV +TL TAAA ++AAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  SIVRPQAVAPRLILLISDTVVVTLNTAAAAAAAAIVYLAHNGNANTNWLPICQQFGDFCQ  177



>emb|CDX75070.1| BnaA05g08160D [Brassica napus]
Length=207

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 127/180 (71%), Gaps = 11/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            EST IDV E S   K  +      +V  D K      A  AGGGYK+GLAIFD +LR+ +
Sbjct  4    ESTTIDVGEPSTITKSSS------HVVVDEKKKKGFVAAAAGGGYKRGLAIFDFLLRLAA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            +   I A+  M TAEETLPFFTQF QF+A YDD PTF FFVIS+ IV+ YLVLSLPFSIV
Sbjct  58   IGITIGASSVMFTAEETLPFFTQFLQFQAGYDDFPTFQFFVISIAIVASYLVLSLPFSIV  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  AV PR+ L+I+DTV +TL TAAA ++AAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  SIVRPLAVVPRLILLISDTVVLTLTTAAAAAAAAIVYLAHNGNANTNWLPICQQFGDFCQ  177



>ref|XP_003535799.1| PREDICTED: casparian strip membrane protein 3 [Glycine max]
 gb|KHN02603.1| Casparian strip membrane protein 3 [Glycine soja]
Length=200

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 126/176 (72%), Gaps = 9/176 (5%)
 Frame = +2

Query  134  STKIDVA--ESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvata  307
            ST IDV    +SK   G         +     A P   GG+KKGLAI D +LR+ ++A+A
Sbjct  2    STTIDVPAETTSKNNIGNG-------IRKVPGAPPRPEGGWKKGLAIIDFVLRLGAIASA  54

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            + A  TMAT++ETLPFFTQFFQFEASYD   TF +FVI+M  V GYLVLSLPFSIV I R
Sbjct  55   LGAAATMATSDETLPFFTQFFQFEASYDSFSTFQYFVIAMAFVGGYLVLSLPFSIVTIIR  114

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             +A GPR+FLII DTV +T+AT++A ++ AIVYLAH GN D+NWLAIC QFGDFC+
Sbjct  115  LHAAGPRLFLIILDTVFLTIATSSAAAATAIVYLAHNGNQDSNWLAICNQFGDFCQ  170



>ref|XP_004242111.1| PREDICTED: casparian strip membrane protein 3-like [Solanum lycopersicum]
Length=210

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 125/180 (69%), Gaps = 12/180 (7%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M ++ESTK       ++    AP++      S N+      GG+++GL+IFD ILR+ ++
Sbjct  14   MSETESTK-------QKSSSGAPIIATTKTISHNQ-----KGGWRRGLSIFDFILRLCAL  61

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            AT +AA   M T EETLP FTQFFQF+ASYDDLP FS+FV++  I S Y+VLSLPFSIVC
Sbjct  62   ATTLAAATAMGTTEETLPLFTQFFQFQASYDDLPAFSYFVVANAIASAYVVLSLPFSIVC  121

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R + VG ++ L+I DTV +   TAAA ++AAIVYLA  GN+   W+AICQQFGDFC+R
Sbjct  122  IVRPHLVGVKLLLLILDTVMVAFTTAAAAAAAAIVYLAENGNSTTQWVAICQQFGDFCQR  181



>ref|XP_002323409.1| hypothetical protein POPTR_0016s07610g [Populus trichocarpa]
 sp|B9IIR4.1|CASP3_POPTR RecName: Full=Casparian strip membrane protein 3; Short=PtCASP3 
[Populus trichocarpa]
 gb|EEF05170.1| hypothetical protein POPTR_0016s07610g [Populus trichocarpa]
Length=197

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 155/205 (76%), Gaps = 10/205 (5%)
 Frame = +2

Query  134  STKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            S ++D+ A++S   KG APL+ A         +    GGYKKGLAIFDL+LR+ +V TA+
Sbjct  2    SARVDIPADTSAAAKGTAPLIAA---------STHVKGGYKKGLAIFDLVLRLGAVVTAL  52

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA  TM T ++TLPFFTQFFQF+ASYDDLPTF FFVI+M IVSGYLVLSLPFSIV I R 
Sbjct  53   AAAATMGTTDQTLPFFTQFFQFQASYDDLPTFQFFVIAMAIVSGYLVLSLPFSIVAIIRP  112

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCERassa  670
            +A GPR+ LII DTVA+TL TAAA ++ AIV LA  GN+ ANWL ICQQFGDFC++AS A
Sbjct  113  HATGPRLLLIILDTVALTLNTAAAAAAVAIVDLAQNGNSSANWLGICQQFGDFCQKASGA  172

Query  671  vvvgfvtvvilivmvllsaCALRRR  745
            VV  F+   +L+ ++++SA ALR+R
Sbjct  173  VVASFIAAGVLLFLIVISALALRKR  197



>ref|XP_011004187.1| PREDICTED: casparian strip membrane protein 1 [Populus euphratica]
Length=199

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 136/178 (76%), Gaps = 9/178 (5%)
 Frame = +2

Query  125  KSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvat  304
            KSES  ID+ ESS   KGKAPL+    V+ D K      GGY KG+AIFD ILR+ ++AT
Sbjct  2    KSESAAIDIPESSSVAKGKAPLIA---VSRDEK------GGYGKGIAIFDFILRLAAIAT  52

Query  305  aiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIA  484
            A+AA   M T+EETLPFFTQFFQF+ASYDDLPTF FFVI+   V GYLVLSLP SIV I 
Sbjct  53   ALAAAAAMGTSEETLPFFTQFFQFQASYDDLPTFQFFVIATAFVGGYLVLSLPLSIVGIV  112

Query  485  RSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            R +AVGPR+ LII DTVA+TL TAA  ++AAIVYLAH GN + NWLAICQQ+GDFC++
Sbjct  113  RPHAVGPRLLLIILDTVALTLNTAAGAAAAAIVYLAHNGNPNTNWLAICQQYGDFCQK  170



>ref|XP_011043429.1| PREDICTED: LOW QUALITY PROTEIN: casparian strip membrane protein 
4-like [Populus euphratica]
Length=214

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 5/182 (3%)
 Frame = +2

Query  122  EKSESTKIDVAESSKERKGKA---PLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIV  292
            +  E+ KI + E   + KGK      +  + VA+  KAA     G++KG+AIFDL+LR+ 
Sbjct  5    KSGEAAKITIQEPKADTKGKGIDGAFIAPVMVAA--KAAQRPRKGWEKGVAIFDLVLRLS  62

Query  293  SvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSI  472
            ++    AAT  MAT +ETLPFFTQF QF A Y+DLPTFSFF+I+  I SGYLVL+LPFSI
Sbjct  63   AIVAGFAATSLMATTDETLPFFTQFLQFHAQYNDLPTFSFFLIANAITSGYLVLTLPFSI  122

Query  473  VCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFC  652
            VCI R  A GPR+ LII D+V + L T+AA +SAAIVYLAH GN+ +NW A C QF +FC
Sbjct  123  VCIVRPRAAGPRLLLIILDSVMMGLTTSAASASAAIVYLAHNGNSSSNWNAFCLQFNNFC  182

Query  653  ER  658
            ++
Sbjct  183  QQ  184



>gb|ACU14340.1| unknown [Glycine max]
Length=199

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +2

Query  224  AAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPT  403
            A P   GG+KKGLAI D +LR+ ++A+A+ A  TMAT++ETLPFFTQFFQFEASYD   T
Sbjct  27   APPRPEGGWKKGLAIIDFVLRLGAIASALGAAATMATSDETLPFFTQFFQFEASYDSFST  86

Query  404  FSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaiv  583
            F +FVI+M  V GYLVLSLPFSIV I R +A GPR+FLII DTV +T+AT++A ++ AIV
Sbjct  87   FQYFVIAMAFVGGYLVLSLPFSIVTIIRLHAAGPRLFLIILDTVFLTIATSSAAAATAIV  146

Query  584  ylaHVGNTDANWLAICQQFGDFCE  655
            YLAH GN D+NWLAIC QFGDFC+
Sbjct  147  YLAHNGNQDSNWLAICNQFGDFCQ  170



>ref|XP_006295518.1| hypothetical protein CARUB_v10024622mg [Capsella rubella]
 gb|EOA28416.1| hypothetical protein CARUB_v10024622mg [Capsella rubella]
Length=206

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 124/176 (70%), Gaps = 2/176 (1%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST IDV E S   K  + ++G  +       A  AGGG K+GLAIFD +LR+ ++A  I
Sbjct  4    ESTTIDVGEPSTVTKSSSHVVG--DAKKKGFVAAAAGGGAKRGLAIFDFLLRLAAIAVTI  61

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A   M TAEETLPFFTQF QF+A YDDLP F +FV+++ IV+ YLVLSLPFSIV I R 
Sbjct  62   GAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVVAVAIVASYLVLSLPFSIVAIVRP  121

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             AV PR+ L+I DT+ +TL T+AAG++A+I YLAH GN   NWL ICQQFGDFC+ 
Sbjct  122  LAVAPRLILLICDTLVLTLNTSAAGAAASIDYLAHNGNQSTNWLPICQQFGDFCQN  177



>gb|KFK28903.1| hypothetical protein AALP_AA7G063100 [Arabis alpina]
Length=221

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 125/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V+   +K+G+AIF
Sbjct  3    IEKANSRREEEEPIVQKPKLDKGKGKAHVFAPPMNYSRIMDKHKQEKVSMASWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D ILR+++  TA++A   MAT EETLPFFTQF QF+A Y DLPTFS FVI   IV GYL 
Sbjct  63   DFILRLIAAITAMSAAAKMATTEETLPFFTQFLQFQADYTDLPTFSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R   + PR+FLI+ DT  + L   AA +SAAIVY+AH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLVLPPRLFLILCDTAMMGLTMVAASASAAIVYVAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFCE
Sbjct  183  QQFGDFCE  190



>ref|XP_010104281.1| hypothetical protein L484_005384 [Morus notabilis]
 gb|EXB99566.1| hypothetical protein L484_005384 [Morus notabilis]
Length=202

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 150/210 (71%), Gaps = 11/210 (5%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKE--RKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIV  292
            M   +S  IDV + ++   +  K P+L A   A           G KKG+AI D +LR+ 
Sbjct  1    MANRDSITIDVDQETRTAAKLEKVPMLAAPKPAKR---------GLKKGIAITDFVLRLG  51

Query  293  SvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSI  472
            ++A A++A  TM TA+ETLPFFTQFFQFEASYDDLPTF FFVI+M IV GYLVLSLP SI
Sbjct  52   AIAAALSAAATMGTADETLPFFTQFFQFEASYDDLPTFMFFVIAMAIVGGYLVLSLPLSI  111

Query  473  VCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFC  652
            V I R +A  PR+ L+I DTVA+TLAT+ A ++ +IVYLAH GN+ ANW+A+CQQF  FC
Sbjct  112  VTIIRPHAAAPRLALLILDTVALTLATSCAAAATSIVYLAHNGNSSANWMAVCQQFTGFC  171

Query  653  ERassavvvgfvtvvilivmvllsaCALRR  742
            + AS AVV  FV VV+L+++V LSACALRR
Sbjct  172  QGASGAVVSSFVAVVLLMLLVALSACALRR  201



>ref|XP_011043416.1| PREDICTED: casparian strip membrane protein 4-like [Populus euphratica]
Length=214

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 126/186 (68%), Gaps = 13/186 (7%)
 Frame = +2

Query  122  EKSESTKIDVAESSKERKGK-------APLLGALNVASDNKAAPVAGGGYKKGLAIFDLI  280
            +  E+ KI + E   + KGK       AP++ A       KAA     G+KKG+AI DL+
Sbjct  5    KSGEAAKITIQEPKADTKGKGIDGAFIAPVMVA------AKAAQRPRKGWKKGVAIVDLV  58

Query  281  LRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSL  460
            LR+ ++    AAT  MAT +ETLPFFTQF QF A Y+DLPTFSFF+I+  I SGYLVL+L
Sbjct  59   LRLSAIVAGFAATSLMATTDETLPFFTQFLQFHAQYNDLPTFSFFLIANAITSGYLVLTL  118

Query  461  PFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQF  640
            PFSIVCI R  A GPR+ LII D+V + L T+AA +SAAIVYLAH GN+ +NW A C QF
Sbjct  119  PFSIVCIVRPRAAGPRLLLIILDSVMMGLTTSAASASAAIVYLAHNGNSSSNWNAFCLQF  178

Query  641  GDFCER  658
             +FC++
Sbjct  179  NNFCQQ  184



>ref|NP_001236338.1| casparian strip membrane protein 5 [Glycine max]
 sp|C6T4E0.1|CASP5_SOYBN RecName: Full=Casparian strip membrane protein 5; Short=GmCASP5 
[Glycine max]
 gb|ACU16550.1| unknown [Glycine max]
 gb|KHN32862.1| Casparian strip membrane protein 5 [Glycine soja]
Length=218

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
              KA P+  GG+KKG+AI D I+R+ ++ +A+ A   M  +E+ LPFFTQFFQF A +DD
Sbjct  42   STKATPLPRGGWKKGVAILDFIIRLGAIGSALGAAAIMGNSEQILPFFTQFFQFHAQWDD  101

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
             P F FFV + G   G+L+LSLPFSIVCI R Y VGPR+ L+I D + + L  AAA S+A
Sbjct  102  FPMFQFFVFANGAAGGFLILSLPFSIVCIVRPYTVGPRLLLVILDILMMALVMAAASSAA  161

Query  575  aivylaHVGNTDANWLAICQQFGDFCE  655
            A+VYLAH G+ DANW+AICQQF DFC+
Sbjct  162  AVVYLAHNGSQDANWIAICQQFTDFCQ  188



>ref|XP_003535780.1| PREDICTED: casparian strip membrane protein 2-like [Glycine max]
 gb|KHN02601.1| Casparian strip membrane protein 2 [Glycine soja]
Length=196

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 122/175 (70%), Gaps = 9/175 (5%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST I++ ESS +                   AP   GG+KKG+AI D ILR+ ++A A+ 
Sbjct  2    STTIEIPESSTKVA---------KGKGVVVVAPARPGGWKKGVAIMDFILRLGAIAAALG  52

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  TM T+++TLPFFTQFFQFEASYD   TF FFVI+M +V GYLVLSLPFSIV I R +
Sbjct  53   AAATMGTSDQTLPFFTQFFQFEASYDSFTTFQFFVITMALVGGYLVLSLPFSIVAIVRPH  112

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            AVGPR+ LII DTV +TLATA   S+AAIVYLAH G+ D NWLAIC QFGDFC +
Sbjct  113  AVGPRLSLIILDTVFLTLATAGGASAAAIVYLAHNGDQDTNWLAICNQFGDFCAQ  167



>ref|XP_009360780.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Pyrus x bretschneideri]
Length=197

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  242  GGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVI  421
            GG+KKG+A+ D  LR+ + A A+ A + M +++E LPFF QFFQF ASYDDLPTF FFVI
Sbjct  30   GGWKKGIAVLDFTLRLGATAAALGAAIAMGSSDEILPFFMQFFQFSASYDDLPTFQFFVI  89

Query  422  SMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVG  601
            +MGIV  +LVLSLPFSIV I R +AV P++ L+I  T+A+ L T+AA ++AAIVYLAH G
Sbjct  90   AMGIVGAFLVLSLPFSIVSIIRPHAVAPKLVLLIFYTLALALNTSAAAAAAAIVYLAHKG  149

Query  602  NTDANWLAICQQFGDFCER  658
            N+DANWLAICQQFGDFC +
Sbjct  150  NSDANWLAICQQFGDFCPQ  168



>ref|XP_011046927.1| PREDICTED: casparian strip membrane protein 1-like [Populus euphratica]
Length=199

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 133/178 (75%), Gaps = 9/178 (5%)
 Frame = +2

Query  125  KSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvat  304
            KSES  ID+ ESS   KGKAPL+    V+ D K      GGY KG+AIFD ILR+ ++AT
Sbjct  2    KSESAAIDIPESSSVAKGKAPLIA---VSRDEK------GGYGKGIAIFDFILRLAAIAT  52

Query  305  aiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIA  484
            A+AA   M T+EETLPFFTQFFQF+ASYDDLPTF FFVI+   V GYLVLSLP SIV I 
Sbjct  53   ALAAAAAMGTSEETLPFFTQFFQFQASYDDLPTFQFFVIATAFVGGYLVLSLPLSIVGIV  112

Query  485  RSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            R +AVGPR+ LII DTVA+    AA  ++AAIVYLAH GN + NWLAICQQ+GDFC++
Sbjct  113  RPHAVGPRLLLIILDTVALPQNPAAGAAAAAIVYLAHNGNPNTNWLAICQQYGDFCQK  170



>ref|XP_002880911.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7LGW9.1|CASP3_ARALL RecName: Full=Casparian strip membrane protein 3; Short=AlCASP3 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH57170.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=221

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 126/188 (67%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V+  G+K+G+AIF
Sbjct  3    IEKAASRREEEEPIVQRPKLDKGKGKAHVFAPPMNYNRIMDKHKQEKVSAAGWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF+A Y DLPT S FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQAEYTDLPTMSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLII DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLIICDTAMMGLTMMAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|XP_006408711.1| hypothetical protein EUTSA_v10002094mg [Eutrema salsugineum]
 gb|ESQ50164.1| hypothetical protein EUTSA_v10002094mg [Eutrema salsugineum]
Length=221

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 127/188 (68%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   ++  G+K+G+AIF
Sbjct  3    IEKAGSRREEEEPIVQKPKLDKGKGKAHVFAPPMNYSRIMDKHKQEKMSKAGWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF+A Y DLPTFS FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQAEYTDLPTFSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLILCDTAMMGLTMMAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|XP_006399087.1| hypothetical protein EUTSA_v10015967mg [Eutrema salsugineum]
 gb|ESQ40540.1| hypothetical protein EUTSA_v10015967mg [Eutrema salsugineum]
Length=183

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 125/179 (70%), Gaps = 27/179 (15%)
 Frame = +2

Query  125  KSESTKIDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            KS+S  +DV AESS   KGKAPLLG  +  S         GGYK+GL+IFD +LR+ ++ 
Sbjct  2    KSDSIAVDVPAESSSAIKGKAPLLGLAHTGS---------GGYKRGLSIFDFLLRLAAIV  52

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AA  TM T++ETLPFFTQF QF+ASYDDLPTF FFVI++ +V+GYLVLSLP S+V I
Sbjct  53   AALAAAATMGTSDETLPFFTQFLQFQASYDDLPTFQFFVIAIAMVAGYLVLSLPISVVTI  112

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
                              A+ L+TAAA ++AAIVYLAH GN + NWLAICQQFGDFC++
Sbjct  113  V-----------------ALVLSTAAASAAAAIVYLAHNGNQNTNWLAICQQFGDFCQK  154



>ref|XP_010557426.1| PREDICTED: casparian strip membrane protein 3 [Tarenaya hassleriana]
Length=217

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 117/174 (67%), Gaps = 5/174 (3%)
 Frame = +2

Query  149  VAESSKERKGK-----APLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            + +  K  KGK     AP     +V    K   V   G K+G+AIFD +LR+++  TA+A
Sbjct  15   IVQKVKLDKGKGKAVFAPPANYKDVLDQRKQEQVKADGLKRGVAIFDFVLRLIAAITAMA  74

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A   MAT +ETLPFFTQF QF+A Y DLPTFS FVI+  IV GYL LSLPFSIVCI R  
Sbjct  75   AAAKMATTDETLPFFTQFLQFQADYTDLPTFSLFVIANAIVGGYLTLSLPFSIVCIIRPL  134

Query  494  AVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
            AV PR+FLII DT  + + T  A +SAAIVYLAH G+  ANWL +CQQFGDFC+
Sbjct  135  AVPPRLFLIICDTAMVAVTTGVAAASAAIVYLAHNGSPSANWLPVCQQFGDFCQ  188



>sp|P0DI60.1|CASP1_HELAN RecName: Full=Casparian strip membrane protein 1; Short=HaCASP1 
[Helianthus annuus]
Length=212

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 127/185 (69%), Gaps = 7/185 (4%)
 Frame = +2

Query  119  MEKSESTK----IDV-AESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLIL  283
            M+ S STK    I +   SSK  K   P + A    S  K   V+G  +K+GL I D IL
Sbjct  1    MDSSNSTKETGDIPIPVTSSKSSKAAPPPVVAAKAKSTTKQPLVSG--WKRGLGIIDFIL  58

Query  284  RIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLP  463
            RI ++A A+AA   M T  + LPFFTQFFQF+A Y+DLP F+FFVI+  +   YLVLSLP
Sbjct  59   RICAIAAALAAATAMGTTSQQLPFFTQFFQFKADYNDLPAFTFFVIANAMAGAYLVLSLP  118

Query  464  FSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFG  643
            FSI+CI R + +G R+ L++ DTVA+ L TAAA ++A+IVYLAH GN+DANW+AIC+QF 
Sbjct  119  FSILCIVRPHILGARLMLLVFDTVAVPLVTAAASAAASIVYLAHNGNSDANWVAICRQFN  178

Query  644  DFCER  658
            DFC+R
Sbjct  179  DFCQR  183



>ref|XP_008237717.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Prunus mume]
Length=209

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 136/180 (76%), Gaps = 10/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKER--KGKAPL--LGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            +ST I++ ES  +   KG+ P   + A +   D K      GG+KKG++IFD ILR+ + 
Sbjct  7    DSTTINIPESRNKTVAKGETPYVRIQAAHPMHDQK------GGWKKGISIFDFILRLGAT  60

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A A+ A + M ++E+TLPFFTQFFQF+ASYDDLPTF+FFVI MGIV  YLVLSLPFSIV 
Sbjct  61   AAALGAAIAMGSSEQTLPFFTQFFQFQASYDDLPTFTFFVIGMGIVGAYLVLSLPFSIVT  120

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +AV PR+ L+I DT+A+TL T+ A S+AAIVYL+H GN+DANWLAICQQFGDFC++
Sbjct  121  IVRPHAVAPRLLLLIFDTLALTLNTSCAASAAAIVYLSHNGNSDANWLAICQQFGDFCQQ  180



>ref|XP_010037287.1| PREDICTED: casparian strip membrane protein 1-like [Eucalyptus 
grandis]
 gb|KCW48963.1| hypothetical protein EUGRSUZ_K02571 [Eucalyptus grandis]
Length=203

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 133/180 (74%), Gaps = 6/180 (3%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M+  +S  IDV +S+      A   G   VA     AP AGG + KG+AIFD ILR+ ++
Sbjct  1    MKSGDSATIDVPDSTASGGATAKGKGVTVVA-----APRAGG-WNKGVAIFDFILRLCAI  54

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
             TA+AA   M T++ETLPFFTQFFQF+ASYDDLPTF FFVI+M IV GYLVLSLPFSIVC
Sbjct  55   VTALAAAAAMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAMAIVGGYLVLSLPFSIVC  114

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R++A G RM L++ D +A+TL TAA  ++AAIVYLAH GN + NWLAICQQFGDFC++
Sbjct  115  IIRTHAAGLRMLLLVLDAMALTLTTAAGAAAAAIVYLAHNGNPNTNWLAICQQFGDFCQK  174



>ref|XP_007201619.1| hypothetical protein PRUPE_ppa019901mg [Prunus persica]
 gb|EMJ02818.1| hypothetical protein PRUPE_ppa019901mg [Prunus persica]
Length=209

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 136/180 (76%), Gaps = 10/180 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKER--KGKAPL--LGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            +ST I+++ES  +   KG+ P   + A +   D K      GG+KKG++IFD ILR+ + 
Sbjct  7    DSTTINISESRNKTVAKGETPYVRIQAAHPMHDQK------GGWKKGISIFDFILRLGAT  60

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A A+ A + M ++E+TLPFFTQFFQF+ASYDDLPTF FFVI MGIV  YLVLSLPFSIV 
Sbjct  61   AAALGAAIAMGSSEQTLPFFTQFFQFQASYDDLPTFMFFVIGMGIVGAYLVLSLPFSIVT  120

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +AV PR+ L+I DT+A+TL T+ A S+AAIVYLAH GN+DANWLAICQQFGDFC++
Sbjct  121  IVRPHAVAPRLLLLIFDTLALTLNTSCAASAAAIVYLAHNGNSDANWLAICQQFGDFCQQ  180



>sp|P0DI48.1|CASP4_RAPSA RecName: Full=Casparian strip membrane protein 4; Short=RsCASP4 
[Raphanus sativus]
Length=205

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 125/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V+  G+K+G+AIF
Sbjct  3    IEKTGSRREEEEPIVQKPKLEKGKGKAHVFAPPMNYSRIMEKHKQEKVSMAGWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF A Y DLPT S FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFSADYTDLPTLSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLILCDTAMMGLTMVAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCK  190



>ref|XP_002881427.1| hypothetical protein ARALYDRAFT_482586 [Arabidopsis lyrata subsp. 
lyrata]
 sp|D7LIN7.1|CASP1_ARALL RecName: Full=Casparian strip membrane protein 1; Short=AlCASP1 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH57686.1| hypothetical protein ARALYDRAFT_482586 [Arabidopsis lyrata subsp. 
lyrata]
Length=203

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 121/176 (69%), Gaps = 5/176 (3%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST IDV E S   K  + +     V      A  AGGG K+GLAIFD +LR+ ++   I
Sbjct  4    ESTTIDVGEPSTVTKSSSHV-----VKKKGFVAAAAGGGAKRGLAIFDFLLRLAAIGVTI  58

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A   M TA+ETLPFFTQF QF+A YDDLP F +FVI++ IV+ YLVLSLPFSIV I R 
Sbjct  59   GAASVMYTAQETLPFFTQFLQFQAGYDDLPAFQYFVIAVAIVASYLVLSLPFSIVTIVRP  118

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             AV PR+ L+I DT+ +TL T+AA ++A+IVYLAH GN   NWL ICQQFGDFC+ 
Sbjct  119  LAVAPRLILLIFDTLVVTLNTSAAAAAASIVYLAHNGNQSTNWLPICQQFGDFCQN  174



>ref|XP_002313609.1| hypothetical protein POPTR_0009s16160g [Populus trichocarpa]
 gb|EEE87564.1| hypothetical protein POPTR_0009s16160g [Populus trichocarpa]
Length=198

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 127/186 (68%), Gaps = 4/186 (2%)
 Frame = +2

Query  110  VSIMEKS-ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAG--GGYKKGLAIFDLI  280
            + + +KS E+TKI + E   + KGK  + GAL       A        G+KKG AIFDL 
Sbjct  1    MDVSDKSGEATKITIQEPKADTKGKG-IAGALTAPVVVAAKAAQRPRKGWKKGAAIFDLT  59

Query  281  LRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSL  460
            LR+ ++A   AAT  MAT ++TLPFFTQFFQF A Y DLPTF  F+I   I SGYLVLSL
Sbjct  60   LRLSAIAAGFAATSLMATTDQTLPFFTQFFQFHAQYTDLPTFLSFMIVNAITSGYLVLSL  119

Query  461  PFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQF  640
            PFSIVCI R+ A GPR+ LII D+V + L T+AA +SAAIVYLAH GN+ +NW A CQQF
Sbjct  120  PFSIVCIVRARAAGPRLLLIILDSVMMALTTSAASASAAIVYLAHNGNSSSNWNAFCQQF  179

Query  641  GDFCER  658
             ++C++
Sbjct  180  NNYCQQ  185



>ref|XP_010271592.1| PREDICTED: casparian strip membrane protein 2-like [Nelumbo nucifera]
Length=216

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 126/187 (67%), Gaps = 7/187 (4%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGG-------GYKKGLAIFDL  277
            M+ S+ST I++AE   E KG++  + A   A+                 G+KKGLAIFD 
Sbjct  1    MKNSDSTAINIAEPGNEAKGESTTVDAKGKAAAGAPVTATTTATKTAREGWKKGLAIFDF  60

Query  278  ILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLS  457
            ILR++++   + A++ M T ++ LP FTQ FQFEASY DLP   FFVI+  I +G+LVLS
Sbjct  61   ILRLLAIGATLGASIAMGTTDQILPIFTQAFQFEASYSDLPALLFFVIANAIAAGFLVLS  120

Query  458  LPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQ  637
            LPFSIV I R +A GP++ L+I DTV ++L  A A S+AAIVYLAH GN++ANW+AICQQ
Sbjct  121  LPFSIVGIVRPHAEGPKLLLLILDTVMVSLTAAGASSAAAIVYLAHTGNSNANWVAICQQ  180

Query  638  FGDFCER  658
            F  FC++
Sbjct  181  FDSFCQQ  187



>ref|NP_180305.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9ZQI2.1|CASP3_ARATH RecName: Full=Casparian strip membrane protein 3; Short=AtCASP3 
[Arabidopsis thaliana]
 gb|AAD41993.1| unknown protein [Arabidopsis thaliana]
 gb|AAM15182.1| unknown protein [Arabidopsis thaliana]
 gb|AAO23628.1| At2g27370 [Arabidopsis thaliana]
 dbj|BAE99586.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07986.1| uncharacterized protein AT2G27370 [Arabidopsis thaliana]
 gb|AEJ82279.1| casparian strip protein 3 [Cloning vector pCASP3::CASP3:GFP]
 gb|AEJ82289.1| casparian strip protein 3 [Cloning vector p35S::CASP3:GFP]
Length=221

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 127/188 (68%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   ++  G+K+G+AIF
Sbjct  3    IEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYNRIMDKHKQEKMSPAGWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF+A Y DLPT S FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DTV + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLILCDTVMMGLTLMAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|NP_001242085.1| casparian strip membrane protein 4 [Glycine max]
 sp|C6TH93.1|CASP4_SOYBN RecName: Full=Casparian strip membrane protein 4; Short=GmCASP4 
[Glycine max]
 gb|ACU21195.1| unknown [Glycine max]
Length=210

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +2

Query  251  KKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMG  430
            KKG+AI D ILR+ ++ +A+ A  TMAT++ETLPFFTQFFQFEASYD   TF FFVI+M 
Sbjct  46   KKGVAILDFILRLGAITSALGAAATMATSDETLPFFTQFFQFEASYDSFSTFQFFVIAMA  105

Query  431  IVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTD  610
             V GYLVLSLPFSIV I R +A GPR+FLII DTV +TLAT++A ++ AIVYLAH GN D
Sbjct  106  FVGGYLVLSLPFSIVTIIRPHAAGPRLFLIILDTVFLTLATSSAAAATAIVYLAHNGNQD  165

Query  611  ANWLAICQQFGDFCER  658
            +NWLAIC QFGDFC+ 
Sbjct  166  SNWLAICNQFGDFCQE  181



>gb|AEJ82303.1| casparian strip protein 3 [Cloning vector pScarecrow::CASP3:mCherry]
Length=229

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 127/188 (68%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   ++  G+K+G+AIF
Sbjct  3    IEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYNRIMDKHKQEKMSPAGWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF+A Y DLPT S FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DTV + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLILCDTVMMGLTLMAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|XP_008361038.1| PREDICTED: casparian strip membrane protein VIT_06s0080g00840-like 
[Malus domestica]
Length=217

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  239  GGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFV  418
            GGG+KKGLAI D++LR+ + + A+AA  T    E+ LPFFTQFFQF A Y+DLPTF+FFV
Sbjct  49   GGGWKKGLAIIDIVLRLGAGSAAVAAAYTAGNTEQILPFFTQFFQFHAQYNDLPTFTFFV  108

Query  419  ISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHV  598
            ++  +  GY+  SLPFSI+C+ R +A GPR+ L+I DTV + L  AA G+S+AIVYLAH 
Sbjct  109  VANAVAVGYIGFSLPFSIICVIRPHAXGPRLLLVILDTVMVALIIAADGASSAIVYLAHN  168

Query  599  GNTDANWLAICQQFGDFCE  655
            GN +ANWLAIC+Q+ DFC+
Sbjct  169  GNVNANWLAICRQYNDFCQ  187



>ref|XP_010683665.1| PREDICTED: casparian strip membrane protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=216

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 128/176 (73%), Gaps = 12/176 (7%)
 Frame = +2

Query  155  ESSKER---KGK-----APLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            ESS  R   KGK     APL+G + VA +N      G G K+G+ + D ++R++++ATA+
Sbjct  16   ESSGARDQAKGKTPIMEAPLIGKV-VARENSND---GAGVKRGVGVIDFVVRLIALATAL  71

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AATV M T ++TLPFFTQFFQF A Y DLPTF++FVI+  IV+ YLVLS+PFSIV I R 
Sbjct  72   AATVVMGTTDQTLPFFTQFFQFRARYYDLPTFTYFVIANAIVAAYLVLSMPFSIVTIVRP  131

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             A GPR+ L+I DT+A+TL  +AA + AAIV LAH GNT+ NW+AICQQF +FC+R
Sbjct  132  LAAGPRLILVIFDTIALTLTISAAAAGAAIVSLAHKGNTNTNWIAICQQFDNFCQR  187



>ref|XP_010672773.1| PREDICTED: casparian strip membrane protein 3-like [Beta vulgaris 
subsp. vulgaris]
Length=203

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 126/180 (70%), Gaps = 6/180 (3%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M + ES+ I + E   E +GK   +GA+ V +   A    GG  K+GLAIFD +LR+ ++
Sbjct  1    MSQHESSTITIQEPKSEARGK---VGAMKVVT---AMGSGGGAVKRGLAIFDFVLRLAAL  54

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A A+ AT+ M T+++TL FFTQFFQF A YDDLP FSFFV +  + SGYLVLSLPFSIV 
Sbjct  55   AAALGATIAMGTSDQTLNFFTQFFQFRAQYDDLPAFSFFVAANAVASGYLVLSLPFSIVS  114

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R    G R+ LII DTVA+ L +A AG++AAIVYLAH GNT  NW AICQQFG FCER
Sbjct  115  IVRPQITGVRLLLIILDTVAVALVSAGAGAAAAIVYLAHKGNTQINWGAICQQFGSFCER  174



>gb|KHN36486.1| Casparian strip membrane protein 5 [Glycine soja]
Length=218

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +2

Query  218  NKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDL  397
             KA P+   G+KKG+AI D ILR+ ++ +A+ A   M  +E+ LPFFTQFFQF A +DD 
Sbjct  43   TKATPLPRAGWKKGVAILDFILRLGAIGSALGAAAIMGNSEQILPFFTQFFQFHAQWDDF  102

Query  398  PTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaa  577
            P F FFV + G   G+L+LSLPFSIVCI R +AVGPR+ L+I D + + L  AAA ++AA
Sbjct  103  PMFQFFVFANGAAGGFLILSLPFSIVCIVRPFAVGPRLLLVILDILMMALVMAAASAAAA  162

Query  578  ivylaHVGNTDANWLAICQQFGDFCE  655
            +VYLAH G+ DANW+AICQQF DFC+
Sbjct  163  VVYLAHNGSQDANWIAICQQFTDFCQ  188



>ref|XP_010417897.1| PREDICTED: casparian strip membrane protein 3 [Camelina sativa]
Length=221

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 125/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V   G+K+G+AIF
Sbjct  3    IEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYSRIMEKHKQEKVGTPGWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF+A Y DLPT S FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLILCDTAMMGLTMMAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|XP_006295716.1| hypothetical protein CARUB_v10024835mg [Capsella rubella]
 gb|EOA28614.1| hypothetical protein CARUB_v10024835mg [Capsella rubella]
Length=221

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 125/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V   G+++G+AIF
Sbjct  3    IEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYSRIMEKHKQEKVGTSGWRRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF+A Y DLPT S FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLILCDTAMMGLTMIAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>gb|ACU20464.1| unknown [Glycine max]
Length=223

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = +2

Query  218  NKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDL  397
             KA P+   G+KKG+AI D ILR+ ++ +A+ A   M  +E+ LPFFTQFFQF A +DD 
Sbjct  43   TKATPLPRAGWKKGVAILDFILRLGTIGSALRAAAIMGNSEQILPFFTQFFQFHAQWDDF  102

Query  398  PTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaa  577
            P F FFV + G   G+L+LSLPFSIVCI R +AVGPR+ L+I D + + L  AAA ++AA
Sbjct  103  PMFQFFVFANGAAGGFLILSLPFSIVCIVRPFAVGPRLLLVILDILMMALVMAAASAAAA  162

Query  578  ivylaHVGNTDANWLAICQQFGDFCE  655
            +VYLAH G+ DANW+AICQQF DFC 
Sbjct  163  VVYLAHNGSQDANWIAICQQFTDFCH  188



>ref|XP_003596846.1| hypothetical protein MTR_2g086740 [Medicago truncatula]
 sp|G7IHF9.1|CASP4_MEDTR RecName: Full=Casparian strip membrane protein 4; Short=MtCASP4 
[Medicago truncatula]
 gb|AES67097.1| plant integral membrane protein [Medicago truncatula]
Length=220

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 121/187 (65%), Gaps = 11/187 (6%)
 Frame = +2

Query  122  EKSESTKIDVAESSKER---KGKA------PLLGALNVASDNKAAPVAGGGYKKGLAIFD  274
            E  ES+   + ES + R   KGK+      P   A  V +  KA P+  GG KKG+AI D
Sbjct  6    EVEESSTAPILESKRTRSNGKGKSIDGDHSPPHAATVVTT--KATPLQKGGMKKGIAILD  63

Query  275  LILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVL  454
             ILR+ ++  A+ A V M T E+ LPFFTQF QF A +DD P F FFV++ G  +G+L+L
Sbjct  64   FILRLGAIGAALGAAVIMGTNEQILPFFTQFLQFHAQWDDFPMFKFFVVANGAAAGFLIL  123

Query  455  SLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQ  634
            SLPFSIVCI R  A GPR  L+I D V + L  AAA S+AA+VYLAH G+ DANW AICQ
Sbjct  124  SLPFSIVCIVRPLAAGPRFLLVIVDLVLMALVVAAASSAAAVVYLAHNGSQDANWNAICQ  183

Query  635  QFGDFCE  655
            QF DFC+
Sbjct  184  QFTDFCQ  190



>ref|XP_009377816.1| PREDICTED: casparian strip membrane protein VIT_06s0080g00840-like 
[Pyrus x bretschneideri]
Length=218

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  239  GGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFV  418
            GGG+KKGLAI D++LR+ + + A+AA  T    E+ LPFFTQFFQF A Y+DLPT +FF+
Sbjct  50   GGGWKKGLAIIDIVLRLGAGSAAVAAAYTAGNTEQILPFFTQFFQFHAQYNDLPTITFFI  109

Query  419  ISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHV  598
            ++  +  GY+  SLPFSI+CI R +A+GPR+ L+I DTV + L  AA G+S+AIVYLAH 
Sbjct  110  VANAVAVGYIGFSLPFSIICIIRPHAIGPRLLLVILDTVMVALIIAADGASSAIVYLAHN  169

Query  599  GNTDANWLAICQQFGDFCE  655
            GN +ANWLAIC+Q+ DFC+
Sbjct  170  GNMNANWLAICRQYNDFCQ  188



>ref|XP_010505142.1| PREDICTED: casparian strip membrane protein 1 [Camelina sativa]
Length=207

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 124/181 (69%), Gaps = 11/181 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            EST IDV E S   K  +      +V  D K      A  AGGG K+GLAIFD +LR+ +
Sbjct  4    ESTTIDVGEPSTVTKSSS------HVVVDGKKKKGFVAAAAGGGAKRGLAIFDFLLRLGA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            +A  I A   M TAEETLPFFTQF QF+A YDDLP F +FVI++ IV+ YLVLSLPFSI+
Sbjct  58   IAVTIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAIVASYLVLSLPFSII  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  AV PR+ L+I DT+ +TL T+AA ++A+IVYLAH GN   NWL ICQQFGDFC+
Sbjct  118  AIIRPLAVAPRLILLIFDTLVVTLNTSAAAAAASIVYLAHNGNQSTNWLPICQQFGDFCQ  177

Query  656  R  658
             
Sbjct  178  N  178



>emb|CDX77114.1| BnaC04g39090D [Brassica napus]
Length=221

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 117/175 (67%), Gaps = 6/175 (3%)
 Frame = +2

Query  149  VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            + +  K  KGK      AP +    +   +K   V   G+K+G+AIFD +LR+++  TA+
Sbjct  16   IVQKPKLDKGKGKAHVFAPPMNYSRIMEKHKQEKVNMAGWKRGVAIFDFVLRLIAAITAM  75

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA   MAT EETLPFFTQF QF A Y DLPT S FVI   IV GYL LSLPFSIVCI R 
Sbjct  76   AAAAKMATTEETLPFFTQFLQFSADYTDLPTLSSFVIVNSIVGGYLTLSLPFSIVCIIRP  135

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             AV PR+FLI+ DT  + L   AA +SAAIVYLAH GN+ +NWL +CQQFGDFC+
Sbjct  136  LAVPPRLFLILCDTAMMGLTMIAASASAAIVYLAHNGNSSSNWLPVCQQFGDFCQ  190



>ref|XP_009140798.1| PREDICTED: casparian strip membrane protein ARALYDRAFT_901635 
[Brassica rapa]
 emb|CDY30551.1| BnaA04g15820D [Brassica napus]
Length=221

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 124/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V   G+K+G+AIF
Sbjct  3    IEKAGSRREEEEPIVQKPKLDKGKGKAHVFAPPMNYSRIMEKHKQEKVNMAGWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF A Y DLPT S FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFSADYTDLPTLSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCIIRPLAVPPRLFLILCDTAMMGLTMMAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|XP_008243654.1| PREDICTED: casparian strip membrane protein POPTRDRAFT_763057-like 
[Prunus mume]
Length=211

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  242  GGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVI  421
            GG ++G+AI DL+LRI +V  A+AA  TM T+++ LPFFTQFFQFEASYDD+P+F FF+I
Sbjct  44   GGMRRGMAIIDLVLRIGAVVAALAAAATMGTSDQNLPFFTQFFQFEASYDDMPSFQFFLI  103

Query  422  SMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVG  601
            +M +V+GYLVLS+PFSIV I R +A G R+ L+I D VA+TLAT+AAG++ AIVYLAH G
Sbjct  104  AMSLVAGYLVLSVPFSIVSIVRPHASGIRLLLLILDVVALTLATSAAGAATAIVYLAHNG  163

Query  602  NTDANWLAICQQFGDFCE  655
            N+ +NWLAIC QFGDFC+
Sbjct  164  NSSSNWLAICNQFGDFCQ  181



>ref|XP_009141561.1| PREDICTED: casparian strip membrane protein 1-like [Brassica 
rapa]
Length=202

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 124/175 (71%), Gaps = 6/175 (3%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST I+V E S   K  +      +       A  AGGG+K+GLAIFD +LR+ ++   I
Sbjct  4    ESTTIEVGEPSTVTKSTS------HEKKKGFVAAAAGGGHKRGLAIFDFLLRLAAIGITI  57

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A+  M TAEETLPFFTQF QF+A YDD PTF FFVIS+ IV+ YLVL+LPFSIV I R 
Sbjct  58   GASSVMFTAEETLPFFTQFLQFQAGYDDFPTFQFFVISIAIVASYLVLALPFSIVTIVRP  117

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             AV PR+ L+I+DTV +TL T+AA ++A+IVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  LAVVPRLILLISDTVVLTLTTSAAAAAASIVYLAHNGNANTNWLPICQQFGDFCQ  172



>ref|XP_010473135.1| PREDICTED: casparian strip membrane protein 3-like [Camelina 
sativa]
Length=221

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 124/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V   G+K+G+AIF
Sbjct  3    LEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYSRIMEKHKQEKVGTPGWKRGVAIF  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D  LR+++  TA+AA   MAT EETLPFFTQF QF+A Y DLPT S FVI   IV GYL 
Sbjct  63   DFFLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLILCDTAMMGLTMMAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|XP_010510780.1| PREDICTED: casparian strip membrane protein 3-like [Camelina 
sativa]
Length=221

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 124/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V   G+K+G+AI 
Sbjct  3    IEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYSRIMEKHKQEKVGTPGWKRGVAIL  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF+A Y DLPT S FVI   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FLI+ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLILCDTAMMGLTMMAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|XP_011089204.1| PREDICTED: LOW QUALITY PROTEIN: casparian strip membrane protein 
3-like [Sesamum indicum]
Length=207

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 120/179 (67%), Gaps = 6/179 (3%)
 Frame = +2

Query  122  EKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            + +E T I++ ES K  KGK  +       +   A P     +K+G+ IFD ILRI ++ 
Sbjct  6    KNTEETAINIPES-KSTKGKHVVY-----TATTTATPHHQARWKRGVGIFDFILRICALV  59

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AAT TM T ++TLPF TQFFQF+ASYDDLPTF FFV++  I SGYLVLSLPFSIV I
Sbjct  60   AALAATTTMGTTDQTLPFSTQFFQFQASYDDLPTFMFFVVANAIASGYLVLSLPFSIVGI  119

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R  A G ++ L+I DT   T       ++AAIVYLAH GN++ NWLAICQQF DFC+R
Sbjct  120  VRPSAAGIKLLLLILDTXFFTXKRCWWLAAAAIVYLAHNGNSNTNWLAICQQFTDFCQR  178



>emb|CDY43748.1| BnaAnng07630D [Brassica napus]
Length=202

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 124/175 (71%), Gaps = 6/175 (3%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST I+V E S   K  +      +       A  AGGG+K+GLAIFD +LR+ ++   I
Sbjct  4    ESTTIEVGEPSTVTKSTS------HEKKKGFVAAAAGGGHKRGLAIFDFLLRLAAIGITI  57

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A+  M TAEETLPFFTQF QF+A YDD PTF FFVI++ IV+ YLVL+LPFSIV I R 
Sbjct  58   GASSVMFTAEETLPFFTQFLQFQAGYDDFPTFQFFVIAIAIVASYLVLALPFSIVTIVRP  117

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             AV PR+ L+I+DTV +TL T+AA ++A+IVYLAH GN + NWL ICQQFGDFC+
Sbjct  118  LAVVPRLILLISDTVVLTLTTSAAAAAASIVYLAHNGNANTNWLPICQQFGDFCQ  172



>sp|P0DI56.1|CASP3_LOTJA RecName: Full=Casparian strip membrane protein 3; Short=LjCASP3 
[Lotus japonicus]
 gb|AFK39351.1| unknown [Lotus japonicus]
Length=219

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 114/175 (65%), Gaps = 2/175 (1%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            ES +       K   G AP      V++  KAAP+  GG+KKG+AI D ILR+ ++  A+
Sbjct  17   ESRRTRSNGRGKATVGDAPPPAETVVST--KAAPLPTGGWKKGIAILDFILRLGAIGAAM  74

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
             A++ M T E+ LPFFTQF QF A +DD P F  FV+   +  G+L+LSLP SIVCI R 
Sbjct  75   GASILMGTNEQILPFFTQFLQFHAQWDDFPVFKLFVVLNALAGGFLILSLPLSIVCIVRP  134

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             AVGPR  L+I D V +    AAA ++AAIVY+AH G+ DANW+AICQQF DFC+
Sbjct  135  LAVGPRFLLLITDLVNMATVIAAASAAAAIVYVAHNGSQDANWIAICQQFTDFCQ  189



>ref|XP_010102014.1| hypothetical protein L484_016304 [Morus notabilis]
 gb|EXB91234.1| hypothetical protein L484_016304 [Morus notabilis]
Length=214

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 117/183 (64%), Gaps = 3/183 (2%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASD---NKAAPVAGGGYKKGLAIFDLILRI  289
            ME  +S    V     E KGKA +             KA  +   G+KKG+AIFD +LRI
Sbjct  1    MEAKQSDDAAVLIPKPESKGKAVVDAPPPPPVAVAARKATVLRRVGWKKGVAIFDFVLRI  60

Query  290  VSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFS  469
             + A A AA   +  AE+ LPFFTQF QF   + DLPT +FFV++     GYLVLSLPFS
Sbjct  61   GAAAAAFAAATAVGQAEQVLPFFTQFLQFHVEFTDLPTLTFFVVANATAGGYLVLSLPFS  120

Query  470  IVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDF  649
            I CI R + VGPR+FLII D+V   L  AAAG++ AI+YLAH G+TDANWLA+CQQ+ DF
Sbjct  121  ITCIIRPHKVGPRLFLIILDSVMTALTIAAAGATTAIMYLAHNGSTDANWLAVCQQYTDF  180

Query  650  CER  658
            C++
Sbjct  181  CQQ  183



>ref|XP_011016793.1| PREDICTED: casparian strip membrane protein 4-like [Populus euphratica]
Length=180

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  KAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLP  400
            KAA     G+KKG+AI DL+LR+ ++    AAT  MAT +ETLPFFTQF QF A Y+DLP
Sbjct  5    KAAQRPRKGWKKGVAIVDLVLRLSAIVAGFAATSLMATTDETLPFFTQFLQFHAQYNDLP  64

Query  401  TFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaai  580
            TFSFF+I+  I SGYLVL+LPFSIVCI R  A GPR+ LII D+V + L T+AA +SAAI
Sbjct  65   TFSFFLIANAITSGYLVLTLPFSIVCIVRPRAAGPRLLLIILDSVMMGLTTSAASASAAI  124

Query  581  vylaHVGNTDANWLAICQQFGDFCER  658
            VYLAH GN+ +NW A C QF +FC++
Sbjct  125  VYLAHNGNSSSNWNAFCLQFNNFCQQ  150



>ref|XP_009133899.1| PREDICTED: casparian strip membrane protein ARALYDRAFT_901635-like 
[Brassica rapa]
 emb|CDX83261.1| BnaA03g22450D [Brassica napus]
Length=221

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 124/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V+  G+K+G+AI 
Sbjct  3    IEKAGSRREEEEPIVQKPKLDKGKGKAHVFAPPMNYSRIMEKHKQEKVSMPGWKRGVAIV  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF A Y DLPT S FV+   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFSADYTDLPTLSSFVVVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FL++ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLVLCDTAMMGLTMIAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>emb|CDY31172.1| BnaC03g47190D [Brassica napus]
Length=221

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 124/188 (66%), Gaps = 9/188 (5%)
 Frame = +2

Query  119  MEKSESTKID---VAESSKERKGK------APLLGALNVASDNKAAPVAGGGYKKGLAIF  271
            +EK+ S + +   + +  K  KGK      AP +    +   +K   V+  G+K+G+AI 
Sbjct  3    IEKAGSRREEEEPIVQKPKLDKGKGKAHVFAPPMNNSRIMEKHKQEKVSMPGWKRGVAIV  62

Query  272  DLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLV  451
            D +LR+++  TA+AA   MAT EETLPFFTQF QF A Y DLPT S FV+   IV GYL 
Sbjct  63   DFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFSADYTDLPTLSSFVVVNSIVGGYLT  122

Query  452  LSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAIC  631
            LSLPFSIVCI R  AV PR+FL++ DT  + L   AA +SAAIVYLAH GN+ +NWL +C
Sbjct  123  LSLPFSIVCILRPLAVPPRLFLVLCDTAMMGLTMIAASASAAIVYLAHNGNSSSNWLPVC  182

Query  632  QQFGDFCE  655
            QQFGDFC+
Sbjct  183  QQFGDFCQ  190



>ref|XP_008229074.1| PREDICTED: casparian strip membrane protein VIT_06s0080g00840 
[Prunus mume]
Length=216

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 123/186 (66%), Gaps = 7/186 (4%)
 Frame = +2

Query  119  MEKSESTKIDVAESSK---ERKGKA----PLLGALNVASDNKAAPVAGGGYKKGLAIFDL  277
            M+  +S ++ ++  +K   + KGKA    P      V    KA  +     KKGLAI D+
Sbjct  1    MDSKKSDEVAISRDAKANYDAKGKAVEGAPPPPPPPVVVTTKATKIRNIRGKKGLAIIDI  60

Query  278  ILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLS  457
            +LR+ + + A+AA       E+ LPFFTQFFQF A Y+DLPTF+FFV +  + SGY+ +S
Sbjct  61   VLRLGAGSAALAAAYISGNTEQILPFFTQFFQFHAQYNDLPTFTFFVAANAVASGYIAIS  120

Query  458  LPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQ  637
            LPFSIVCI R +A+GPR+ L+  DTV + L  +AAG+S+AIVYLAH GN ++NWLAIC Q
Sbjct  121  LPFSIVCIVRPHAIGPRLLLVFLDTVMVALVMSAAGASSAIVYLAHNGNLNSNWLAICMQ  180

Query  638  FGDFCE  655
            + DFC+
Sbjct  181  YTDFCQ  186



>ref|XP_010516820.1| PREDICTED: casparian strip membrane protein 1-like [Camelina 
sativa]
Length=207

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 125/181 (69%), Gaps = 11/181 (6%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNK-----AAPVAGGGYKKGLAIFDLILRIVS  295
            ++T IDV E S   K  +      +V  D K      A  AGGG K+GLAIFD +LR+ +
Sbjct  4    DATTIDVGEPSTVTKSSS------HVVVDAKKKKGFVAAAAGGGAKRGLAIFDFLLRLGA  57

Query  296  vataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIV  475
            +A +I A   M TAEETLPFFTQF QF+A YDDLP F +FVI++ IV+ YLVLSLPFSI+
Sbjct  58   IAVSIGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAIVASYLVLSLPFSII  117

Query  476  CIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             I R  AV PR+ L+I DT+ +TL T+AA ++A+IVYLAH GN   NWL ICQQFGDFC+
Sbjct  118  AIIRPLAVAPRLILLIFDTLVVTLNTSAAAAAASIVYLAHNGNQSTNWLPICQQFGDFCQ  177

Query  656  R  658
             
Sbjct  178  N  178



>ref|XP_010534401.1| PREDICTED: casparian strip membrane protein 4-like [Tarenaya 
hassleriana]
Length=204

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M KSEST IDV ESS   KGKAPL     +   + A+  AGGGYK+GL+IFD +LRI ++
Sbjct  1    MAKSESTTIDVPESSAVAKGKAPL-----IVHGSAASAAAGGGYKRGLSIFDFLLRIAAI  55

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
              A+AA+ TM T++ETLPFFTQFFQF+ASYDDLPTF FFVI+M IV+GYLVLSLPFS+V 
Sbjct  56   VAALAASATMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAMAIVAGYLVLSLPFSVVT  115

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R  A  PR+ L++ DT  +TL TAAA ++AAIVYLAH GN + NWLAICQQFGDFC++
Sbjct  116  IVRPLAAAPRLLLLVLDTAVLTLNTAAASAAAAIVYLAHSGNPNTNWLAICQQFGDFCQK  175



>emb|CDP06886.1| unnamed protein product [Coffea canephora]
Length=212

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 151/213 (71%), Gaps = 5/213 (2%)
 Frame = +2

Query  119  MEKSESTKID----VAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILR  286
            ME S STK +    +   SK  KGK+       + +  KA P   GG+K+G+AIFD ILR
Sbjct  1    MEPSHSTKSNPETAILIDSKSAKGKS-TAAPAAITATTKATPYRKGGWKRGVAIFDFILR  59

Query  287  IVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPF  466
            + ++   + AT+TM T ++TLPFFTQFFQF+ASYDDLP FS+FV++  I SGYLVLSLPF
Sbjct  60   LCALIATLTATITMGTTDQTLPFFTQFFQFQASYDDLPAFSYFVVANAIASGYLVLSLPF  119

Query  467  SIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGD  646
            SIVCI R +A G R+ L+I DT+ +   TAAA S+AAIVYLAH GN +ANWLAICQQ+ D
Sbjct  120  SIVCIVRPHAAGARLALLIFDTMLLAFTTAAAASAAAIVYLAHNGNQNANWLAICQQYTD  179

Query  647  FCERassavvvgfvtvvilivmvllsaCALRRR  745
            FC+R S AVV  F+  V  + +V+LSA ALRRR
Sbjct  180  FCQRVSGAVVASFMAAVTFVFLVVLSAVALRRR  212



>ref|XP_007150053.1| hypothetical protein PHAVU_005G122200g [Phaseolus vulgaris]
 gb|ESW22047.1| hypothetical protein PHAVU_005G122200g [Phaseolus vulgaris]
Length=217

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 123/189 (65%), Gaps = 17/189 (9%)
 Frame = +2

Query  131  ESTKIDVA------ESSKER---KGK-----APLLGALNVASDNKAAPVAGGGYKKGLAI  268
            +S K DVA      ES + R   KGK     AP   ++ V S  KA P   GG+KKG+AI
Sbjct  2    DSKKEDVASAPTSPESRRTRSNGKGKNIAEAAP--PSVTVVS-TKATPSPRGGWKKGVAI  58

Query  269  FDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYL  448
             D ILR+ ++ +AI A   M  +E+ LPFFTQFFQF   +DD P F FFV + G  + +L
Sbjct  59   LDFILRLGAIGSAIGAAAIMGNSEQILPFFTQFFQFHVQWDDFPMFQFFVFANGGAAVFL  118

Query  449  VLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAI  628
            +LSLPFSIVCI R +A GPR+ L I D  ++ L  AAA ++AA+VYLAH G+ DANW+AI
Sbjct  119  ILSLPFSIVCIVRPFATGPRLLLAIIDIFSMALVMAAASAAAAVVYLAHNGSQDANWIAI  178

Query  629  CQQFGDFCE  655
            CQQF DFC+
Sbjct  179  CQQFTDFCQ  187



>ref|XP_004487484.1| PREDICTED: casparian strip membrane protein MTR_2g086740-like 
[Cicer arietinum]
Length=224

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 116/189 (61%), Gaps = 11/189 (6%)
 Frame = +2

Query  122  EKSESTKIDVAESSKER---KGKAPLLGALNVAS--------DNKAAPVAGGGYKKGLAI  268
            E  ES+   + ES + R   KGK+   G                KA P   GG KKG+AI
Sbjct  6    EVEESSSAPILESKRTRSNGKGKSIDDGDAPPPPAAAKTHVVTTKATPHHKGGMKKGIAI  65

Query  269  FDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYL  448
             D ILR+ ++ +A+ A V M T E+ LPFFTQF QF A +DD P F FFV +    SG L
Sbjct  66   LDFILRLSAIGSALGAAVLMGTNEQILPFFTQFLQFHAQWDDFPMFRFFVGANATASGIL  125

Query  449  VLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAI  628
            +LSLPFSIVCI R  AVGPR  L+I D V + L  AAA S+AAIVYLAH G+ DANW AI
Sbjct  126  ILSLPFSIVCIVRPLAVGPRFLLVIIDLVLMGLVVAAASSAAAIVYLAHNGSQDANWNAI  185

Query  629  CQQFGDFCE  655
            CQQF DFC+
Sbjct  186  CQQFTDFCQ  194



>ref|XP_010258295.1| PREDICTED: casparian strip membrane protein 3 [Nelumbo nucifera]
Length=188

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = +2

Query  194  GALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQ  373
            GAL V   +  A   G G  +G++I DL+LR+V+VA  + + + M T  ETLPFFTQF +
Sbjct  5    GALEVGEASSRASTPGRGLNRGISILDLVLRLVAVAGTLGSAIAMGTTNETLPFFTQFIR  64

Query  374  FEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlat  553
            F+A Y DLP+F+FFVI+  +VS YL+LSLP SI  IARS A G R+ L   D   + L T
Sbjct  65   FKAQYSDLPSFTFFVIANAVVSAYLILSLPLSIYHIARSSARGSRIVLTFLDAAMLALLT  124

Query  554  aaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A A ++AAIVYLAH GN  ANW +ICQQF  FCER
Sbjct  125  AGASAAAAIVYLAHKGNARANWFSICQQFNSFCER  159



>ref|XP_010059483.1| PREDICTED: casparian strip membrane protein 1-like [Eucalyptus 
grandis]
 gb|KCW90515.1| hypothetical protein EUGRSUZ_A02631 [Eucalyptus grandis]
Length=202

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 131/180 (73%), Gaps = 7/180 (4%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M+  E   I+V E+S   KGKAPL+ A       +       G+ KG+AI DLILRI +V
Sbjct  1    MKSGEGFSIEVQETSAAAKGKAPLIPAPLPPPRPE-------GWGKGIAILDLILRICAV  53

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
               +A+T  M T+EETLPFFTQFFQF+ASYDDLPT  FFVI+M +V GYLVLS+PFSIV 
Sbjct  54   VATLASTAAMGTSEETLPFFTQFFQFQASYDDLPTLQFFVIAMALVGGYLVLSIPFSIVT  113

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R  AVGPR  L+I DTVA+TLAT+A  ++AAIVYLAH GN + NWLAICQQFGDFC++
Sbjct  114  IIRPRAVGPRFLLLILDTVALTLATSAGAAAAAIVYLAHNGNLNTNWLAICQQFGDFCQK  173



>ref|XP_002436759.1| hypothetical protein SORBIDRAFT_10g008220 [Sorghum bicolor]
 sp|C5Z7E3.1|CASP3_SORBI RecName: Full=Casparian strip membrane protein 3; Short=SbCASP3 
[Sorghum bicolor]
 gb|EER88126.1| hypothetical protein SORBIDRAFT_10g008220 [Sorghum bicolor]
Length=186

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = +2

Query  218  NKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDL  397
            +KAAP+  GG  KG+++ DLILR +++   +A+ + M T  ETLPFFTQF +F+A Y DL
Sbjct  11   SKAAPLGRGGVSKGVSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSDL  70

Query  398  PTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaa  577
            PT +FFV++  IV  YL+LSLP SIV I RS A   R+ LI  D   + L TA A ++AA
Sbjct  71   PTLTFFVVANSIVCAYLILSLPLSIVHIIRSRAKYSRLLLIFLDAAMLALVTAGASAAAA  130

Query  578  ivylaHVGNTDANWLAICQQFGDFCER  658
            IVYLAH GN  ANWLAICQQF  FCER
Sbjct  131  IVYLAHKGNVRANWLAICQQFDSFCER  157



>ref|XP_007206803.1| hypothetical protein PRUPE_ppa025691mg [Prunus persica]
 gb|EMJ08002.1| hypothetical protein PRUPE_ppa025691mg [Prunus persica]
Length=206

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +2

Query  251  KKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMG  430
            KKGLAI D++LR+ + + A+AA       E+ LPFFTQFFQF A Y+DLPTF+FFV +  
Sbjct  42   KKGLAIIDIVLRLGAGSAALAAAYIAGNTEQILPFFTQFFQFHAQYNDLPTFTFFVAANA  101

Query  431  IVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTD  610
            +  GY+  SLPFSIVCI R +A+GPR+ L+  DTV + L  +AAG+S+AIVYLAH GN +
Sbjct  102  VAVGYIAFSLPFSIVCIVRPHAIGPRLLLVFLDTVMVALVMSAAGASSAIVYLAHNGNLN  161

Query  611  ANWLAICQQFGDFCE  655
            +NWLAIC Q+ DFC+
Sbjct  162  SNWLAICMQYNDFCQ  176



>ref|XP_002276085.1| PREDICTED: casparian strip membrane protein 1 [Vitis vinifera]
 sp|A7PP95.1|CASP1_VITVI RecName: Full=Casparian strip membrane protein 1; Short=VvCASP1 
[Vitis vinifera]
 emb|CBI30337.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 131/176 (74%), Gaps = 1/176 (1%)
 Frame = +2

Query  128  SESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvata  307
            + +T IDV E+  E KGKAPL+ A  VA+  KA P    G+KKGLAIFD +LR+ ++A  
Sbjct  5    ANATTIDVPETRAEAKGKAPLIAAPIVAT-TKATPHPNAGWKKGLAIFDFLLRLAAIAAT  63

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            +AA  TM T +ETLPFFTQFFQF+AS+DDLP F FFV++  I SGYL LSLPFS+V I R
Sbjct  64   LAAATTMGTTDETLPFFTQFFQFQASFDDLPAFMFFVVATAIASGYLALSLPFSLVSIFR  123

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
             +A G R+ LII+DTV + L TA A S+ AIVYLAH G++ ANW+AICQQF DFC+
Sbjct  124  PHAQGIRLLLIISDTVMLALTTAGAASATAIVYLAHNGDSSANWIAICQQFTDFCQ  179



>ref|XP_010046723.1| PREDICTED: casparian strip membrane protein 2-like [Eucalyptus 
grandis]
Length=205

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 108/138 (78%), Gaps = 4/138 (3%)
 Frame = +2

Query  242  GGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVI  421
            GG+KKG+A+FD +LR+V+  T +AA  TM T ++TLPFFTQFFQ++ASYDDLP F+FFVI
Sbjct  42   GGWKKGVAVFDFLLRLVATGTTLAAATTMGTTDQTLPFFTQFFQYQASYDDLPAFTFFVI  101

Query  422  SMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVG  601
            +    S YLVLSLPFSIVCI R  AVGPR+ L+I DT+ + L  AAA S+AAIVYLA   
Sbjct  102  ANAGASAYLVLSLPFSIVCIVRPQAVGPRLLLLIFDTIFVALTMAAASSAAAIVYLAQ--  159

Query  602  NTDANWLAICQQFGDFCE  655
              +ANWLAIC+QF DFC+
Sbjct  160  --NANWLAICRQFNDFCQ  175



>sp|P0DI41.1|CASP3_VIGUN RecName: Full=Casparian strip membrane protein 3; Short=VuCASP3 
[Vigna unguiculata]
Length=224

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
              K  P   GG++KG AI D ILR+ ++++AI A   M   E+ LPFFTQFFQF   +DD
Sbjct  41   STKVTPSPRGGWRKGAAILDFILRLGAISSAIGAAAVMGNNEQILPFFTQFFQFHVQWDD  100

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
             P F FFV + G    +L+LSLPFSIVCI R +AVGPR+ L+I D  A+ L  AAA ++A
Sbjct  101  FPMFQFFVFANGAAVVFLILSLPFSIVCIVRPFAVGPRLLLVIVDIFAMALVIAAASAAA  160

Query  575  aivylaHVGNTDANWLAICQQFGDFCE  655
            A+VYLAH G+ DANW+AICQQ+ DFC+
Sbjct  161  AVVYLAHNGSQDANWIAICQQYTDFCQ  187



>gb|KCW87345.1| hypothetical protein EUGRSUZ_B03828, partial [Eucalyptus grandis]
Length=187

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 108/138 (78%), Gaps = 4/138 (3%)
 Frame = +2

Query  242  GGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVI  421
            GG+KKG+A+FD +LR+V+  T +AA  TM T ++TLPFFTQFFQ++ASYDDLP F+FFVI
Sbjct  24   GGWKKGVAVFDFLLRLVATGTTLAAATTMGTTDQTLPFFTQFFQYQASYDDLPAFTFFVI  83

Query  422  SMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVG  601
            +    S YLVLSLPFSIVCI R  AVGPR+ L+I DT+ + L  AAA S+AAIVYLA   
Sbjct  84   ANAGASAYLVLSLPFSIVCIVRPQAVGPRLLLLIFDTIFVALTMAAASSAAAIVYLAQ--  141

Query  602  NTDANWLAICQQFGDFCE  655
              +ANWLAIC+QF DFC+
Sbjct  142  --NANWLAICRQFNDFCQ  157



>ref|XP_004955209.1| PREDICTED: casparian strip membrane protein Os06g0231050-like 
[Setaria italica]
Length=198

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 114/179 (64%), Gaps = 14/179 (8%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYK---KGLAIFDLILRIVSva  301
            E+ K  V+E  +  K KA    AL VAS        GGG +   +GLA+ DLILR V+V 
Sbjct  2    ETGKAPVSEHEETSKSKA---AALEVAS--------GGGSRAASRGLAVLDLILRFVAVI  50

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
              + + + M T  +TLPFFTQF +F+A YDDLPT +FFV++  IV+ YLVLS+P SIV  
Sbjct  51   ATVGSAIAMGTTNQTLPFFTQFLRFKAQYDDLPTLTFFVVANSIVAAYLVLSIPLSIVHT  110

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             RS A   R+ L+  D   + L T+AA ++AAIVYLAH GN  ANW AICQQF  FCER
Sbjct  111  IRSRAKYSRLVLVFFDAAMLALVTSAASAAAAIVYLAHKGNARANWFAICQQFDAFCER  169



>ref|XP_002278569.1| PREDICTED: casparian strip membrane protein 3 [Vitis vinifera]
 sp|A7PMY7.1|CASP3_VITVI RecName: Full=Casparian strip membrane protein 3; Short=VvCASP3 
[Vitis vinifera]
 emb|CBI22242.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = +2

Query  194  GALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQ  373
            GAL +   +K + +  GG  +G++I D ILR++++   + + + M T  ETLPFFTQF Q
Sbjct  4    GALELGEGSKTS-IPRGGVNRGISILDFILRLITIIGTLGSAIAMGTTNETLPFFTQFTQ  62

Query  374  FEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlat  553
            F A YDDLPTF+FFVI+  IVSGYLVLSLP SI+ I RS A   R+ LI  DT  + L T
Sbjct  63   FRAEYDDLPTFTFFVIANSIVSGYLVLSLPMSILHIVRSGARASRIVLIFFDTAMLALLT  122

Query  554  aaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            AAA +++AIVYLAH GN  ANW AICQQF  FCER
Sbjct  123  AAASAASAIVYLAHKGNAQANWFAICQQFKSFCER  157



>ref|XP_004293125.1| PREDICTED: casparian strip membrane protein 5-like [Fragaria 
vesca subsp. vesca]
Length=207

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G KKGLAI DL+LR+ + A A AA  T   +++ LPFFTQF QF A Y DLPTF+FFV++
Sbjct  42   GSKKGLAIVDLVLRLGASAAAFAAAYTTGNSDQILPFFTQFLQFHAQYTDLPTFTFFVVA  101

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              +  GY+ LS+PFSIVCI R  A+GPR+ L+I DTV I L  +AAG+S+ IVYLAH GN
Sbjct  102  NAVAVGYIGLSMPFSIVCIIRPRAIGPRLVLVIFDTVMIALLISAAGASSTIVYLAHNGN  161

Query  605  TDANWLAICQQFGDFCE  655
             D+NWLAIC Q+ +FC+
Sbjct  162  LDSNWLAICMQYSNFCQ  178



>ref|XP_010520695.1| PREDICTED: casparian strip membrane protein 1-like [Tarenaya 
hassleriana]
Length=202

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 120/175 (69%), Gaps = 9/175 (5%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST ID+ ESS   K KA     + +A+       A GG K+GLAIFD +LR+V++A  I
Sbjct  7    ESTAIDMGESSSMAKEKAEAKKKVGMAT------AAAGGSKRGLAIFDFLLRLVAIAFTI  60

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA   M  AEETLPFFTQFFQF+ASYDD+P F FF+I+M +V+GYLVLSLPFSIV I R 
Sbjct  61   AAAAVMGMAEETLPFFTQFFQFQASYDDIPIFQFFLIAMAMVAGYLVLSLPFSIVAIVRP  120

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
            +AV PR+           + T  A ++AAIVYLAH GN + NWL ICQQFGDFC+
Sbjct  121  HAVAPRLL---LLIFDTVVMTLNAAAAAAIVYLAHNGNPNTNWLPICQQFGDFCQ  172



>ref|XP_002533115.1| conserved hypothetical protein [Ricinus communis]
 sp|B9T4E6.1|CASP5_RICCO RecName: Full=Casparian strip membrane protein 5; Short=RcCASP5 
[Ricinus communis]
 gb|EEF29260.1| conserved hypothetical protein [Ricinus communis]
Length=186

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +2

Query  200  LNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFE  379
            L VA D  + P+  GG  +G++I D ILR+V++   +A+ + M T  ETLPF TQF +F 
Sbjct  8    LGVAKD--STPI--GGANRGVSILDFILRLVALVGTLASAILMGTTNETLPFATQFIRFR  63

Query  380  ASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataa  559
            A YDDLPTF+FFV++  +VSGYL+LSLP SIV I RS A   R+ LII DT  + L TA 
Sbjct  64   AEYDDLPTFTFFVVANIVVSGYLLLSLPLSIVNIVRSTAKNRRIILIIFDTAMLALLTAG  123

Query  560  agssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A ++AAIVYLAH GNT ANW AICQQF  FCER
Sbjct  124  ASAAAAIVYLAHKGNTRANWFAICQQFNSFCER  156



>gb|AFW85233.1| membrane protein 2 [Zea mays]
Length=186

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 0/147 (0%)
 Frame = +2

Query  218  NKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDL  397
            +K AP+   G  KG+++ DLILR +++   +A+ + M T  ETLPFFTQF +F+A Y DL
Sbjct  11   SKQAPLGSRGVSKGVSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSDL  70

Query  398  PTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaa  577
            PT +FFV++  IV  YL LSLP SIV I RS A   R+ L++ D   + L TA A ++AA
Sbjct  71   PTLTFFVVANSIVCAYLTLSLPLSIVHIIRSRAKYSRLLLVVLDAAMLALVTAGASAAAA  130

Query  578  ivylaHVGNTDANWLAICQQFGDFCER  658
            IVYLAH GN  ANWLAICQQF  FCER
Sbjct  131  IVYLAHKGNVRANWLAICQQFDSFCER  157



>gb|KDP36190.1| hypothetical protein JCGZ_08834 [Jatropha curcas]
Length=196

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 115/180 (64%), Gaps = 14/180 (8%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSv  298
            M KSEST IDV   + E K KA  +       D +      G YKKG+AI D  LR+ ++
Sbjct  1    MMKSESTAIDV--PALEPKAKASFI------RDER------GSYKKGIAIIDFFLRLGAL  46

Query  299  ataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVC  478
            A A+ A  TM T++E LPFFT+F QF+ASYD + TF FFVI+M + +GYL LSLPFS+V 
Sbjct  47   ACAVVAAATMVTSDEDLPFFTRFNQFQASYDAVQTFQFFVIAMAMTAGYLALSLPFSVVG  106

Query  479  IARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            I R +A GPR+ L I DTV++ L  A A ++A  VYL H GN   NW AIC Q+ DFC +
Sbjct  107  IVRPHAAGPRILLFILDTVSLGLNAAVAAAAADTVYLMHNGNATLNWFAICLQYTDFCSK  166



>ref|XP_010029309.1| PREDICTED: casparian strip membrane protein 1 [Eucalyptus grandis]
 gb|KCW56206.1| hypothetical protein EUGRSUZ_I01956 [Eucalyptus grandis]
Length=186

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 101/150 (67%), Gaps = 0/150 (0%)
 Frame = +2

Query  209  ASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASY  388
            A +   A  A  G  KG+A+ D ILRI++    + + + M T  ETLPFFTQF +F A Y
Sbjct  8    AGEVAKASAARYGINKGVAVLDFILRILAFVCTLGSAIAMGTTNETLPFFTQFIRFRARY  67

Query  389  DDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaags  568
            DDLPTF+FFV++  +VS YLVLSLP S+  I RS A   R+ L+I DT  + L TA A +
Sbjct  68   DDLPTFTFFVVANSVVSAYLVLSLPLSVFHIMRSAAQNSRIVLVIFDTAMLALLTAGASA  127

Query  569  saaivylaHVGNTDANWLAICQQFGDFCER  658
            SAAIVYLAH GNT ANW +ICQQF  FCER
Sbjct  128  SAAIVYLAHKGNTKANWFSICQQFNSFCER  157



>ref|XP_002273638.1| PREDICTED: casparian strip membrane protein 2 [Vitis vinifera]
 sp|A7QF77.1|CASP2_VITVI RecName: Full=Casparian strip membrane protein 2; Short=VvCASP2 
[Vitis vinifera]
 emb|CBI28289.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 126/175 (72%), Gaps = 9/175 (5%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            E+T I++ E+            A  VA+  KA      G K+GLAIFD ILR+ ++  A+
Sbjct  6    EATAINIGETKSA--------SATTVAT-TKAIQHPKAGLKRGLAIFDFILRLSAIGAAL  56

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AAT TM T ++TLPFFTQFFQF+ASYDDLP FSFFVI+  I SGYL LSLPFSIVCI R 
Sbjct  57   AATTTMGTTDQTLPFFTQFFQFQASYDDLPAFSFFVIANAIASGYLFLSLPFSIVCIVRP  116

Query  491  YAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCE  655
            +A+G R+ L+I DTV + L  AAA ++AAIVYLAH GN++ANW+AICQQF DFC+
Sbjct  117  HAMGARLLLVICDTVMVALTIAAAAAAAAIVYLAHNGNSNANWVAICQQFDDFCQ  171



>ref|XP_006827304.1| hypothetical protein AMTR_s00010p00265970 [Amborella trichopoda]
 gb|ERM94541.1| hypothetical protein AMTR_s00010p00265970 [Amborella trichopoda]
Length=179

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 101/146 (69%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  KAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLP  400
            + + V  GG  KG+++FD +LR++     +A  + M T +ETLPFFTQF +F A Y DLP
Sbjct  5    EGSRVVRGGVNKGISVFDFVLRLMGFMGTLAGAIAMGTTDETLPFFTQFIRFRARYSDLP  64

Query  401  TFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaai  580
            TF+FFV++  IVS YL+LSLP SI  I RS A G RM LI  DT  + L TA A ++AAI
Sbjct  65   TFTFFVVANAIVSVYLLLSLPLSIFHIVRSKAKGSRMILIFFDTGMLGLITAGASAAAAI  124

Query  581  vylaHVGNTDANWLAICQQFGDFCER  658
            VYLAH GN  ANWLAICQQF  FCER
Sbjct  125  VYLAHKGNVRANWLAICQQFNSFCER  150



>ref|XP_007032593.1| Casparian strip membrane protein 5, putative [Theobroma cacao]
 gb|EOY03519.1| Casparian strip membrane protein 5, putative [Theobroma cacao]
Length=187

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G  KG+++ D I RI++    + + + M T  ETLPFFT+FFQF A YDDLPTF+FFV++
Sbjct  20   GVNKGVSVLDFIFRILAFIGTLGSAIAMVTTNETLPFFTRFFQFRAEYDDLPTFTFFVVA  79

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              IVSGYL+LSLPFSI  I RS A   RM LI  D V + L TA A ++AAIVYLAH GN
Sbjct  80   NAIVSGYLLLSLPFSIFHIVRSSAQRTRMILIFFDMVMLALLTAGASAAAAIVYLAHKGN  139

Query  605  TDANWLAICQQFGDFCER  658
               NWLAICQQF  FC+R
Sbjct  140  ARVNWLAICQQFNSFCQR  157



>ref|XP_004141446.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus]
 ref|XP_004170803.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus]
 gb|KGN52473.1| hypothetical protein Csa_5G636650 [Cucumis sativus]
Length=186

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G  +GL+IFD ILR+ ++  A+ + + M T  +TLPF TQF QF A Y+DLP F+FFV++
Sbjct  19   GVNRGLSIFDFILRLAAIVGALGSAIAMGTTTQTLPFATQFIQFRAEYNDLPMFTFFVVA  78

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              IVSGYLVLSLP SI  I RS A   R+ L+  D   + L T+ A ++AAIVYLAH GN
Sbjct  79   CAIVSGYLVLSLPLSIFHILRSRARATRVVLVFLDAGMMALLTSGASAAAAIVYLAHKGN  138

Query  605  TDANWLAICQQFGDFCER  658
               NWLAICQQF  FCER
Sbjct  139  GKTNWLAICQQFNSFCER  156



>ref|XP_004965049.1| PREDICTED: casparian strip membrane protein 1-like [Setaria italica]
Length=184

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
            +   AP++ G   KGL++ DLILR +++   +A+ + M T  ETLPFFTQF +F+A Y D
Sbjct  9    ETSKAPLSRG-VSKGLSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSD  67

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
            LPT +FFVI+  IV  YL+LSLP SIV I RS A   R+ LI  D   + L TA A ++A
Sbjct  68   LPTLTFFVIANSIVCAYLILSLPLSIVHIIRSRAKFSRLLLIFLDAAMLALVTAGASAAA  127

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GN  ANWLAICQQF  FCER
Sbjct  128  AIVYLAHKGNVRANWLAICQQFDSFCER  155



>gb|AFK48530.1| unknown [Medicago truncatula]
Length=147

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 87/127 (69%), Gaps = 11/127 (9%)
 Frame = +2

Query  134  STKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataia  313
            ST IDV ESS   K K  L+           AP   GG+KKG AI D ILR+ ++A AIA
Sbjct  2    STTIDVPESSNINKEKTILV-----------APARPGGWKKGTAIMDFILRLGAIAAAIA  50

Query  314  atvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSY  493
            A  +M T+++TLPFFTQFFQFEASYD L TF FFVISM I + YLVLSLPFSIV I R +
Sbjct  51   AAASMGTSDQTLPFFTQFFQFEASYDSLTTFQFFVISMAIAASYLVLSLPFSIVAIIRPH  110

Query  494  AVGPRMF  514
            A GPR+F
Sbjct  111  APGPRLF  117



>ref|XP_008459331.1| PREDICTED: CASP-like protein 1 [Cucumis melo]
Length=213

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G  +GL+IFD ILR+ ++  A+ + + M T  +TLPF TQF QF A Y+DLP F+FFV++
Sbjct  46   GVNRGLSIFDFILRLAAIVGALGSAIAMGTTTQTLPFATQFIQFRAEYNDLPMFTFFVVA  105

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              IVSGYLVLSLP SI  I RS A   R+ L+  D   + L T+ A ++AAIVYLAH GN
Sbjct  106  CAIVSGYLVLSLPLSIFHILRSRARATRVVLVFLDAGMMALLTSGASAAAAIVYLAHKGN  165

Query  605  TDANWLAICQQFGDFCER  658
               NWLAICQQF  FCER
Sbjct  166  GKTNWLAICQQFNSFCER  183



>emb|CDP00357.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 105/164 (64%), Gaps = 9/164 (5%)
 Frame = +2

Query  167  ERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeet  346
            E K KA  L A       +A+   GG   +G++IFDLILRIV++   + + + M T  ET
Sbjct  2    ETKTKAVKLEA------GEASRAKGG---RGVSIFDLILRIVAIVGTLGSAIAMGTTSET  52

Query  347  LPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliia  526
            LPFF+QF QF+A YDD  TF+ FVI   IV GYL LSLP SI  I RS A   R+ LI  
Sbjct  53   LPFFSQFVQFQAQYDDFTTFTLFVIVNAIVCGYLALSLPLSIYHIIRSRAAKSRVLLIFL  112

Query  527  dtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            DT  + L TA A ++A IVYLAH GN+ ANW AICQQF DFC+R
Sbjct  113  DTTMLALLTAGASAAAGIVYLAHNGNSSANWFAICQQFQDFCQR  156



>ref|NP_001148957.1| casparian strip membrane protein 1 [Zea mays]
 sp|B6T959.1|CASP1_MAIZE RecName: Full=Casparian strip membrane protein 1; Short=ZmCASP1 
[Zea mays]
 gb|ACG33642.1| plant integral membrane protein TIGR01569 containing protein 
[Zea mays]
Length=187

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +2

Query  218  NKAAPVAGG-GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
            +K AP+    G  KG+++ DLILR +++   +A+ + M T  ETLPFFTQF +F+A Y D
Sbjct  11   SKQAPLGSSRGVSKGVSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSD  70

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
            LPT +FFV++  IV  YL LSLP SIV I RS A   R+ L++ D   + L T  A ++A
Sbjct  71   LPTLTFFVVANSIVCAYLTLSLPLSIVHIIRSRAKYSRLLLVVLDAAMLALVTPGASAAA  130

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GN  ANWLAICQQF  FCER
Sbjct  131  AIVYLAHKGNVRANWLAICQQFDSFCER  158



>ref|XP_002318369.1| integral membrane family protein [Populus trichocarpa]
 sp|B9I534.1|CASP6_POPTR RecName: Full=Casparian strip membrane protein 6; Short=PtCASP6 
[Populus trichocarpa]
 gb|EEE96589.1| integral membrane family protein [Populus trichocarpa]
Length=186

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 104/155 (67%), Gaps = 2/155 (1%)
 Frame = +2

Query  194  GALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQ  373
            G + +     +AP A     +G+AI D ILRI++    + + ++MAT  ETLPFFTQF +
Sbjct  4    GPIELGEGKSSAPKAA--VNRGVAILDFILRILAFIGTLGSAISMATTNETLPFFTQFIR  61

Query  374  FEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlat  553
            F A YDDLPTF+FFV++ G+VS YL+ SLPFSI  I RS A   R+ LII DT  + L +
Sbjct  62   FRAEYDDLPTFTFFVVANGVVSAYLLFSLPFSIFNIVRSKAQNSRILLIILDTAMLGLLS  121

Query  554  aaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A A ++AAIVYLAH GN   NW AICQQF  FCER
Sbjct  122  AGASAAAAIVYLAHQGNVRTNWSAICQQFNSFCER  156



>gb|EYU26727.1| hypothetical protein MIMGU_mgv1a013858mg [Erythranthe guttata]
Length=208

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 123/182 (68%), Gaps = 11/182 (6%)
 Frame = +2

Query  122  EKSESTKIDVAESSKERKGKAPLLGALNVASDNK---AAPVAGGGYKKGLAIFDLILRIV  292
            ++     I++ ES K  KGK       NVA       A P   GG+K+G+AIFD ILRI 
Sbjct  5    KREGEAAINIPES-KSTKGK-------NVAHTTTLMAAPPPPRGGWKRGVAIFDFILRIS  56

Query  293  SvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSI  472
             +  A+AAT TM T +ETLPFFTQFFQF+ASYDDLP F+FFV++  I SGYLVLSLPFSI
Sbjct  57   GLVAALAATTTMGTTDETLPFFTQFFQFQASYDDLPAFTFFVVANAIASGYLVLSLPFSI  116

Query  473  VCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFC  652
            V I R +A G ++ L+I D   +    AAA ++AAIVYLAH GN+  NW AICQQF DFC
Sbjct  117  VGIVRPHAAGIKLLLLIFDIAMVAFTAAAAAAAAAIVYLAHNGNSKTNWFAICQQFNDFC  176

Query  653  ER  658
            +R
Sbjct  177  QR  178



>ref|NP_001174676.1| Os06g0231050 [Oryza sativa Japonica Group]
 sp|Q67X40.1|CASP3_ORYSJ RecName: Full=Casparian strip membrane protein 3; Short=OsCASP3 
[Oryza sativa Japonica Group]
 sp|A2YAZ1.1|CASP3_ORYSI RecName: Full=Casparian strip membrane protein 3; Short=OsCASP3 
[Oryza sativa Indica Group]
 dbj|BAD37279.1| integral membrane family protein-like [Oryza sativa Japonica 
Group]
 gb|EAZ00252.1| hypothetical protein OsI_22263 [Oryza sativa Indica Group]
 gb|EAZ36366.1| hypothetical protein OsJ_20694 [Oryza sativa Japonica Group]
 dbj|BAH93404.1| Os06g0231050 [Oryza sativa Japonica Group]
Length=184

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
            +   AP++ G   KG++I D+ILR V++   +A+ + M T  +TLPFFTQF +F+A Y D
Sbjct  9    ETSKAPLSRG-VSKGVSILDVILRFVAIIGTLASAIAMGTTNQTLPFFTQFIRFKAQYSD  67

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
            LPT +FFV++  IVS YL+LSLP SIV + RS A   R+ LI  D   + L TA A ++A
Sbjct  68   LPTLTFFVVANSIVSAYLILSLPLSIVHVIRSRAKYSRLILIFFDAAMLALVTAGASAAA  127

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GN  ANWLAICQQF  FCER
Sbjct  128  AIVYLAHKGNARANWLAICQQFDSFCER  155



>sp|P0DI53.1|CASP3_ERYGU RecName: Full=Casparian strip membrane protein 3; Short=MgCASP3 
[Erythranthe guttata]
 gb|EYU36053.1| hypothetical protein MIMGU_mgv1a013904mg [Erythranthe guttata]
Length=207

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 128/179 (72%), Gaps = 5/179 (3%)
 Frame = +2

Query  122  EKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSva  301
            + +E T I++   S   K K  +     VA+ +K      GG K+G+AIFD ILRI ++A
Sbjct  5    KSTEETAINIPRESSSTKHKIAVAAVKAVATPHKR-----GGMKRGVAIFDFILRICALA  59

Query  302  taiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCI  481
             A+AAT TM T ++TLPFFTQFFQF+ASYDDLPTF+FFVI+  I SGYLVLSLPFSIV I
Sbjct  60   AALAATATMGTTDQTLPFFTQFFQFQASYDDLPTFTFFVIANAIASGYLVLSLPFSIVAI  119

Query  482  ARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             R +  G ++ L+I DTV +   TAAA S+AAIVYLAH GN++ NW AICQQF DFC+R
Sbjct  120  VRPHVTGVKLLLLILDTVLVAFTTAAAASAAAIVYLAHNGNSNTNWFAICQQFNDFCQR  178



>ref|XP_010088133.1| hypothetical protein L484_013577 [Morus notabilis]
 gb|EXB31945.1| hypothetical protein L484_013577 [Morus notabilis]
Length=187

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G KKGL+I D +LR++++   +A+ V M T  ETLPFFT+F +F A YDDLPTF+FFV++
Sbjct  21   GVKKGLSILDFVLRLIAIVGTLASAVAMGTTNETLPFFTRFTRFRAEYDDLPTFTFFVVA  80

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              IVSGYLVLSL  S   I RS A   R+ LII D   + L TA A +SAAIVYLAH GN
Sbjct  81   NAIVSGYLVLSLVLSFFHIVRSNAQNSRVLLIIFDAAMLGLLTAGASASAAIVYLAHNGN  140

Query  605  TDANWLAICQQFGDFCER  658
            T+ NW AIC+QF  FCER
Sbjct  141  TNTNWFAICRQFNSFCER  158



>sp|P0DI33.1|CASP1_PANVG RecName: Full=Casparian strip membrane protein 1; Short=PvCASP1 
[Panicum virgatum]
Length=184

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
            +   AP+   G  KGL++ DLILR +++   +A+ + M T  ETLPFFTQF +F+A Y D
Sbjct  9    ETSKAPL-NRGVSKGLSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQFIRFKAQYSD  67

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
            LPT +FFV++  IV  YL+LSLP SIV I RS A   R+ LI  D V + L TA A ++A
Sbjct  68   LPTLTFFVVANSIVCAYLILSLPLSIVHIIRSRAKFSRLLLIFLDAVMLALVTAGASAAA  127

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GN  ANWLAICQQF  FCER
Sbjct  128  AIVYLAHKGNVRANWLAICQQFDSFCER  155



>sp|P0DI30.1|CASP2_TRIPD RecName: Full=Casparian strip membrane protein 2; Short=TpCASP2 
[Triphysaria pusilla]
Length=208

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 129/178 (72%), Gaps = 5/178 (3%)
 Frame = +2

Query  125  KSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvat  304
            +SES  I++ ES+  +     +  A  VA+    AP  GGG+++G++IFD ILRI ++A 
Sbjct  7    RSESA-INIPESNSTKHKSTVVHTATKVAA---VAP-RGGGWRRGVSIFDFILRICALAA  61

Query  305  aiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIA  484
            A+AAT TM T ++TLPFFTQFFQF+ASYDDLP F+FFV++ GI SGYLVLSLPFSI  I 
Sbjct  62   ALAATATMGTTDQTLPFFTQFFQFQASYDDLPAFTFFVVANGIASGYLVLSLPFSIATIV  121

Query  485  RSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            R +A   ++ LII DTV +    AAA ++AAIVYLAH GN+  NW AICQQF DFC+R
Sbjct  122  RPHAAAIKLLLIIFDTVMVAFTAAAAAAAAAIVYLAHNGNSKTNWFAICQQFNDFCQR  179



>ref|XP_009411946.1| PREDICTED: casparian strip membrane protein VIT_06s0080g00840-like 
[Musa acuminata subsp. malaccensis]
Length=206

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 120/190 (63%), Gaps = 23/190 (12%)
 Frame = +2

Query  119  MEKSESTKIDVAESSKERKGKAPLLGALNVASDNKAAPV----------AGGGYKKGLAI  268
            M  SE+T I  A    +   KAPL           AAP           A GG+++G+A+
Sbjct  1    MNTSEATAI--ANEGSDASRKAPL-----------AAPARFPFFLRKTGADGGWQRGVAL  47

Query  269  FDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYL  448
            F+ ILR+  +A  + A +TM T  ETLPFFT+FFQF A++ DLP  +FFV++  I +GYL
Sbjct  48   FEFILRLCGIAATLVAAITMGTTNETLPFFTEFFQFHANFADLPALTFFVVANAIAAGYL  107

Query  449  VLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAI  628
            VLSLPFS+  + R  A+GPR+ L I DTV + L TAAA ++AAIVYLAH G+  ANW+AI
Sbjct  108  VLSLPFSLAIMVRPRAIGPRLLLFICDTVMVALTTAAASAAAAIVYLAHNGDAKANWIAI  167

Query  629  CQQFGDFCER  658
            C +F  FC+R
Sbjct  168  CLRFDGFCQR  177



>ref|XP_010683143.1| PREDICTED: casparian strip membrane protein 3 [Beta vulgaris 
subsp. vulgaris]
Length=184

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +2

Query  251  KKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMG  430
             +G++I D + RIV+ A+ + + + M T  +TLPFFTQF +F A YDDLPTF FFV++  
Sbjct  19   SRGISILDFVFRIVAGASTLGSAIAMGTTNQTLPFFTQFIRFSAQYDDLPTFMFFVVANA  78

Query  431  IVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTD  610
            I++GYLVLSL  SI  I RS A G R+ L I DT A+ L T+AA ++AAIVYLAH GNT 
Sbjct  79   IITGYLVLSLTLSIFHIVRSGAKGTRILLTILDTAALGLLTSAASAAAAIVYLAHKGNTS  138

Query  611  ANWLAICQQFGDFCER  658
            ANW AICQQF  FCER
Sbjct  139  ANWFAICQQFDSFCER  154



>ref|XP_011001927.1| PREDICTED: casparian strip membrane protein 6 [Populus euphratica]
Length=186

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 104/155 (67%), Gaps = 2/155 (1%)
 Frame = +2

Query  194  GALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQ  373
            G + +    ++AP A     +G+AI D ILRI++    + + ++MAT  ETLPFFT+F +
Sbjct  4    GPIELGEGRRSAPKAA--VNRGVAILDFILRILAFIGTLGSAISMATTNETLPFFTRFIR  61

Query  374  FEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlat  553
            F A YDDLPTF+FFV++ G+VS YL+ SLP SI  I RS A   R+ LII DT  + L +
Sbjct  62   FRAEYDDLPTFTFFVVANGVVSAYLLFSLPLSIFNIVRSKAQNSRILLIILDTAMLGLLS  121

Query  554  aaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            A A ++AAIVYLAH GN   NW AICQQF  FCER
Sbjct  122  AGASAAAAIVYLAHRGNVRTNWFAICQQFNSFCER  156



>ref|XP_008379370.1| PREDICTED: CASP-like protein 1 [Malus domestica]
 ref|XP_008348077.1| PREDICTED: CASP-like protein 1 [Malus domestica]
Length=193

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 99/163 (61%), Gaps = 0/163 (0%)
 Frame = +2

Query  170  RKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetL  349
            + G A  LG     S    +  A  G  +G +I D ILRIV+    + + VTM T  E L
Sbjct  2    KAGAAIELGRGESNSKGMTSTAARAGVNRGASILDFILRIVAFLGTLVSAVTMGTTRERL  61

Query  350  PFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiad  529
            PFFTQF QF A YDDLPTF+FFV++  IV  YLV SL  S+  I RS A   R+ LI  D
Sbjct  62   PFFTQFLQFRAEYDDLPTFTFFVVANSIVCAYLVFSLALSVFHILRSNAKKSRIILIFFD  121

Query  530  tvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            T  + L TA A ++AAIVYLAH GN  ANW AICQQF  FCER
Sbjct  122  TAMLALLTAGASAAAAIVYLAHKGNAKANWFAICQQFNSFCER  164



>ref|XP_009376287.1| PREDICTED: CASP-like protein 1 [Pyrus x bretschneideri]
Length=193

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 98/163 (60%), Gaps = 0/163 (0%)
 Frame = +2

Query  170  RKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetL  349
            + G A  LG     S    +  A  G  +G +I D ILRIV+    + + + M T  E L
Sbjct  2    KAGAAIELGRGESNSKGMTSTAARAGVNRGASILDFILRIVAFLGTLVSAIAMGTTRERL  61

Query  350  PFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiad  529
            PFFTQF QF A YDDLPTF+FFV++  IV  YLV SL  S+  I RS A   R+ LI  D
Sbjct  62   PFFTQFLQFRAEYDDLPTFTFFVVANSIVCAYLVFSLALSVFHIIRSNAKKSRIILIFFD  121

Query  530  tvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            T  + L TA A ++AAIVYLAH GN  ANW AICQQF  FCER
Sbjct  122  TAMLALLTAGASAAAAIVYLAHKGNAKANWFAICQQFNSFCER  164



>ref|XP_003555157.1| PREDICTED: casparian strip membrane protein 5-like [Glycine max]
Length=212

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  212  SDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYD  391
            S  KAAP +   +KKG+A+ D +LR+ ++  A+ + VTM T EE LPFFTQF QF A + 
Sbjct  37   SSTKAAPFSR--WKKGIAVTDFVLRLGAIGAAMGSAVTMGTNEEQLPFFTQFLQFHAQWS  94

Query  392  DLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagss  571
            D P F FFV + G++SGY +LSLPFS VCI + +AV PR+ L+  DTV + L + AA  +
Sbjct  95   DFPVFQFFVFANGVISGYAILSLPFSYVCIVQPHAVRPRLLLMTFDTVMMGLISVAAAGA  154

Query  572  aaivylaHVGNTDANWLAICQQFGDFCE  655
            AAIVY+ H G+ DANW+A CQ F +FC+
Sbjct  155  AAIVYVGHNGSQDANWMAFCQGFTNFCQ  182



>ref|XP_009393394.1| PREDICTED: casparian strip membrane protein VIT_08s0007g02880-like 
[Musa acuminata subsp. malaccensis]
Length=226

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = +2

Query  236  AGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFF  415
            AGGG K+G+A FD +LR+ ++A  + A + M T +ETLPFFTQFFQF A++ DLP  +FF
Sbjct  57   AGGGCKRGVACFDFLLRLCAIAATLVAAIMMGTTDETLPFFTQFFQFHANFADLPALTFF  116

Query  416  VISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaH  595
            V+   I +GYLVLSLPFS+  + R  A+GPR+ L + DTV + L  AAA S+ AIVYLAH
Sbjct  117  VVGNAIAAGYLVLSLPFSLAAMIRPQAIGPRLLLFVLDTVMMELTIAAASSATAIVYLAH  176

Query  596  VGNTDANWLAICQQFGDFCE  655
             G++ ANW+AIC +F  FC+
Sbjct  177  NGSSKANWVAICLRFDGFCQ  196



>ref|XP_006655941.1| PREDICTED: casparian strip membrane protein Os06g0231050-like 
[Oryza brachyantha]
Length=184

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
            +   AP++ G   KG++I D+ILR V++   +A+ + M T  +TLPFFTQF +F+A Y D
Sbjct  9    ETSKAPLSKG-ISKGVSILDVILRFVAIIGTLASAIAMGTTNQTLPFFTQFIRFKAQYSD  67

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
            LPT +FFV++  IV  YL+LSLP SIV + RS A   R+ LI  D V + L  A A ++A
Sbjct  68   LPTLTFFVVANSIVCAYLILSLPLSIVHVIRSRAKYSRLILIFFDAVMLALVAAGASAAA  127

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GN  ANWLAICQQF  FCER
Sbjct  128  AIVYLAHKGNARANWLAICQQFDSFCER  155



>ref|XP_009789554.1| PREDICTED: casparian strip membrane protein 2-like [Nicotiana 
sylvestris]
Length=186

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 103/157 (66%), Gaps = 0/157 (0%)
 Frame = +2

Query  188  LLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQF  367
            ++ A+++ S   +  +   G  +GL++FDLILRIV++   +A  V M TAE+TLPF TQ 
Sbjct  1    MMKAVSIESGEASKAIGHHGVNRGLSVFDLILRIVAIVGTLAGAVAMGTAEQTLPFVTQL  60

Query  368  FQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitl  547
             QF A YDD  TF  FVI   I+  YL LSLPFSI  I RS A   R+ LI  D + + L
Sbjct  61   VQFSAQYDDFDTFKLFVIVNAIICAYLALSLPFSIYHIMRSRAGKSRILLIFLDAIMLVL  120

Query  548  ataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             T+ A ++AAIVYLAH GN+ ANW +ICQQ+ DFC+R
Sbjct  121  LTSGASAAAAIVYLAHNGNSSANWFSICQQYTDFCQR  157



>sp|Q6Z2U5.2|CASP4_ORYSJ RecName: Full=Casparian strip membrane protein 4; Short=OsCASP4 
[Oryza sativa Japonica Group]
Length=201

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 107/173 (62%), Gaps = 4/173 (2%)
 Frame = +2

Query  140  KIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaat  319
            K  V  S++   G+A    A  V S +      GG   + L++ DLILR+V+V   + + 
Sbjct  4    KAAVTTSTEHGDGEASRTAARTVVSGSSR----GGAASRALSVADLILRVVAVVAIVDSA  59

Query  320  vtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAV  499
            + M T  +TLPFFTQF +F+A Y DLPT + FV++   V+ YLVLS+P S+V I RS A 
Sbjct  60   IAMGTTNQTLPFFTQFLRFKAQYSDLPTLTLFVVANSAVTAYLVLSIPLSVVHIIRSRAS  119

Query  500  GPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
              R+ LI  D+V + L  A A +SAAIVYLAH GN  ANW A+CQQF  FCER
Sbjct  120  YSRLVLIFLDSVMLALVAAVASASAAIVYLAHKGNVRANWFAVCQQFDSFCER  172



>ref|XP_009610092.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana tomentosiformis]
Length=188

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 100/156 (64%), Gaps = 1/156 (1%)
 Frame = +2

Query  194  GALNVASDNK-AAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFF  370
            GAL +   +K  A V   G  +G++I DL LRI+++   + + + M T  ETLPFFTQF 
Sbjct  4    GALELGHASKVTATVPQRGVNRGMSILDLFLRIIAIIATLGSAIAMGTTNETLPFFTQFI  63

Query  371  QFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitla  550
            +F A Y DLPTF+FFV++  IVS YLVLSL  SI  I RS A   R+ LI  D   + L 
Sbjct  64   RFRAKYSDLPTFTFFVVANAIVSAYLVLSLGMSIFHIMRSRAQASRIALIFFDAAMLALL  123

Query  551  taaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            TA A +SAAIVYLAH GNT ANW  ICQQ+  FC R
Sbjct  124  TAGASASAAIVYLAHKGNTKANWFPICQQYDSFCHR  159



>ref|XP_004304287.1| PREDICTED: CASP-like protein 1-like [Fragaria vesca subsp. vesca]
Length=187

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
            ++K       G  +G AI D ILRI++    +A+ + M T  E LPFFTQF QF A YDD
Sbjct  11   ESKIGSAPRSGVNRGAAILDFILRIIAFLGTLASAIAMGTTRERLPFFTQFLQFRAEYDD  70

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
            LPTF+FFV++  IV  YL+ SL  SI  I RS+A   R+ LI  DT  + L T+ A ++ 
Sbjct  71   LPTFTFFVVANSIVCVYLMFSLALSIFHILRSHAKNSRIILIFFDTGMLALLTSGASAAT  130

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GN  ANW AICQQF  FCER
Sbjct  131  AIVYLAHKGNAKANWFAICQQFNSFCER  158



>ref|XP_008230985.1| PREDICTED: CASP-like protein 1 [Prunus mume]
Length=189

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 97/156 (62%), Gaps = 1/156 (1%)
 Frame = +2

Query  194  GALNVASDNKAAPVAG-GGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFF  370
            GA+ +     A+     GG  KG++I D ILRI++    + + + M T  E LPFFTQF 
Sbjct  5    GAIELGESKSASSTPKIGGVNKGVSILDFILRIIAFLGTLVSAIAMGTTRERLPFFTQFL  64

Query  371  QFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitla  550
            QF A YDDLPTF+FFV++  +V  YLV SL  SI  I RS A   R+  I  DT  + L 
Sbjct  65   QFRAEYDDLPTFTFFVVANSVVCAYLVCSLALSIFHIIRSNAKRSRIISIFFDTAMLALL  124

Query  551  taaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            TA A ++AAIVYLAH GN  ANW AICQQF  FCER
Sbjct  125  TAGASAAAAIVYLAHKGNAKANWFAICQQFNSFCER  160



>ref|XP_009360608.1| PREDICTED: CASP-like protein 1 [Pyrus x bretschneideri]
Length=193

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 97/163 (60%), Gaps = 0/163 (0%)
 Frame = +2

Query  170  RKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetL  349
            + G A  LG     S   A+  A  G  +G +I D ILRIV+    + + + M T  E L
Sbjct  2    KAGAAIELGHGESNSKGIASTTASAGVNRGASILDFILRIVAFLGTLVSAIAMGTTRERL  61

Query  350  PFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiad  529
            PFFTQF QF   YDDLPTF+FFV++  IV  YLV SL  S+  I RS A   R+ LI  D
Sbjct  62   PFFTQFLQFRPEYDDLPTFTFFVVANSIVCAYLVFSLALSVFHIIRSNAKKSRIILIFFD  121

Query  530  tvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            T  + L  A A ++AAIVYLAH GN  ANW AICQQF  FCER
Sbjct  122  TAMLALLMAGASAAAAIVYLAHKGNAKANWFAICQQFNAFCER  164



>ref|XP_004490091.1| PREDICTED: CASP-like protein MTR_5g041900-like [Cicer arietinum]
Length=187

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G K+GL+I D ILRI+     +A+ V+MAT +E LPF T F QF A YDDLP+F FFV++
Sbjct  21   GVKRGLSIMDFILRIIGGVATLASAVSMATTDERLPFATAFIQFRAEYDDLPSFVFFVMA  80

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              +V GYLVLSL  SI  I RS AV  R+FLI+ D   ++L TAAA ++AAIVY+AH GN
Sbjct  81   NSVVCGYLVLSLILSIFHIVRSTAVKSRIFLIVLDMAMMSLLTAAASAAAAIVYIAHYGN  140

Query  605  TDANWLAICQQFGDFCER  658
            + ANW  ICQQ+  FCER
Sbjct  141  SQANWFPICQQYNSFCER  158



>ref|XP_006344265.1| PREDICTED: CASP-like protein SDM1_58t00016-like [Solanum tuberosum]
Length=185

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
              +A+   G G  +GL++FDL+LRIV++   +A  V M TAE+TLPF TQ  QF A YDD
Sbjct  9    SGEASKAIGHGVNRGLSVFDLVLRIVAIVGTLAGAVAMGTAEQTLPFATQLVQFSAQYDD  68

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
              +F  FVI   IV  YL LSLPFSI  I RS A   R+ LI  D + + L T+ A ++A
Sbjct  69   FDSFKLFVIVNAIVCAYLALSLPFSIFHIMRSRAGKSRILLIFLDAIMLVLLTSGASAAA  128

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GNT ANW ++CQQ+ DFC+R
Sbjct  129  AIVYLAHTGNTSANWFSVCQQYTDFCQR  156



>ref|XP_004237043.1| PREDICTED: casparian strip membrane protein 2-like [Solanum lycopersicum]
Length=185

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = +2

Query  188  LLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQF  367
            ++ A++V S  +A+   G G  +GL++FDL+LRIV++   +A  V M TAE+TLPF TQ 
Sbjct  1    MMKAVSVES-GEASKAKGHGVNRGLSVFDLVLRIVAIVGTLAGAVAMGTAEQTLPFATQL  59

Query  368  FQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitl  547
             QF A YDD  +F  FVI   IV  YL L+LPFSI  I RS A   R+ LI  D + + L
Sbjct  60   VQFSAQYDDFDSFKLFVIVNAIVCAYLALTLPFSIFHIMRSRAGKSRILLIFLDAIMLVL  119

Query  548  ataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             T+ A ++AAIVYLAH GNT ANW ++CQQ+ DFC+R
Sbjct  120  LTSGASAAAAIVYLAHTGNTSANWFSVCQQYTDFCQR  156



>gb|KHN12189.1| CASP-like protein 1 [Glycine soja]
Length=186

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G  +GL+I D ILRI++    + + + M T  ETLPF TQF +F A +DDLP+  FFV++
Sbjct  20   GVARGLSIMDFILRIIAAVATLGSALAMGTTNETLPFATQFIKFRAEFDDLPSLVFFVMA  79

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              +V GYLVLSL  S+  I RS AV  R+ L+  DTV ++L TA+A ++ +IVY+AH GN
Sbjct  80   NAVVCGYLVLSLMISVFHILRSTAVKSRILLVALDTVMLSLVTASASAATSIVYIAHNGN  139

Query  605  TDANWLAICQQFGDFCER  658
            T ANW AICQQ+ +FCER
Sbjct  140  TGANWFAICQQYNNFCER  157



>emb|CDY00740.1| BnaC03g37240D [Brassica napus]
Length=163

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = +2

Query  173  KGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLP  352
            KGKA L+G   VA D+  +    GGYK+GL+IFD +LR+ ++  A  A  TM T++ETLP
Sbjct  2    KGKASLIG---VAKDHTTS--GSGGYKRGLSIFDFLLRLAAIIAASVAAGTMFTSDETLP  56

Query  353  FFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRM  511
            FFTQF QFEA YDDLPT+ FFVI+M IVSGYLVLSLP S+V I    A  PR+
Sbjct  57   FFTQFLQFEAGYDDLPTYQFFVIAMSIVSGYLVLSLPISVVTIVHPLASAPRL  109



>ref|XP_006665081.1| PREDICTED: casparian strip membrane protein ORW1943Ba0077G13.16-like 
[Oryza brachyantha]
Length=189

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
             +KA  VA  G  + +A+ D+ LR +++   + + + M T  ETLPFFTQF QFEA Y D
Sbjct  12   SSKAPLVAAAGVNRAVAVVDIFLRFIAIIGTVGSAIAMGTTNETLPFFTQFIQFEAKYSD  71

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
            LP+F+FFV +  +V  YLVLS+P SIV I R  A   R+FL+  DT  + L TA A ++A
Sbjct  72   LPSFTFFVAANAVVCTYLVLSIPLSIVHIIRPRARYSRLFLVFFDTAMLALLTAGASAAA  131

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GN  ANW +ICQQF  FCER
Sbjct  132  AIVYLAHKGNVRANWFSICQQFDSFCER  159



>gb|EYU34055.1| hypothetical protein MIMGU_mgv1a020210mg [Erythranthe guttata]
Length=182

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = +2

Query  242  GGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVI  421
             G  +G+A+ D  LRIV++   +A+ ++M T +E+LPFFTQF +F A Y+DLPTF+FFV+
Sbjct  14   AGVNRGVAVVDFFLRIVAIIATLASAISMGTTDESLPFFTQFIRFRAKYNDLPTFTFFVV  73

Query  422  SMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVG  601
            +  IVS YLVLSL  SI  I RS +   R+ LII DT  + L T+ A ++AAIVYLAH G
Sbjct  74   ANSIVSAYLVLSLALSISHIIRSGSRNSRVVLIIFDTAMLALLTSGASAAAAIVYLAHKG  133

Query  602  NTDANWLAICQQFGDFCER  658
            NT  NW AICQQ+  FCER
Sbjct  134  NTKTNWFAICQQYNSFCER  152



>ref|XP_010554941.1| PREDICTED: casparian strip membrane protein 1-like [Tarenaya 
hassleriana]
Length=222

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 118/194 (61%), Gaps = 24/194 (12%)
 Frame = +2

Query  131  ESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvatai  310
            EST IDV E S   K          V +  KAA     G K+GLAIFD +LR+ ++A+ I
Sbjct  4    ESTTIDVGEPSSVTKADKVEAKKSVVVAGTKAA-----GSKRGLAIFDFLLRLAAIASTI  58

Query  311  aatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARS  490
            AA V M  A+ETLPFFTQFFQF+ASYDDLP F FF+I+M IV+GYLVLSLPFSIV I R 
Sbjct  59   AAAVVMGMAQETLPFFTQFFQFQASYDDLPVFQFFLIAMAIVAGYLVLSLPFSIVAIVRP  118

Query  491  YAVGPRMFliiadtvaitlataaags-------------------saaivylaHVGNTDA  613
             A+ PR+ L+I D V+                             +A+IVYLAH GN + 
Sbjct  119  LAIAPRLLLLIFDAVSTLPNLPYLSLSLYIYIYECMYNTDLQDSGAASIVYLAHNGNPNT  178

Query  614  NWLAICQQFGDFCE  655
            NWL ICQQFGDFC+
Sbjct  179  NWLPICQQFGDFCQ  192



>sp|P0DI54.1|CASP1_MALDO RecName: Full=Casparian strip membrane protein 1; Short=MdCASP1 
[Malus domestica]
Length=175

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 93/144 (65%), Gaps = 0/144 (0%)
 Frame = +2

Query  227  APVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTF  406
            +  A  G  +G +I D ILRIV+    + + VTM T  E LPFFTQF QF A YDDLPTF
Sbjct  3    STAARAGVNRGASILDFILRIVAFLGTLVSAVTMGTTRERLPFFTQFLQFRAEYDDLPTF  62

Query  407  SFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivy  586
            +FFV++  IV  YLV SL  S+  I RS A   R+ LI  DT  + L TA A ++AAIVY
Sbjct  63   TFFVVANSIVCAYLVFSLALSVFHIIRSNAKKSRIILIFFDTAMLALLTAGASAAAAIVY  122

Query  587  laHVGNTDANWLAICQQFGDFCER  658
            L+H GN  ANW AICQQF  FCER
Sbjct  123  LSHKGNAKANWFAICQQFNSFCER  146



>ref|XP_003564046.1| PREDICTED: casparian strip membrane protein 3 [Brachypodium distachyon]
 sp|P0DI36.1|CASP3_BRADI RecName: Full=Casparian strip membrane protein 3; Short=BdCASP3 
[Brachypodium distachyon]
Length=184

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 93/138 (67%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G  +GL I DLI R+++V   +A+ + M T  +T+PFFTQF QF+  Y DLPT +FFV++
Sbjct  18   GVSRGLCILDLIFRVIAVIGTLASAIAMGTTNQTMPFFTQFVQFKERYSDLPTLTFFVVA  77

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              I S YL++SLP SIV I RS A   R+ LI  D   + L TAAA + AAIVYLAH GN
Sbjct  78   NSIASAYLIISLPLSIVHIIRSRAKYSRLILIFFDVAMLALVTAAASAGAAIVYLAHNGN  137

Query  605  TDANWLAICQQFGDFCER  658
              ANW AICQQF  FCER
Sbjct  138  VSANWFAICQQFDSFCER  155



>ref|XP_010265175.1| PREDICTED: casparian strip membrane protein 1-like [Nelumbo nucifera]
Length=194

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = +2

Query  251  KKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMG  430
             +G+++ D +LR+V+VA  I + V M T  ETLPFFTQF QF+A Y+DLP+F+FFVI+  
Sbjct  27   NRGISVLDFVLRLVAVAATIGSAVAMGTTNETLPFFTQFIQFKAQYNDLPSFTFFVIANA  86

Query  431  IVSGYLVLSLPFSIVCIAR--SYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
            +VS YL+LSLP SI  I R  S A G R+ LI  D   + L TA A ++AA+VYLAH GN
Sbjct  87   VVSAYLILSLPLSIYHIVRTTSSARGSRIILIFLDAAMMALLTAGASAAAAVVYLAHKGN  146

Query  605  TDANWLAICQQFGDFCER  658
              ANW AICQQF  FCER
Sbjct  147  ARANWFAICQQFNSFCER  164



>ref|XP_010066899.1| PREDICTED: casparian strip membrane protein 3-like [Eucalyptus 
grandis]
 gb|KCW64942.1| hypothetical protein EUGRSUZ_G02489 [Eucalyptus grandis]
Length=186

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G KK +++ D  LRIV+    + + + MAT  +TLPFFTQF QF A Y+DLP+F FFVI+
Sbjct  20   GLKKWMSMVDFALRIVAAIGTLGSAIAMATTNQTLPFFTQFLQFRAQYNDLPSFMFFVIA  79

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
             G+V GYLVLS+P SI  I R      R+ LII DT  + L TA   ++AAIVYLAH GN
Sbjct  80   NGMVCGYLVLSIPLSIFHIKRPELTITRIILIIFDTAMMALLTAGGSAAAAIVYLAHNGN  139

Query  605  TDANWLAICQQFGDFCER  658
            + ANW AICQQFG FCER
Sbjct  140  SSANWFAICQQFGSFCER  157



>ref|XP_008669320.1| PREDICTED: casparian strip membrane protein Sb06g018970-like 
[Zea mays]
Length=193

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = +2

Query  224  AAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPT  403
            AA VA GG  + ++I D+ LR +++   I + V+M T  ETLPFFTQF QFEA Y DLP+
Sbjct  19   AASVAAGGVGRAVSIADVFLRFLAIVATIGSAVSMGTTNETLPFFTQFIQFEAKYSDLPS  78

Query  404  FSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaiv  583
            F+FFV +  +V  YLVLS+P SIV I R  A   R+ L+  D   + L TA A ++AAIV
Sbjct  79   FTFFVAANAVVCTYLVLSIPLSIVHIVRPRAHYSRLILVFFDAAMLALLTAGASAAAAIV  138

Query  584  ylaHVGNTDANWLAICQQFGDFCER  658
            YLAH GN  ANW AICQQF  FCER
Sbjct  139  YLAHKGNVRANWFAICQQFDSFCER  163



>gb|KDP27167.1| hypothetical protein JCGZ_19866 [Jatropha curcas]
Length=185

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +2

Query  251  KKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMG  430
            K+G++I D  LRI++    +A+ + M T +ETLPF TQFF+F A +DDLPTF+FFV++  
Sbjct  22   KRGVSILDSFLRIIAFIGTLASGILMGTTKETLPFSTQFFRFRAEFDDLPTFTFFVVANV  81

Query  431  IVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTD  610
            +V GYL+LSLP SI  I RS A   R+  II DTV +TL T  A ++AAIVYLAH GNT 
Sbjct  82   VVCGYLLLSLPLSIFNIVRSNAKNSRIIFIIFDTVMVTLLTGGAAAAAAIVYLAHKGNTR  141

Query  611  ANWLAICQQFGDFCER  658
            ANW AICQQF  FCER
Sbjct  142  ANWFAICQQFNSFCER  157



>ref|XP_008663281.1| PREDICTED: casparian strip membrane protein 2 [Zea mays]
 gb|AFW58489.1| hypothetical protein ZEAMMB73_640463 [Zea mays]
Length=192

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 108/177 (61%), Gaps = 16/177 (9%)
 Frame = +2

Query  128  SESTKIDVAESSKERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvata  307
            ++   I+  ESSK     APL+           APVA GG  + +++ D+ LR +++   
Sbjct  2    TKDVVIEHGESSK-----APLV-----------APVAAGGVSRAVSVADVFLRFLAIVAT  45

Query  308  iaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIAR  487
            I + V+M T  +TLPFFTQF QFEA Y DLP+F+FFV +  +   YLVLS+P SIV + R
Sbjct  46   IGSAVSMGTTNQTLPFFTQFIQFEAKYSDLPSFTFFVAANAVACTYLVLSIPLSIVHVVR  105

Query  488  SYAVGPRMFliiadtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
              A   R+ L+  D   + L TA A ++AAIVYLAH GN  ANW AICQQF  FCER
Sbjct  106  PSARYSRLVLVFFDAAMLALLTAGASAAAAIVYLAHKGNVRANWFAICQQFDSFCER  162



>sp|P0DI42.1|CASP2_WHEAT RecName: Full=Casparian strip membrane protein 2; Short=TaCASP2 
[Triticum aestivum]
 gb|EMT15400.1| hypothetical protein F775_31947 [Aegilops tauschii]
Length=183

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +2

Query  215  DNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDD  394
            +   AP+   G  +G++I DLILR+++V + +A+ + M T  ETLP FT F QF+A Y D
Sbjct  8    ETSKAPL-NKGVSRGVSILDLILRVIAVISTLASAIAMGTTNETLPLFTPFIQFKARYSD  66

Query  395  LPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssa  574
            LP  +FFV++  IVS YL+LSLP SI  I RS A   R+ LII D   + L TAA+ ++ 
Sbjct  67   LPALTFFVVANSIVSAYLILSLPLSIAHIIRSGAKYSRLVLIIFDAAMLALVTAASSAAT  126

Query  575  aivylaHVGNTDANWLAICQQFGDFCER  658
            AIVYLAH GN  ANWLAICQQ   FCER
Sbjct  127  AIVYLAHKGNVRANWLAICQQLDSFCER  154



>ref|XP_010042237.1| PREDICTED: casparian strip membrane protein 3-like [Eucalyptus 
grandis]
Length=186

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G KK +++ D  LRI++    + + + MAT  +TLPFFTQF QF A Y+DLP+F FFVI+
Sbjct  20   GLKKWMSMVDFALRIIAAIGTLGSAIAMATTNQTLPFFTQFLQFRAQYNDLPSFMFFVIA  79

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
             G+V GYLVLS+P SI  I R      R+ LII DT  + L TA   ++AAIVYLAH GN
Sbjct  80   NGMVCGYLVLSIPLSIFHIKRPELTITRIILIIFDTAMMALLTAGGSAAAAIVYLAHNGN  139

Query  605  TDANWLAICQQFGDFCER  658
            + ANW AICQQFG FCER
Sbjct  140  SSANWFAICQQFGSFCER  157



>gb|KDO72617.1| hypothetical protein CISIN_1g045471mg [Citrus sinensis]
Length=185

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +2

Query  194  GALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQ  373
            GA+ +     + P  G    KG++I D +LR+++ A A+ + + M T  ETLPFF+Q  +
Sbjct  4    GAVEIGEAKNSTPTYG--VNKGISILDFVLRLLAFAGALGSAIAMGTTNETLPFFSQLIR  61

Query  374  FEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlat  553
            F A YDDLP+F+FFV +  +VSGYL+LSL  SI  I RS A   R+ L+  DT  + L T
Sbjct  62   FRAEYDDLPSFTFFVAANAVVSGYLILSLSLSIFHIVRSRAQKSRILLVFFDTAMLALLT  121

Query  554  aaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             +A ++AAIVYLAH GN  ANW AICQQF  FC+R
Sbjct  122  GSASAAAAIVYLAHKGNAKANWFAICQQFNSFCQR  156



>ref|XP_011098775.1| PREDICTED: casparian strip membrane protein 1-like [Sesamum indicum]
Length=189

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = +2

Query  191  LGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFF  370
            LGA  V S  ++   AG    +G+AI D ILR+V +   +A+ + MAT  E+LPFFTQF 
Sbjct  8    LGAKEVGSVLRSHKGAG----RGVAILDFILRLVGIVATLASAIAMATTNESLPFFTQFI  63

Query  371  QFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitla  550
            +F A Y+DLPTF+FFV +  +V  YLVLSL  SI  I RS A   R+ LI  DT  + L 
Sbjct  64   RFRAKYNDLPTFTFFVAANSVVCAYLVLSLALSIFHIVRSSAQNSRVVLIFFDTGMLGLL  123

Query  551  taaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            +A A +SAAIVYLAH GNT ANW AICQQF  FC+R
Sbjct  124  SAGASASAAIVYLAHKGNTRANWFAICQQFNSFCQR  159



>ref|NP_001236648.1| CASP-like protein 7 [Glycine max]
 sp|C6T1G0.1|CASP7_SOYBN RecName: Full=CASP-like protein 7; Short=GmCASP7 [Glycine max]
 gb|ACU15399.1| unknown [Glycine max]
Length=186

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G  +GL+I D ILRI++    + + + M T  ETLPF TQF +F A +DDLP+  FFV++
Sbjct  20   GVARGLSIMDFILRIIAAVATLGSALAMGTTNETLPFATQFIKFRAEFDDLPSLVFFVMA  79

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              +V GYLVLSL  S+  I RS  V  R+ L+  DTV ++L TA+A ++ +IVY+AH GN
Sbjct  80   NAVVCGYLVLSLMISVFHILRSTPVKSRILLVALDTVMLSLVTASASAATSIVYIAHNGN  139

Query  605  TDANWLAICQQFGDFCER  658
            T ANW AICQQ+ +FCER
Sbjct  140  TGANWFAICQQYNNFCER  157



>ref|XP_009602468.1| PREDICTED: casparian strip membrane protein 2-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = +2

Query  245  GYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLPTFSFFVIS  424
            G  +GL++FDLILRIV++   +A  V M TAE+TLPF TQ  QF A YDD  TF  FVI 
Sbjct  21   GVNRGLSVFDLILRIVAIVGTLAGAVAMGTAEQTLPFVTQLVQFSAQYDDFDTFKLFVIV  80

Query  425  MGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaaivylaHVGN  604
              I+  YL LSLPFSI  I RS A   R+ LI  D + + L T+ A ++AAIVYLAH GN
Sbjct  81   NAIICAYLALSLPFSIFHIIRSRAGKSRILLIFLDAIMLALLTSGASAAAAIVYLAHNGN  140

Query  605  TDANWLAICQQFGDFCER  658
            + ANW +ICQQ+ DFC+R
Sbjct  141  SSANWFSICQQYTDFCQR  158



>ref|XP_009763947.1| PREDICTED: casparian strip membrane protein 1 [Nicotiana sylvestris]
Length=184

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 94/146 (64%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  KAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQFEASYDDLP  400
             A+ V   G  +G++I DL LRI+++   + + + M T  ETLPFFTQF +F A Y DLP
Sbjct  10   HASKVTQRGVNRGMSILDLFLRIIAIIATLGSAIAMGTTNETLPFFTQFVRFRAKYSDLP  69

Query  401  TFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlataaagssaai  580
            TF+FFV++  IVS YLVLSL  SI  I RS A   R+ LI  D   + L TA A +SAAI
Sbjct  70   TFTFFVVANAIVSAYLVLSLGMSIFHIMRSRAQASRIALIFFDAAMMALLTAGASASAAI  129

Query  581  vylaHVGNTDANWLAICQQFGDFCER  658
            VYLAH GNT  NW  ICQQ+  FC R
Sbjct  130  VYLAHKGNTKTNWFPICQQYDSFCHR  155



>ref|XP_006482625.1| PREDICTED: casparian strip membrane protein VIT_14s0108g01050-like 
[Citrus sinensis]
Length=185

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +2

Query  194  GALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeetLPFFTQFFQ  373
            GA+ +     + P  G    KG++I D +LR+++ A A+ + + M T  ETLPFF+Q  +
Sbjct  4    GAVEIGEAKNSTPRYG--VNKGISILDFVLRLLAFAGALGSAIAMGTTNETLPFFSQLIR  61

Query  374  FEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliiadtvaitlat  553
            F A YDDLP+F+FFV +  +VSGYL+LSL  SI  I RS A   R+ L+  DT  + L T
Sbjct  62   FRAEYDDLPSFTFFVAANAVVSGYLILSLSLSIFHIVRSRAQKSRILLVFFDTAMLALLT  121

Query  554  aaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
             +A ++AAIVYLAH GN  ANW AICQQF  FC+R
Sbjct  122  GSASAAAAIVYLAHKGNAKANWFAICQQFNSFCQR  156



>ref|NP_001052990.2| Os04g0460400 [Oryza sativa Japonica Group]
 sp|Q7XUV7.2|CASP5_ORYSJ RecName: Full=Casparian strip membrane protein 5; Short=OsCASP5 
[Oryza sativa Japonica Group]
 sp|A2XU91.1|CASP6_ORYSI RecName: Full=Casparian strip membrane protein 6; Short=OsCASP6 
[Oryza sativa Indica Group]
 sp|F2QA93.1|CASP1_ORYRU RecName: Full=Casparian strip membrane protein 1; Short=OrCASP1 
[Oryza rufipogon]
 emb|CAD40983.2| OSJNBa0072F16.8 [Oryza sativa Japonica Group]
 emb|CAH67083.1| OSIGBa0097P08.13 [Oryza sativa Indica Group]
 emb|CAH67451.1| H0219H12.8 [Oryza sativa Indica Group]
 gb|EAY94401.1| hypothetical protein OsI_16169 [Oryza sativa Indica Group]
 gb|EAZ30975.1| hypothetical protein OsJ_15056 [Oryza sativa Japonica Group]
 dbj|BAF14904.2| Os04g0460400 [Oryza sativa Japonica Group]
 emb|CBW45788.1| ORW1943Ba0077G13.16 [Oryza rufipogon]
Length=186

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 102/164 (62%), Gaps = 12/164 (7%)
 Frame = +2

Query  167  ERKGKAPLLGALNVASDNKAAPVAGGGYKKGLAIFDLILRIVSvataiaatvtmataeet  346
            E   KAPL+           APVA G   + +A+ D  LR +++   I + + M T  ET
Sbjct  5    EISSKAPLV-----------APVAAG-VNRAVAVVDTFLRFIAIIGTIGSAIAMGTTNET  52

Query  347  LPFFTQFFQFEASYDDLPTFSFFVISMGIVSGYLVLSLPFSIVCIARSYAVGPRMFliia  526
            LPFFTQF QFEA Y DLP+F+FFV +  +V  YLVLS+P SIV I R  A   R+FL+  
Sbjct  53   LPFFTQFIQFEAKYSDLPSFTFFVAANAVVCTYLVLSIPLSIVHILRPRARYSRLFLVFF  112

Query  527  dtvaitlataaagssaaivylaHVGNTDANWLAICQQFGDFCER  658
            DT  + L TA A ++AAIVYLAH GN  ANW +ICQQF  FCER
Sbjct  113  DTAMLALLTAGASAAAAIVYLAHKGNVRANWFSICQQFDSFCER  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1994468264640