BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c68191_g1_i1 len=117 path=[1:0-116]

Length=117
                                                                      Score     E

ref|XP_006443693.1|  hypothetical protein CICLE_v10023818mg           81.3    9e-17   
ref|XP_010522520.1|  PREDICTED: probable indole-3-pyruvate monoox...  79.7    3e-16   
gb|ACX33887.1|  flavin monooxygenase-like protein                     79.0    6e-16   Solanum lycopersicum
ref|XP_006340902.1|  PREDICTED: probable indole-3-pyruvate monoox...  79.0    7e-16   
ref|XP_009791244.1|  PREDICTED: probable indole-3-pyruvate monoox...  78.6    7e-16   
ref|XP_009411368.1|  PREDICTED: probable indole-3-pyruvate monoox...  78.2    1e-15   
gb|KDO65782.1|  hypothetical protein CISIN_1g014522mg                 77.8    1e-15   
ref|XP_010540939.1|  PREDICTED: probable indole-3-pyruvate monoox...  77.8    1e-15   
ref|XP_010548723.1|  PREDICTED: probable indole-3-pyruvate monoox...  77.8    2e-15   
ref|XP_006285300.1|  hypothetical protein CARUB_v10006681mg           77.8    2e-15   
gb|KFK29415.1|  hypothetical protein AALP_AA7G131400                  77.8    2e-15   
ref|XP_009791243.1|  PREDICTED: probable indole-3-pyruvate monoox...  77.4    2e-15   
ref|XP_010243626.1|  PREDICTED: probable indole-3-pyruvate monoox...  77.0    3e-15   
ref|XP_009624017.1|  PREDICTED: probable indole-3-pyruvate monoox...  77.0    3e-15   
ref|XP_002869478.1|  flavin-containing monooxygenase family protein   76.6    4e-15   
ref|XP_009384501.1|  PREDICTED: probable indole-3-pyruvate monoox...  76.6    5e-15   
ref|XP_010447924.1|  PREDICTED: probable indole-3-pyruvate monoox...  76.6    5e-15   
ref|XP_010438392.1|  PREDICTED: probable indole-3-pyruvate monoox...  76.6    5e-15   
ref|NP_194601.1|  flavin-containing monooxygenase YUCCA8              76.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433170.1|  PREDICTED: probable indole-3-pyruvate monoox...  76.6    5e-15   
ref|XP_010243627.1|  PREDICTED: probable indole-3-pyruvate monoox...  76.3    6e-15   
ref|XP_009401703.1|  PREDICTED: probable indole-3-pyruvate monoox...  75.9    9e-15   
ref|XP_004247940.2|  PREDICTED: probable indole-3-pyruvate monoox...  75.5    1e-14   
ref|XP_008342551.1|  PREDICTED: probable indole-3-pyruvate monoox...  75.5    1e-14   
ref|NP_199202.1|  probable indole-3-pyruvate monooxygenase YUCCA5     75.5    1e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94734.1|  BnaC07g17430D                                        75.5    1e-14   
ref|XP_007225027.1|  hypothetical protein PRUPE_ppa019979mg           75.1    1e-14   
gb|KEH42432.1|  indole-3-pyruvate monooxygenase                       75.1    1e-14   
ref|XP_008224116.1|  PREDICTED: probable indole-3-pyruvate monoox...  75.1    2e-14   
ref|XP_011091378.1|  PREDICTED: probable indole-3-pyruvate monoox...  75.1    2e-14   
ref|XP_008365940.1|  PREDICTED: probable indole-3-pyruvate monoox...  75.1    2e-14   
ref|XP_011024522.1|  PREDICTED: probable indole-3-pyruvate monoox...  75.1    2e-14   
gb|KDP26439.1|  hypothetical protein JCGZ_17597                       74.7    2e-14   
ref|NP_001266992.1|  uncharacterized protein LOC101308331             74.7    2e-14   
gb|KHN05899.1|  Flavin-containing monooxygenase YUCCA8                74.7    2e-14   
ref|XP_003537140.1|  PREDICTED: probable indole-3-pyruvate monoox...  74.7    2e-14   
ref|XP_009129331.1|  PREDICTED: probable indole-3-pyruvate monoox...  74.7    2e-14   
emb|CDY06876.1|  BnaC01g09750D                                        74.7    2e-14   
emb|CDY35214.1|  BnaA01g08170D                                        74.7    2e-14   
ref|XP_008459986.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...  74.7    2e-14   
ref|XP_004140585.1|  PREDICTED: flavin-containing monooxygenase Y...  74.7    2e-14   
ref|NP_001288908.1|  probable indole-3-pyruvate monooxygenase YUCCA8  74.7    2e-14   
ref|XP_010510306.1|  PREDICTED: probable indole-3-pyruvate monoox...  74.7    2e-14   
gb|EPS72004.1|  flavin monooxygenase-like protein                     74.3    3e-14   
gb|KHN48962.1|  Flavin-containing monooxygenase YUCCA8                74.3    3e-14   
ref|XP_003542445.1|  PREDICTED: probable indole-3-pyruvate monoox...  74.3    3e-14   
emb|CBI33313.3|  unnamed protein product                              74.3    3e-14   
ref|XP_010481808.1|  PREDICTED: probable indole-3-pyruvate monoox...  74.3    3e-14   
gb|AGL50941.1|  FMO-flavin monooxygenase YUC3                         74.3    3e-14   
ref|NP_001266952.1|  uncharacterized protein LOC101305359             74.3    3e-14   
ref|XP_006280526.1|  hypothetical protein CARUB_v10026464mg           74.3    3e-14   
ref|XP_010494376.1|  PREDICTED: probable indole-3-pyruvate monoox...  74.3    3e-14   
ref|XP_010441967.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.9    4e-14   
ref|XP_008372417.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.9    4e-14   
ref|XP_010091845.1|  Flavin-containing monooxygenase YUCCA8           73.9    4e-14   
ref|XP_004495036.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.9    4e-14   
emb|CAN83595.1|  hypothetical protein VITISV_041375                   73.9    4e-14   Vitis vinifera
ref|XP_009370885.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.9    4e-14   
emb|CAN68655.1|  hypothetical protein VITISV_009086                   73.6    4e-14   Vitis vinifera
gb|KFK31683.1|  hypothetical protein AALP_AA6G145600                  73.9    4e-14   
emb|CDX97452.1|  BnaC08g13170D                                        73.9    4e-14   
ref|XP_010263981.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.9    5e-14   
ref|XP_002281597.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  73.6    5e-14   Vitis vinifera
gb|KFK23319.1|  hypothetical protein AALP_AAs74635U000900             73.9    5e-14   
ref|XP_002268052.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.6    5e-14   Vitis vinifera
ref|XP_003554314.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.6    5e-14   
emb|CBI20900.3|  unnamed protein product                              73.6    5e-14   
ref|XP_002282648.3|  PREDICTED: probable indole-3-pyruvate monoox...  73.9    5e-14   Vitis vinifera
ref|XP_002303099.1|  flavin-containing monooxygenase family protein   73.6    6e-14   Populus trichocarpa [western balsam poplar]
gb|KHG11991.1|  Flavin-containing monooxygenase YUCCA8 -like protein  73.6    6e-14   
ref|XP_003521326.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.6    6e-14   
gb|KCW60149.1|  hypothetical protein EUGRSUZ_H02874                   73.2    7e-14   
gb|AIN44210.1|  YUCCA3                                                73.2    7e-14   
ref|XP_002521164.1|  monooxygenase, putative                          73.2    8e-14   Ricinus communis
emb|CBI37227.3|  unnamed protein product                              72.8    8e-14   
ref|XP_009365491.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.2    9e-14   
ref|XP_007162643.1|  hypothetical protein PHAVU_001G168000g           73.2    9e-14   
ref|XP_009398050.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.8    9e-14   
ref|XP_010023778.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.2    9e-14   
gb|AGL50940.1|  FMO-flavin monooxygenase YUC7                         72.8    9e-14   
ref|XP_010556939.1|  PREDICTED: probable indole-3-pyruvate monoox...  73.2    1e-13   
ref|XP_003535245.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.8    1e-13   
gb|KHN09407.1|  Flavin-containing monooxygenase YUCCA8                72.8    1e-13   
ref|XP_006403167.1|  hypothetical protein EUTSA_v10003214mg           72.8    1e-13   
ref|XP_003559094.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.8    1e-13   
ref|XP_008235554.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.8    1e-13   
ref|XP_007222931.1|  hypothetical protein PRUPE_ppa005244mg           72.8    1e-13   
ref|XP_010038328.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.8    1e-13   
ref|XP_007201525.1|  hypothetical protein PRUPE_ppa015832mg           72.4    1e-13   
ref|XP_009415536.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.4    1e-13   
ref|XP_009382170.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.4    1e-13   
gb|KHG12306.1|  Flavin-containing monooxygenase YUCCA8 -like protein  72.4    1e-13   
emb|CDO99380.1|  unnamed protein product                              72.4    2e-13   
emb|CDY22326.1|  BnaA06g36480D                                        72.4    2e-13   
ref|XP_002863626.1|  SUPER1/YUCCA5                                    72.4    2e-13   
ref|XP_008220100.1|  PREDICTED: LOW QUALITY PROTEIN: indole-3-pyr...  72.0    2e-13   
emb|CDY14900.1|  BnaA02g22420D                                        72.0    2e-13   
ref|XP_009101756.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.0    2e-13   
ref|XP_010526480.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...  72.0    2e-13   
ref|XP_006420425.1|  hypothetical protein CICLE_v10006828mg           72.0    2e-13   
ref|XP_009143881.1|  PREDICTED: probable indole-3-pyruvate monoox...  72.0    2e-13   
emb|CDY19472.1|  BnaC04g11270D                                        72.0    2e-13   
ref|XP_002311709.1|  flavin-containing monooxygenase family protein   71.6    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010483250.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.6    3e-13   
ref|XP_010542972.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.6    3e-13   
gb|KHG02091.1|  Flavin-containing monooxygenase YUCCA8 -like protein  71.6    3e-13   
ref|XP_006412918.1|  hypothetical protein EUTSA_v10025272mg           71.6    3e-13   
ref|XP_006350286.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.6    3e-13   
gb|AHC98648.1|  flavin-containing monooxygenase YUCCA3-like protein   68.9    3e-13   
ref|XP_006418157.1|  hypothetical protein EUTSA_v10009484mg           71.6    3e-13   
gb|KHN06601.1|  Flavin-containing monooxygenase YUCCA6                71.2    3e-13   
ref|XP_004240470.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.2    3e-13   
ref|XP_002874274.1|  hypothetical protein ARALYDRAFT_910627           71.2    3e-13   
ref|XP_009767954.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.2    3e-13   
ref|XP_008447351.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.2    3e-13   
ref|XP_009629512.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.2    3e-13   
ref|NP_001190399.1|  flavin-containing monooxygenase YUCCA6           71.2    4e-13   
gb|EMT15352.1|  Putative oxidoreductase czcO-like protein             71.2    4e-13   
ref|XP_009622501.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.2    4e-13   
ref|XP_009385858.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.2    4e-13   
ref|XP_003544664.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  71.2    4e-13   
ref|XP_010457452.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.2    4e-13   
ref|XP_006307620.1|  hypothetical protein CARUB_v10009248mg           71.2    4e-13   
ref|XP_009771853.1|  PREDICTED: probable indole-3-pyruvate monoox...  71.2    4e-13   
ref|XP_007034552.1|  Yucca 3                                          71.2    4e-13   
ref|XP_002889495.1|  flavin-containing monooxygenase family protein   71.2    4e-13   
ref|NP_197944.2|  flavin-containing monooxygenase YUCCA6              71.2    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410463.1|  hypothetical protein EUTSA_v10017688mg           71.2    4e-13   
ref|XP_004170806.1|  PREDICTED: LOW QUALITY PROTEIN: flavin-conta...  70.9    5e-13   
ref|XP_011029710.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.9    5e-13   
gb|KFK42760.1|  hypothetical protein AALP_AA1G036000                  70.9    5e-13   
ref|XP_010475064.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.9    5e-13   
ref|XP_010936109.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.9    5e-13   
emb|CDY17153.1|  BnaA05g10350D                                        70.9    5e-13   
ref|XP_010069688.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.9    5e-13   
ref|XP_006287768.1|  hypothetical protein CARUB_v10000978mg           70.9    6e-13   
ref|XP_006295706.1|  hypothetical protein CARUB_v10024824mg           70.9    6e-13   
ref|XP_010419690.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.5    6e-13   
ref|XP_009618244.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.5    6e-13   
emb|CDY14230.1|  BnaA08g13610D                                        70.5    7e-13   
ref|XP_008804753.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    7e-13   
ref|XP_009383126.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.5    8e-13   
ref|NP_171914.1|  flavin-containing monooxygenase YUCCA9              70.5    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789578.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    9e-13   
gb|KDP33364.1|  hypothetical protein JCGZ_12913                       70.1    9e-13   
ref|XP_006303679.1|  hypothetical protein CARUB_v10011757mg           70.1    1e-12   
ref|XP_009119273.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    1e-12   
emb|CDY61147.1|  BnaC05g49050D                                        70.1    1e-12   
ref|XP_004242376.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    1e-12   
ref|XP_002881269.1|  predicted protein                                70.1    1e-12   
ref|XP_009343403.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    1e-12   
ref|XP_010933164.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    1e-12   
ref|XP_011089305.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  70.1    1e-12   
ref|XP_010509914.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    1e-12   
ref|XP_009384175.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    1e-12   
ref|XP_004152071.1|  PREDICTED: flavin-containing monooxygenase Y...  70.1    1e-12   
ref|NP_171955.1|  flavin-containing monooxygenase YUCCA3              70.1    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004493850.1|  PREDICTED: probable indole-3-pyruvate monoox...  70.1    1e-12   
ref|XP_010519914.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  70.1    1e-12   
ref|XP_002889517.1|  flavin-containing monooxygenase                  70.1    1e-12   
ref|XP_009796775.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.7    1e-12   
ref|XP_004247118.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.7    1e-12   
emb|CDY53200.1|  BnaAnng12250D                                        69.7    1e-12   
gb|AIN44209.1|  YUCCA2                                                69.7    1e-12   
ref|XP_010413899.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.7    1e-12   
ref|NP_001267010.1|  flavin-containing monooxygenase YUCCA6-like      69.7    1e-12   
emb|CDP03336.1|  unnamed protein product                              69.3    1e-12   
ref|XP_010918863.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.7    2e-12   
emb|CDY18209.1|  BnaC05g02320D                                        69.7    2e-12   
ref|XP_009118628.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.7    2e-12   
ref|XP_010501315.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.3    2e-12   
ref|XP_010475123.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.7    2e-12   
ref|XP_009118662.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.3    2e-12   
ref|XP_010111561.1|  Flavin-containing monooxygenase YUCCA3           69.7    2e-12   
ref|XP_010112168.1|  Flavin-containing monooxygenase YUCCA6           69.3    2e-12   
ref|XP_006418109.1|  hypothetical protein EUTSA_v10010013mg           69.7    2e-12   
gb|AFG16914.1|  YUC1                                                  69.3    2e-12   
ref|XP_007144428.1|  hypothetical protein PHAVU_007G155200g           69.3    2e-12   
ref|XP_007144427.1|  hypothetical protein PHAVU_007G155100g           69.3    2e-12   
emb|CDY32533.1|  BnaA09g50630D                                        69.3    2e-12   
tpg|DAA39727.1|  TPA: disulfide oxidoreductase/ monooxygenase/ ox...  69.3    2e-12   
ref|XP_010684810.1|  PREDICTED: probable indole-3-pyruvate monoox...  69.3    2e-12   
emb|CDY69333.1|  BnaCnng63040D                                        69.3    2e-12   
gb|KFK42802.1|  hypothetical protein AALP_AA1G040600                  69.3    2e-12   
ref|NP_001148256.1|  disulfide oxidoreductase/ monooxygenase/ oxi...  68.9    2e-12   Zea mays [maize]
emb|CDY62422.1|  BnaA06g39380D                                        69.3    2e-12   
ref|XP_003555725.2|  PREDICTED: probable indole-3-pyruvate monoox...  69.3    2e-12   
ref|XP_009151094.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  69.3    2e-12   
ref|XP_010493826.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  69.3    2e-12   
ref|XP_010454909.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  69.3    2e-12   
emb|CDY10073.1|  BnaC08g43780D                                        68.9    2e-12   
ref|XP_010493825.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  68.9    2e-12   
gb|KFK31070.1|  hypothetical protein AALP_AA6G064400                  68.9    2e-12   
gb|KHN10236.1|  Flavin-containing monooxygenase YUCCA6                68.9    3e-12   
ref|XP_006352723.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.9    3e-12   
ref|XP_010454908.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  68.9    3e-12   
gb|EPS72220.1|  hypothetical protein M569_02528                       68.9    3e-12   
ref|XP_010421426.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  68.9    3e-12   
ref|XP_010457515.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.9    3e-12   
ref|XP_010421424.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  68.9    3e-12   
ref|XP_007137165.1|  hypothetical protein PHAVU_009G105400g           68.9    3e-12   
ref|XP_004501192.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  68.9    3e-12   
ref|XP_009367925.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  68.9    3e-12   
ref|XP_009338719.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  68.9    3e-12   
gb|EPS72404.1|  hypothetical protein M569_02353                       68.6    3e-12   
ref|XP_007145436.1|  hypothetical protein PHAVU_007G238900g           68.6    3e-12   
ref|XP_010491852.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.6    3e-12   
gb|AFW57823.1|  disulfide oxidoreductase/ monooxygenase/ oxidored...  68.6    4e-12   
ref|NP_001147961.1|  disulfide oxidoreductase/ monooxygenase/ oxi...  68.6    4e-12   Zea mays [maize]
ref|XP_010419689.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.6    4e-12   
ref|XP_006364550.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.6    4e-12   
ref|XP_011083085.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.6    4e-12   
gb|KFK27814.1|  hypothetical protein AALP_AA8G433400                  68.6    4e-12   
ref|XP_008438433.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.6    4e-12   
ref|XP_003625456.1|  Dimethylaniline monooxygenase                    68.6    4e-12   
ref|XP_007161550.1|  hypothetical protein PHAVU_001G078900g           68.6    4e-12   
ref|XP_009119327.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.6    4e-12   
gb|EYU46374.1|  hypothetical protein MIMGU_mgv1a007103mg              68.2    4e-12   
emb|CDX89837.1|  BnaA10g02450D                                        68.2    4e-12   
ref|XP_007137061.1|  hypothetical protein PHAVU_009G096500g           68.2    4e-12   
gb|EYU17958.1|  hypothetical protein MIMGU_mgv1a026496mg              68.2    5e-12   
ref|XP_008807966.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.2    5e-12   
ref|XP_006394817.1|  hypothetical protein EUTSA_v10004282mg           68.2    5e-12   
ref|XP_008669713.1|  PREDICTED: probable indole-3-pyruvate monoox...  68.2    5e-12   
ref|XP_003522685.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  68.2    5e-12   
gb|EPS64200.1|  hypothetical protein M569_10581                       67.8    5e-12   
emb|CDP16149.1|  unnamed protein product                              68.2    6e-12   
ref|XP_006286661.1|  hypothetical protein CARUB_v10002580mg           67.8    6e-12   
ref|NP_180881.1|  flavin monooxygenase YUCCA7                         67.8    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004245254.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  67.8    7e-12   
emb|CDX80530.1|  BnaC07g29140D                                        67.8    7e-12   
ref|XP_006493990.1|  PREDICTED: probable indole-3-pyruvate monoox...  67.8    7e-12   
gb|KEH41176.1|  indole-3-pyruvate monooxygenase YUCCA8                67.8    7e-12   
ref|XP_004498640.1|  PREDICTED: probable indole-3-pyruvate monoox...  67.4    9e-12   
ref|XP_002873506.1|  hypothetical protein ARALYDRAFT_487963           67.4    9e-12   
emb|CAN60211.1|  hypothetical protein VITISV_036965                   67.4    9e-12   Vitis vinifera
emb|CDY72645.1|  BnaAnng41850D                                        67.0    9e-12   
ref|XP_010249920.1|  PREDICTED: probable indole-3-pyruvate monoox...  67.4    9e-12   
ref|XP_002281015.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  67.4    1e-11   Vitis vinifera
ref|NP_001147849.1|  LOC100281459                                     67.4    1e-11   Zea mays [maize]
ref|XP_008651410.1|  PREDICTED: LOC100281459 isoform X1               67.4    1e-11   
ref|XP_010048258.1|  PREDICTED: probable indole-3-pyruvate monoox...  67.4    1e-11   
ref|XP_007012038.1|  Flavin-binding monooxygenase family protein      67.4    1e-11   
ref|XP_011041485.1|  PREDICTED: probable indole-3-pyruvate monoox...  67.0    1e-11   
gb|KDP34220.1|  hypothetical protein JCGZ_07791                       67.0    1e-11   
ref|XP_008378116.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  67.0    1e-11   
ref|XP_003523701.1|  PREDICTED: probable indole-3-pyruvate monoox...  66.6    1e-11   
ref|XP_004975027.1|  PREDICTED: probable indole-3-pyruvate monoox...  66.6    1e-11   
ref|XP_002314526.2|  flavin-containing monooxygenase family protein   67.0    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_006476224.1|  PREDICTED: probable indole-3-pyruvate monoox...  66.6    2e-11   
gb|EMT21209.1|  Putative dimethylaniline monooxygenase (N-oxide-f...  66.2    2e-11   
ref|XP_006450542.1|  hypothetical protein CICLE_v10008466mg           66.6    2e-11   
gb|KHN07109.1|  Flavin-containing monooxygenase YUCCA4                66.6    2e-11   
gb|KHN05207.1|  Flavin-containing monooxygenase YUCCA6                66.6    2e-11   
ref|XP_002518191.1|  monooxygenase, putative                          66.6    2e-11   Ricinus communis
ref|XP_003563191.1|  PREDICTED: probable indole-3-pyruvate monoox...  66.2    2e-11   
ref|XP_010238992.1|  PREDICTED: probable indole-3-pyruvate monoox...  66.2    2e-11   
emb|CDY19798.1|  BnaA09g04510D                                        66.6    2e-11   
ref|XP_009111671.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  66.6    2e-11   
gb|EYU21924.1|  hypothetical protein MIMGU_mgv1a024074mg              66.2    2e-11   
ref|XP_004497732.1|  PREDICTED: probable indole-3-pyruvate monoox...  66.6    2e-11   
emb|CBI28073.3|  unnamed protein product                              66.6    2e-11   
ref|XP_011013240.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  66.2    2e-11   
gb|AAU43964.1|  putative dimethylaniline monooxygenase                65.9    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010450315.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  66.2    2e-11   
ref|XP_010440609.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  66.2    2e-11   
ref|XP_009372957.1|  PREDICTED: probable indole-3-pyruvate monoox...  66.2    2e-11   
ref|XP_003550114.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  66.2    2e-11   
ref|XP_004172308.1|  PREDICTED: flavin-containing monooxygenase Y...  66.2    3e-11   
ref|XP_008350337.1|  PREDICTED: probable indole-3-pyruvate monoox...  64.7    3e-11   
dbj|BAJ95692.1|  predicted protein                                    65.9    3e-11   
ref|XP_004150279.1|  PREDICTED: flavin-containing monooxygenase Y...  65.5    3e-11   
ref|XP_002309571.2|  flavin-containing monooxygenase family protein   65.9    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_006283821.1|  hypothetical protein CARUB_v10004923mg           65.9    3e-11   
ref|XP_010541625.1|  PREDICTED: probable indole-3-pyruvate monoox...  65.9    3e-11   
ref|XP_002324821.2|  hypothetical protein POPTR_0018s00840g           65.9    3e-11   Populus trichocarpa [western balsam poplar]
gb|ADP88696.2|  YUC1                                                  65.9    3e-11   
ref|XP_002447449.1|  hypothetical protein SORBIDRAFT_06g001210        65.9    4e-11   Sorghum bicolor [broomcorn]
ref|XP_011019745.1|  PREDICTED: probable indole-3-pyruvate monoox...  65.5    4e-11   
ref|XP_011019671.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.9    4e-11   
ref|XP_010453176.1|  PREDICTED: probable indole-3-pyruvate monoox...  65.5    4e-11   
ref|XP_004969853.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.9    4e-11   
emb|CAN80184.1|  hypothetical protein VITISV_015371                   65.5    4e-11   
ref|XP_002282357.1|  PREDICTED: probable indole-3-pyruvate monoox...  65.5    4e-11   
gb|ABW82012.1|  Bs3                                                   65.1    4e-11   
ref|XP_003527821.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.5    4e-11   
ref|XP_009129950.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.5    4e-11   
ref|XP_004956077.1|  PREDICTED: probable indole-3-pyruvate monoox...  65.5    4e-11   
ref|XP_004956076.1|  PREDICTED: probable indole-3-pyruvate monoox...  65.5    4e-11   
ref|XP_006854434.1|  hypothetical protein AMTR_s00039p00215960        65.5    4e-11   
ref|XP_009377493.1|  PREDICTED: probable indole-3-pyruvate monoox...  65.5    4e-11   
ref|XP_007050091.1|  Flavin-binding monooxygenase family protein      65.9    4e-11   
gb|EEC79565.1|  hypothetical protein OsI_20710                        64.7    4e-11   
ref|XP_006450617.1|  hypothetical protein CICLE_v10008473mg           65.5    5e-11   
gb|EPS60617.1|  hypothetical protein M569_14186                       63.2    5e-11   
ref|XP_002324838.1|  hypothetical protein POPTR_0018s01210g           65.5    5e-11   
gb|EYU43792.1|  hypothetical protein MIMGU_mgv1a006740mg              65.5    5e-11   
gb|EEE64442.1|  hypothetical protein OsJ_19287                        65.5    5e-11   
ref|XP_002456301.1|  hypothetical protein SORBIDRAFT_03g033730        65.5    5e-11   
ref|XP_008394023.1|  PREDICTED: probable indole-3-pyruvate monoox...  65.5    5e-11   
emb|CDP03823.1|  unnamed protein product                              65.5    5e-11   
ref|XP_006838919.1|  hypothetical protein AMTR_s00002p00269920        65.5    5e-11   
gb|AIN44208.1|  YUCCA1                                                65.1    5e-11   
ref|XP_010532855.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.5    5e-11   
gb|ABW82011.1|  Bs3-E                                                 64.7    5e-11   
ref|XP_008393894.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.5    5e-11   
gb|EYU21876.1|  hypothetical protein MIMGU_mgv1a023619mg              65.5    5e-11   
ref|NP_193062.1|  protein YUCCA2                                      65.1    5e-11   
ref|NP_001266953.1|  flavin-containing monooxygenase YUCCA4-like      65.1    6e-11   
ref|XP_006464531.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.1    6e-11   
ref|XP_006646293.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.1    6e-11   
ref|XP_010086911.1|  Flavin-containing monooxygenase YUCCA4           65.1    6e-11   
gb|KDO79706.1|  hypothetical protein CISIN_1g013943mg                 65.1    6e-11   
ref|XP_009389971.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  65.1    6e-11   
emb|CDY05502.1|  BnaA02g31890D                                        65.1    6e-11   
emb|CDY54895.1|  BnaC02g48550D                                        65.1    7e-11   
ref|XP_008366655.1|  PREDICTED: probable indole-3-pyruvate monoox...  64.7    7e-11   
ref|XP_002309594.1|  YUCCA family protein                             64.7    7e-11   
emb|CAJ46040.1|  flavin monooxygenase-like protein                    64.7    7e-11   
ref|XP_008366654.1|  PREDICTED: probable indole-3-pyruvate monoox...  64.7    7e-11   
ref|XP_004134027.1|  PREDICTED: flavin-containing monooxygenase Y...  65.1    7e-11   
gb|AAK74069.1|  flavin monoxygenase-like protein floozy               64.7    7e-11   
ref|XP_003588697.1|  Dimethylaniline monooxygenase                    64.7    7e-11   
gb|KGN56791.1|  hypothetical protein Csa_3G133910                     64.7    8e-11   
ref|XP_002863149.1|  hypothetical protein ARALYDRAFT_332994           64.7    8e-11   
emb|CBI20984.3|  unnamed protein product                              64.7    8e-11   
ref|XP_006353649.1|  PREDICTED: probable indole-3-pyruvate monoox...  64.7    8e-11   
ref|XP_006829642.1|  hypothetical protein AMTR_s00122p00099920        64.7    8e-11   
ref|XP_008779220.1|  PREDICTED: probable indole-3-pyruvate monoox...  62.4    8e-11   
ref|XP_008795039.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  64.7    8e-11   
ref|NP_001234343.1|  flavin monooxygenase-like protein                64.7    8e-11   
emb|CDY50808.1|  BnaCnng19720D                                        64.3    9e-11   
ref|XP_011026572.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  64.7    9e-11   
ref|XP_010667780.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  64.7    9e-11   
ref|XP_010670736.1|  PREDICTED: probable indole-3-pyruvate monoox...  64.3    9e-11   
ref|XP_008795040.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  64.7    9e-11   
ref|XP_010099581.1|  Flavin-containing monooxygenase YUCCA2           64.7    9e-11   
ref|XP_009603072.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  64.3    1e-10   
ref|NP_196693.1|  probable indole-3-pyruvate monooxygenase YUCCA4     64.3    1e-10   
ref|XP_002461906.1|  hypothetical protein SORBIDRAFT_02g010351        62.4    1e-10   
ref|XP_006837924.1|  hypothetical protein AMTR_s00218p00027210        64.3    1e-10   
ref|XP_010435296.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  64.3    1e-10   
ref|XP_010915799.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  64.3    1e-10   
ref|XP_011080140.1|  PREDICTED: probable indole-3-pyruvate monoox...  64.7    1e-10   
emb|CDM80552.1|  unnamed protein product                              64.3    1e-10   
ref|NP_850808.1|  probable indole-3-pyruvate monooxygenase YUCCA4     63.9    1e-10   
ref|XP_010905087.1|  PREDICTED: probable indole-3-pyruvate monoox...  64.3    1e-10   
ref|XP_008445038.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  64.3    1e-10   
gb|KHG06104.1|  Flavin-containing monooxygenase YUCCA4 -like protein  64.3    1e-10   
ref|XP_010254247.1|  PREDICTED: probable indole-3-pyruvate monoox...  64.3    1e-10   
ref|XP_006399634.1|  hypothetical protein EUTSA_v10016084mg           63.9    1e-10   
emb|CDX85720.1|  BnaA02g00930D                                        63.9    1e-10   
gb|EEC81940.1|  hypothetical protein OsI_25812                        63.9    1e-10   
ref|NP_001059508.1|  Os07g0437000                                     63.9    1e-10   
ref|XP_004168289.1|  PREDICTED: flavin-containing monooxygenase Y...  63.9    2e-10   
ref|XP_004138744.1|  PREDICTED: flavin-containing monooxygenase Y...  63.9    2e-10   
ref|XP_009782408.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  63.9    2e-10   
ref|XP_008219870.1|  PREDICTED: probable indole-3-pyruvate monoox...  63.9    2e-10   
ref|XP_011026573.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  63.9    2e-10   
gb|KGN62904.1|  hypothetical protein Csa_2G379350                     63.9    2e-10   
ref|XP_010047734.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  63.9    2e-10   
ref|XP_008781679.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  63.9    2e-10   
gb|KCW79690.1|  hypothetical protein EUGRSUZ_C01042                   63.9    2e-10   
ref|XP_003603602.1|  Dimethylaniline monooxygenase                    63.5    2e-10   
emb|CBI17544.3|  unnamed protein product                              63.5    2e-10   
gb|AGL50939.1|  FMO-flavin monooxygenase YUC6                         63.5    2e-10   
gb|EMT32024.1|  Dimethylaniline monooxygenase (N-oxide-forming) 2     63.5    2e-10   
ref|XP_009125799.1|  PREDICTED: probable indole-3-pyruvate monoox...  63.5    2e-10   
ref|XP_007013782.1|  Flavin monooxygenase-like protein floozy         63.5    2e-10   
ref|NP_001266982.1|  uncharacterized protein LOC101300089             63.5    2e-10   
ref|XP_010667671.1|  PREDICTED: probable indole-3-pyruvate monoox...  63.5    2e-10   
ref|XP_009783754.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  63.5    2e-10   
ref|XP_008445144.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...  63.2    3e-10   
ref|XP_006652087.1|  PREDICTED: probable indole-3-pyruvate monoox...  63.2    3e-10   
ref|XP_002516580.1|  monooxygenase, putative                          63.2    3e-10   
ref|XP_003565511.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  63.2    3e-10   
dbj|BAK01110.1|  predicted protein                                    62.8    3e-10   
ref|XP_002514307.1|  monooxygenase, putative                          63.2    3e-10   
ref|XP_007227629.1|  hypothetical protein PRUPE_ppa024927mg           63.2    3e-10   
ref|XP_006645656.1|  PREDICTED: LOW QUALITY PROTEIN: indole-3-pyr...  62.8    3e-10   
emb|CDX97092.1|  BnaC09g45330D                                        62.8    3e-10   
ref|XP_001753831.1|  predicted protein                                62.8    4e-10   
ref|NP_001131490.1|  hypothetical protein                             63.2    4e-10   
ref|XP_006286020.1|  hypothetical protein CARUB_v10007550mg           62.8    4e-10   
gb|ADP88697.1|  YUC2                                                  62.4    4e-10   
gb|EYU32612.1|  hypothetical protein MIMGU_mgv1a020573mg              62.8    4e-10   
ref|XP_010688195.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  62.8    4e-10   
ref|XP_009121966.1|  PREDICTED: probable indole-3-pyruvate monoox...  62.8    4e-10   
ref|XP_011026510.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...  62.8    4e-10   
ref|XP_006356642.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  62.8    4e-10   
ref|XP_004987167.1|  PREDICTED: probable indole-3-pyruvate monoox...  62.4    6e-10   
ref|XP_002468464.1|  hypothetical protein SORBIDRAFT_01g046330        60.5    6e-10   
ref|XP_011086571.1|  PREDICTED: probable indole-3-pyruvate monoox...  62.0    7e-10   
gb|AFG16915.1|  YUC2                                                  62.0    7e-10   
ref|XP_003609190.1|  Dimethylaniline monooxygenase                    60.1    7e-10   
gb|KFK29864.1|  hypothetical protein AALP_AA7G189000                  62.0    7e-10   
ref|XP_008797687.1|  PREDICTED: probable indole-3-pyruvate monoox...  62.0    7e-10   
ref|XP_002962409.1|  hypothetical protein SELMODRAFT_23133            62.0    8e-10   
ref|XP_010254124.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  62.0    8e-10   
ref|XP_002515593.1|  monooxygenase, putative                          62.0    8e-10   
ref|XP_006412458.1|  hypothetical protein EUTSA_v10026965mg           62.0    8e-10   
ref|XP_008242624.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  62.0    8e-10   
gb|KDP32299.1|  hypothetical protein JCGZ_13224                       62.0    8e-10   
ref|XP_010925841.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  62.0    9e-10   
emb|CDX68858.1|  BnaC01g05950D                                        62.0    9e-10   
emb|CDM84071.1|  unnamed protein product                              62.0    9e-10   
ref|XP_009597506.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  61.2    9e-10   
ref|XP_009387179.1|  PREDICTED: probable indole-3-pyruvate monoox...  61.6    9e-10   
ref|XP_009383502.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  61.6    1e-09   
ref|XP_009125871.1|  PREDICTED: probable indole-3-pyruvate monoox...  61.6    1e-09   
emb|CDY23330.1|  BnaA08g12160D                                        61.6    1e-09   
gb|EEC71436.1|  hypothetical protein OsI_03635                        61.6    1e-09   
gb|EEE55342.1|  hypothetical protein OsJ_03359                        61.6    1e-09   
ref|XP_003588544.1|  Dimethylaniline monooxygenase                    61.6    1e-09   
ref|XP_008365036.1|  PREDICTED: probable indole-3-pyruvate monoox...  61.6    1e-09   
ref|XP_009416414.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  61.6    1e-09   
dbj|BAD87432.1|  putative flavin monoxygenase-like protein floozy     61.6    1e-09   
gb|EEE67071.1|  hypothetical protein OsJ_24041                        61.6    1e-09   
emb|CDX75253.1|  BnaA01g04490D                                        61.2    1e-09   
ref|XP_010049004.1|  PREDICTED: probable indole-3-pyruvate monoox...  61.2    1e-09   
emb|CAH65864.1|  OSIGBa0126J24.9                                      61.2    1e-09   
ref|NP_001052088.1|  Os04g0128900                                     61.2    1e-09   
ref|XP_002445660.1|  hypothetical protein SORBIDRAFT_07g023640        61.2    1e-09   
ref|XP_008777574.1|  PREDICTED: probable indole-3-pyruvate monoox...  61.2    1e-09   
emb|CDY39891.1|  BnaC03g67260D                                        61.2    1e-09   
ref|XP_007161250.1|  hypothetical protein PHAVU_001G054600g           61.2    1e-09   
ref|XP_009108870.1|  PREDICTED: probable indole-3-pyruvate monoox...  61.2    1e-09   
ref|XP_003569735.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  61.2    1e-09   
ref|XP_009631013.1|  PREDICTED: probable indole-3-pyruvate monoox...  61.2    2e-09   
ref|XP_008337390.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  61.2    2e-09   
ref|XP_002963791.1|  hypothetical protein SELMODRAFT_80431            60.8    2e-09   
ref|XP_002974880.1|  hypothetical protein SELMODRAFT_102211           60.8    2e-09   
ref|XP_009382030.1|  PREDICTED: probable indole-3-pyruvate monoox...  60.8    2e-09   
ref|XP_002268001.2|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.8    2e-09   
ref|XP_010925177.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.8    2e-09   
ref|XP_009395195.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.8    2e-09   
ref|XP_007204473.1|  hypothetical protein PRUPE_ppa022204mg           60.8    2e-09   
ref|XP_009374016.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.8    2e-09   
ref|XP_009371467.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.8    2e-09   
gb|EMS52275.1|  Flavin-containing monooxygenase YUCCA2                60.8    2e-09   
ref|NP_001172554.1|  Os01g0732600                                     59.3    2e-09   
ref|XP_008651253.1|  PREDICTED: probable indole-3-pyruvate monoox...  60.5    2e-09   
gb|KDP33668.1|  hypothetical protein JCGZ_07239                       60.5    2e-09   
ref|XP_008463388.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.5    2e-09   
ref|XP_010688566.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.5    3e-09   
ref|XP_002965620.1|  hypothetical protein SELMODRAFT_64527            60.5    3e-09   
ref|XP_008651250.1|  PREDICTED: probable indole-3-pyruvate monoox...  60.5    3e-09   
ref|XP_003532486.2|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.5    3e-09   
ref|XP_008386461.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.5    3e-09   
gb|KFK36212.1|  hypothetical protein AALP_AA4G092300                  60.5    3e-09   
ref|XP_010239639.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...  60.5    3e-09   
ref|XP_009381767.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.1    3e-09   
ref|XP_006414940.1|  hypothetical protein EUTSA_v10025326mg           60.1    3e-09   
gb|KHN16603.1|  Flavin-containing monooxygenase YUCCA2                60.1    3e-09   
ref|XP_011081905.1|  PREDICTED: probable indole-3-pyruvate monoox...  60.1    3e-09   
ref|XP_006451149.1|  hypothetical protein CICLE_v100091081mg          58.9    4e-09   
ref|XP_008242625.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.1    4e-09   
ref|XP_008795668.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  60.1    4e-09   
emb|CDY71836.1|  BnaCnng74730D                                        59.7    4e-09   
gb|EPS63344.1|  hypothetical protein M569_11440                       59.7    4e-09   
ref|XP_010923752.1|  PREDICTED: probable indole-3-pyruvate monoox...  59.7    4e-09   
ref|XP_011025748.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  59.7    4e-09   
gb|EEE58368.1|  hypothetical protein OsJ_09509                        59.7    5e-09   
ref|XP_009360777.1|  PREDICTED: probable indole-3-pyruvate monoox...  59.7    5e-09   
ref|XP_010447373.1|  PREDICTED: probable indole-3-pyruvate monoox...  59.7    5e-09   
ref|XP_009396730.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  59.7    5e-09   
ref|XP_002310212.2|  hypothetical protein POPTR_0007s12580g           59.3    6e-09   
gb|KEH27129.1|  indole-3-pyruvate monooxygenase                       59.3    6e-09   
ref|NP_001049048.1|  Os03g0162000                                     59.3    6e-09   
dbj|BAG14340.1|  flavin-containing monooxygenase YUCCA                59.3    6e-09   
ref|XP_004498541.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  59.3    6e-09   
ref|XP_006646145.1|  PREDICTED: probable indole-3-pyruvate monoox...  59.3    7e-09   
gb|KHN44811.1|  Flavin-containing monooxygenase YUCCA4                59.3    7e-09   
gb|KHN41633.1|  Flavin-containing monooxygenase YUCCA2                59.3    7e-09   
ref|XP_006475617.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  59.3    7e-09   
ref|XP_003524392.2|  PREDICTED: indole-3-pyruvate monooxygenase Y...  59.3    7e-09   
ref|XP_004972032.1|  PREDICTED: probable indole-3-pyruvate monoox...  59.3    8e-09   
ref|XP_001771611.1|  predicted protein                                58.9    8e-09   
gb|AAN06861.1|  Putative flavin-containing monooxygenase              59.3    8e-09   
ref|XP_002869265.1|  hypothetical protein ARALYDRAFT_353573           58.9    8e-09   
ref|XP_006425709.1|  hypothetical protein CICLE_v10027059mg           58.9    9e-09   
ref|NP_194980.1|  flavin-containing monooxygenase YUCCA1              58.9    9e-09   
ref|NP_001042455.1|  Os01g0224700                                     58.9    9e-09   
ref|XP_008792406.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  58.9    1e-08   
ref|XP_008810038.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  58.9    1e-08   
ref|XP_010245351.1|  PREDICTED: probable indole-3-pyruvate monoox...  58.5    1e-08   
ref|XP_003549250.1|  PREDICTED: probable indole-3-pyruvate monoox...  58.5    1e-08   
ref|XP_010249741.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  58.5    1e-08   
ref|XP_006583377.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  58.5    1e-08   
gb|KDO79505.1|  hypothetical protein CISIN_1g039923mg                 58.5    1e-08   
gb|KHN45645.1|  Flavin-containing monooxygenase YUCCA2                58.5    1e-08   
ref|XP_010245350.1|  PREDICTED: probable indole-3-pyruvate monoox...  58.2    1e-08   
ref|XP_010244331.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  58.5    1e-08   
ref|XP_003533388.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  58.5    1e-08   
ref|XP_010432702.1|  PREDICTED: probable indole-3-pyruvate monoox...  58.5    1e-08   
ref|XP_010437892.1|  PREDICTED: probable indole-3-pyruvate monoox...  58.2    2e-08   
ref|XP_010916813.1|  PREDICTED: indole-3-pyruvate monooxygenase Y...  58.2    2e-08   
emb|CDP04838.1|  unnamed protein product                              57.8    2e-08   
ref|XP_009781970.1|  PREDICTED: probable indole-3-pyruvate monoox...  57.8    2e-08   
gb|KGN65144.1|  hypothetical protein Csa_1G242600                     57.8    2e-08   



>ref|XP_006443693.1| hypothetical protein CICLE_v10023818mg [Citrus clementina]
 ref|XP_006480158.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8-like 
[Citrus sinensis]
 gb|ESR56933.1| hypothetical protein CICLE_v10023818mg [Citrus clementina]
Length=423

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFIQYLESYAE+F+I+PRFN
Sbjct  77   CQLPKLPFPEDFPEYPTKRQFIQYLESYAEKFEINPRFN  115



>ref|XP_010522520.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Tarenaya 
hassleriana]
Length=426

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP+ FPEYPTKRQFI+YLESYA+RF+ISPRFN
Sbjct  77   CELPKIPFPEHFPEYPTKRQFIEYLESYAKRFEISPRFN  115



>gb|ACX33887.1| flavin monooxygenase-like protein [Solanum lycopersicum]
Length=431

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPYFPFP++FPEYPTK QFI YLESYA+ F+ISPRFN
Sbjct  86   CELPYFPFPQNFPEYPTKYQFISYLESYAKNFEISPRFN  124



>ref|XP_006340902.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3-like 
[Solanum tuberosum]
Length=431

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPYFPFP++FPEYPTK QFI YLESYA+ F+ISPRFN
Sbjct  86   CELPYFPFPQNFPEYPTKYQFISYLESYAKNFEISPRFN  124



>ref|XP_009791244.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 isoform 
X2 [Nicotiana sylvestris]
Length=394

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPYFPFP++FPEYPTK QFI YLESYA++F+I+PRFN
Sbjct  85   CELPYFPFPENFPEYPTKYQFISYLESYAKKFEINPRFN  123



>ref|XP_009411368.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP DFPEYPTK+QFI YLESYA+ FQI PRFN
Sbjct  74   CQLPKFPFPDDFPEYPTKKQFIDYLESYAQHFQIRPRFN  112



>gb|KDO65782.1| hypothetical protein CISIN_1g014522mg [Citrus sinensis]
Length=423

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP   FP+DFPEYPTKRQFIQYLESYAE+F+I+PRFN
Sbjct  77   CQLPKLQFPEDFPEYPTKRQFIQYLESYAEKFEINPRFN  115



>ref|XP_010540939.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Tarenaya 
hassleriana]
Length=424

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYPTKRQFIQYLESYA RF+I+P+FN
Sbjct  77   CQLPKMPFPADFPEYPTKRQFIQYLESYANRFEINPKFN  115



>ref|XP_010548723.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Tarenaya 
hassleriana]
Length=424

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYPTKRQFIQYLESYA+RF+ISP FN
Sbjct  77   CQLPKMPFPDDFPEYPTKRQFIQYLESYAKRFEISPEFN  115



>ref|XP_006285300.1| hypothetical protein CARUB_v10006681mg [Capsella rubella]
 gb|EOA18198.1| hypothetical protein CARUB_v10006681mg [Capsella rubella]
Length=426

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  78   CQLPKMPFPEDFPEYPTKRQFIHYLESYASRFEINPKFN  116



>gb|KFK29415.1| hypothetical protein AALP_AA7G131400 [Arabis alpina]
Length=426

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFPKDFPEYPTKRQFI YLESYA RF+++P+FN
Sbjct  78   CQLPKMPFPKDFPEYPTKRQFIDYLESYASRFEVNPKFN  116



>ref|XP_009791243.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 isoform 
X1 [Nicotiana sylvestris]
Length=429

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPYFPFP++FPEYPTK QFI YLESYA++F+I+PRFN
Sbjct  85   CELPYFPFPENFPEYPTKYQFISYLESYAKKFEINPRFN  123



>ref|XP_010243626.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 isoform 
X1 [Nelumbo nucifera]
Length=434

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA+RF+I+PRFN
Sbjct  74   CQLPKVPFPEDFPEYPTKKQFIEYLESYAKRFEINPRFN  112



>ref|XP_009624017.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Nicotiana 
tomentosiformis]
Length=429

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPYFPFP++FPEYPTK QFI YLESYA+ F+I+PRFN
Sbjct  85   CELPYFPFPENFPEYPTKYQFISYLESYAKHFEINPRFN  123



>ref|XP_002869478.1| flavin-containing monooxygenase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45737.1| flavin-containing monooxygenase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=426

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  78   CQLPKMPFPEDFPEYPTKRQFIDYLESYATRFEINPKFN  116



>ref|XP_009384501.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+D+PEYPTK+QF+ YLESYA+ F+ISPRFN
Sbjct  74   CQLPKFPFPEDYPEYPTKKQFVDYLESYAKHFEISPRFN  112



>ref|XP_010447924.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Camelina 
sativa]
Length=427

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  79   CQLPKMPFPEDFPEYPTKRQFIDYLESYATRFEINPKFN  117



>ref|XP_010438392.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Camelina 
sativa]
Length=427

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  79   CQLPKMPFPEDFPEYPTKRQFIDYLESYATRFEINPKFN  117



>ref|NP_194601.1| flavin-containing monooxygenase YUCCA8 [Arabidopsis thaliana]
 sp|Q9SVU0.1|YUC8_ARATH RecName: Full=Probable indole-3-pyruvate monooxygenase YUCCA8; 
AltName: Full=Flavin-containing monooxygenase YUCCA8 [Arabidopsis 
thaliana]
 emb|CAA22980.1| putative protein [Arabidopsis thaliana]
 emb|CAB81460.1| putative protein [Arabidopsis thaliana]
 gb|ABJ98570.1| At4g28720 [Arabidopsis thaliana]
 gb|AEE85534.1| flavin-containing monooxygenase YUCCA8 [Arabidopsis thaliana]
Length=426

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  78   CQLPKMPFPEDFPEYPTKRQFIDYLESYATRFEINPKFN  116



>ref|XP_010433170.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Camelina 
sativa]
Length=427

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  79   CQLPKMPFPEDFPEYPTKRQFIDYLESYATRFEINPKFN  117



>ref|XP_010243627.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 isoform 
X2 [Nelumbo nucifera]
Length=419

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA+RF+I+PRFN
Sbjct  74   CQLPKVPFPEDFPEYPTKKQFIEYLESYAKRFEINPRFN  112



>ref|XP_009401703.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+D+PEYPTK+QF+ YLESYA+ F+ISPRFN
Sbjct  74   CQLPNFPFPEDYPEYPTKKQFVDYLESYAKHFEISPRFN  112



>ref|XP_004247940.2| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Solanum 
lycopersicum]
Length=431

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CEL YFPFP++FPEYPTK QFI YLESYA+ F+ISPRFN
Sbjct  86   CELRYFPFPQNFPEYPTKYQFISYLESYAKNFEISPRFN  124



>ref|XP_008342551.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Malus 
domestica]
Length=426

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFPKDFPEYPTK QFI YLESYA+ F ISP FN
Sbjct  76   CQLPNFPFPKDFPEYPTKNQFINYLESYAQHFDISPNFN  114



>ref|NP_199202.1| probable indole-3-pyruvate monooxygenase YUCCA5 [Arabidopsis 
thaliana]
 sp|Q9LKC0.1|YUC5_ARATH RecName: Full=Probable indole-3-pyruvate monooxygenase YUCCA5; 
AltName: Full=Flavin-containing monooxygenase YUCCA5; AltName: 
Full=Protein SUPPRESSOR OF ER 1 [Arabidopsis thaliana]
 dbj|BAA98069.1| dimethylaniline monooxygenase-like [Arabidopsis thaliana]
 gb|AAZ93924.1| putative flavin monooxygenase protein [Arabidopsis thaliana]
 gb|ABM06013.1| At5g43890 [Arabidopsis thaliana]
 gb|AED95021.1| probable indole-3-pyruvate monooxygenase YUCCA5 [Arabidopsis 
thaliana]
Length=424

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYPTKRQFI+YLESYA +F+I+P+FN
Sbjct  78   CQLPKMPFPEDYPEYPTKRQFIEYLESYANKFEITPQFN  116



>emb|CDX94734.1| BnaC07g17430D [Brassica napus]
Length=426

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYPTKRQFI YLESYA RF I+P+FN
Sbjct  78   CQLPKMPFPEDYPEYPTKRQFIDYLESYATRFNINPQFN  116



>ref|XP_007225027.1| hypothetical protein PRUPE_ppa019979mg [Prunus persica]
 gb|EMJ26226.1| hypothetical protein PRUPE_ppa019979mg [Prunus persica]
Length=424

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA+ F ISP+FN
Sbjct  75   CQLPNFPFPEDFPEYPTKNQFINYLESYAQHFDISPQFN  113



>gb|KEH42432.1| indole-3-pyruvate monooxygenase [Medicago truncatula]
Length=421

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP++FPEYPTK+QFI YLESYA+ F+I+PRFN
Sbjct  78   CQLPNFPFPQEFPEYPTKKQFINYLESYAKHFEINPRFN  116



>ref|XP_008224116.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Prunus 
mume]
Length=424

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA+ F ISP+FN
Sbjct  75   CQLPNFPFPEDFPEYPTKNQFINYLESYAQHFDISPQFN  113



>ref|XP_011091378.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Sesamum 
indicum]
Length=414

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPY PFP++FPEYP+K QFI YLESYA+ F+I PRFN
Sbjct  72   CELPYIPFPENFPEYPSKHQFINYLESYAKHFEIDPRFN  110



>ref|XP_008365940.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Malus 
domestica]
Length=423

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTKRQFI YLESYA+ F+I+P+FN
Sbjct  77   CQLPKFPFPEDFPEYPTKRQFIDYLESYAKHFEINPKFN  115



>ref|XP_011024522.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Populus 
euphratica]
Length=422

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA++F+I+PRFN
Sbjct  77   CQLPKVPFPEDFPEYPTKKQFIEYLESYAKQFEINPRFN  115



>gb|KDP26439.1| hypothetical protein JCGZ_17597 [Jatropha curcas]
Length=423

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA+ F+I+PRFN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFIEYLESYAKHFEINPRFN  115



>ref|NP_001266992.1| uncharacterized protein LOC101308331 [Fragaria vesca]
 gb|AFG16918.1| YUC3 [Fragaria vesca]
Length=424

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKRQFIDYLESYAKHFEINPKFN  115



>gb|KHN05899.1| Flavin-containing monooxygenase YUCCA8 [Glycine soja]
Length=423

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFPKDFPEYPTK+ FI YLESYA++F+I+PRFN
Sbjct  77   CQLPNLPFPKDFPEYPTKKHFIDYLESYAQKFEINPRFN  115



>ref|XP_003537140.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8-like 
[Glycine max]
Length=423

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFPKDFPEYPTK+ FI YLESYA++F+I+PRFN
Sbjct  77   CQLPNLPFPKDFPEYPTKKHFIDYLESYAQKFEINPRFN  115



>ref|XP_009129331.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Brassica 
rapa]
Length=426

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTKRQFI YLESYA RF ISP+FN
Sbjct  78   CQLPKMPFPESFPEYPTKRQFIDYLESYASRFDISPKFN  116



>emb|CDY06876.1| BnaC01g09750D [Brassica napus]
Length=426

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTKRQFI YLESYA RF ISP+FN
Sbjct  78   CQLPKMPFPESFPEYPTKRQFIDYLESYASRFDISPKFN  116



>emb|CDY35214.1| BnaA01g08170D [Brassica napus]
Length=426

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTKRQFI YLESYA RF ISP+FN
Sbjct  78   CQLPKMPFPESFPEYPTKRQFIDYLESYASRFDISPKFN  116



>ref|XP_008459986.1| PREDICTED: LOW QUALITY PROTEIN: probable indole-3-pyruvate monooxygenase 
YUCCA8 [Cucumis melo]
Length=423

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI+YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKRQFIEYLESYAKHFEINPQFN  115



>ref|XP_004140585.1| PREDICTED: flavin-containing monooxygenase YUCCA8-like [Cucumis 
sativus]
 ref|XP_004168228.1| PREDICTED: flavin-containing monooxygenase YUCCA8-like [Cucumis 
sativus]
Length=423

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI+YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKRQFIEYLESYAKHFEINPQFN  115



>ref|NP_001288908.1| probable indole-3-pyruvate monooxygenase YUCCA8 [Brassica rapa]
 gb|AHM23828.1| flavin-containing monooxygenase family protein [Brassica rapa]
Length=426

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  80   CQLPKMPFPESFPEYPTKRQFIDYLESYASRFEINPKFN  118



>ref|XP_010510306.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Camelina 
sativa]
Length=425

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+++PEYPTKRQFI YLESYA RF ISP+FN
Sbjct  78   CQLPKMPFPENYPEYPTKRQFIDYLESYANRFDISPQFN  116



>gb|EPS72004.1| flavin monooxygenase-like protein, partial [Genlisea aurea]
Length=401

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPY PFP DFPEYP++ QF+ YL+SYAERF I PRFN
Sbjct  75   CELPYVPFPVDFPEYPSRNQFVGYLKSYAERFGIDPRFN  113



>gb|KHN48962.1| Flavin-containing monooxygenase YUCCA8 [Glycine soja]
Length=423

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFPKDFPEYPTK+ FI YLESYA++F+I+PRFN
Sbjct  77   CQLPNLPFPKDFPEYPTKKHFIDYLESYAQKFEINPRFN  115



>ref|XP_003542445.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8-like 
[Glycine max]
Length=423

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFPKDFPEYPTK+ FI YLESYA++F+I+PRFN
Sbjct  77   CQLPNLPFPKDFPEYPTKKHFIDYLESYAQKFEINPRFN  115



>emb|CBI33313.3| unnamed protein product [Vitis vinifera]
Length=408

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LPYFPFP +FPEYPTK QFI YLESYA+ F+I+PRFN
Sbjct  83   CQLPYFPFPDNFPEYPTKVQFIDYLESYAKHFEITPRFN  121



>ref|XP_010481808.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Camelina 
sativa]
Length=424

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYPTKRQFI YLESYA +F+I+P+FN
Sbjct  78   CQLPKMPFPEDYPEYPTKRQFIDYLESYANKFEITPQFN  116



>gb|AGL50941.1| FMO-flavin monooxygenase YUC3 [Fragaria x ananassa]
Length=424

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKRQFIDYLESYAKHFEINPKFN  115



>ref|NP_001266952.1| uncharacterized protein LOC101305359 [Fragaria vesca]
 gb|AFG16917.1| YUC7 [Fragaria vesca]
Length=428

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYP+K QFI+YLESYAE F I+P FN
Sbjct  81   CQLPNFPFPEDFPEYPSKNQFIKYLESYAEHFDINPNFN  119



>ref|XP_006280526.1| hypothetical protein CARUB_v10026464mg [Capsella rubella]
 gb|EOA13424.1| hypothetical protein CARUB_v10026464mg [Capsella rubella]
Length=424

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYPTKRQFI YLESYA +F+I+P+FN
Sbjct  78   CQLPKMPFPEDYPEYPTKRQFIDYLESYANKFEITPQFN  116



>ref|XP_010494376.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Camelina 
sativa]
Length=424

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYPTKRQFI YLESYA +F+I+P+FN
Sbjct  78   CQLPKMPFPEDYPEYPTKRQFIDYLESYANKFEITPQFN  116



>ref|XP_010441967.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Camelina 
sativa]
Length=424

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYPTKRQFI YLESYA +F+I+P+FN
Sbjct  78   CQLPKMPFPEDYPEYPTKRQFIDYLESYANKFEITPQFN  116



>ref|XP_008372417.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Malus 
domestica]
Length=423

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKRQFIDYLESYAKHFEINPKFN  115



>ref|XP_010091845.1| Flavin-containing monooxygenase YUCCA8 [Morus notabilis]
 gb|EXB46053.1| Flavin-containing monooxygenase YUCCA8 [Morus notabilis]
Length=420

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFIQYLESYA RF I P+FN
Sbjct  77   CQLPKMPFPEDFPEYPTKKQFIQYLESYAARFDIKPQFN  115



>ref|XP_004495036.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8-like 
[Cicer arietinum]
Length=423

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ FP+YPTK+QFI YLESYA+RF+I+PRFN
Sbjct  80   CQLPNFPFPQHFPQYPTKKQFINYLESYAKRFEINPRFN  118



>emb|CAN83595.1| hypothetical protein VITISV_041375 [Vitis vinifera]
Length=424

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTK+QFI+YLESYA+RF+++PRFN
Sbjct  77   CQLPKMPFPEAFPEYPTKKQFIEYLESYAKRFEVNPRFN  115



>ref|XP_009370885.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Pyrus 
x bretschneideri]
Length=423

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKRQFIDYLESYAKHFEINPKFN  115



>emb|CAN68655.1| hypothetical protein VITISV_009086 [Vitis vinifera]
Length=374

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP++FP YPTK+QFI+YLE+YAERF I PRFN
Sbjct  85   CELPLMPFPENFPTYPTKQQFIEYLEAYAERFBIRPRFN  123



>gb|KFK31683.1| hypothetical protein AALP_AA6G145600 [Arabis alpina]
Length=423

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+++PEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  78   CQLPKMPFPENYPEYPTKRQFIDYLESYATRFEITPQFN  116



>emb|CDX97452.1| BnaC08g13170D [Brassica napus]
Length=426

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTKRQFI YLESYA RF I+P+FN
Sbjct  80   CQLPKMPFPESFPEYPTKRQFIDYLESYASRFDINPKFN  118



>ref|XP_010263981.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Nelumbo 
nucifera]
Length=424

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI YLESYA+RF+++PRFN
Sbjct  76   CQLPKVPFPEDFPEYPTKKQFIGYLESYAKRFELNPRFN  114



>ref|XP_002281597.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6 [Vitis vinifera]
 ref|XP_010648530.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6 [Vitis vinifera]
Length=415

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP++FP YPTK+QFI+YLE+YAERF I PRFN
Sbjct  85   CELPLMPFPENFPTYPTKQQFIEYLEAYAERFDIQPRFN  123



>gb|KFK23319.1| hypothetical protein AALP_AAs74635U000900 [Arabis alpina]
Length=425

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYPTKRQFI YLESYA RF+I P+F+
Sbjct  78   CQLPKMPFPEDYPEYPTKRQFIDYLESYANRFEIRPQFS  116



>ref|XP_002268052.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Vitis 
vinifera]
Length=424

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTK+QFI+YLESYA+RF+++PRFN
Sbjct  77   CQLPKMPFPEAFPEYPTKKQFIEYLESYAKRFEVNPRFN  115



>ref|XP_003554314.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8-like 
[Glycine max]
 gb|KHN02439.1| Flavin-containing monooxygenase YUCCA8 [Glycine soja]
Length=424

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFIEYLESYAKHFEINPQFN  115



>emb|CBI20900.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP++FP YPTK+QFI+YLE+YAERF I PRFN
Sbjct  85   CELPLMPFPENFPTYPTKQQFIEYLEAYAERFDIQPRFN  123



>ref|XP_002282648.3| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Vitis 
vinifera]
Length=522

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LPYFPFP +FPEYPTK QFI YLESYA+ F+I+PRFN
Sbjct  83   CQLPYFPFPDNFPEYPTKVQFIDYLESYAKHFEITPRFN  121



>ref|XP_002303099.1| flavin-containing monooxygenase family protein [Populus trichocarpa]
 gb|EEE82372.1| flavin-containing monooxygenase family protein [Populus trichocarpa]
Length=422

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QF++YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFVEYLESYAKHFEINPKFN  115



>gb|KHG11991.1| Flavin-containing monooxygenase YUCCA8 -like protein [Gossypium 
arboreum]
Length=424

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI+YLESYA+ F I+P+FN
Sbjct  78   CQLPKMPFPEDFPEYPTKRQFIEYLESYAKHFDINPKFN  116



>ref|XP_003521326.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8-like 
[Glycine max]
Length=424

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFIEYLESYAKHFEINPQFN  115



>gb|KCW60149.1| hypothetical protein EUGRSUZ_H02874 [Eucalyptus grandis]
Length=422

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YL+SYA  F ISP FN
Sbjct  74   CQLPDFPFPEDFPEYPTKHQFITYLDSYARHFDISPNFN  112



>gb|AIN44210.1| YUCCA3 [Rosa hybrid cultivar]
Length=424

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQFI YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKRQFIDYLESYAKHFEINPKFN  115



>ref|XP_002521164.1| monooxygenase, putative [Ricinus communis]
 gb|EEF41315.1| monooxygenase, putative [Ricinus communis]
Length=423

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFIEYLESYAKTFEINPKFN  115



>emb|CBI37227.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 72.8 bits (177),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTK+QFI+YLESYA+RF+++PRFN
Sbjct  77   CQLPKMPFPEAFPEYPTKKQFIEYLESYAKRFEVNPRFN  115



>ref|XP_009365491.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Pyrus 
x bretschneideri]
Length=426

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP DFPEYPTK QFI YLESYA+ F ISP FN
Sbjct  76   CQLPNFPFPDDFPEYPTKDQFINYLESYAQHFDISPNFN  114



>ref|XP_007162643.1| hypothetical protein PHAVU_001G168000g [Phaseolus vulgaris]
 gb|ESW34637.1| hypothetical protein PHAVU_001G168000g [Phaseolus vulgaris]
Length=423

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA  F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFIEYLESYARHFEINPQFN  115



>ref|XP_009398050.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Musa 
acuminata subsp. malaccensis]
Length=417

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYP+++QFI YLESYA+ F++SPRFN
Sbjct  74   CQLPMLPFPEDYPEYPSRKQFIDYLESYAKHFKLSPRFN  112



>ref|XP_010023778.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA7 [Eucalyptus 
grandis]
Length=434

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YL+SYA  F ISP FN
Sbjct  86   CQLPDFPFPEDFPEYPTKHQFITYLDSYARHFDISPNFN  124



>gb|AGL50940.1| FMO-flavin monooxygenase YUC7 [Fragaria x ananassa]
Length=428

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYP+K QFI+YLESYA+ F+I+P FN
Sbjct  81   CQLPNFPFPEDFPEYPSKYQFIKYLESYAKHFEINPNFN  119



>ref|XP_010556939.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA7 [Tarenaya 
hassleriana]
Length=435

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFIQYLESYA  F I P+FN
Sbjct  88   CQLPNFPFPEDFPEYPTKYQFIQYLESYATHFDIRPKFN  126



>ref|XP_003535245.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3-like 
[Glycine max]
 gb|KHN14055.1| Flavin-containing monooxygenase YUCCA3 [Glycine soja]
Length=441

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA+ F ISP+FN
Sbjct  84   CQLPNFPFPEDFPEYPTKFQFISYLESYAKHFNISPQFN  122



>gb|KHN09407.1| Flavin-containing monooxygenase YUCCA8 [Glycine soja]
Length=406

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI+YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFIEYLESYAKHFEINPQFN  115



>ref|XP_006403167.1| hypothetical protein EUTSA_v10003214mg [Eutrema salsugineum]
 gb|ESQ44620.1| hypothetical protein EUTSA_v10003214mg [Eutrema salsugineum]
Length=427

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ +PEYPTKRQFI YLESYA RF ISP+FN
Sbjct  78   CQLPKMPFPETYPEYPTKRQFIDYLESYATRFDISPQFN  116



>ref|XP_003559094.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Brachypodium 
distachyon]
Length=410

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFPEYP+K QF+ YL SYA RF ++PRFN
Sbjct  60   CELPGMPFPADFPEYPSKHQFLSYLHSYAARFHVAPRFN  98



>ref|XP_008235554.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Prunus 
mume]
Length=423

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFIDYLESYAKHFEINPKFN  115



>ref|XP_007222931.1| hypothetical protein PRUPE_ppa005244mg [Prunus persica]
 gb|EMJ24130.1| hypothetical protein PRUPE_ppa005244mg [Prunus persica]
Length=471

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+ PFP DFP YPTK+QFIQYLE YA +F I PRFN
Sbjct  125  CELPFMPFPNDFPTYPTKQQFIQYLEDYATKFDIRPRFN  163



>ref|XP_010038328.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Eucalyptus 
grandis]
 gb|KCW50149.1| hypothetical protein EUGRSUZ_K03581 [Eucalyptus grandis]
Length=423

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYP ++QFI YLESYA RF+ISP FN
Sbjct  77   CQLPKLPFPEDFPEYPNRKQFIDYLESYATRFEISPNFN  115



>ref|XP_007201525.1| hypothetical protein PRUPE_ppa015832mg [Prunus persica]
 gb|EMJ02724.1| hypothetical protein PRUPE_ppa015832mg [Prunus persica]
Length=423

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK+QFI YLESYA+ F+I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKKQFIDYLESYAKHFEINPKFN  115



>ref|XP_009415536.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Musa 
acuminata subsp. malaccensis]
Length=416

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYPTK QFI YLESYA RF+++P+FN
Sbjct  74   CQLPKLPFPVDFPEYPTKDQFIDYLESYAARFELNPQFN  112



>ref|XP_009382170.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYPTK+QFI YLESYA+  +ISPRFN
Sbjct  74   CQLPRFPFPEHYPEYPTKQQFIDYLESYAKHLEISPRFN  112



>gb|KHG12306.1| Flavin-containing monooxygenase YUCCA8 -like protein [Gossypium 
arboreum]
Length=428

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTKRQF+ YLESYA+ F I+P+FN
Sbjct  80   CQLPKLPFPEDFPEYPTKRQFLDYLESYAKHFDINPKFN  118



>emb|CDO99380.1| unnamed protein product [Coffea canephora]
Length=417

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPYFPFPK+FPEYPTK QFI YLESYA+ F+I PRFN
Sbjct  74   CELPYFPFPKEFPEYPTKNQFIDYLESYAKHFKIIPRFN  112



>emb|CDY22326.1| BnaA06g36480D [Brassica napus]
Length=426

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ +PEYPTKRQFI YLESYA RF I+P+FN
Sbjct  78   CQLPKMPFPESYPEYPTKRQFIDYLESYATRFNINPQFN  116



>ref|XP_002863626.1| SUPER1/YUCCA5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39885.1| SUPER1/YUCCA5 [Arabidopsis lyrata subsp. lyrata]
Length=425

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYPTK QFI+YLESYA +F+I+P+FN
Sbjct  78   CQLPKMPFPEDYPEYPTKGQFIEYLESYANKFEITPQFN  116



>ref|XP_008220100.1| PREDICTED: LOW QUALITY PROTEIN: indole-3-pyruvate monooxygenase 
YUCCA6 [Prunus mume]
Length=401

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+ PFP DFP YPTK+QFIQYLE YA +F I PRFN
Sbjct  69   CELPFMPFPNDFPTYPTKQQFIQYLEDYATKFDIRPRFN  107



>emb|CDY14900.1| BnaA02g22420D [Brassica napus]
Length=388

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+++P+YPTKRQFI YLESYA RF ISP+FN
Sbjct  78   CQLPKMPFPENYPDYPTKRQFIDYLESYATRFDISPQFN  116



>ref|XP_009101756.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Brassica 
rapa]
Length=426

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ +PEYPTKRQFI YLESYA RF I+P+FN
Sbjct  78   CQLPKMPFPESYPEYPTKRQFIDYLESYATRFNINPQFN  116



>ref|XP_010526480.1| PREDICTED: LOW QUALITY PROTEIN: probable indole-3-pyruvate monooxygenase 
YUCCA8 [Tarenaya hassleriana]
Length=419

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEY TKRQFIQYLESYA+ F I+P+FN
Sbjct  77   CQLPKMPFPEDFPEYLTKRQFIQYLESYAKHFDINPKFN  115



>ref|XP_006420425.1| hypothetical protein CICLE_v10006828mg [Citrus clementina]
 gb|ESR33665.1| hypothetical protein CICLE_v10006828mg [Citrus clementina]
Length=421

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA++F I+PRFN
Sbjct  75   CQLPNFPFPEDFPEYPTKYQFITYLESYAKQFDINPRFN  113



>ref|XP_009143881.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA7 [Brassica 
rapa]
Length=436

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYPTK QFIQYLESYA  F I P+FN
Sbjct  90   CQLPNLPFPDDFPEYPTKYQFIQYLESYATHFDIQPKFN  128



>emb|CDY19472.1| BnaC04g11270D [Brassica napus]
Length=436

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYPTK QFIQYLESYA  F I P+FN
Sbjct  90   CQLPNLPFPDDFPEYPTKYQFIQYLESYATHFDIQPKFN  128



>ref|XP_002311709.1| flavin-containing monooxygenase family protein [Populus trichocarpa]
 gb|EEE89076.1| flavin-containing monooxygenase family protein [Populus trichocarpa]
Length=421

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA+ F I+P FN
Sbjct  75   CQLPSFPFPEDFPEYPTKYQFINYLESYAKHFNINPHFN  113



>ref|XP_010483250.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Camelina 
sativa]
Length=421

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP ++PEYPTKRQFI YLESYA RF+I P FN
Sbjct  78   CQLPKMPFPDNYPEYPTKRQFIDYLESYANRFEIKPEFN  116



>ref|XP_010542972.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA7 [Tarenaya 
hassleriana]
Length=441

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFIQYLESYA  F I P+FN
Sbjct  94   CQLPNLPFPEDFPEYPTKYQFIQYLESYANHFDIHPKFN  132



>gb|KHG02091.1| Flavin-containing monooxygenase YUCCA8 -like protein [Gossypium 
arboreum]
Length=425

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPT++QFI+YLESYA+ F I+P+FN
Sbjct  79   CQLPKLPFPEDFPEYPTRKQFIEYLESYAKHFDINPKFN  117



>ref|XP_006412918.1| hypothetical protein EUTSA_v10025272mg [Eutrema salsugineum]
 gb|ESQ54371.1| hypothetical protein EUTSA_v10025272mg [Eutrema salsugineum]
Length=427

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYP+KR+FI YLESYA RF+I+P+FN
Sbjct  78   CQLPKMPFPESFPEYPSKREFIDYLESYASRFEINPKFN  116



>ref|XP_006350286.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5-like 
[Solanum tuberosum]
Length=415

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYP+KRQFI+YLESYA +F +SP+FN
Sbjct  73   CQLPKFPFPEHYPEYPSKRQFIEYLESYARKFDLSPQFN  111



>gb|AHC98648.1| flavin-containing monooxygenase YUCCA3-like protein, partial 
[Coffea canephora]
Length=157

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LPYFPFP +FPEYPTK QFI YLESYA+ F+I+PRFN
Sbjct  48   CQLPYFPFPDNFPEYPTKVQFIDYLESYAKHFEITPRFN  86



>ref|XP_006418157.1| hypothetical protein EUTSA_v10009484mg [Eutrema salsugineum]
 gb|ESQ36510.1| hypothetical protein EUTSA_v10009484mg [Eutrema salsugineum]
Length=424

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA RF+I P FN
Sbjct  78   CQLPKMPFPDHYPEYPTKRQFIDYLESYANRFEIKPEFN  116



>gb|KHN06601.1| Flavin-containing monooxygenase YUCCA6 [Glycine soja]
Length=415

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP   FP DFP YPTK+QFI+YLESYAERF I PRFN
Sbjct  74   CELPLMGFPCDFPTYPTKQQFIEYLESYAERFHIRPRFN  112



>ref|XP_004240470.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Solanum 
lycopersicum]
 gb|ACX33888.1| flavin monooxygenase-like protein [Solanum lycopersicum]
Length=411

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYPTK+QFI YLESYA+RF I+P FN
Sbjct  75   CQLPKFPFPQHYPEYPTKKQFIDYLESYAKRFDINPMFN  113



>ref|XP_002874274.1| hypothetical protein ARALYDRAFT_910627 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50533.1| hypothetical protein ARALYDRAFT_910627 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P FN
Sbjct  85   CELPILPFPADFPTYPTKQQFIEYLEDYARRFDIKPEFN  123



>ref|XP_009767954.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Nicotiana 
sylvestris]
Length=413

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYPTKRQFI YLESYA++F + P+FN
Sbjct  73   CQLPNFPFPEHYPEYPTKRQFIDYLESYAKKFDLKPQFN  111



>ref|XP_008447351.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Cucumis 
melo]
Length=410

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP++FPEYP+K+QF+QYL+SYA++F I+P+FN
Sbjct  75   CQLPRLPFPQEFPEYPSKKQFVQYLQSYAQKFDINPQFN  113



>ref|XP_009629512.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Nicotiana 
tomentosiformis]
Length=415

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYPTK+QFI+YLESYA +F I+PRFN
Sbjct  73   CQLPKFPFPQHYPEYPTKKQFIEYLESYARKFNINPRFN  111



>ref|NP_001190399.1| flavin-containing monooxygenase YUCCA6 [Arabidopsis thaliana]
 gb|AED93474.1| flavin-containing monooxygenase YUCCA6 [Arabidopsis thaliana]
Length=426

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P FN
Sbjct  77   CELPIIPFPGDFPTYPTKQQFIEYLEDYARRFDIKPEFN  115



>gb|EMT15352.1| Putative oxidoreductase czcO-like protein [Aegilops tauschii]
Length=387

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP+ +PEYPT+RQFI YLESYA RF I P FN
Sbjct  72   CELPRMPFPESYPEYPTRRQFIDYLESYAARFDIKPEFN  110



>ref|XP_009622501.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Nicotiana 
tomentosiformis]
Length=413

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYPTKRQFI YLESYA++F + P+FN
Sbjct  73   CQLPNFPFPEHYPEYPTKRQFIDYLESYAKKFDLKPQFN  111



>ref|XP_009385858.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Musa 
acuminata subsp. malaccensis]
Length=419

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYPT+ QFI YLESYA  F++SPRFN
Sbjct  71   CQLPKLPFPDDFPEYPTRNQFIGYLESYAAHFELSPRFN  109



>ref|XP_003544664.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like [Glycine 
max]
Length=436

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP   FP DFP YPTK+QFI+YLESYAERF I PRFN
Sbjct  95   CELPLMGFPCDFPTYPTKQQFIEYLESYAERFHIRPRFN  133



>ref|XP_010457452.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Camelina 
sativa]
Length=421

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA RF+I P FN
Sbjct  78   CQLPKMPFPDHYPEYPTKRQFIDYLESYANRFEIKPEFN  116



>ref|XP_006307620.1| hypothetical protein CARUB_v10009248mg [Capsella rubella]
 gb|EOA40518.1| hypothetical protein CARUB_v10009248mg [Capsella rubella]
Length=421

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA RF+I P FN
Sbjct  78   CQLPKMPFPDHYPEYPTKRQFIDYLESYANRFEIKPEFN  116



>ref|XP_009771853.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Nicotiana 
sylvestris]
Length=415

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYPTK+QFI+YLESYA +F I+PRFN
Sbjct  73   CQLPKFPFPQHYPEYPTKKQFIEYLESYARKFNINPRFN  111



>ref|XP_007034552.1| Yucca 3 [Theobroma cacao]
 gb|EOY05478.1| Yucca 3 [Theobroma cacao]
Length=430

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA++F I+P FN
Sbjct  84   CQLPNFPFPEDFPEYPTKNQFINYLESYAKQFDINPHFN  122



>ref|XP_002889495.1| flavin-containing monooxygenase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65754.1| flavin-containing monooxygenase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=421

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA RF+I P FN
Sbjct  78   CQLPTMPFPDHYPEYPTKRQFIDYLESYANRFEIKPEFN  116



>ref|NP_197944.2| flavin-containing monooxygenase YUCCA6 [Arabidopsis thaliana]
 sp|Q8VZ59.1|YUC6_ARATH RecName: Full=Indole-3-pyruvate monooxygenase YUCCA6; AltName: 
Full=Flavin-containing monooxygenase YUCCA6; AltName: Full=Protein 
HYPERTALL1 [Arabidopsis thaliana]
 gb|AAL38705.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44899.1| unknown protein [Arabidopsis thaliana]
 gb|AED93473.1| flavin-containing monooxygenase YUCCA6 [Arabidopsis thaliana]
Length=417

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P FN
Sbjct  85   CELPIIPFPGDFPTYPTKQQFIEYLEDYARRFDIKPEFN  123



>ref|XP_006410463.1| hypothetical protein EUTSA_v10017688mg [Eutrema salsugineum]
 gb|ESQ51916.1| hypothetical protein EUTSA_v10017688mg [Eutrema salsugineum]
Length=433

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFI+YLESYA  F I+P+FN
Sbjct  87   CQLPNLPFPEDFPEYPTKYQFIEYLESYASHFGINPKFN  125



>ref|XP_004170806.1| PREDICTED: LOW QUALITY PROTEIN: flavin-containing monooxygenase 
YUCCA8-like [Cucumis sativus]
Length=419

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP++FPEYP+K+QFIQYL+SY ++F I+P+FN
Sbjct  75   CQLPRLPFPQEFPEYPSKKQFIQYLQSYTQKFDINPQFN  113



>ref|XP_011029710.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA7 [Populus 
euphratica]
Length=431

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA+ F I+P FN
Sbjct  85   CQLPNFPFPEDFPEYPTKYQFINYLESYAKHFDINPHFN  123



>gb|KFK42760.1| hypothetical protein AALP_AA1G036000 [Arabis alpina]
Length=421

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI+YLESYA RF I P FN
Sbjct  78   CQLPKMPFPDHYPEYPTKRQFIEYLESYANRFDIKPEFN  116



>ref|XP_010475064.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Camelina 
sativa]
Length=421

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA RF+I P FN
Sbjct  78   CQLPKMPFPDHYPEYPTKRQFIDYLESYANRFEIKPEFN  116



>ref|XP_010936109.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Elaeis 
guineensis]
Length=422

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYPTK+QF+ YLESYA+ F+++P+FN
Sbjct  74   CQLPKLPFPDDFPEYPTKKQFMDYLESYAKIFELNPQFN  112



>emb|CDY17153.1| BnaA05g10350D [Brassica napus]
Length=436

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYPTK QFIQYLESYA  F I P+FN
Sbjct  90   CQLPNLPFPDDFPEYPTKYQFIQYLESYATHFDIQPKFN  128



>ref|XP_010069688.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8 [Eucalyptus 
grandis]
 gb|KCW58108.1| hypothetical protein EUGRSUZ_H00831 [Eucalyptus grandis]
Length=422

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFI YLE+YA RF I+P+FN
Sbjct  77   CQLPKLPFPEDFPEYPTKSQFIGYLEAYARRFDINPQFN  115



>ref|XP_006287768.1| hypothetical protein CARUB_v10000978mg, partial [Capsella rubella]
 gb|EOA20666.1| hypothetical protein CARUB_v10000978mg, partial [Capsella rubella]
Length=439

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P FN
Sbjct  107  CELPIIPFPADFPTYPTKQQFIEYLEDYARRFDIKPEFN  145



>ref|XP_006295706.1| hypothetical protein CARUB_v10024824mg [Capsella rubella]
 gb|EOA28604.1| hypothetical protein CARUB_v10024824mg [Capsella rubella]
Length=431

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFI+YLESYA  F I P+FN
Sbjct  85   CQLPNLPFPEDFPEYPTKYQFIEYLESYATHFDIRPKFN  123



>ref|XP_010419690.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA4 isoform 
X2 [Camelina sativa]
Length=392

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFPK+FP+YP+K+QFI Y+ESYA RF I P FN
Sbjct  70   CELPLMPFPKNFPKYPSKQQFISYVESYAARFNIKPVFN  108



>ref|XP_009618244.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Nicotiana 
tomentosiformis]
Length=413

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP  +PEYPTKRQFI YLESYA+ F I P+FN
Sbjct  73   CQLPKFPFPNHYPEYPTKRQFIDYLESYAQHFDIKPQFN  111



>emb|CDY14230.1| BnaA08g13610D [Brassica napus]
Length=397

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTKRQFI YLESYA R  ISP+ N
Sbjct  80   CQLPKMPFPESFPEYPTKRQFIDYLESYASRLHISPQLN  118



>ref|XP_008804753.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Phoenix 
dactylifera]
Length=384

 Score = 70.1 bits (170),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYP+K+QFI YLESYA+ F I+PRFN
Sbjct  71   CQLPKLPFPEDYPEYPSKKQFIDYLESYAKHFDINPRFN  109



>ref|XP_009383126.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Musa 
acuminata subsp. malaccensis]
Length=419

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYP+K QF+ YLESYA  FQ++P+F+
Sbjct  71   CQLPKLPFPEDFPEYPSKNQFVDYLESYAAHFQLNPQFD  109



>ref|NP_171914.1| flavin-containing monooxygenase YUCCA9 [Arabidopsis thaliana]
 sp|O64489.1|YUC9_ARATH RecName: Full=Probable indole-3-pyruvate monooxygenase YUCCA9; 
AltName: Full=Flavin-containing monooxygenase YUCCA9 [Arabidopsis 
thaliana]
 gb|AAC16744.1| Contains similarity to myosin IB heavy chain gb|X70400 from Gallus 
gallus [Arabidopsis thaliana]
 gb|AEE27667.1| flavin-containing monooxygenase YUCCA9 [Arabidopsis thaliana]
Length=421

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA RF I P FN
Sbjct  78   CQLPKMPFPDHYPEYPTKRQFIDYLESYANRFDIKPEFN  116



>ref|XP_008789578.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Phoenix 
dactylifera]
Length=424

 Score = 70.1 bits (170),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYP+K+QF+ YLESYA+ F+++P+FN
Sbjct  74   CQLPKLPFPDDFPEYPSKKQFVDYLESYAKIFELNPQFN  112



>gb|KDP33364.1| hypothetical protein JCGZ_12913 [Jatropha curcas]
Length=421

 Score = 70.1 bits (170),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA+ + I+P+FN
Sbjct  74   CQLPNFPFPEDFPEYPTKYQFISYLESYAKHYDITPQFN  112



>ref|XP_006303679.1| hypothetical protein CARUB_v10011757mg [Capsella rubella]
 gb|EOA36577.1| hypothetical protein CARUB_v10011757mg [Capsella rubella]
Length=436

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP +PFP +FPEYPTK QFIQYLE+YA  F ISP+FN
Sbjct  89   CQLPNYPFPDEFPEYPTKFQFIQYLEAYAANFDISPKFN  127



>ref|XP_009119273.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Brassica 
rapa]
 emb|CDX89807.1| BnaA10g02750D [Brassica napus]
Length=436

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+D+PEYPTK QFIQYLE YA  F I+P++N
Sbjct  89   CQLPNFPFPEDYPEYPTKFQFIQYLEEYATHFDINPKYN  127



>emb|CDY61147.1| BnaC05g49050D [Brassica napus]
Length=436

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+D+PEYPTK QFIQYLE YA  F I+P++N
Sbjct  89   CQLPNFPFPEDYPEYPTKFQFIQYLEEYATHFDINPKYN  127



>ref|XP_004242376.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Solanum 
lycopersicum]
 gb|ACX33889.1| flavin monooxygenase-like protein [Solanum lycopersicum]
Length=416

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP  FPEYPTKRQFI+YLE YA+ F I+P+FN
Sbjct  74   CQLPKFPFPNHFPEYPTKRQFIEYLELYAKHFDINPQFN  112



>ref|XP_002881269.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57528.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=431

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFI+YLESYA  F + P+FN
Sbjct  85   CQLPNLPFPEDFPEYPTKYQFIEYLESYATHFDLRPKFN  123



>ref|XP_009343403.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Pyrus 
x bretschneideri]
Length=426

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFI YLESYA  F ISP FN
Sbjct  76   CQLPNLPFPEDFPEYPTKDQFISYLESYANHFYISPNFN  114



>ref|XP_010933164.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Elaeis 
guineensis]
Length=412

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP+ +PEYP+K+QFI+YLESYA  F I PRFN
Sbjct  71   CELPKLPFPEGYPEYPSKKQFIEYLESYATHFDIKPRFN  109



>ref|XP_011089305.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6 [Sesamum indicum]
Length=410

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+  FP+DFP YPTK+QFIQYLE YA+RF+I P FN
Sbjct  69   CELPHMSFPQDFPTYPTKQQFIQYLEDYAKRFEIKPVFN  107



>ref|XP_010509914.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA7 [Camelina 
sativa]
Length=431

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFI+YLESYA  F + P+FN
Sbjct  85   CQLPNLPFPEDFPEYPTKYQFIEYLESYATHFDLRPKFN  123



>ref|XP_009384175.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYP+K QFI YLESYA  FQ++P+F+
Sbjct  74   CQLPKLPFPDDFPEYPSKNQFIDYLESYARHFQLNPQFD  112



>ref|XP_004152071.1| PREDICTED: flavin-containing monooxygenase YUCCA8-like [Cucumis 
sativus]
 gb|KGN58322.1| hypothetical protein Csa_3G619930 [Cucumis sativus]
Length=418

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP++FPEYP+K+QFIQYL+SY ++F I+P+FN
Sbjct  75   CQLPRLPFPQEFPEYPSKKQFIQYLQSYTQKFDINPQFN  113



>ref|NP_171955.1| flavin-containing monooxygenase YUCCA3 [Arabidopsis thaliana]
 sp|O23024.1|YUC3_ARATH RecName: Full=Probable indole-3-pyruvate monooxygenase YUCCA3; 
AltName: Full=Flavin-containing monooxygenase YUCCA3 [Arabidopsis 
thaliana]
 gb|AAB80641.1| Contains similarity to human dimethylaniline monooxygenase (gb|M64082) 
[Arabidopsis thaliana]
 gb|AAL23752.1| flavin-containing monooxygenase YUCCA3 [Arabidopsis thaliana]
 gb|AAR92277.1| At1g04610 [Arabidopsis thaliana]
 gb|AAS99690.1| At1g04610 [Arabidopsis thaliana]
 dbj|BAF00666.1| putative dimethylaniline monooxygenase [Arabidopsis thaliana]
 gb|AEE27721.1| flavin-containing monooxygenase YUCCA3 [Arabidopsis thaliana]
Length=437

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP +PFP +FPEYPTK QFIQYLESYA  F I+P+FN
Sbjct  90   CQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFN  128



>ref|XP_004493850.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8-like 
[Cicer arietinum]
Length=415

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP DFPEYP+K+QFI YLE+YA +F+I+P+FN
Sbjct  77   CQLPNLPFPDDFPEYPSKKQFINYLETYANKFEINPQFN  115



>ref|XP_010519914.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6 [Tarenaya hassleriana]
Length=442

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            CELP  PFP DFP YPTK+QFI+YLE YA RF I PRF
Sbjct  103  CELPLMPFPADFPTYPTKQQFIEYLEEYARRFDIRPRF  140



>ref|XP_002889517.1| flavin-containing monooxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65776.1| flavin-containing monooxygenase [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP +PFP +FPEYPTK QFIQYLESYA  F I+P+FN
Sbjct  90   CQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFN  128



>ref|XP_009796775.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Nicotiana 
sylvestris]
Length=413

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP  +PEYPTKRQFI YLESYA  F I P+FN
Sbjct  73   CQLPKFPFPNHYPEYPTKRQFIDYLESYANHFDIKPQFN  111



>ref|XP_004247118.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Solanum 
lycopersicum]
Length=415

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYP+KRQFI+YLESYA++F ++P+FN
Sbjct  73   CQLPKFPFPEHYPEYPSKRQFIEYLESYAKQFDLTPQFN  111



>emb|CDY53200.1| BnaAnng12250D [Brassica napus]
Length=430

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+D+PEYPTK QFIQYLE YA  F I+P++N
Sbjct  89   CQLPNFPFPEDYPEYPTKFQFIQYLEDYATHFDINPKYN  127



>gb|AIN44209.1| YUCCA2 [Rosa hybrid cultivar]
Length=440

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK QFI YLE YA +F I PRFN
Sbjct  95   CELPLLPFPADFPTYPTKEQFIHYLEDYATKFDIQPRFN  133



>ref|XP_010413899.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA7 [Camelina 
sativa]
Length=431

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFI+YLESYA  F + P+FN
Sbjct  85   CQLPNLPFPEDFPEYPTKFQFIEYLESYATHFDLRPKFN  123



>ref|NP_001267010.1| flavin-containing monooxygenase YUCCA6-like [Fragaria vesca]
 gb|ADZ36700.1| YUC6 [Fragaria vesca]
Length=435

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+ PFP DFP YPTK+QFI+YL+ YA +F I PRFN
Sbjct  90   CELPFVPFPSDFPTYPTKQQFIRYLDDYATKFDIQPRFN  128



>emb|CDP03336.1| unnamed protein product [Coffea canephora]
Length=403

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFPKDFP YPTK+QFI YLESYA+ F + P +N
Sbjct  68   CELPLLPFPKDFPTYPTKQQFISYLESYAKHFDLEPAYN  106



>ref|XP_010918863.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Elaeis 
guineensis]
Length=422

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D+PEYP+K +FI+YLESYA+ F I+PRFN
Sbjct  74   CQLPKLPFPEDYPEYPSKEEFIRYLESYAKHFNINPRFN  112



>emb|CDY18209.1| BnaC05g02320D [Brassica napus]
Length=422

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA +F+I P FN
Sbjct  78   CQLPKMPFPDHYPEYPTKRQFIDYLESYANKFEIKPEFN  116



>ref|XP_009118628.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Brassica 
rapa]
Length=436

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+D+PEYPTK QFIQYLE YA  F I+P++N
Sbjct  89   CQLPNFPFPEDYPEYPTKFQFIQYLEDYATHFDINPKYN  127



>ref|XP_010501315.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Camelina 
sativa]
Length=398

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP +PFP +FPEYPTK QFIQYLE+YA  F I+P+FN
Sbjct  89   CQLPNYPFPDEFPEYPTKFQFIQYLEAYAANFDINPKFN  127



>ref|XP_010475123.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Camelina 
sativa]
Length=436

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP +PFP +FPEYPTK QFIQYLE YA  F ISP+FN
Sbjct  89   CQLPNYPFPDEFPEYPTKFQFIQYLEDYAANFDISPKFN  127



>ref|XP_009118662.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Brassica 
rapa]
Length=422

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA  F+I P FN
Sbjct  79   CQLPKMPFPDHYPEYPTKRQFIDYLESYASHFKIKPEFN  117



>ref|XP_010111561.1| Flavin-containing monooxygenase YUCCA3 [Morus notabilis]
 gb|EXC31268.1| Flavin-containing monooxygenase YUCCA3 [Morus notabilis]
Length=432

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP++FPEYPTK QFI YLESYA+ F I+P FN
Sbjct  88   CQLPGFPFPENFPEYPTKYQFIDYLESYAKHFDINPLFN  126



>ref|XP_010112168.1| Flavin-containing monooxygenase YUCCA6 [Morus notabilis]
 gb|EXC32793.1| Flavin-containing monooxygenase YUCCA6 [Morus notabilis]
Length=430

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+  FP DFP+YPTK QF+QYLE YA  F ISPRFN
Sbjct  72   CELPFMGFPADFPKYPTKSQFVQYLEDYAAEFGISPRFN  110



>ref|XP_006418109.1| hypothetical protein EUTSA_v10010013mg [Eutrema salsugineum]
 gb|ESQ36462.1| hypothetical protein EUTSA_v10010013mg [Eutrema salsugineum]
Length=436

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+D+PEYPTK QFIQYLE YA  F I+P++N
Sbjct  89   CQLPNFPFPEDYPEYPTKFQFIQYLEDYATNFDINPKYN  127



>gb|AFG16914.1| YUC1 [Fragaria x ananassa]
Length=435

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+ PFP DFP YPTK+QFI+YL+ YA +F I PRFN
Sbjct  90   CELPFVPFPSDFPTYPTKQQFIRYLDDYATKFDIQPRFN  128



>ref|XP_007144428.1| hypothetical protein PHAVU_007G155200g [Phaseolus vulgaris]
 gb|ESW16422.1| hypothetical protein PHAVU_007G155200g [Phaseolus vulgaris]
Length=418

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ FP+YP+K QFI YL+SYA  F I+PRFN
Sbjct  77   CQLPNFPFPQHFPQYPSKNQFIDYLQSYARHFDINPRFN  115



>ref|XP_007144427.1| hypothetical protein PHAVU_007G155100g [Phaseolus vulgaris]
 gb|ESW16421.1| hypothetical protein PHAVU_007G155100g [Phaseolus vulgaris]
Length=418

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ FP+YP+K QFI YL+SYA  F I+PRFN
Sbjct  77   CQLPNFPFPQHFPQYPSKNQFIDYLQSYARHFDINPRFN  115



>emb|CDY32533.1| BnaA09g50630D [Brassica napus]
Length=422

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA  F+I P FN
Sbjct  79   CQLPKMPFPDHYPEYPTKRQFIDYLESYASHFKIKPEFN  117



>tpg|DAA39727.1| TPA: disulfide oxidoreductase/ monooxygenase/ oxidoreductase 
[Zea mays]
Length=398

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP  +PEYPTKRQF++YL++YA+R  + PRFN
Sbjct  67   CELPGMPFPAHYPEYPTKRQFVEYLQAYADRAGVEPRFN  105



>ref|XP_010684810.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Beta 
vulgaris subsp. vulgaris]
Length=420

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+ FPEYPTK+QFI YLESYA+ F+I+P FN
Sbjct  80   CQLPKMPFPESFPEYPTKKQFINYLESYAKHFEINPHFN  118



>emb|CDY69333.1| BnaCnng63040D [Brassica napus]
Length=417

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP   FP+++P+YPTKRQFI YLESYA RF ISP+FN
Sbjct  78   CQLPNMSFPENYPDYPTKRQFIDYLESYATRFDISPQFN  116



>gb|KFK42802.1| hypothetical protein AALP_AA1G040600 [Arabis alpina]
Length=437

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+D+PEYPTK QFIQYLE YA  F I+P++N
Sbjct  90   CQLPNFPFPEDYPEYPTKFQFIQYLEDYATNFDINPKYN  128



>ref|NP_001148256.1| disulfide oxidoreductase/ monooxygenase/ oxidoreductase [Zea 
mays]
 gb|ACG30322.1| disulfide oxidoreductase/ monooxygenase/ oxidoreductase [Zea 
mays]
Length=402

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP  +PEYPTKRQF++YL++YA+R  + PRFN
Sbjct  67   CELPGMPFPAHYPEYPTKRQFVEYLQAYADRAGVEPRFN  105



>emb|CDY62422.1| BnaA06g39380D [Brassica napus]
Length=442

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P F
Sbjct  88   CELPLMPFPADFPTYPTKQQFIEYLEDYARRFDIRPEF  125



>ref|XP_003555725.2| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3-like 
[Glycine max]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFPEYPTK QFI YLESYA+ F I+P+FN
Sbjct  84   CQLPNVPFPEDFPEYPTKFQFISYLESYAKHFSIAPQFN  122



>ref|XP_009151094.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6 [Brassica rapa]
Length=438

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P F
Sbjct  88   CELPLMPFPADFPTYPTKQQFIEYLEDYARRFDIRPEF  125



>ref|XP_010493826.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6 isoform X2 
[Camelina sativa]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA  F I P FN
Sbjct  90   CELPIIPFPADFPTYPTKQQFIEYLEDYARSFDIKPEFN  128



>ref|XP_010454909.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like isoform 
X2 [Camelina sativa]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA  F I P FN
Sbjct  90   CELPIIPFPADFPTYPTKQQFIEYLEDYARSFDIKPEFN  128



>emb|CDY10073.1| BnaC08g43780D [Brassica napus]
Length=421

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA  F+I P FN
Sbjct  78   CQLPKMPFPDHYPEYPTKRQFIDYLESYASHFKIKPEFN  116



>ref|XP_010493825.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6 isoform X1 
[Camelina sativa]
Length=422

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA  F I P FN
Sbjct  90   CELPIIPFPADFPTYPTKQQFIEYLEDYARSFDIKPEFN  128



>gb|KFK31070.1| hypothetical protein AALP_AA6G064400 [Arabis alpina]
Length=408

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+DFP+YPTK QFI+YLESYA  F I P+FN
Sbjct  86   CQLPNLPFPEDFPKYPTKYQFIEYLESYATYFDIQPKFN  124



>gb|KHN10236.1| Flavin-containing monooxygenase YUCCA6 [Glycine soja]
Length=422

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+  FP  FP YP+K+QF+QYLE+YAERF I PRFN
Sbjct  80   CELPFMGFPSHFPTYPSKQQFVQYLENYAERFGIRPRFN  118



>ref|XP_006352723.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5-like 
[Solanum tuberosum]
Length=416

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP  FPEYPTKRQFI+YLE YA+ F I+P+FN
Sbjct  74   CQLPKFPFPNHFPEYPTKRQFIEYLELYAKHFDINPQFN  112



>ref|XP_010454908.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like isoform 
X1 [Camelina sativa]
Length=422

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA  F I P FN
Sbjct  90   CELPIIPFPADFPTYPTKQQFIEYLEDYARSFDIKPEFN  128



>gb|EPS72220.1| hypothetical protein M569_02528 [Genlisea aurea]
Length=417

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP   FP D+PEYP+KRQF+QYLE+YA  F I+P FN
Sbjct  75   CQLPQLDFPADYPEYPSKRQFVQYLEAYARNFDINPHFN  113



>ref|XP_010421426.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like isoform 
X3 [Camelina sativa]
Length=439

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA  F I P FN
Sbjct  90   CELPIIPFPADFPTYPTKQQFIEYLEDYARSFDIKPEFN  128



>ref|XP_010457515.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Camelina 
sativa]
Length=436

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP +PFP +FPEYPTK QFIQYLE+YA  F I+P+FN
Sbjct  89   CQLPNYPFPDEFPEYPTKFQFIQYLEAYAANFDINPKFN  127



>ref|XP_010421424.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like isoform 
X1 [Camelina sativa]
 ref|XP_010421425.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like isoform 
X2 [Camelina sativa]
Length=422

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLE YA  F I P FN
Sbjct  90   CELPIIPFPADFPTYPTKQQFIEYLEDYARSFDIKPEFN  128



>ref|XP_007137165.1| hypothetical protein PHAVU_009G105400g [Phaseolus vulgaris]
 gb|ESW09159.1| hypothetical protein PHAVU_009G105400g [Phaseolus vulgaris]
Length=429

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+ PFP  FP YP+K+QF++YLE+YA+RF+I P FN
Sbjct  87   CELPFMPFPSHFPTYPSKQQFVEYLETYAQRFKIKPSFN  125



>ref|XP_004501192.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like [Cicer 
arietinum]
Length=434

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+  FP DFP YP+K+QFI+YLE+YAERF I P+FN
Sbjct  102  CELPFMEFPFDFPTYPSKQQFIKYLENYAERFSIRPKFN  140



>ref|XP_009367925.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like [Pyrus 
x bretschneideri]
Length=459

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+ PFP DFP YPTK+QFIQYLE YA ++ I P+FN
Sbjct  111  CELPFMPFPNDFPTYPTKQQFIQYLEDYATKYDIRPQFN  149



>ref|XP_009338719.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like [Pyrus 
x bretschneideri]
Length=461

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+ PFP DFP YPTK+QFIQYLE YA ++ I P+FN
Sbjct  113  CELPFMPFPNDFPTYPTKQQFIQYLEDYATKYDIRPQFN  151



>gb|EPS72404.1| hypothetical protein M569_02353, partial [Genlisea aurea]
Length=394

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELPY  FP +FP+YPT+ QF+ YLESYAERF+I P FN
Sbjct  70   CELPYMGFPAEFPDYPTRSQFVGYLESYAERFEIRPIFN  108



>ref|XP_007145436.1| hypothetical protein PHAVU_007G238900g [Phaseolus vulgaris]
 gb|ESW17430.1| hypothetical protein PHAVU_007G238900g [Phaseolus vulgaris]
Length=433

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLE YA+ F I+P+FN
Sbjct  84   CQLPNFPFPEDFPEYPTKFQFISYLELYAKHFNIAPQFN  122



>ref|XP_010491852.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA4 [Camelina 
sativa]
Length=411

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFPK+FP+YP+K+QFI Y+ESYA RF I P FN
Sbjct  70   CELPLMPFPKNFPKYPSKQQFISYVESYAARFNIKPVFN  108



>gb|AFW57823.1| disulfide oxidoreductase/ monooxygenase/ oxidoreductase [Zea 
mays]
Length=422

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP  +PEYPT+RQFI YLE YA RF+I P F+
Sbjct  76   CELPRMPFPDHYPEYPTRRQFIDYLEDYAARFEIRPEFS  114



>ref|NP_001147961.1| disulfide oxidoreductase/ monooxygenase/ oxidoreductase [Zea 
mays]
 gb|ACG29248.1| disulfide oxidoreductase/ monooxygenase/ oxidoreductase [Zea 
mays]
Length=424

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP  +PEYPT+RQFI YLE YA RF+I P F+
Sbjct  76   CELPRMPFPDHYPEYPTRRQFIDYLEDYAARFEIRPEFS  114



>ref|XP_010419689.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA4 isoform 
X1 [Camelina sativa]
Length=411

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFPK+FP+YP+K+QFI Y+ESYA RF I P FN
Sbjct  70   CELPLMPFPKNFPKYPSKQQFISYVESYAARFNIKPVFN  108



>ref|XP_006364550.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA8-like 
[Solanum tuberosum]
 gb|AEX15600.1| YUC-like protein 1 [Solanum tuberosum subsp. andigenum]
Length=408

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYPTK+QFI YLESYA +F I+P FN
Sbjct  73   CQLPKFPFPQHYPEYPTKKQFIDYLESYARKFDINPMFN  111



>ref|XP_011083085.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Sesamum 
indicum]
Length=415

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYPTKRQFI+YLESY   F I+P+FN
Sbjct  73   CQLPNFPFPEHYPEYPTKRQFIEYLESYTRHFGINPQFN  111



>gb|KFK27814.1| hypothetical protein AALP_AA8G433400 [Arabis alpina]
Length=432

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P F
Sbjct  95   CELPIVPFPADFPTYPTKQQFIEYLEDYARRFDIKPEF  132



>ref|XP_008438433.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Cucumis 
melo]
Length=431

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP++FP YP+K QFI YLESYA  F I+PRFN
Sbjct  86   CQLPNFPFPEEFPAYPSKFQFISYLESYANHFDITPRFN  124



>ref|XP_003625456.1| Dimethylaniline monooxygenase [Medicago truncatula]
 gb|AES81674.1| indole-3-pyruvate monooxygenase [Medicago truncatula]
Length=416

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  P P+DFPEYP+K+QFI YLE+YA +F+I+P+FN
Sbjct  77   CQLPNLPMPEDFPEYPSKKQFISYLENYANKFEINPQFN  115



>ref|XP_007161550.1| hypothetical protein PHAVU_001G078900g [Phaseolus vulgaris]
 gb|ESW33544.1| hypothetical protein PHAVU_001G078900g [Phaseolus vulgaris]
Length=422

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP   FP +FP YPTK+QFI+YLESYAERF I PRFN
Sbjct  93   CELPLMGFPCEFPTYPTKQQFIEYLESYAERFAIRPRFN  131



>ref|XP_009119327.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Brassica 
rapa]
Length=420

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA +F+I P F+
Sbjct  76   CQLPKMPFPDHYPEYPTKRQFIDYLESYANKFEIKPEFS  114



>gb|EYU46374.1| hypothetical protein MIMGU_mgv1a007103mg [Erythranthe guttata]
Length=419

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+ +PEYP+KRQF++YLESYA  F I+P FN
Sbjct  73   CQLPGFPFPEHYPEYPSKRQFVEYLESYAANFDIAPHFN  111



>emb|CDX89837.1| BnaA10g02450D [Brassica napus]
Length=420

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP  +PEYPTKRQFI YLESYA +F+I P F+
Sbjct  76   CQLPKMPFPDHYPEYPTKRQFIDYLESYANKFEIKPEFS  114



>ref|XP_007137061.1| hypothetical protein PHAVU_009G096500g [Phaseolus vulgaris]
 gb|ESW09055.1| hypothetical protein PHAVU_009G096500g [Phaseolus vulgaris]
Length=408

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP+ PFP  FP+YP+K QFI YL SYA RF I PRFN
Sbjct  73   CQLPFMPFPHHFPKYPSKNQFISYLHSYASRFNIRPRFN  111



>gb|EYU17958.1| hypothetical protein MIMGU_mgv1a026496mg [Erythranthe guttata]
Length=415

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP +PFP  +PEYP+KRQFI+YLESYA  F ISP+FN
Sbjct  73   CQLPEYPFPDHYPEYPSKRQFIEYLESYAANFDISPQFN  111



>ref|XP_008807966.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5 [Phoenix 
dactylifera]
Length=419

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+++PEYP K+QFI YLESYA+ F+I+PRFN
Sbjct  71   CQLPKLPFPEEYPEYPCKQQFIGYLESYAKHFKINPRFN  109



>ref|XP_006394817.1| hypothetical protein EUTSA_v10004282mg [Eutrema salsugineum]
 gb|ESQ32103.1| hypothetical protein EUTSA_v10004282mg [Eutrema salsugineum]
Length=424

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P F
Sbjct  90   CELPLIPFPADFPTYPTKQQFIEYLEDYARRFDIRPEF  127



>ref|XP_008669713.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA9 [Zea 
mays]
 tpg|DAA38697.1| TPA: hypothetical protein ZEAMMB73_974870 [Zea mays]
Length=421

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            C+LP  PFP+D+PEYPT+RQF+ YLE YA  F+I P F
Sbjct  76   CQLPRMPFPEDYPEYPTRRQFVDYLERYAAEFEIKPEF  113



>ref|XP_003522685.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like [Glycine 
max]
Length=437

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+  FP  FP YP+K+QF+QYLE+YAERF I PRFN
Sbjct  95   CELPFMGFPSHFPTYPSKQQFVQYLENYAERFGIRPRFN  133



>gb|EPS64200.1| hypothetical protein M569_10581 [Genlisea aurea]
Length=358

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP D+PEYP++ QFI+YLE YAE F I PRFN
Sbjct  66   CQLPGLPFPADYPEYPSRGQFIRYLEDYAENFGIEPRFN  104



>emb|CDP16149.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP+ FP YPTK+QFIQYLE+YA +F I+P FN
Sbjct  87   CELPLMPFPEGFPTYPTKQQFIQYLEAYARKFDINPCFN  125



>ref|XP_006286661.1| hypothetical protein CARUB_v10002580mg [Capsella rubella]
 gb|EOA19559.1| hypothetical protein CARUB_v10002580mg [Capsella rubella]
Length=412

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFPK+FP+YP+K+QFI Y+ESYA RF I P FN
Sbjct  70   CELPLMPFPKNFPKYPSKQQFISYVESYAARFNIKPVFN  108



>ref|NP_180881.1| flavin monooxygenase YUCCA7 [Arabidopsis thaliana]
 sp|O49312.1|YUC7_ARATH RecName: Full=Probable indole-3-pyruvate monooxygenase YUCCA7; 
AltName: Full=Flavin-containing monooxygenase YUCCA7 [Arabidopsis 
thaliana]
 gb|AAC04900.1| putative flavin-containing monooxygenase [Arabidopsis thaliana]
 gb|AEC08802.1| flavin monooxygenase YUCCA7 [Arabidopsis thaliana]
Length=431

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP  PFP+D PEYPTK QFI+YLESYA  F + P+FN
Sbjct  85   CQLPNLPFPEDIPEYPTKYQFIEYLESYATHFDLRPKFN  123



>ref|XP_004245254.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6 [Solanum lycopersicum]
 gb|ACX33886.1| flavin monooxygenase-like protein [Solanum lycopersicum var. 
cerasiforme]
Length=411

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK+QFI+YLESYA  F I P FN
Sbjct  88   CELPLMPFPHDFPTYPTKQQFIKYLESYAITFNIRPLFN  126



>emb|CDX80530.1| BnaC07g29140D [Brassica napus]
Length=442

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            CELP  PFP DFP YPTK+QFI+YLE YA RF I P F
Sbjct  88   CELPLKPFPADFPTYPTKQQFIEYLEDYARRFDIRPEF  125



>ref|XP_006493990.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3-like 
[Citrus sinensis]
Length=437

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP+DFPEYPTK QFI YLESYA++F I+PRFN
Sbjct  91   CQLPNFPFPEDFPEYPTKYQFITYLESYAKQFDINPRFN  129



>gb|KEH41176.1| indole-3-pyruvate monooxygenase YUCCA8 [Medicago truncatula]
Length=423

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP  FPEYP+K QFI YLESYA+ F I+P FN
Sbjct  77   CQLPNFPFPDHFPEYPSKFQFISYLESYAKNFNITPNFN  115



>ref|XP_004498640.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA4-like 
[Cicer arietinum]
Length=405

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+  FP +FP+YPTK QFI Y+ESYA  F I+PRFN
Sbjct  69   CELPFMNFPTNFPQYPTKHQFISYMESYATHFSITPRFN  107



>ref|XP_002873506.1| hypothetical protein ARALYDRAFT_487963 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49765.1| hypothetical protein ARALYDRAFT_487963 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFPK+FP+YP+K+QFI Y+ESYA RF I P FN
Sbjct  70   CELPLMPFPKNFPKYPSKQQFISYVESYAARFNIKPVFN  108



>emb|CAN60211.1| hypothetical protein VITISV_036965 [Vitis vinifera]
Length=422

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK QF+ YLE+YA+RF I P FN
Sbjct  85   CELPLMPFPPDFPRYPTKHQFLNYLEAYAKRFDIRPFFN  123



>emb|CDY72645.1| BnaAnng41850D [Brassica napus]
Length=342

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  99  PFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
           PFP+ FPEYPTKRQFI YLESYA RF+I+P+FN
Sbjct  2   PFPESFPEYPTKRQFIDYLESYASRFEINPKFN  34



>ref|XP_010249920.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA4 [Nelumbo 
nucifera]
Length=408

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            CELP   FP+DFPEYP+++QFI Y+ESYA RF I PRF
Sbjct  72   CELPLLGFPEDFPEYPSRQQFISYIESYAARFSIKPRF  109



>ref|XP_002281015.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA2 [Vitis vinifera]
Length=422

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP DFP YPTK QF+ YLE+YA+RF I P FN
Sbjct  85   CELPLMPFPPDFPRYPTKHQFLNYLEAYAKRFDIRPFFN  123



>ref|NP_001147849.1| LOC100281459 [Zea mays]
 gb|ACG28890.1| disulfide oxidoreductase/ monooxygenase/ oxidoreductase [Zea 
mays]
 tpg|DAA60418.1| TPA: disulfide oxidoreductase/ monooxygenase/ oxidoreductase 
[Zea mays]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP  +PEYPTKRQF+ YL++YAER  + PRFN
Sbjct  76   CELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFN  114



>ref|XP_008651410.1| PREDICTED: LOC100281459 isoform X1 [Zea mays]
Length=412

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP  +PEYPTKRQF+ YL++YAER  + PRFN
Sbjct  76   CELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFN  114



>ref|XP_010048258.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA4 [Eucalyptus 
grandis]
 gb|KCW80463.1| hypothetical protein EUGRSUZ_C01808 [Eucalyptus grandis]
Length=420

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP   FPK+FP+YPTK+QF+ YLESYA  F+I P FN
Sbjct  81   CELPLLRFPKNFPKYPTKQQFVSYLESYASHFKIEPIFN  119



>ref|XP_007012038.1| Flavin-binding monooxygenase family protein [Theobroma cacao]
 gb|EOY29657.1| Flavin-binding monooxygenase family protein [Theobroma cacao]
Length=419

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP   FP DFP YPTK+QF+ YLE+YA RF I PRFN
Sbjct  88   CELPLMGFPSDFPTYPTKQQFVDYLEAYARRFDIRPRFN  126



>ref|XP_011041485.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA3 [Populus 
euphratica]
Length=432

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP++FPEYPTK QFI YL SYA+ F I+P FN
Sbjct  85   CQLPDFPFPEEFPEYPTKYQFISYLASYAKHFDINPHFN  123



>gb|KDP34220.1| hypothetical protein JCGZ_07791 [Jatropha curcas]
Length=429

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP   FP DFP YPTK+QFI YLE YAE+F I PRFN
Sbjct  87   CQLPLMGFPDDFPTYPTKQQFIDYLEKYAEKFDIRPRFN  125



>ref|XP_008378116.1| PREDICTED: indole-3-pyruvate monooxygenase YUCCA6-like [Malus 
domestica]
Length=448

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP+ PFP DFP YP K+QFIQYLE YA ++ I P+FN
Sbjct  113  CELPFMPFPNDFPTYPIKQQFIQYLEDYATKYDIRPQFN  151



>ref|XP_003523701.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA4-like 
[Glycine max]
Length=403

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP  FP+YP+K QFI YL SYA RF I PRFN
Sbjct  70   CELPLMPFPLHFPKYPSKNQFISYLNSYASRFNIRPRFN  108



>ref|XP_004975027.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA5-like 
[Setaria italica]
Length=420

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            CELP  PFP  +P+YPT+RQFI YLE YA +F+I P FN
Sbjct  76   CELPRMPFPDHYPKYPTRRQFIDYLEDYAAKFEIKPEFN  114



>ref|XP_002314526.2| flavin-containing monooxygenase family protein [Populus trichocarpa]
 gb|EEF00697.2| flavin-containing monooxygenase family protein [Populus trichocarpa]
Length=432

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRFN  1
            C+LP FPFP++FPEYPTK QFI YL SYA+ F I+P FN
Sbjct  85   CQLPDFPFPEEFPEYPTKYQFISYLASYAKHFDINPHFN  123



>ref|XP_006476224.1| PREDICTED: probable indole-3-pyruvate monooxygenase YUCCA4-like 
[Citrus sinensis]
 gb|KDO79594.1| hypothetical protein CISIN_1g037065mg [Citrus sinensis]
Length=412

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  117  CELPYFPFPKDFPEYPTKRQFIQYLESYAERFQISPRF  4
            CELP F FP++FP+YPTKRQFI Y+ESYA  F+I P+F
Sbjct  73   CELPLFGFPENFPKYPTKRQFIAYIESYASHFKIQPKF  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519686539684