BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c67783_g1_i1 len=268 path=[1:0-267]

Length=268
                                                                      Score     E

dbj|BAG72096.1|  Gag-protease-integrase-RT-RNaseH polyprotein           172   2e-47   Glycine max [soybeans]
emb|CAN69553.1|  hypothetical protein VITISV_009018                     165   7e-46   Vitis vinifera
emb|CAN61323.1|  hypothetical protein VITISV_012107                     161   2e-43   Vitis vinifera
emb|CAN76841.1|  hypothetical protein VITISV_004490                     158   1e-42   Vitis vinifera
emb|CAN64190.1|  hypothetical protein VITISV_002428                     154   4e-41   Vitis vinifera
ref|XP_010521850.1|  PREDICTED: protein kinase 2B, chloroplastic-...    142   1e-37   
emb|CAN75287.1|  hypothetical protein VITISV_037638                     129   2e-35   Vitis vinifera
emb|CBI20118.3|  unnamed protein product                                137   5e-35   
ref|XP_009615394.1|  PREDICTED: uncharacterized protein LOC104108115    134   7e-35   
gb|ABW74556.1|  copia-like pol polyprotein                              136   1e-34   Boechera divaricarpa
emb|CAN69396.1|  hypothetical protein VITISV_021034                     133   2e-33   Vitis vinifera
emb|CAN83951.1|  hypothetical protein VITISV_043907                     128   5e-32   Vitis vinifera
emb|CAN69787.1|  hypothetical protein VITISV_018508                     124   3e-30   Vitis vinifera
ref|XP_008237271.1|  PREDICTED: uncharacterized protein LOC103336013    121   9e-30   
gb|AAM18738.1|AC092548_16  putative gag-pol polyprotein                 122   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97882.1|  transposon protein, putative, unclassified              117   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAP53325.2|  retrotransposon protein, putative, Ty1-copia subc...    121   2e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CAN62870.1|  hypothetical protein VITISV_015928                     118   1e-28   Vitis vinifera
gb|EMT12132.1|  Eukaryotic translation initiation factor 3 subunit A    118   3e-28   
emb|CAE04259.3|  OSJNBa0089N06.20                                       117   4e-28   Oryza sativa [red rice]
emb|CAE02960.2|  OSJNBb0050N09.11                                       117   4e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAN79076.1|  hypothetical protein VITISV_007708                     117   4e-28   Vitis vinifera
gb|ABF94883.1|  transposon protein, putative, unclassified              117   4e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03910.2|  OSJNBb0015G09.4                                        117   4e-28   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96044.1|  transposon protein, putative, unclassified              117   4e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAS98437.1|  putative polyprotein                                    117   5e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAT69633.1|  putative polyprotein                                    117   5e-28   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97777.1|  transposon protein, putative, unclassified              117   5e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAN64507.1|  hypothetical protein VITISV_008916                     115   5e-28   Vitis vinifera
emb|CAD40806.1|  OSJNBb0076A22.18                                       117   7e-28   Oryza sativa [red rice]
emb|CAN81838.1|  hypothetical protein VITISV_034340                     117   9e-28   Vitis vinifera
emb|CAN67331.1|  hypothetical protein VITISV_010354                     114   1e-27   Vitis vinifera
gb|ABA94504.1|  transposon protein, putative, unclassified              116   1e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66381.1|  OSIGBa0092E09.8                                        116   2e-27   Oryza sativa [red rice]
ref|XP_008356166.1|  PREDICTED: uncharacterized protein LOC103419855    113   2e-27   
emb|CAH67504.1|  OSIGBa0134H18.6                                        115   2e-27   Oryza sativa [red rice]
emb|CAN80145.1|  hypothetical protein VITISV_015720                     114   3e-27   Vitis vinifera
emb|CAN74164.1|  hypothetical protein VITISV_026444                     114   3e-27   Vitis vinifera
emb|CAN63575.1|  hypothetical protein VITISV_003796                     115   3e-27   Vitis vinifera
gb|ABA94411.1|  transposon protein, putative, unclassified              115   4e-27   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95205.1|  retrotransposon protein, putative, Ty1-copia subc...    114   8e-27   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98016.1|  retrotransposon protein, putative, Ty1-copia subc...    114   8e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AAD12998.1|  pol polyprotein                                         113   1e-26   Zea mays [maize]
emb|CAN82950.1|  hypothetical protein VITISV_032128                     110   1e-26   Vitis vinifera
emb|CAN62131.1|  hypothetical protein VITISV_043715                     113   2e-26   Vitis vinifera
gb|ABA94768.1|  transposon protein, putative, unclassified              112   3e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAD12997.1|  gag-pol polyprotein                                     112   3e-26   Zea mays [maize]
emb|CAN64464.1|  hypothetical protein VITISV_029013                     112   5e-26   Vitis vinifera
emb|CAN63912.1|  hypothetical protein VITISV_044222                     111   5e-26   Vitis vinifera
gb|ABA95153.1|  transposon protein, putative, CACTA, En/Spm sub-c...    112   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009796879.1|  PREDICTED: uncharacterized protein LOC104243397    110   8e-26   
emb|CAN66383.1|  hypothetical protein VITISV_020130                     109   2e-25   Vitis vinifera
ref|XP_007220808.1|  hypothetical protein PRUPE_ppb020817mg             106   3e-25   
ref|XP_009758388.1|  PREDICTED: uncharacterized protein LOC104211087    102   3e-25   
ref|XP_010101641.1|  Retrovirus-related Pol polyprotein from tran...    107   7e-25   
emb|CAN62509.1|  hypothetical protein VITISV_039839                     107   1e-24   Vitis vinifera
emb|CAN69142.1|  hypothetical protein VITISV_039520                     106   1e-24   Vitis vinifera
ref|XP_010656643.1|  PREDICTED: uncharacterized protein LOC104880714    107   1e-24   
ref|XP_008349237.1|  PREDICTED: uncharacterized protein LOC103412461    106   2e-24   
ref|XP_008353440.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    107   2e-24   
emb|CAN69679.1|  hypothetical protein VITISV_006037                     107   2e-24   Vitis vinifera
emb|CAN73613.1|  hypothetical protein VITISV_023299                     107   2e-24   Vitis vinifera
emb|CAN83337.1|  hypothetical protein VITISV_004574                     107   2e-24   Vitis vinifera
emb|CAN61065.1|  hypothetical protein VITISV_004411                     106   3e-24   Vitis vinifera
gb|AHL77759.1|  polyprotein                                             105   1e-23   
emb|CAN71319.1|  hypothetical protein VITISV_032710                     104   1e-23   Vitis vinifera
emb|CAN78069.1|  hypothetical protein VITISV_032701                     105   1e-23   Vitis vinifera
emb|CAN81793.1|  hypothetical protein VITISV_020571                     104   2e-23   Vitis vinifera
emb|CAN64450.1|  hypothetical protein VITISV_023114                     103   2e-23   Vitis vinifera
emb|CAN64073.1|  hypothetical protein VITISV_038270                     104   2e-23   Vitis vinifera
emb|CDF77009.1|  hypothetical transposable element-related protein      103   4e-23   
ref|XP_009587139.1|  PREDICTED: uncharacterized protein LOC104084888  99.8    4e-23   
emb|CAN74511.1|  hypothetical protein VITISV_011891                     103   5e-23   Vitis vinifera
emb|CAN65284.1|  hypothetical protein VITISV_038283                     102   5e-23   Vitis vinifera
emb|CAN83745.1|  hypothetical protein VITISV_025094                     102   9e-23   Vitis vinifera
emb|CAN67821.1|  hypothetical protein VITISV_025855                     101   2e-22   Vitis vinifera
emb|CAN74421.1|  hypothetical protein VITISV_010977                     101   2e-22   Vitis vinifera
emb|CAN61557.1|  hypothetical protein VITISV_035097                   98.2    3e-22   Vitis vinifera
emb|CAN63402.1|  hypothetical protein VITISV_030427                     100   4e-22   Vitis vinifera
emb|CAN72835.1|  hypothetical protein VITISV_027171                     100   4e-22   Vitis vinifera
emb|CAN69408.1|  hypothetical protein VITISV_014748                     100   6e-22   Vitis vinifera
emb|CAN82869.1|  hypothetical protein VITISV_019901                   99.8    8e-22   Vitis vinifera
emb|CAN74363.1|  hypothetical protein VITISV_002579                   99.0    8e-22   Vitis vinifera
ref|XP_008340335.1|  PREDICTED: uncharacterized protein LOC103403295  99.4    9e-22   
emb|CAN69052.1|  hypothetical protein VITISV_007852                   99.4    9e-22   Vitis vinifera
emb|CAN76092.1|  hypothetical protein VITISV_027115                   99.0    1e-21   Vitis vinifera
emb|CAN71183.1|  hypothetical protein VITISV_033416                   98.6    2e-21   Vitis vinifera
gb|ABF95712.1|  retrotransposon protein, putative, Ty1-copia subc...  97.8    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74826.1|  hypothetical protein VITISV_043646                   96.3    3e-21   Vitis vinifera
emb|CAN66083.1|  hypothetical protein VITISV_028833                   97.8    3e-21   Vitis vinifera
emb|CAN75475.1|  hypothetical protein VITISV_006889                   97.8    4e-21   Vitis vinifera
emb|CAN61880.1|  hypothetical protein VITISV_018026                   97.4    5e-21   Vitis vinifera
emb|CAN71426.1|  hypothetical protein VITISV_002521                   97.4    6e-21   Vitis vinifera
emb|CAN83623.1|  hypothetical protein VITISV_010870                   97.4    7e-21   Vitis vinifera
emb|CAN67457.1|  hypothetical protein VITISV_039473                   95.1    1e-20   Vitis vinifera
emb|CAN70156.1|  hypothetical protein VITISV_016168                   95.9    1e-20   Vitis vinifera
emb|CAN78206.1|  hypothetical protein VITISV_023427                   93.2    1e-20   Vitis vinifera
emb|CAN78154.1|  hypothetical protein VITISV_032622                   96.3    1e-20   Vitis vinifera
emb|CAN81238.1|  hypothetical protein VITISV_031073                   96.3    2e-20   Vitis vinifera
emb|CAN83824.1|  hypothetical protein VITISV_040849                   95.1    2e-20   Vitis vinifera
ref|XP_004516035.1|  PREDICTED: uncharacterized protein LOC101492305  95.1    4e-20   
emb|CAN77298.1|  hypothetical protein VITISV_022386                   94.4    4e-20   Vitis vinifera
emb|CAN62045.1|  hypothetical protein VITISV_040357                   94.7    4e-20   Vitis vinifera
emb|CAN72447.1|  hypothetical protein VITISV_027001                   94.4    5e-20   Vitis vinifera
emb|CAN77511.1|  hypothetical protein VITISV_036216                   94.4    6e-20   Vitis vinifera
ref|XP_006603235.1|  PREDICTED: uncharacterized protein LOC100778101  92.4    8e-20   
ref|XP_006603522.1|  PREDICTED: uncharacterized protein LOC102659641  91.3    1e-19   
emb|CAN74042.1|  hypothetical protein VITISV_012948                   92.0    2e-19   Vitis vinifera
ref|XP_006574181.1|  PREDICTED: uncharacterized protein LOC102663039  89.4    3e-19   
emb|CAN81241.1|  hypothetical protein VITISV_031076                   92.0    3e-19   Vitis vinifera
emb|CAN61645.1|  hypothetical protein VITISV_036929                   90.9    8e-19   Vitis vinifera
ref|XP_006606826.1|  PREDICTED: uncharacterized protein LOC100808452  88.2    2e-18   
emb|CAN62491.1|  hypothetical protein VITISV_031832                   89.0    4e-18   Vitis vinifera
emb|CAN71504.1|  hypothetical protein VITISV_021017                   84.0    2e-16   Vitis vinifera
emb|CAN65807.1|  hypothetical protein VITISV_033388                   84.0    2e-16   Vitis vinifera
ref|XP_004295969.1|  PREDICTED: uncharacterized protein LOC101308855  84.0    3e-16   
emb|CAN75957.1|  hypothetical protein VITISV_012562                   83.2    4e-16   Vitis vinifera
emb|CAN64743.1|  hypothetical protein VITISV_006459                   82.0    8e-16   Vitis vinifera
gb|ADJ18449.1|  gag/pol protein                                       81.6    2e-15   
emb|CAN62130.1|  hypothetical protein VITISV_019730                   79.7    2e-15   Vitis vinifera
ref|XP_004980714.1|  PREDICTED: uncharacterized protein LOC101780104  75.9    4e-15   
gb|ABA94675.1|  retrotransposon protein, putative, Ty1-copia subc...  80.1    5e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABN08353.1|  Polynucleotidyl transferase, Ribonuclease H fold      75.1    5e-15   Medicago truncatula
emb|CAN73567.1|  hypothetical protein VITISV_003451                   80.1    5e-15   Vitis vinifera
emb|CAN66637.1|  hypothetical protein VITISV_011340                   80.1    6e-15   Vitis vinifera
ref|XP_006344599.1|  PREDICTED: uncharacterized protein LOC102579723  78.6    2e-14   
gb|EZA50979.1|  Copia protein                                         75.1    2e-14   
gb|ABI34376.1|  Polyprotein, putative                                 76.3    3e-14   Solanum demissum
emb|CAN68929.1|  hypothetical protein VITISV_044375                   77.4    4e-14   Vitis vinifera
ref|XP_010089825.1|  hypothetical protein L484_022341                 72.4    1e-13   
emb|CAE05252.2|  OSJNBb0115I09.14                                     75.5    2e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CAX68207.1|  Copia-like retrotransposon                           75.9    2e-13   
gb|ABA99012.1|  retrotransposon protein, putative, Ty1-copia subc...  73.2    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95851.1|  retrotransposon protein, putative, Ty1-copia subc...  75.1    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|WP_036673399.1|  hypothetical protein                             72.8    3e-13   
emb|CAN75131.1|  hypothetical protein VITISV_024973                   73.9    5e-13   Vitis vinifera
ref|XP_004150929.1|  PREDICTED: uncharacterized protein LOC101213227  73.6    6e-13   
emb|CAN59916.1|  hypothetical protein VITISV_016016                   71.6    7e-13   Vitis vinifera
emb|CAN78764.1|  hypothetical protein VITISV_003317                   73.9    7e-13   Vitis vinifera
emb|CAN68020.1|  hypothetical protein VITISV_003621                   73.9    7e-13   Vitis vinifera
emb|CAN64685.1|  hypothetical protein VITISV_020338                   73.6    9e-13   Vitis vinifera
gb|AAR01713.1|  putative Gag and Pol polyprotein, 3'-partial          70.1    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010099335.1|  hypothetical protein L484_000113                 70.9    1e-12   
emb|CAE04792.1|  OSJNBb0018J12.5                                      73.2    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98797.2|  retrotransposon protein, putative, Ty1-copia subc...  73.2    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAP94586.1|  putative retrotransposon RIRE1 poly protein           72.8    2e-12   Zea mays [maize]
ref|XP_008388960.1|  PREDICTED: DNA polymerase zeta catalytic sub...  73.2    2e-12   
ref|XP_009348351.1|  PREDICTED: uncharacterized protein LOC103939989  72.8    2e-12   
emb|CAN76565.1|  hypothetical protein VITISV_010942                   72.4    2e-12   Vitis vinifera
emb|CAN83369.1|  hypothetical protein VITISV_011463                   72.4    2e-12   Vitis vinifera
emb|CAN65627.1|  hypothetical protein VITISV_032735                   72.4    3e-12   Vitis vinifera
gb|AAN64998.1|  Putative gag-pol polyprotein                          72.0    3e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98935.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006494292.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    4e-12   
gb|AAK12626.1|  unknown protein                                       72.0    4e-12   Aedes aegypti
emb|CAD39988.3|  OSJNBb0045P24.6                                      71.6    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAX92916.1|  retrotransposon protein, putative, Ty1-copia sub-...  71.2    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAS01934.1|  putative Integrase core domain containing protein     71.6    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96953.1|  retrotransposon protein, putative, Ty1-copia subc...  71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03908.2|  OSJNBb0015G09.2                                      71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02325.2|  OSJNBb0112E13.7                                      71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40744.2|  OSJNBa0072D21.4                                      71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97861.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010110117.1|  hypothetical protein L484_003433                 68.6    5e-12   
emb|CAD40198.2|  OSJNBb0043H09.7                                      71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04541.2|  OSJNBa0040D17.9                                      71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97938.1|  retrotransposon protein, putative, Ty1-copia subc...  71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA96419.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03994.1|  OSJNBb0089B03.8                                      71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAR01682.1|  putative gag and pol protein                          71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAU44026.2|  putative polyprotein                                  71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAT58810.1|  putative polyprotein                                  71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAR01716.1|  putative Gag and Pol polyprotein                      71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAK84454.1|AC087192_15  putative polyprotein                       71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAP54573.2|  retrotransposon protein, putative, Ty1-copia subc...  71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAT77367.1|  putative polyprotein                                  71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAN61480.1|  Putative polyprotein from transposon TNT              71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05795.1|  OSJNBb0046K02.5                                      71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98853.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAT69606.1|  putative polyprotein                                  71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAT38001.1|  Putative polyprotein                                  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAK71544.1|AC087852_4  putative polyprotein                        71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96832.1|  retrotransposon protein, putative, Ty1-copia sub-...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03086.1|  OSJNBa0017B10.1                                      71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAH65951.1|  H0716A07.9                                           71.2    6e-12   Oryza sativa [red rice]
gb|ABA98136.2|  retrotransposon protein, putative, Ty1-copia subc...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAP53927.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91250.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA96779.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51974.1|  hypothetical protein OsJ_33644                        70.9    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAV31347.1|  putative polyprotein                                  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAT93941.1|  putative polyprotein                                  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98555.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99751.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAP68369.1|  putative polyprotein, 3'-partial                      70.9    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95768.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93952.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAR87214.1|  retrotransposon protein, putative, Ty1-copia sub-...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98943.1|  retrotransposon protein, putative, unclassified, ...  71.2    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABI34306.1|  Polyprotein, putative                                 71.2    7e-12   Solanum demissum
gb|ABA93737.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97537.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91402.1|  retrotransposon protein, putative, Ty1-copia subc...  71.2    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAT93940.1|  putative polyprotein                                  71.2    7e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010110617.1|  hypothetical protein L484_000603                 67.8    8e-12   
emb|CAE01299.2|  OSJNBa0020P07.16                                     70.9    8e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98465.1|  retrotransposon protein, putative, Ty1-copia subc...  70.9    8e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAK50117.1|AC087797_2  putative gag-pol polyprotein                70.9    8e-12   Oryza sativa [red rice]
gb|AAG03096.2|AC073405_12  putative polyprotein                       70.9    9e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99473.2|  retrotransposon protein, putative, Ty1-copia subc...  70.9    9e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96807.1|  retrotransposon protein, putative, Ty1-copia sub-...  70.5    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007032925.1|  Uncharacterized protein TCM_019054               69.3    9e-12   
gb|ABA98024.2|  retrotransposon protein, putative, Ty1-copia subc...  70.5    1e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03764.2|  OSJNBa0013K16.13                                     70.5    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010087941.1|  Retrovirus-related Pol polyprotein from tran...  69.3    1e-11   
gb|AAT44162.1|  putative polyprotein                                  70.5    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95047.1|  retrotransposon protein, putative, Ty1-copia sub-...  70.5    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABG22406.1|  retrotransposon protein, putative, Ty1-copia subc...  70.5    1e-11   
ref|XP_002442065.1|  hypothetical protein SORBIDRAFT_08g008672        70.1    1e-11   Sorghum bicolor [broomcorn]
emb|CAI44606.1|  P0650D04.10                                          70.5    1e-11   Oryza sativa [red rice]
gb|ABA91445.2|  retrotransposon protein, putative, Ty1-copia subc...  70.5    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93525.1|  retrotransposon protein, putative, Ty1-copia subc...  70.1    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99836.1|  retrotransposon protein, putative, Ty1-copia subc...  70.1    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010095473.1|  hypothetical protein L484_014900                 66.6    2e-11   
gb|AAT39267.1|  putative polyprotein                                  69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02547.1|  OSJNBb0069N01.13                                     69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95374.1|  Integrase core domain, putative                       69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96109.1|  retrotransposon protein, putative, Ty1-copia sub-...  69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAV43866.1|  putative polyprotein                                  69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009803853.1|  PREDICTED: uncharacterized protein LOC104249176  66.6    2e-11   
gb|AAR13298.1|  gag-pol polyprotein                                   69.3    2e-11   Phaseolus vulgaris [French bean]
gb|ACB59199.1|  copia-like protein                                    68.9    3e-11   Brassica oleracea
gb|ABA93820.1|  retrotransposon protein, putative, Ty1-copia subc...  69.3    3e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40924.3|  OSJNBa0033G16.12                                     68.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ADN33807.1|  ty1-copia retrotransposon protein                     68.9    3e-11   
gb|AAP20858.1|  retrotransposon protein, putative, Ty1-copia sub-...  68.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAW57815.1|  putative polyprotein                                  68.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAV85747.1|  Integrase core domain, putative                       68.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95219.1|  retrotransposon protein, putative, Ty1-copia subc...  68.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96702.1|  retrotransposon protein, putative, Ty1-copia subc...  68.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAN66959.1|  hypothetical protein VITISV_013138                   68.9    4e-11   Vitis vinifera
gb|AAM22635.1|AF434192_2  Gag and Pol                                 68.9    4e-11   Zea mays [maize]
emb|CAN82637.1|  hypothetical protein VITISV_028818                   68.9    4e-11   Vitis vinifera
ref|XP_002461816.1|  hypothetical protein SORBIDRAFT_02g008720        68.6    4e-11   Sorghum bicolor [broomcorn]
emb|CAN77568.1|  hypothetical protein VITISV_010611                   68.6    5e-11   Vitis vinifera
emb|CAN61066.1|  hypothetical protein VITISV_004412                   68.6    5e-11   Vitis vinifera
emb|CAN66710.1|  hypothetical protein VITISV_006397                   68.6    5e-11   Vitis vinifera
emb|CAN62884.1|  hypothetical protein VITISV_039744                   68.6    5e-11   Vitis vinifera
gb|AAT38005.1|  putative polyprotein                                  68.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449917.1|  hypothetical protein SORBIDRAFT_05g025655        68.2    5e-11   Sorghum bicolor [broomcorn]
gb|AAX92828.1|  retrotransposon protein, putative, Ty1-copia sub-...  68.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAN69855.1|  hypothetical protein VITISV_041230                   68.6    6e-11   Vitis vinifera
ref|XP_010451299.1|  PREDICTED: uncharacterized protein LOC104733420  67.8    7e-11   
ref|XP_008337163.1|  PREDICTED: uncharacterized protein LOC103400289  67.4    7e-11   
ref|XP_010496878.1|  PREDICTED: uncharacterized protein LOC104773906  67.8    7e-11   
ref|XP_002459428.1|  hypothetical protein SORBIDRAFT_02g004525        67.8    8e-11   Sorghum bicolor [broomcorn]
gb|ABF96975.1|  retrotransposon protein, putative, Ty1-copia subc...  67.4    9e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAO37490.1|  putative gag-pol polyprotein                          67.0    9e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008356174.1|  PREDICTED: uncharacterized protein LOC103419864  67.8    1e-10   
gb|KFD67433.1|  hypothetical protein M514_20469                       67.8    1e-10   
ref|XP_004297983.1|  PREDICTED: uncharacterized protein LOC101308670  65.1    1e-10   
gb|AAU90333.1|  Putative gag and pol polyprotein, identical           67.4    1e-10   Solanum demissum
gb|ABG22008.1|  retrotransposon protein, putative, Ty1-copia subc...  67.4    1e-10   
ref|XP_009602612.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  66.6    1e-10   
gb|AAV24814.1|  putative polyprotein                                  67.4    1e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41731.1|  OSJNBb0034I13.10                                     67.4    1e-10   Oryza sativa [red rice]
emb|CAH65753.1|  OSIGBa0123D13.2                                      67.4    1e-10   Oryza sativa [red rice]
emb|CAN65331.1|  hypothetical protein VITISV_018654                   67.4    1e-10   Vitis vinifera
emb|CAN62431.1|  hypothetical protein VITISV_015835                   67.4    1e-10   Vitis vinifera
gb|ABA97460.1|  retrotransposon protein, putative, Ty1-copia subc...  67.0    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAO60021.1|  putative polyprotein                                  67.4    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAR96231.1|  putative integrase                                    67.4    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94191.1|  retrotransposon protein, putative, Ty1-copia subc...  67.0    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95363.1|  Integrase core domain, putative                       67.0    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97705.1|  retrotransposon protein, putative, Ty1-copia subc...  67.0    2e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04657.2|  OSJNBa0061G20.13                                     67.0    2e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66692.1|  OSIGBa0097A15.7                                      67.0    2e-10   Oryza sativa [red rice]
gb|KFM63066.1|  Retrovirus-related Pol polyprotein from transposo...  65.5    2e-10   
ref|XP_002445775.1|  hypothetical protein SORBIDRAFT_07g025585        66.6    2e-10   Sorghum bicolor [broomcorn]
gb|ABW81017.1|  gag-pol polymerase                                    67.0    2e-10   
gb|ABA97555.1|  retrotransposon protein, putative, Ty1-copia subc...  66.6    2e-10   
gb|KFD64006.1|  hypothetical protein M514_23854                       66.6    2e-10   
gb|AAN65018.1|  putative polyprotein                                  66.6    2e-10   
dbj|BAG94704.1|  unnamed protein product                              66.6    2e-10   
emb|CAE03845.1|  OSJNBb0089K06.4                                      66.6    2e-10   
ref|XP_008462933.1|  PREDICTED: uncharacterized protein LOC103501196  66.2    2e-10   
ref|NP_001059837.1|  Os07g0528100                                     66.6    2e-10   
gb|ABA93554.1|  retrotransposon protein, putative, Ty1-copia subc...  66.2    3e-10   
emb|CAN66576.1|  hypothetical protein VITISV_016964                   66.6    3e-10   
emb|CAN63819.1|  hypothetical protein VITISV_028102                   66.2    3e-10   
ref|XP_010534024.1|  PREDICTED: uncharacterized protein LOC104809678  66.6    3e-10   
gb|ABF96674.1|  retrotransposon protein, putative, Ty1-copia subc...  66.2    3e-10   
gb|AAT85017.1|  putative polyprotein                                  66.2    3e-10   
ref|NP_001174195.1|  Os05g0126900                                     65.9    3e-10   
ref|XP_003376808.1|  retrovirus-related Pol polyprotein from tran...  66.2    3e-10   
gb|ABG22485.1|  retrotransposon protein, putative, Ty1-copia subc...  65.9    4e-10   
gb|ABA93966.1|  retrotransposon protein, putative, Ty1-copia subc...  65.9    4e-10   
gb|AAS90682.1|  pupative polyprotein                                  65.9    4e-10   
gb|AAX96223.1|  retrotransposon protein, putative, Ty1-copia sub-...  65.9    5e-10   
gb|AAU90089.1|  putative polyprotein                                  65.5    5e-10   
emb|CAH66624.1|  OSIGBa0115A19.5                                      65.5    5e-10   
gb|AAO72413.1|  gag-pol polyprotein                                   65.5    5e-10   
ref|NP_001064098.1|  Os10g0130700                                     65.5    5e-10   
emb|CAE01957.2|  OSJNBb0071D01.3                                      65.1    5e-10   
emb|CAN66883.1|  hypothetical protein VITISV_000960                   57.0    5e-10   
gb|EEC84282.1|  hypothetical protein OsI_30754                        65.5    5e-10   
ref|NP_001060895.1|  Os08g0125300                                     65.5    6e-10   
gb|ABB47537.2|  retrotransposon protein, putative, unclassified       65.5    6e-10   
gb|ABH07409.1|  putative pol polyprotein                              65.5    6e-10   
emb|CAN59755.1|  hypothetical protein VITISV_034567                   65.5    6e-10   
gb|ABA97342.2|  retrotransposon protein, putative, Ty1-copia subc...  65.1    7e-10   
gb|ABA98367.2|  retrotransposon protein, putative, Ty1-copia subc...  65.5    7e-10   
ref|XP_006584231.1|  PREDICTED: uncharacterized protein LOC102663134  64.3    7e-10   
gb|ABW74566.1|  integrase                                             65.1    7e-10   
ref|XP_010422526.1|  PREDICTED: uncharacterized protein LOC104707795  64.7    9e-10   
gb|ABA92101.2|  retrotransposon protein, putative, Ty1-copia subc...  64.7    1e-09   
gb|EMS60921.1|  hypothetical protein TRIUR3_17552                     63.9    1e-09   
ref|NP_001059496.1|  Os07g0434200                                     64.7    1e-09   
ref|XP_002464673.1|  hypothetical protein SORBIDRAFT_01g023130        64.3    1e-09   
gb|ABF95769.1|  retrotransposon protein, putative, Ty1-copia subc...  64.7    1e-09   
gb|AAR01736.1|  putative Gag and Pol polyprotein                      64.7    1e-09   
gb|AAM74249.1|AC074355_11  Putative retroelement                      63.9    1e-09   
gb|AAP53887.2|  retrotransposon protein, putative, Ty1-copia subc...  64.3    1e-09   
gb|EXX50149.1|  gag-pol fusion protein                                64.3    1e-09   
gb|EEC67008.1|  hypothetical protein OsI_33720                        64.3    1e-09   
gb|AAP52343.2|  retrotransposon protein, putative, Ty1-copia subc...  63.9    1e-09   
gb|AAL56548.1|AF387862_2  pol polyprotein                             63.9    2e-09   
emb|CAH66177.1|  OSIGBa0130O15.1                                      64.3    2e-09   
emb|CAE03978.3|  OSJNBa0033H08.2                                      64.3    2e-09   
gb|ABA95283.1|  retrotransposon protein, putative, unclassified, ...  63.9    2e-09   
emb|CAE04807.2|  OSJNBb0022P19.2                                      63.9    2e-09   
emb|CDY24759.1|  BnaC04g13640D                                        63.9    2e-09   
ref|XP_010666016.1|  PREDICTED: uncharacterized protein LOC104883233  62.4    2e-09   
emb|CAN66873.1|  hypothetical protein VITISV_021427                   63.9    2e-09   
ref|NP_001068391.2|  Os11g0656500                                     63.9    2e-09   
ref|NP_001064658.2|  Os10g0429700                                     63.5    2e-09   
emb|CAE02400.1|  OSJNBa0024J22.4                                      63.5    2e-09   
gb|AAX96510.1|  retrotransposon protein, putative, Ty1-copia sub-...  63.2    2e-09   
emb|CAH66352.1|  OSIGBa0135C09.3                                      63.5    2e-09   
ref|NP_001068460.1|  Os11g0682500                                     63.5    2e-09   
gb|AAP44677.1|  putative gag-pol polyprotein                          63.5    2e-09   
emb|CAN81156.1|  hypothetical protein VITISV_016610                   63.5    2e-09   
gb|ABF99351.1|  retrotransposon protein, putative, unclassified       63.5    2e-09   
emb|CAN68340.1|  hypothetical protein VITISV_025981                   63.5    2e-09   
ref|XP_008237766.1|  PREDICTED: uncharacterized protein LOC103336496  63.9    3e-09   
gb|ABB47787.2|  retrotransposon protein, putative, Ty1-copia subc...  63.5    3e-09   
gb|AAL31045.1|AC078893_8  putative polyprotein                        63.5    3e-09   
ref|XP_008677438.1|  PREDICTED: uncharacterized protein LOC100304...  63.5    3e-09   
gb|EEE67150.1|  hypothetical protein OsJ_24213                        63.5    3e-09   
ref|XP_008810186.1|  PREDICTED: uncharacterized protein LOC103721669  63.5    3e-09   
ref|XP_006588194.1|  PREDICTED: uncharacterized protein LOC102666960  62.8    3e-09   
gb|AAP54390.2|  retrotransposon protein, putative, Ty1-copia subc...  63.5    3e-09   
gb|AAK39592.1|AC025296_27  putative retrotransposon polyprotein       63.2    3e-09   
ref|XP_010239195.1|  PREDICTED: uncharacterized protein LOC104585011  62.4    3e-09   
gb|ACL97386.1|  Gag-Pol polyprotein                                   63.2    3e-09   
emb|CAH66912.1|  OSIGBa0126B18.5                                      63.2    3e-09   
gb|ABF99156.1|  retrotransposon protein, putative, Ty1-copia subc...  63.2    3e-09   
gb|ABA96192.2|  retrotransposon protein, putative, Ty1-copia subc...  63.2    3e-09   
gb|ABB47865.2|  retrotransposon protein, putative, Ty1-copia subc...  63.2    3e-09   
ref|XP_006577615.1|  PREDICTED: uncharacterized protein LOC102665777  62.4    3e-09   
gb|AAM19019.1|AC084748_9  putative polyprotein                        63.2    3e-09   
gb|AAM95676.1|  putative polyprotein                                  63.2    3e-09   
gb|ABA96250.1|  retrotransposon protein, putative, Ty1-copia subc...  63.2    3e-09   
ref|XP_010526684.1|  PREDICTED: retrovirus-related Pol polyprotei...  62.8    3e-09   
gb|ABA98785.1|  retrotransposon protein, putative, Ty1-copia subc...  63.2    3e-09   
dbj|BAB03249.1|  polyprotein                                          63.2    3e-09   
emb|CAN67941.1|  hypothetical protein VITISV_033155                   63.2    4e-09   
gb|ABA98084.1|  retrotransposon protein, putative, Ty1-copia subc...  63.2    4e-09   
gb|AAO52669.1|  putative copia-type polyprotein                       59.3    4e-09   
gb|AAV43959.2|  putative polyprotein                                  63.2    4e-09   
ref|XP_004149950.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.2    4e-09   
gb|AAG13538.1|AC023240_11  putative gag-pol polyprotein               63.2    4e-09   
gb|AAS07202.1|  putative integrase                                    63.2    4e-09   
gb|KFD61333.1|  hypothetical protein M514_12060                       63.2    4e-09   
gb|AAV31383.1|  putative polyprotein                                  62.8    4e-09   
gb|ABG66192.1|  retrotransposon protein, putative, Ty1-copia subc...  63.2    4e-09   
ref|XP_010495581.1|  PREDICTED: uncharacterized protein LOC104772693  62.8    4e-09   
gb|AAV44166.1|  putative polyprotein                                  62.8    4e-09   
ref|XP_008388992.1|  PREDICTED: uncharacterized protein LOC103451356  62.8    4e-09   
emb|CAN78666.1|  hypothetical protein VITISV_032507                   62.8    4e-09   
dbj|BAA22288.1|  polyprotein                                          62.8    5e-09   
emb|CAE05248.2|  OSJNBb0115I09.10                                     62.8    5e-09   
ref|XP_009798005.1|  PREDICTED: uncharacterized protein LOC104244304  59.7    5e-09   
gb|ABA97124.1|  retrotransposon protein, putative, Ty1-copia subc...  62.8    5e-09   
gb|EGI65265.1|  Retrovirus-related Pol polyprotein from transposo...  58.5    5e-09   
gb|ABF94034.1|  retrotransposon protein, putative, unclassified       62.8    5e-09   
gb|KFD66912.1|  hypothetical protein M514_20778                       61.6    5e-09   
gb|AAP03376.1|  putative gag-pol polyprotein                          62.4    5e-09   
ref|XP_008338000.1|  PREDICTED: uncharacterized protein LOC103401070  62.4    5e-09   
ref|XP_010526682.1|  PREDICTED: retrovirus-related Pol polyprotei...  62.4    5e-09   
gb|ABA94371.1|  retrotransposon protein, putative, Ty1-copia subc...  62.4    6e-09   
gb|KHJ41521.1|  zinc knuckle                                          62.0    6e-09   
ref|XP_008387850.1|  PREDICTED: uncharacterized protein LOC103450292  62.4    6e-09   
ref|XP_008650258.1|  PREDICTED: uncharacterized protein LOC103631015  61.2    6e-09   
ref|XP_008650257.1|  PREDICTED: uncharacterized protein LOC103631014  61.2    6e-09   
gb|ABF93649.1|  retrotransposon protein, putative, Ty1-copia subc...  62.4    6e-09   
gb|ACL97387.1|  Gag-Pol polyprotein                                   62.4    6e-09   
ref|XP_010424606.1|  PREDICTED: uncharacterized protein LOC104709740  62.0    6e-09   
ref|XP_008357483.1|  PREDICTED: HBS1-like protein                     62.4    6e-09   
dbj|BAC65862.1|  hypothetical polyprotein                             62.4    6e-09   
ref|XP_010526678.1|  PREDICTED: retrovirus-related Pol polyprotei...  62.4    7e-09   
gb|AAV32100.1|  putative polyprotein                                  62.4    7e-09   
ref|XP_008680413.1|  PREDICTED: uncharacterized protein LOC103655437  61.6    7e-09   
emb|CAE05066.1|  OSJNBa0094P09.5                                      62.0    7e-09   
ref|XP_010526681.1|  PREDICTED: retrovirus-related Pol polyprotei...  62.4    7e-09   
gb|ACL97385.1|  Gag-Pol polyprotein                                   62.4    7e-09   
gb|ACL97383.1|  Gag-Pol polyprotein                                   62.4    7e-09   
gb|ACL97384.1|  Gag-Pol polyprotein                                   62.4    7e-09   
ref|XP_004301658.1|  PREDICTED: uncharacterized protein LOC101293311  62.0    7e-09   
ref|XP_006598641.1|  PREDICTED: uncharacterized protein LOC100790305  61.2    8e-09   
gb|EGI68480.1|  Copia protein                                         58.2    8e-09   
gb|ABA96626.1|  retrotransposon protein, putative, unclassified       62.0    8e-09   
ref|XP_010526683.1|  PREDICTED: retrovirus-related Pol polyprotei...  62.0    8e-09   
ref|XP_010526680.1|  PREDICTED: retrovirus-related Pol polyprotei...  62.0    9e-09   
gb|EEC81933.1|  hypothetical protein OsI_25798                        62.0    9e-09   
ref|XP_008650298.1|  PREDICTED: uncharacterized protein LOC103631070  60.8    9e-09   
ref|XP_008650161.1|  PREDICTED: uncharacterized protein LOC103630903  60.5    1e-08   
gb|AAK73108.1|AF391808_10  Fourf gag/pol protein                      61.6    1e-08   
gb|AAD15534.1|  putative retroelement pol polyprotein                 61.6    1e-08   
ref|NP_001061718.1|  Os08g0389500                                     61.6    1e-08   
ref|XP_007021628.1|  Uncharacterized protein TCM_031677               61.6    1e-08   
ref|XP_008650230.1|  PREDICTED: uncharacterized protein LOC103630987  60.5    1e-08   
gb|AAX96287.1|  retrotransposon protein, putative, Ty1-copia sub-...  61.6    1e-08   
ref|XP_006588669.1|  PREDICTED: myosin-16-like isoform X4             61.6    1e-08   
emb|CAE03692.2|  OSJNBb0026E15.10                                     61.6    1e-08   
gb|ABA98225.1|  retrotransposon protein, putative, Ty1-copia subc...  61.6    1e-08   
gb|AAL31653.1|AC079179_8  Putative polyprotein from transposon TNT    61.6    1e-08   
gb|AAZ41811.1|  01P13-1                                               61.6    1e-08   
gb|AAC26250.1|  contains similarity to reverse transcriptase (Pfa...  61.2    1e-08   
emb|CAA49283.1|  gag,protease,endonuclease, reverse transcriptase...  61.6    1e-08   
emb|CAN66190.1|  hypothetical protein VITISV_006048                   61.2    1e-08   
gb|ABA98885.1|  retrotransposon protein, putative, Ty1-copia subc...  61.2    1e-08   
ref|XP_010480845.1|  PREDICTED: uncharacterized protein LOC104759633  60.8    1e-08   
gb|ABF94664.1|  retrotransposon protein, putative, Ty1-copia subc...  61.2    1e-08   
gb|ABA96132.1|  retrotransposon protein, putative, Ty1-copia subc...  61.2    1e-08   
emb|CAN70479.1|  hypothetical protein VITISV_023585                   61.2    1e-08   
emb|CAN64779.1|  hypothetical protein VITISV_043230                   61.2    1e-08   
gb|AIC77183.1|  polyprotein                                           61.2    2e-08   
gb|KDQ06095.1|  hypothetical protein BOTBODRAFT_82766                 58.2    2e-08   
gb|KFK24421.1|  hypothetical protein AALP_AAs56100U000100             60.5    2e-08   
ref|XP_008650254.1|  PREDICTED: uncharacterized protein LOC103631012  60.1    2e-08   
ref|XP_010239208.1|  PREDICTED: uncharacterized protein LOC104585019  60.5    2e-08   
emb|CCA67899.1|  hypothetical protein PIIN_01770                      60.8    2e-08   
emb|CAN75392.1|  hypothetical protein VITISV_020537                   60.8    2e-08   
gb|ADB85424.1|  putative retrotransposon protein                      61.2    2e-08   
emb|CAN74029.1|  hypothetical protein VITISV_013540                   60.8    2e-08   
gb|AAT44282.1|  putative polyprotein                                  60.8    2e-08   
ref|XP_010412399.1|  PREDICTED: uncharacterized protein LOC104698686  58.2    2e-08   
ref|XP_008650172.1|  PREDICTED: uncharacterized protein LOC103630918  60.1    2e-08   
ref|XP_008650203.1|  PREDICTED: uncharacterized protein LOC103630957  60.5    2e-08   
gb|ABA99813.1|  retrotransposon protein, putative, Ty1-copia subc...  60.8    2e-08   
ref|XP_003376336.1|  retrovirus-related Pol polyprotein from tran...  60.8    2e-08   
ref|XP_010236605.1|  PREDICTED: uncharacterized protein LOC104584152  60.1    2e-08   
emb|CAD40519.1|  OSJNBa0023J03.5                                      60.8    2e-08   
emb|CAH66193.1|  OSIGBa0144J05.5                                      60.8    2e-08   
ref|XP_010030630.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.8    2e-08   
emb|CDO76235.1|  hypothetical protein BN946_scf184644.g9              60.8    2e-08   
emb|CAH68021.1|  H0807C06-H0308C08.8                                  60.5    2e-08   
gb|AAS07263.1|  putative gag/pol polyprotein                          60.8    2e-08   
gb|EMS50467.1|  Retrovirus-related Pol polyprotein from transposo...  60.8    2e-08   
gb|AAP54028.1|  retrotransposon protein, putative, Ty1-copia subc...  60.8    2e-08   
gb|KHN01991.1|  Retrovirus-related Pol polyprotein from transposo...  60.8    2e-08   
emb|CCI11793.1|  unnamed protein product                              57.8    2e-08   
ref|XP_010239210.1|  PREDICTED: uncharacterized protein LOC104585020  60.1    2e-08   
gb|ABA96257.1|  retrotransposon protein, putative, Ty1-copia subc...  60.1    2e-08   
emb|CAN67199.1|  hypothetical protein VITISV_017217                   60.5    3e-08   
ref|XP_008337255.1|  PREDICTED: retrovirus-related Pol polyprotei...  60.5    3e-08   
emb|CAN72993.1|  hypothetical protein VITISV_002698                   60.5    3e-08   
ref|XP_007021177.1|  Uncharacterized protein TCM_031224               60.5    3e-08   
gb|EZA58507.1|  Eukaryotic translation initiation factor 3 subunit A  60.5    3e-08   
ref|XP_008372204.1|  PREDICTED: uncharacterized protein LOC103435597  60.5    3e-08   
emb|CAN74283.1|  hypothetical protein VITISV_032452                   60.5    3e-08   
gb|AAU90206.1|  putative polyprotein                                  60.5    3e-08   
gb|KFD65016.1|  LOW QUALITY PROTEIN: hypothetical protein M514_22733  60.5    3e-08   
gb|AAL75486.1|AF466202_12  putative Fourf gag/pol protein             60.5    3e-08   
gb|AAX96544.1|  retrotransposon protein, putative, Ty1-copia sub-...  60.1    3e-08   
emb|CAE04463.2|  OSJNBa0029L02.4                                      60.1    4e-08   
gb|KCW61617.1|  hypothetical protein EUGRSUZ_H043552                  56.6    4e-08   
emb|CAN73802.1|  hypothetical protein VITISV_001401                   60.1    4e-08   
emb|CAE02415.2|  OSJNBa0095E20.2                                      60.1    4e-08   
gb|ABA95374.1|  retrotransposon protein, putative, Ty1-copia subc...  60.1    4e-08   
gb|ADK92880.1|  retrotransposon 4 protein                             60.1    4e-08   
ref|XP_006584290.1|  PREDICTED: uncharacterized protein LOC102667662  57.8    4e-08   
gb|ABA97039.1|  retrotransposon protein, putative, Ty1-copia subc...  59.3    4e-08   
emb|CCI55340.1|  PH01B019A14.9                                        60.1    4e-08   
gb|AAX96359.1|  retrotransposon protein, putative, Ty1-copia sub-...  59.7    5e-08   
gb|KFD67411.1|  LOW QUALITY PROTEIN: hypothetical protein M514_20447  59.7    5e-08   
emb|CAH66022.1|  OSIGBa0105O19.1                                      59.7    5e-08   
emb|CAD40363.2|  OSJNBa0093P23.9                                      59.7    5e-08   
emb|CAN72676.1|  hypothetical protein VITISV_020406                   59.7    5e-08   
ref|XP_009790744.1|  PREDICTED: uncharacterized protein LOC104238152  56.2    5e-08   
emb|CAN71759.1|  hypothetical protein VITISV_020777                   59.7    6e-08   
emb|CAN62685.1|  hypothetical protein VITISV_019302                   58.5    6e-08   
emb|CAN69956.1|  hypothetical protein VITISV_032883                   59.3    6e-08   
gb|EHJ63306.1|  integrase                                             55.5    6e-08   
gb|AAL79695.1|AC087599_14  putative gag-pol polyprotein               59.3    6e-08   
emb|CAD41912.2|  OSJNBa0033G05.13                                     59.3    6e-08   
emb|CAE02382.2|  OSJNBb0080H08.8                                      59.3    6e-08   
gb|ABA96959.2|  retrotransposon protein, putative, Ty1-copia subc...  59.3    6e-08   
ref|XP_010473967.1|  PREDICTED: uncharacterized protein LOC104753406  58.9    6e-08   



>dbj|BAG72096.1| Gag-protease-integrase-RT-RNaseH polyprotein [Glycine max]
Length=1321

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA+PKTPFELFKGWKPSL HMRVWGCPSEVRIYNP EKKLDPRTIS +FIGYA+ SKGY
Sbjct  601  TKAVPKTPFELFKGWKPSLKHMRVWGCPSEVRIYNPQEKKLDPRTISGYFIGYAERSKGY  660

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFYCP H TRIVESRNAKF+E+DLISG D
Sbjct  661  RFYCPHHITRIVESRNAKFIENDLISGSD  689



>emb|CAN69553.1| hypothetical protein VITISV_009018 [Vitis vinifera]
Length=635

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA+PKTPFEL KGWKPSL HMRVWGC S VRIYNP EKKLDPRTIS +FIGYA++SKGY
Sbjct  410  TKAVPKTPFELLKGWKPSLQHMRVWGCSSVVRIYNPQEKKLDPRTISGYFIGYAKNSKGY  469

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFYCP H TRIVESRNAKFLE DL+SG D
Sbjct  470  RFYCPSHNTRIVESRNAKFLEYDLVSGSD  498



>emb|CAN61323.1| hypothetical protein VITISV_012107 [Vitis vinifera]
Length=1077

 Score =   161 bits (407),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKAIPKTPFEL+KGWKPSL HMRVWGC SEVRIYNP EKKLDPRTIS +FIGY +  KGY
Sbjct  321  TKAIPKTPFELWKGWKPSLRHMRVWGCLSEVRIYNPQEKKLDPRTISGYFIGYVEKFKGY  380

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
             FYCP H TRIVESRNAKF++ DL+SG D
Sbjct  381  IFYCPSHNTRIVESRNAKFMKYDLVSGID  409



>emb|CAN76841.1| hypothetical protein VITISV_004490 [Vitis vinifera]
Length=906

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA+PKTPF+L KGWK SL HMRVWGC  EVRIYNP EKKLDPRTIS +FIGYA+ SKGY
Sbjct  469  TKAVPKTPFKLLKGWKSSLRHMRVWGCSFEVRIYNPQEKKLDPRTISGYFIGYAEKSKGY  528

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFYCP H TRIVESRNAKFLE DL+ G D
Sbjct  529  RFYCPSHNTRIVESRNAKFLEYDLVGGSD  557



>emb|CAN64190.1| hypothetical protein VITISV_002428 [Vitis vinifera]
Length=950

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  8    AIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRF  187
            A+PKTPFEL KGWKPSL HM +WGC SEVRIYNP EKKLDPRTIS +FIGY + SKGYRF
Sbjct  465  AVPKTPFELLKGWKPSLRHMCIWGCSSEVRIYNPQEKKLDPRTISGYFIGYVEKSKGYRF  524

Query  188  YCPKHTTRIVESRNAKFLEDDLISGRD  268
            YCP H TRIVESRN KFLE DL+ G D
Sbjct  525  YCPSHNTRIVESRNDKFLEYDLVGGSD  551



>ref|XP_010521850.1| PREDICTED: protein kinase 2B, chloroplastic-like [Tarenaya hassleriana]
Length=616

 Score =   142 bits (358),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KAIPKTP+EL+ G KPSL H+ VWGC +E+RIYNPHEKKLDPRTIS FFIGY + SKG+
Sbjct  250  SKAIPKTPYELWTGRKPSLRHLHVWGCQAEIRIYNPHEKKLDPRTISGFFIGYPEKSKGF  309

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
             FYCP H+TRI+E+ NA+F+E+  ISG +
Sbjct  310  IFYCPNHSTRIMETGNARFIENGQISGSE  338



>emb|CAN75287.1| hypothetical protein VITISV_037638 [Vitis vinifera]
Length=177

 Score =   129 bits (325),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK +PKTPFEL+K WKPSL HMRVWGC SEVRIYNP EKKLDPRTIS +FI Y + SK Y
Sbjct  52   TKVVPKTPFELWKAWKPSLRHMRVWGCLSEVRIYNPQEKKLDPRTISGYFIRYVEKSKEY  111

Query  182  RFYCPKHTTRIVESRN  229
            +FYCP HTT+I ESRN
Sbjct  112  KFYCPFHTTKIXESRN  127



>emb|CBI20118.3| unnamed protein product [Vitis vinifera]
Length=1354

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2     TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
             +KA+PKTPFEL+ G KPSL H+ +WGCP+E RIYNPHEKKLD RT+S +FIGY   SKGY
Sbjct  1016  SKAVPKTPFELWTGRKPSLRHIHIWGCPAEARIYNPHEKKLDSRTVSGYFIGYPDKSKGY  1075

Query  182   RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
             RFYCP H+ RIVE+ NA+FLE+  ISG +
Sbjct  1076  RFYCPNHSVRIVETGNARFLENGEISGSN  1104



>ref|XP_009615394.1| PREDICTED: uncharacterized protein LOC104108115 [Nicotiana tomentosiformis]
Length=539

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+PKTPFEL+KGWKPSL H+ VWGCP+EVR+YNP  KKLD RT S +FIGYA +SK  
Sbjct  384  SKAVPKTPFELWKGWKPSLNHLHVWGCPTEVRVYNPQLKKLDERTTSGYFIGYAVNSKRL  443

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP H+++IVE RNAKFLE    SG
Sbjct  444  RFYCPSHSSKIVEVRNAKFLEAHEESG  470



>gb|ABW74556.1| copia-like pol polyprotein [Boechera divaricarpa]
Length=931

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+PKTPFEL+ G KPSL H+RVWGCP+EV++YNPHEKKLD RT+S FFIGY + SKGY
Sbjct  340  SKAVPKTPFELWTGRKPSLKHLRVWGCPAEVKLYNPHEKKLDSRTVSGFFIGYPEKSKGY  399

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
             FYCP H+ RIVE+ NA+F+E+   SG
Sbjct  400  TFYCPNHSMRIVETGNARFIENIETSG  426



>emb|CAN69396.1| hypothetical protein VITISV_021034 [Vitis vinifera]
Length=2026

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+PKTPFEL+   KPSL H+ +WGCP+E RIYNPHEKKLD RTIS +FIGY   SKGY
Sbjct  409  SKAVPKTPFELWTXRKPSLRHIHIWGCPAETRIYNPHEKKLDSRTISGYFIGYPDKSKGY  468

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
             FYCP H  RIVE+ NA+FLE+  ISG +
Sbjct  469  XFYCPNHXVRIVETXNARFLENGEISGSN  497



>emb|CAN83951.1| hypothetical protein VITISV_043907 [Vitis vinifera]
Length=745

 Score =   128 bits (321),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  65   MRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLE  244
            MRVWGC SEVRIYNP EKKLDPRTIS +FIGYA+ SKGY+FYCP H TRIVESRNAKFL+
Sbjct  1    MRVWGCSSEVRIYNPQEKKLDPRTISGYFIGYAEKSKGYKFYCPSHNTRIVESRNAKFLK  60

Query  245  DDLISGRD  268
             DL+SG D
Sbjct  61   YDLVSGSD  68



>emb|CAN69787.1| hypothetical protein VITISV_018508 [Vitis vinifera]
Length=1096

 Score =   124 bits (310),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G KPSL H  VWGC +EVR YNP  KKLDP+TI+ FF+GY   S+G 
Sbjct  328  SKSVPKTPYELWSGKKPSLHHFHVWGCKAEVRPYNPQSKKLDPKTINGFFVGYCIGSRGS  387

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RFYCP HTTRI+E     + EDDL
Sbjct  388  RFYCPSHTTRIIELDKVVYFEDDL  411



>ref|XP_008237271.1| PREDICTED: uncharacterized protein LOC103336013 [Prunus mume]
Length=766

 Score =   121 bits (304),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+PKT FE++ G +PSL H+ VWGC +E R YNP EKKLDPRT S+FFIGY   SKG+
Sbjct  32   SKAVPKTSFEIWVGRQPSLMHLHVWGCKAEARSYNPIEKKLDPRTQSSFFIGYPDKSKGF  91

Query  182  RFYCPKHTTRIVESRNAKFLED  247
            RFYCP   TRIVE+ NAKFLED
Sbjct  92   RFYCPHLHTRIVETNNAKFLED  113



>gb|AAM18738.1|AC092548_16 putative gag-pol polyprotein [Oryza sativa Japonica Group]
Length=1787

 Score =   122 bits (305),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  543  SKSMPKTPYELWTGRVPSLAHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  602

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  603  RFYCPNSYTKFVETRHAVFLEDEMIRG  629



>gb|ABA97882.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=308

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  16   SKSVPKTPYELWTGKVPSLAHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  75

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ +E+R+A FLED++I G
Sbjct  76   RFYCPNSYTKFIETRHAIFLEDEMIRG  102



>gb|AAP53325.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1884

 Score =   121 bits (304),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  543  SKSMPKTPYELWTGRVPSLAHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  602

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  603  RFYCPNSYTKFVETRHAVFLEDEMIRG  629



>emb|CAN62870.1| hypothetical protein VITISV_015928 [Vitis vinifera]
Length=764

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK  PKTPFEL+   KPSL H+ VWGCP+E RIY+PHEKKLD +TIS +FI Y   SKGY
Sbjct  542  TKTXPKTPFELWTRRKPSLRHLHVWGCPTEGRIYSPHEKKLDFKTISGYFIDYPMKSKGY  601

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFY P H+T+IVE+ N +F+E+  I G D
Sbjct  602  RFYYPNHSTKIVETGNXRFIENGEIRGSD  630



>gb|EMT12132.1| Eukaryotic translation initiation factor 3 subunit A [Aegilops 
tauschii]
Length=2007

 Score =   118 bits (296),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H  VWGCP+E +++NP+  KLDP+T+S  FIGY   SKG+
Sbjct  759  SKSVPKTPYELWTGRMPSLQHFSVWGCPAEAKMFNPNIAKLDPKTVSCHFIGYPDRSKGF  818

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  819  RFYCPDRYTQFVETRHAVFLEDEMIRG  845



>emb|CAE04259.3| OSJNBa0089N06.20 [Oryza sativa Japonica Group]
Length=1405

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  668  SKSVPKTPYELWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  727

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  728  RFYCPNSYTKFVETRHAVFLEDEMIRG  754



>emb|CAE02960.2| OSJNBb0050N09.11 [Oryza sativa Japonica Group]
Length=1405

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  668  SKSVPKTPYELWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  727

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  728  RFYCPNSYTKFVETRHAVFLEDEMIRG  754



>emb|CAN79076.1| hypothetical protein VITISV_007708 [Vitis vinifera]
Length=900

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G KPSL H  VWGC +EVR YNP  KKLDP+TIS  F+GY   S+G 
Sbjct  674  SKSVPKTPYELWSGKKPSLHHFHVWGCKAEVRPYNPQSKKLDPKTISGLFVGYCIGSRGS  733

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RFYCP HTTRI+ES  A + ED +
Sbjct  734  RFYCPSHTTRIIESDRAVYFEDKV  757



>gb|ABF94883.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1390

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  663  SKSVPKTPYELWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  722

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  723  RFYCPNSYTKFVETRHAVFLEDEMIRG  749



>emb|CAE03910.2| OSJNBb0015G09.4 [Oryza sativa Japonica Group]
Length=1393

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  668  SKSVPKTPYELWTGRVPSLTHLRVWGSPTEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  727

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  728  RFYCPNSYTKFVETRHAVFLEDEMIRG  754



>gb|ABF96044.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1395

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  658  SKSVPKTPYELWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  717

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  718  RFYCPNSYTKFVETRHAVFLEDEMIRG  744



>gb|AAS98437.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1362

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  625  SKSVPKTPYELWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  684

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  685  RFYCPNSYTKFVETRHAVFLEDEMIRG  711



>gb|AAT69633.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1358

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  621  SKSVPKTPYELWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  680

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  681  RFYCPNSYTKFVETRHAVFLEDEMIRG  707



>gb|ABA97777.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1378

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  654  SKSVPKTPYELWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  713

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  714  RFYCPNSYTKFVETRHAVFLEDEMIRG  740



>emb|CAN64507.1| hypothetical protein VITISV_008916 [Vitis vinifera]
Length=621

 Score =   115 bits (289),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/89 (62%), Positives = 63/89 (71%), Gaps = 13/89 (15%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK +PKTPFEL+K WKP             +RIYN  EKKLD RTIS +FIGY + SKGY
Sbjct  76   TKVVPKTPFELWKCWKP-------------MRIYNLQEKKLDRRTISGYFIGYVERSKGY  122

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFYCP H T+IVESRN KFLE DL+SG +
Sbjct  123  RFYCPSHITKIVESRNTKFLEYDLVSGSN  151



>emb|CAD40806.1| OSJNBb0076A22.18 [Oryza sativa Japonica Group]
Length=1296

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  643  SKSVPKTPYELWIGRVPSLTHLRVWGSPTEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  702

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  703  RFYCPNSYTKFVETRHAVFLEDEMIRG  729



>emb|CAN81838.1| hypothetical protein VITISV_034340 [Vitis vinifera]
Length=1252

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G KPSL H  VWGC +EVR YNP  KKLDP+TIS FF+ Y   S+G 
Sbjct  649  SKSVPKTPYELWSGKKPSLHHFHVWGCKAEVRPYNPQSKKLDPKTISGFFVDYYIGSRGS  708

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
             FYCP HTTRI+ES NA + ED++
Sbjct  709  IFYCPSHTTRIIESHNAVYFEDEV  732



>emb|CAN67331.1| hypothetical protein VITISV_010354 [Vitis vinifera]
Length=490

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  65   MRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLE  244
            M VWGC  EVRIY+  EKKLDPRTIS +FIGY + SKGYRFYCP H+T+IVESRNAKFLE
Sbjct  1    MHVWGCSPEVRIYHLQEKKLDPRTISGYFIGYIKRSKGYRFYCPSHSTKIVESRNAKFLE  60

Query  245  DDLISGRD  268
             DL++G +
Sbjct  61   YDLVNGSN  68



>gb|ABA94504.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1230

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P E +++NP+  KLDP+TIS  FIGY Q SKGY
Sbjct  559  SKSMPKTPYELWTGRVPSLAHLRVWGSPVEAKVFNPNIGKLDPKTISCHFIGYPQRSKGY  618

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP    + VE+R+A FLED++I G
Sbjct  619  RFYCPNSYIKFVETRHAVFLEDEMIRG  645



>emb|CAH66381.1| OSIGBa0092E09.8 [Oryza sativa Indica Group]
Length=1280

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP++L+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  543  SKSVPKTPYKLWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  602

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  603  RFYCPNSYTKFVETRHAVFLEDEMIRG  629



>ref|XP_008356166.1| PREDICTED: uncharacterized protein LOC103419855 [Malus domestica]
Length=527

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+  TPFEL+ G +PSL H+ +WGC +E ++YNP+ KKLDP+T+S +F+GYA+ SKG+
Sbjct  396  SKAVVNTPFELWTGRRPSLNHLHIWGCKAEAKVYNPNGKKLDPKTLSCYFVGYAERSKGF  455

Query  182  RFYCPKHTTRIVESRNAKFLE  244
            RFYCP H  +IVE+  A F+E
Sbjct  456  RFYCPNHDMKIVETGKAIFME  476



>emb|CAH67504.1| OSIGBa0134H18.6 [Oryza sativa Indica Group]
Length=1261

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PK P+EL+ G  PSL H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  524  SKSVPKAPYELWTGRVPSLTHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  583

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE+R+A FLED++I G
Sbjct  584  RFYCPNSYTKFVETRHAVFLEDEMIRG  610



>emb|CAN80145.1| hypothetical protein VITISV_015720 [Vitis vinifera]
Length=712

 Score =   114 bits (285),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTPFEL+   KPSL H +VWGCP+EV+IY+   KK D RT   +FIGY   SKGY
Sbjct  52   SKSVPKTPFELWTNRKPSLNHFKVWGCPAEVKIYDLSLKKTDSRTTRCYFIGYPSHSKGY  111

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            +FYC  H TRIVES+ AKFLE D+
Sbjct  112  KFYCSTHGTRIVESQVAKFLELDV  135



>emb|CAN74164.1| hypothetical protein VITISV_026444 [Vitis vinifera]
Length=689

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 62/89 (70%), Gaps = 17/89 (19%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK +PKTPFEL K                 VRIYNP EKKLDPRTIS +FI YA+ SKGY
Sbjct  556  TKVVPKTPFELLK-----------------VRIYNPQEKKLDPRTISGYFIRYAEKSKGY  598

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFYCP H+ RIVESRNAKFLE DL+SG D
Sbjct  599  RFYCPSHSIRIVESRNAKFLEYDLVSGSD  627



>emb|CAN63575.1| hypothetical protein VITISV_003796 [Vitis vinifera]
Length=1305

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G KP+L H  VWGC +EVR YNP  KKLDP+TIS FF+GY   S+G 
Sbjct  543  SKSMPKTPYELWSGKKPNLHHFHVWGCKTEVRPYNPQLKKLDPKTISGFFVGYCIGSRGS  602

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RFYC  HTTRI+ES  A + ED++
Sbjct  603  RFYCSSHTTRIIESDRAVYFEDEV  626



>gb|ABA94411.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1171

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PS+ H+RVWG P+E +++NP+  KLDP+T+S  FIGY + SKGY
Sbjct  466  SKSVPKTPYELWTGSVPSIAHLRVWGSPAEAKVFNPNIGKLDPKTVSCHFIGYPERSKGY  525

Query  182  RFYCPKHTTRIVESRNAKFLEDDLI  256
            RFYCP   T+ VE+R+A FLED++I
Sbjct  526  RFYCPNSYTKFVETRHAVFLEDEMI  550



>gb|ABA95205.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1407

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTPFEL+ G KP+L +  VWGCP+E R++NP+  KLD +TIS  FIGY   SK Y
Sbjct  677  SKSVPKTPFELWTGKKPTLNYFHVWGCPAEARVFNPNMGKLDLKTISCHFIGYPDKSKAY  736

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ +E+R+A FLE+D+I G
Sbjct  737  RFYCPNQFTKFIETRHAVFLENDIIKG  763



>gb|ABA98016.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1014

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG P E +++NP+  KLDP+T+S  FIGY   SKGY
Sbjct  571  SKSVPKTPYELWTGRVPSLAHLRVWGSPVEAKVFNPNIGKLDPKTVSCHFIGYPGISKGY  630

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE R+A FLED++I G
Sbjct  631  RFYCPNSYTKFVEMRHAIFLEDEMIRG  657



>gb|AAD12998.1| pol polyprotein [Zea mays]
Length=998

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++ +TP+EL+ G KP+L +  +WGCP+E RI+NP + KLD RT S  FIGY   SKGY
Sbjct  249  SKSVARTPYELWTGRKPTLNYFHIWGCPAEARIFNPGQGKLDERTTSCHFIGYPDRSKGY  308

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ +E+R+A FLEDD+I G
Sbjct  309  RFYCPDRQTKFIETRHAIFLEDDMIKG  335



>emb|CAN82950.1| hypothetical protein VITISV_032128 [Vitis vinifera]
Length=460

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 60/84 (71%), Gaps = 13/84 (15%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK +PKTPFEL+K WKP             +RIYNP EKKLDP TI+ +FIGY +SSK Y
Sbjct  76   TKVVPKTPFELWKCWKP-------------MRIYNPQEKKLDPMTINGYFIGYVESSKRY  122

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RFYCP H T IVESRNAKFLE DL
Sbjct  123  RFYCPSHNTNIVESRNAKFLEYDL  146



>emb|CAN62131.1| hypothetical protein VITISV_043715 [Vitis vinifera]
Length=1066

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+   KPSL H  VWG  +EVR YNP  KKLDP+TIS FF+GY   S+G 
Sbjct  502  SKSMPKTPYELWSRKKPSLHHFHVWGSKAEVRPYNPQSKKLDPKTISGFFVGYCIRSRGS  561

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            +FYCP HT RI+ES +  + ED +
Sbjct  562  KFYCPSHTARIIESNSVVYFEDKV  585



>gb|ABA94768.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1144

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G  PSL H+RVWG  +E +++NP+  KLDP+T+   FIGY + SKGY
Sbjct  545  SKSVPKTPYELWTGRVPSLAHLRVWGSSAEAKVFNPNIGKLDPKTVGCHFIGYPERSKGY  604

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ VE R+A FLED++I G
Sbjct  605  RFYCPNSYTKFVEMRHAVFLEDEMIRG  631



>gb|AAD12997.1| gag-pol polyprotein [Zea mays]
Length=1406

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++ +TP+EL+ G KP+L +  +WGCP+E RI+NP + KLD RT S  FIGY   SKGY
Sbjct  657  SKSVARTPYELWIGRKPTLNYFHIWGCPAEARIFNPGQGKLDERTTSCHFIGYPDRSKGY  716

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISG  262
            RFYCP   T+ +E+R+A FLEDD+I G
Sbjct  717  RFYCPDRQTKFIETRHAIFLEDDMIKG  743



>emb|CAN64464.1| hypothetical protein VITISV_029013 [Vitis vinifera]
Length=2655

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +2

Query  2     TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
             +K++PKTP+EL+   KPSL H  VWGC  EVR YNP  KKLDP+TIS +F+GY   S+G 
Sbjct  1861  SKSMPKTPYELWSEKKPSLHHFHVWGCKIEVRSYNPQSKKLDPKTISGYFVGYCIGSRGS  1920

Query  182   RFYCPKHTTRIVESRNAKFLEDDL  253
             RFYCP HTTR +ES  A + ED++
Sbjct  1921  RFYCPSHTTRTIESDRAVYFEDEV  1944



>emb|CAN63912.1| hypothetical protein VITISV_044222 [Vitis vinifera]
Length=1100

 Score =   111 bits (278),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+PKTP+EL+ G KP+L ++ VWGCP+E + +NP  KKLD  TIS  FIGY + SKG+
Sbjct  468  SKAVPKTPYELWVGRKPTLNYLHVWGCPAEAKNFNPQIKKLDFETISCNFIGYPKRSKGF  527

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGR  265
            RFYC     +IVE+R+A FLE++  SGR
Sbjct  528  RFYCHGQGPKIVETRHAVFLENEYFSGR  555



>gb|ABA95153.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=1935

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K +PKTP+EL+ G  PSL H+ VWG P+E +I+NP+  KLDP+T+S  FIGY + SKGY
Sbjct  295  SKLVPKTPYELWTGRVPSLAHLHVWGSPAEAKIFNPNLGKLDPKTVSCHFIGYPERSKGY  354

Query  182  RFYCPKHTTRIVESRNAKFLEDDLI  256
            RFYCP   T+ VE R+A FLED++I
Sbjct  355  RFYCPNSYTKFVEMRHAVFLEDEMI  379



>ref|XP_009796879.1| PREDICTED: uncharacterized protein LOC104243397 [Nicotiana sylvestris]
Length=1034

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK   KTPFEL+   KPSL H  +WGCP++VRIY+P EKK DP+  S FFIGY   SKG+
Sbjct  550  TKPFLKTPFELWTTRKPSLNHFHIWGCPAKVRIYSPTEKKTDPKITSCFFIGYPDHSKGF  609

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RF+CP   T+IVES NAKFLE D+
Sbjct  610  RFFCPGRGTKIVESINAKFLEHDV  633



>emb|CAN66383.1| hypothetical protein VITISV_020130 [Vitis vinifera]
Length=790

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G KPSL H  VW C +EVR YNP  KKLDP+TIS FF+ Y   S+  
Sbjct  333  SKSVPKTPYELWSGKKPSLHHFHVWRCKAEVRPYNPQSKKLDPKTISGFFVDYCIGSRDS  392

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RFYCP HTT+I+ES  A + ED++
Sbjct  393  RFYCPSHTTKIIESDRAIYFEDEV  416



>ref|XP_007220808.1| hypothetical protein PRUPE_ppb020817mg [Prunus persica]
 gb|EMJ22007.1| hypothetical protein PRUPE_ppb020817mg [Prunus persica]
Length=332

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK+I + P+E++ G K SL H+R WGC  E + YNP EKKLDP+T+S++FIGY + +KGY
Sbjct  202  TKSINQIPYEIWHGRKHSLKHLRTWGCKVEAKPYNPAEKKLDPKTVSSYFIGYPERTKGY  261

Query  182  RFYCPKHTTRIVESRNAKFLEDD  250
             FYCP HT R +E+  A F+E D
Sbjct  262  SFYCPHHTMRFIETSRAIFIETD  284



>ref|XP_009758388.1| PREDICTED: uncharacterized protein LOC104211087 [Nicotiana sylvestris]
Length=162

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  47   KPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESR  226
            KPSL H  +WGCP EVRIY+P EKK DP T S FFIGY   SKG+RF+CP+  TRI+ES 
Sbjct  5    KPSLNHFHIWGCPGEVRIYSPTEKKTDPETTSCFFIGYPDHSKGFRFFCPERGTRIIESI  64

Query  227  NAKFLEDDL  253
            NAKFLE D+
Sbjct  65   NAKFLEHDV  73



>ref|XP_010101641.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXB89110.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=625

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K + KTP+EL+   KPSL H  VWGC +EVR YN   KKLDP+TI  FF+GY   S+G 
Sbjct  408  SKYVSKTPYELWSAKKPSLRHHHVWGCKAEVRPYNLQSKKLDPKTIIGFFVGYCVGSRGS  467

Query  182  RFYCPKHTTRIVESRNAKFLEDDLIS  259
            RFYCP HTTR++ES  A +LE+D  S
Sbjct  468  RFYCPYHTTRVIESDRAVYLENDSFS  493



>emb|CAN62509.1| hypothetical protein VITISV_039839 [Vitis vinifera]
Length=1154

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KAIPKTP+EL+ G KP+L ++ VWGCP E +I+NP  KKLD +TIS  FI Y + S G+
Sbjct  198  SKAIPKTPYELWVGRKPTLNYLHVWGCPVEAKIFNPQIKKLDSKTISCNFISYPERSNGF  257

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGR  265
            RFYC     +IVE+R+A FLE++  SGR
Sbjct  258  RFYCHGQGPKIVETRHAVFLENEYFSGR  285



>emb|CAN69142.1| hypothetical protein VITISV_039520 [Vitis vinifera]
Length=687

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KAIPKTP+EL+ G K +L ++ VWGC +E +I+NP  KKLD +TIS  FIGY + SKG+
Sbjct  198  SKAIPKTPYELWVGRKSTLNYLHVWGCLAEAKIFNPQIKKLDSKTISCNFIGYPERSKGF  257

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGR  265
            RFYC     +IVE+R+A FLE++  SGR
Sbjct  258  RFYCHGQGPKIVETRHAVFLENEYFSGR  285



>ref|XP_010656643.1| PREDICTED: uncharacterized protein LOC104880714 [Vitis vinifera]
Length=1782

 Score =   107 bits (268),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2     TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
             TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  1110  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  1169

Query  182   RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
             +FY P     I E+  A F ED    GR+
Sbjct  1170  KFYDPA-IRSIFETGTATFFEDVEFGGRN  1197



>ref|XP_008349237.1| PREDICTED: uncharacterized protein LOC103412461 [Malus domestica]
Length=789

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA+ + PFE++ G KP+  +  VWGC +E R YNPHEKKLD RT + +F+GY + SKG+
Sbjct  525  TKAVSQXPFEIWTGRKPNFDYFHVWGCKAEARFYNPHEKKLDARTQACYFVGYCEKSKGF  584

Query  182  RFYCPKHTTRIVESRNAKFLED  247
            +FY P+  +RI ES NA FLED
Sbjct  585  KFYDPQAHSRIQESHNAVFLED  606



>ref|XP_008353440.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103417009 
[Malus domestica]
Length=1099

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 4/92 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+  TPFE++   KPS  H  V GC +E RIYNP+EKKLD RT S +FIGY+  SKG+
Sbjct  567  SKAVSSTPFEIWNXRKPSFXHFHVXGCKAEARIYNPNEKKLDSRTESCYFIGYSXKSKGF  626

Query  182  RFYCPKHTTRIVESRNAKFLED----DLISGR  265
            +FYCP+  TRI E+ NA+F ED    DL  GR
Sbjct  627  KFYCPQAHTRIHETHNARFFEDQDIADLSQGR  658



>emb|CAN69679.1| hypothetical protein VITISV_006037 [Vitis vinifera]
Length=968

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K+ PKTP+E++   KPSL H  VWGC +EVR YNP  KKLDP+TI  FF+GY   S+  
Sbjct  284  SKSAPKTPYEIWSRKKPSLHHFHVWGCKAEVRPYNPQSKKLDPKTIGGFFVGYCIRSRXS  343

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RFYCP HTT+I+ES    + ED++
Sbjct  344  RFYCPSHTTKIIESNRVVYFEDEV  367



>emb|CAN73613.1| hypothetical protein VITISV_023299 [Vitis vinifera]
Length=1815

 Score =   107 bits (267),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S +FIGYA+ S+G+
Sbjct  615  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSXYFIGYAERSRGF  674

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P     I E+  A F ED    GR+
Sbjct  675  KFYDPA-IRSIFETGTATFFEDVEFGGRN  702



>emb|CAN83337.1| hypothetical protein VITISV_004574 [Vitis vinifera]
Length=1060

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+ G KP+L H  VWGC +EVR YNP  KKLD +TIS FF+ Y   S+G 
Sbjct  456  SKSVPKTPYELWLGKKPNLHHFHVWGCKAEVRPYNPQLKKLDLKTISGFFVSYCIGSRGS  515

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            +FYCP HTTRI+E   A + ED++
Sbjct  516  KFYCPFHTTRIIELDRAVYFEDEV  539



>emb|CAN61065.1| hypothetical protein VITISV_004411 [Vitis vinifera]
Length=872

 Score =   106 bits (264),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  182  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  241

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P     I E+  A F ED    GR+
Sbjct  242  KFYDPA-IRSIFETGTATFFEDVEFGGRN  269



>gb|AHL77759.1| polyprotein [Prunus persica]
Length=1363

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK++ K P+E++   KP L H++VWG  +E + YNP EKKLD +T++ FF+GY   +KGY
Sbjct  644  TKSVNKIPYEIWCNRKPCLSHLKVWGSKAEAKFYNPSEKKLDSKTVTCFFVGYPDRTKGY  703

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFYCP +TTR +E++ A F+ED+   G D
Sbjct  704  RFYCPNNTTRFMETQRAIFIEDESEQGTD  732



>emb|CAN71319.1| hypothetical protein VITISV_032710 [Vitis vinifera]
Length=861

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++ KTP+EL+ G KPS  H  VWGC + VR YNP  KKLDP+TIS FF+GY   S+  
Sbjct  363  SKSVLKTPYELWSGKKPSXHHFHVWGCKAXVRPYNPQSKKLDPKTISGFFVGYCIGSRXS  422

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RFYCP  TTRI+ES    + ED++
Sbjct  423  RFYCPSXTTRIIESBRVVYFEDEV  446



>emb|CAN78069.1| hypothetical protein VITISV_032701 [Vitis vinifera]
Length=1381

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  684  SKAVAKTPYELWTSKKPSIRHLHVWGCPAEARPYKPNEKKLDSRTVSCYFVGYSERSRGF  743

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +SGR+
Sbjct  744  KFYDPS-TRSFFETGNAKFIEDVELSGRE  771



>emb|CAN81793.1| hypothetical protein VITISV_020571 [Vitis vinifera]
Length=1193

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  511  SKAVAKTPYELWTSKKPSIRHLHVWGCPAEARPYKPNEKKLDSRTVSCYFVGYSERSRGF  570

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +SGR+
Sbjct  571  KFYDPS-TRSFFETGNAKFIEDVELSGRE  598



>emb|CAN64450.1| hypothetical protein VITISV_023114 [Vitis vinifera]
Length=738

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  178  SKAVAKTPYELWTSKKPSIRHLHVWGCPAEARPYKPNEKKLDSRTVSCYFVGYSERSRGF  237

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +SGR+
Sbjct  238  KFYDPS-TRSFFETGNAKFIEDVELSGRE  265



>emb|CAN64073.1| hypothetical protein VITISV_038270 [Vitis vinifera]
Length=1181

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  464  SKAVAKTPYELWTSKKPSIRHLHVWGCPAEARPYKPNEKKLDSRTVSCYFVGYSERSRGF  523

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +SGR+
Sbjct  524  KFYDPS-TRSFFETGNAKFIEDVELSGRE  551



>emb|CDF77009.1| hypothetical transposable element-related protein, partial [Boechera 
divaricarpa]
Length=1350

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            T+A  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD RT+S++FIGY++ S+GY
Sbjct  644  TEATAKTPYELWTGRKPSLKHFHIWGCPAEARPYRPHEKKLDSRTVSSYFIGYSERSRGY  703

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P     I E+  A F ED+   GR+
Sbjct  704  KFYDPT-LRNIFETGTATFFEDNEFRGRN  731



>ref|XP_009587139.1| PREDICTED: uncharacterized protein LOC104084888 [Nicotiana tomentosiformis]
Length=285

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  41   GWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVE  220
            G KPSL H+ VWG P+E R+YNP EKKLD RT+S +FIGY + SKGY FY P H++ IVE
Sbjct  116  GRKPSLRHLHVWGFPAEARVYNPQEKKLDSRTVSGYFIGYLEKSKGYVFYYPNHSSGIVE  175

Query  221  SRNAKFLEDDLISG  262
            + N +F+E   +SG
Sbjct  176  TGNTRFIESGEVSG  189



>emb|CAN74511.1| hypothetical protein VITISV_011891 [Vitis vinifera]
Length=1283

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP+E + Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  566  SKAVAKTPYELWTSKKPSIRHLHVWGCPAEAKPYKPNEKKLDSRTVSCYFVGYSERSRGF  625

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +SGR+
Sbjct  626  KFYDPS-TRSFFETGNAKFIEDVELSGRE  653



>emb|CAN65284.1| hypothetical protein VITISV_038283 [Vitis vinifera]
Length=999

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP+EL+   K S  +  VWGC +EVR YNP  KKLDP+TI+ FF+GY   S+G 
Sbjct  408  SKSVPKTPYELWSEKKLSFRYFHVWGCKAEVRPYNPQSKKLDPKTINGFFVGYCIGSRGC  467

Query  182  RFYCPKHTTRIVESRNAKFLEDDL  253
            RFYCP HTTR +ES    + ED++
Sbjct  468  RFYCPSHTTRNIESNRDVYFEDEV  491



>emb|CAN83745.1| hypothetical protein VITISV_025094 [Vitis vinifera]
Length=855

 Score =   102 bits (253),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K + KTP++L+ G KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  490  SKTVAKTPYKLWTGKKPSIRHLHVWGCPAEARSYKPNEKKLDSRTVSCYFVGYSKRSRGF  549

Query  182  RFYCPKHTTRIVESRNAKFLEDD  250
            +FY    T  + E+ NAKF+ED+
Sbjct  550  KFY-DLSTRSLFETGNAKFIEDE  571



>emb|CAN67821.1| hypothetical protein VITISV_025855 [Vitis vinifera]
Length=1356

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  645  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  704

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P     I E+  A F ED    GR+
Sbjct  705  KFYDPA-IRSIFETGTATFFEDVEFGGRN  732



>emb|CAN74421.1| hypothetical protein VITISV_010977 [Vitis vinifera]
Length=972

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  536  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARSYKPHEKKLDSKTVSSYFIGYAERSRGF  595

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P   + I E   A F ED    GR+
Sbjct  596  KFYDPAIRS-IFEMGTATFFEDVEFGGRN  623



>emb|CAN61557.1| hypothetical protein VITISV_035097 [Vitis vinifera]
Length=423

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K + KTP+EL+   KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY + S+G+
Sbjct  52   SKTVAKTPYELWTSKKPSIRHLHVWGCPAEARPYKPNEKKLDSRTVSCYFVGYYERSRGF  111

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +S R+
Sbjct  112  KFYDPS-TRSFFETGNAKFIEDVELSERE  139



>emb|CAN63402.1| hypothetical protein VITISV_030427 [Vitis vinifera]
Length=1403

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  785  SKAVAKTPYELWTSKKPSIRHLHVWGCPTEARPYKPNEKKLDSRTMSCYFVGYSERSRGF  844

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +S R+
Sbjct  845  KFYDPS-TRSFFETGNAKFIEDVELSERE  872



>emb|CAN72835.1| hypothetical protein VITISV_027171 [Vitis vinifera]
Length=888

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K + KTP EL+   KPS+ H+ VWGCP+EVR Y P+EKKLD RT+S +F+GY + S+G+
Sbjct  438  SKVVAKTPHELWTSKKPSIRHLHVWGCPAEVRPYKPNEKKLDSRTVSCYFVGYYERSRGF  497

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E  NAKF+ED  +SGR+
Sbjct  498  KFYDPS-TRSFFEMGNAKFIEDVELSGRE  525



>emb|CAN69408.1| hypothetical protein VITISV_014748 [Vitis vinifera]
Length=1148

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KAIPKTPFEL+   KPSL H+ +WGCP+EVRIYNPHEKKLD RTIS +FIGY  + KG 
Sbjct  644  SKAIPKTPFELWTSRKPSLRHIHIWGCPTEVRIYNPHEKKLDSRTISGYFIGYPDNRKGT  703

Query  182  RF  187
             F
Sbjct  704  DF  705



>emb|CAN82869.1| hypothetical protein VITISV_019901 [Vitis vinifera]
Length=1083

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  438  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  497

Query  182  RFYCPKHTTRIVESRNAKFLED  247
            +FY P     I E+  A F ED
Sbjct  498  KFYDPA-IRSIFETGTATFFED  518



>emb|CAN74363.1| hypothetical protein VITISV_002579 [Vitis vinifera]
Length=687

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K + KTP+EL+   KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY++  +G+
Sbjct  52   SKTVVKTPYELWISKKPSIRHLHVWGCPAEARPYKPNEKKLDSRTVSCYFVGYSERLRGF  111

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +SGR+
Sbjct  112  KFYDPS-TRSFFETGNAKFIEDVELSGRE  139



>ref|XP_008340335.1| PREDICTED: uncharacterized protein LOC103403295 [Malus domestica]
Length=940

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++   PFE + G +PS  H  +WGC +E R YNP+EKKLDPRT+S  F+GY++ SKG+
Sbjct  770  SKSVTVVPFEAWTGRRPSFNHFHIWGCKAEARFYNPNEKKLDPRTMSCRFVGYSEKSKGF  829

Query  182  RFYCPKHTTRIVESRNAKFLED  247
            +FYC    +RI+E+ NAKF+++
Sbjct  830  KFYCQHGPSRIMETHNAKFVKE  851



>emb|CAN69052.1| hypothetical protein VITISV_007852 [Vitis vinifera]
Length=1104

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP E R Y P+EKKLD + +S +F+GY++ S+G+
Sbjct  488  SKAVAKTPYELWTSKKPSIRHLHVWGCPVEARPYKPNEKKLDSKIVSCYFVGYSERSRGF  547

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGR  265
            +FY P   +   E+ NAKF+ED  +SGR
Sbjct  548  KFYSPSSRS-FFETGNAKFIEDVELSGR  574



>emb|CAN76092.1| hypothetical protein VITISV_027115 [Vitis vinifera]
Length=887

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ ++ VWGCP E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  236  SKAVAKTPYELWTSKKPSIRYLHVWGCPVEARPYKPNEKKLDSRTMSCYFVGYSERSRGF  295

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  +    E+ NAKF+ED  +SGR+
Sbjct  296  KFYDPS-SRSFFETGNAKFIEDVELSGRE  323



>emb|CAN71183.1| hypothetical protein VITISV_033416 [Vitis vinifera]
Length=1255

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 56/89 (63%), Gaps = 24/89 (27%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA+ KTPFEL K                        EKKLDPRTIS +FIGY + SKGY
Sbjct  716  TKAVLKTPFELLK------------------------EKKLDPRTISGYFIGYVEKSKGY  751

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFYCP H+TRIVESRNAKFLE DL+ G D
Sbjct  752  RFYCPSHSTRIVESRNAKFLEYDLVXGSD  780



>gb|ABF95712.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=1057

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+E +   KPSL H+R WGCP+E R Y P+EKKLD RTIS++F+GYA+ S GY
Sbjct  611  TKATNKTPYEHWTNKKPSLNHVRTWGCPAEARPYRPNEKKLDFRTISSYFVGYAERSMGY  670

Query  182  RFYCPKHTTRIVESRNAKFLED  247
            +F+ P  T  I E+ NAKF ED
Sbjct  671  KFFDPT-TKAIFETGNAKFFED  691



>emb|CAN74826.1| hypothetical protein VITISV_043646 [Vitis vinifera]
Length=467

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP++L+   KPS+ H+ VWGCP++ R Y P+EKKLD RT+S FF+GY + S+G+
Sbjct  31   SKAVAKTPYKLWTXKKPSIRHLHVWGCPAKARPYKPNEKKLDSRTMSCFFVGYFERSRGF  90

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E  NAKF+ED  +SG++
Sbjct  91   KFYDPS-TRSFFEIGNAKFIEDVELSGKE  118



>emb|CAN66083.1| hypothetical protein VITISV_028833 [Vitis vinifera]
Length=1090

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL  G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  433  TKAAAKTPYELCTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  492

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY       I E+  A F ED    GR+
Sbjct  493  KFY-DLAIRSIFETGTATFFEDVEFGGRN  520



>emb|CAN75475.1| hypothetical protein VITISV_006889 [Vitis vinifera]
Length=1028

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP+E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  565  SKAVAKTPYELWTSKKPSIRHLHVWGCPAEARPYKPNEKKLDSRTVSCYFVGYSKRSRGF  624

Query  182  RFYCPKHTTRIVESRNAKFLED  247
            +FY P  T    E+ NAKF++D
Sbjct  625  KFYDPS-TRSFFETSNAKFIKD  645



>emb|CAN61880.1| hypothetical protein VITISV_018026 [Vitis vinifera]
Length=1001

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KAI KTP+EL+   KPS+ H+ +WGCP+E R Y P+EKKLD +T+S +F+GY++ S+G+
Sbjct  604  SKAIAKTPYELWTSKKPSIRHLHIWGCPAEARPYKPNEKKLDSKTVSCYFLGYSKRSRGF  663

Query  182  RFYCPKHTTRIVESRNAKFLED  247
            +FY P  T    E+ NAKF+ED
Sbjct  664  KFYDP-STRSFFETGNAKFIED  684



>emb|CAN71426.1| hypothetical protein VITISV_002521 [Vitis vinifera]
Length=1489

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+  + VWGCP+E R Y P+EKKLD R +S +F+GY++ S+G+
Sbjct  896  SKAVAKTPYELWTSKKPSIRLLHVWGCPAEARPYKPNEKKLDSRIVSCYFVGYSERSRGF  955

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E  NAKF+ED  +SGR+
Sbjct  956  KFYDPS-TRSFFEMGNAKFIEDVELSGRE  983



>emb|CAN83623.1| hypothetical protein VITISV_010870 [Vitis vinifera]
Length=1601

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +2

Query  2     TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
             TK   KTP+EL+ G K SL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  956   TKVAAKTPYELWTGRKSSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  1015

Query  182   RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
             +FY P     I E+  A F ED    GR+
Sbjct  1016  KFYDPA-IRSIFETGTATFFEDVEFGGRN  1043



>emb|CAN67457.1| hypothetical protein VITISV_039473 [Vitis vinifera]
Length=558

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ K+P+EL+   KPS+ H+ VWGCP E R Y P+EKKLD RT+S +F+GY + S+G+
Sbjct  445  SKAVAKSPYELWTSKKPSIRHLHVWGCPIEARPYKPNEKKLDSRTVSCYFVGYFERSRGF  504

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF ED  +S R+
Sbjct  505  KFYDPS-TRSFFETVNAKFSEDVELSERE  532



>emb|CAN70156.1| hypothetical protein VITISV_016168 [Vitis vinifera]
Length=1015

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  579  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  638

Query  182  RFYCPKHTTRIVESRNAKFLEDD  250
            +FY P       ++RN  F E++
Sbjct  639  KFYDPAIRN---QARNIVFEEEE  658



>emb|CAN78206.1| hypothetical protein VITISV_023427 [Vitis vinifera]
Length=339

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 57/89 (64%), Gaps = 17/89 (19%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            T  + KT FEL+K                 VR+YN  E KLD RTIS +FIGY++ SKGY
Sbjct  122  TNVVLKTSFELWK-----------------VRVYNLQENKLDSRTISVYFIGYSERSKGY  164

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            RFY P H T+IVE RNAKFLE+DLISG +
Sbjct  165  RFYYPSHNTKIVEVRNAKFLENDLISGSN  193



>emb|CAN78154.1| hypothetical protein VITISV_032622 [Vitis vinifera]
Length=1250

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  521  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  580

Query  182  RFYCPKHTTRIVESRNAKFLEDD  250
            +FY P       ++RN  F E++
Sbjct  581  KFYDPAIRN---QARNIVFEEEE  600



>emb|CAN81238.1| hypothetical protein VITISV_031073 [Vitis vinifera]
Length=1354

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G+
Sbjct  690  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGF  749

Query  182  RFYCPKHTTRIVESRNAKFLEDD  250
            +FY P       ++RN  F E++
Sbjct  750  KFYDPAIRN---QARNIVFEEEE  769



>emb|CAN83824.1| hypothetical protein VITISV_040849 [Vitis vinifera]
Length=702

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP+E R Y  +EKKL+ R +S +F+GY + S+G+
Sbjct  153  SKAVAKTPYELWTSKKPSIRHLHVWGCPTEARPYKLNEKKLNSRIVSCYFVGYFERSRGF  212

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +SGR+
Sbjct  213  KFYDPS-TRSFFETGNAKFIEDVELSGRE  240



>ref|XP_004516035.1| PREDICTED: uncharacterized protein LOC101492305, partial [Cicer 
arietinum]
Length=1216

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H+ VWGCP+E R Y P+EKK +PRTIS++FIGY++ S+GY
Sbjct  210  TKAAAKTPYELWIGRKPSLKHLHVWGCPAEARPYRPNEKKFEPRTISSYFIGYSEKSRGY  269

Query  182  RFYCPK  199
            +FY P+
Sbjct  270  KFYDPQ  275



>emb|CAN77298.1| hypothetical protein VITISV_022386 [Vitis vinifera]
Length=853

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KP+  H+ VWGCP+E R Y P+EKKLD RT+S +F+ Y++  +G+
Sbjct  273  SKAVAKTPYELWTSKKPNSRHLHVWGCPTEARPYKPNEKKLDSRTVSCYFVRYSEKLRGF  332

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P   +   E+ NAKF+ED  +SGR+
Sbjct  333  KFYDPSSRS-FFETGNAKFIEDVELSGRE  360



>emb|CAN62045.1| hypothetical protein VITISV_040357 [Vitis vinifera]
Length=1290

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWG P+E R Y P+EKKLD R +S +F+GY + S+G+
Sbjct  582  SKAVAKTPYELWTSKKPSISHLHVWGYPAEARPYKPNEKKLDSRIVSCYFVGYFERSRGF  641

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P       E+ NAKF+ED  +SGR+
Sbjct  642  KFYDPS-IRSFFETGNAKFIEDVELSGRE  669



>emb|CAN72447.1| hypothetical protein VITISV_027001 [Vitis vinifera]
Length=1051

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ H+ VWGCP++ R Y  +EKKLD RT++ +F+GY++ S+G+
Sbjct  431  SKAVAKTPYELWTSKKPSIRHLHVWGCPTKARPYKSNEKKLDFRTVNCYFVGYSERSRGF  490

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P   +   E  NAKF+ED  +SGR+
Sbjct  491  KFYDPSLRS-FFEMGNAKFIEDVELSGRE  518



>emb|CAN77511.1| hypothetical protein VITISV_036216 [Vitis vinifera]
Length=1185

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +  + KTP+EL+   KPS+ H+ VWG P+E R Y P+E KLD RT+S +F+GY++ S+G+
Sbjct  589  STVVTKTPYELWISKKPSIRHLHVWGYPAEARPYKPNENKLDSRTMSCYFVGYSERSRGF  648

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T  + E+ NAKF+ED  +SGR+
Sbjct  649  KFYNPS-TRSLFETGNAKFIEDVELSGRE  676



>ref|XP_006603235.1| PREDICTED: uncharacterized protein LOC100778101 [Glycine max]
Length=471

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+ G + S+ H  +WGCP+E R Y P+E+KLD RTIS +F+GYA+ S+GY
Sbjct  310  SKAVNKTPYELWTGKRSSIKHFHIWGCPAEARPYRPYERKLDSRTISCYFVGYAERSRGY  369

Query  182  RFYCPKHTTRIVESRNAKFLE  244
            +FY P   +   E+ N +FLE
Sbjct  370  KFYNPTLRS-FFETGNVRFLE  389



>ref|XP_006603522.1| PREDICTED: uncharacterized protein LOC102659641 [Glycine max]
Length=412

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK + +TP +L+ G KPSL +  VWGCP+E R Y P+E+KLD +T+S++FIGY++ S+GY
Sbjct  319  TKTVAETPSKLWVGRKPSLKNFHVWGCPAEARPYKPNERKLDSQTVSSYFIGYSKRSRGY  378

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGR  265
            +FY PK  T I E+  A F ED    GR
Sbjct  379  KFYDPKLKT-IFETGIATFFEDIEFGGR  405



>emb|CAN74042.1| hypothetical protein VITISV_012948 [Vitis vinifera]
Length=702

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = +2

Query  5    KAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYR  184
            KAI KTP+EL+   KPS+ H+  WGC ++ R Y P+EKKLD RT+S +F+GY++ S+G++
Sbjct  480  KAIAKTPYELWTSKKPSIRHLHAWGCIADARPYKPNEKKLDSRTVSYYFVGYSERSRGFK  539

Query  185  FYCPKHTTRIVESRNAKFLEDDLISGRD  268
            FY P  T    E+ NAKF+E+  +S R+
Sbjct  540  FYDPS-TRSFFETDNAKFIENVELSERE  566



>ref|XP_006574181.1| PREDICTED: uncharacterized protein LOC102663039 [Glycine max]
Length=307

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+ G +PS+ H+ +WGCP+E + Y PH++KLD RTI+ +F+GYA+ S+GY
Sbjct  233  SKAVNKTPYELWTGKRPSIKHLHIWGCPAEAQPYRPHKRKLDLRTINCYFVGYAKRSRGY  292

Query  182  RFYCP  196
            +FY P
Sbjct  293  KFYNP  297



>emb|CAN81241.1| hypothetical protein VITISV_031076 [Vitis vinifera]
Length=838

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS++H+ VWGCP E R Y  +EKKLD RT++ +F+ Y++ S+G+
Sbjct  652  SKAVAKTPYELWTSKKPSIWHLHVWGCPVEARPYKTNEKKLDSRTVNYYFVRYSKRSRGF  711

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  +  + E+ NAKF++D  +SG++
Sbjct  712  KFYDPP-SKSLFETGNAKFIKDVELSGKE  739



>emb|CAN61645.1| hypothetical protein VITISV_036929 [Vitis vinifera]
Length=1014

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 57/89 (64%), Gaps = 10/89 (11%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T+S++FIGYA+ S+G 
Sbjct  593  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVSSYFIGYAERSRGQ  652

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
             F          E+  A F ED    GR+
Sbjct  653  FF----------ETGTATFFEDVEFGGRN  671



>ref|XP_006606826.1| PREDICTED: uncharacterized protein LOC100808452 [Glycine max]
Length=441

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K + K P+EL+ G +PS+ H+ +WGC +E R Y P+EK LD RTIS +F+ YA+ S+GY
Sbjct  352  SKVVNKNPYELWTGKRPSIKHLHIWGCAAEARPYRPYEKTLDSRTISCYFVSYAEHSRGY  411

Query  182  RFYCPKHTTR-IVESRNAKFLED  247
            +FY P  T R   E  NA+FLE+
Sbjct  412  KFYNP--TLRFFFEVGNARFLEE  432



>emb|CAN62491.1| hypothetical protein VITISV_031832 [Vitis vinifera]
Length=1007

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+   KPS+ ++ V GC  E R Y P+EKKLD RT+S +F+GY++ S+G+
Sbjct  399  SKAVAKTPYELWTSKKPSIRNLHVXGCLVEARPYKPNEKKLDSRTVSCYFVGYSEMSRGF  458

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E  NAKF+ED  +S R+
Sbjct  459  KFYDPS-TXSFFEXGNAKFIEDVELSRRE  486



>emb|CAN71504.1| hypothetical protein VITISV_021017 [Vitis vinifera]
Length=649

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KT +EL+   KPS+ ++ VWG P E R Y P+EKKLD RT S +F+GY + S+G+
Sbjct  173  SKAVTKTLYELWTSKKPSIRNLHVWGYPIEARPYKPNEKKLDFRTGSCYFVGYFERSRGF  232

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E  NAKF+ED  +SGR+
Sbjct  233  KFYDPL-TRCFFEMGNAKFIEDIKLSGRE  260



>emb|CAN65807.1| hypothetical protein VITISV_033388 [Vitis vinifera]
Length=1086

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K +  TP+EL+   KPS++H+ VWGC +E   Y  +EKKL+ RT+S +F+GY +  +G+
Sbjct  617  SKVVAXTPYELWTSKKPSIWHLHVWGCLAEATPYKLNEKKLNSRTMSCYFVGYPERLRGF  676

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P       E+ NAKF+ED  +SGR+
Sbjct  677  KFYDPL-IRSFFETGNAKFIEDVELSGRE  704



>ref|XP_004295969.1| PREDICTED: uncharacterized protein LOC101308855 [Fragaria vesca 
subsp. vesca]
Length=2312

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  32    LFKGWK-PSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTT  208
             + +GWK  ++  +  W   +E R YNP+E KLDP+T+SA FIGY + SKGY+FYCP H+ 
Sbjct  1377  MLQGWKGRTIMALSFWKPTAEARPYNPNESKLDPKTVSASFIGYCEHSKGYKFYCPTHSH  1436

Query  209   RIVESRNAKFLED  247
             RI+E+  A FL +
Sbjct  1437  RIMETNKAVFLNE  1449



>emb|CAN75957.1| hypothetical protein VITISV_012562 [Vitis vinifera]
Length=831

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  80   CPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLEDDL  253
            C +EVR+YNP  KKLDP+TIS FF+GY   S+G RFYCP HTTRI+ES    + ED +
Sbjct  207  CKAEVRLYNPQSKKLDPKTISGFFVGYCIGSRGSRFYCPSHTTRIIESDRVIYFEDKV  264



>emb|CAN64743.1| hypothetical protein VITISV_006459 [Vitis vinifera]
Length=821

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  80   CPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLED  247
            C ++VR+YNP  KKLDP+TIS FF+GY   S+G RFYCP HTTRI+ES    + ED
Sbjct  228  CKAKVRLYNPQSKKLDPKTISGFFVGYCIGSRGSRFYCPSHTTRIIESDRVIYFED  283



>gb|ADJ18449.1| gag/pol protein [Bryonia dioica]
Length=1292

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++ +TP+EL+KG K SL + R+WGCP+ V + NP  KKL+PR+    F+GY + S+G 
Sbjct  646  SKSVLETPYELWKGRKSSLRYFRIWGCPAHVLVQNP--KKLEPRSKLCLFVGYPKESRGG  703

Query  182  RFYCPKHTTRIVESRNAKFLEDD  250
             FY P+   ++  S NA FLE+D
Sbjct  704  LFYHPQE-NKVFVSTNATFLEED  725



>emb|CAN62130.1| hypothetical protein VITISV_019730 [Vitis vinifera]
Length=438

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    KAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYR  184
            K I KTP+EL+KG+ P++ ++RVWGC ++V    P ++KL P+T  A FIGYA++S  YR
Sbjct  133  KRIGKTPYELWKGYAPNIAYLRVWGCLAKVLFLEPKKRKLAPKTFDAMFIGYAKNSXTYR  192

Query  185  FYCPK------HTTRIVESRNAKFLED  247
            F   K          I+E++N  F E+
Sbjct  193  FLVTKLENSXVDVNTIIETKNVDFFEN  219



>ref|XP_004980714.1| PREDICTED: uncharacterized protein LOC101780104 [Setaria italica]
Length=146

 Score = 75.9 bits (185),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSK  175
            +K + KTP+EL+ G +PSL ++RVWGCP+E +++NP+  KLDP+T+S  FIGY + SK
Sbjct  16   SKLVSKTPYELWTGQEPSLNYLRVWGCPAEEKVFNPNIGKLDPKTVSCHFIGYPEKSK  73



>gb|ABA94675.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=815

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  83   PSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLEDDLISG  262
            P+E +++NP+  KLDP+T+S  FIGY + SKG+ FYCP   T+ VE+R+A FLEDD++SG
Sbjct  515  PTEAKLFNPNIGKLDPKTVSCHFIGYPEKSKGFHFYCPDRHTKFVETRHAVFLEDDIVSG  574



>gb|ABN08353.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=114

 Score = 75.1 bits (183),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+EL+KG+KPSL +++VWGC ++V + +P ++K+  +T    FIGYA++S  YRF   
Sbjct  19   KTPYELWKGYKPSLKYLKVWGCLAKVMLPDPKKRKIGFKTSDCLFIGYAENSAAYRFLVL  78

Query  197  K----HTTRIVESRNAKFLED  247
            +        IVE++N  FLE+
Sbjct  79   QSDVLSCNTIVETKNVDFLEN  99



>emb|CAN73567.1| hypothetical protein VITISV_003451 [Vitis vinifera]
Length=1277

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    KAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYR  184
            K   KTP+EL+KG KPS  ++R+WGC ++V +  P + K+ P+TI   FIGYA +S  YR
Sbjct  673  KKAEKTPYELWKGRKPSYTYLRMWGCLAKVAVPPPKKVKIGPKTIDCIFIGYAHNSNAYR  732

Query  185  FYCPK------HTTRIVESRNAKFLED  247
            F   +      H   I+ESRNA F ED
Sbjct  733  FLVYESNIPDIHKNTIMESRNASFFED  759



>emb|CAN66637.1| hypothetical protein VITISV_011340 [Vitis vinifera]
Length=1316

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = +2

Query  5    KAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYR  184
            K   KTP+EL+KG KPS  ++R+WGC ++V +  P + K+ P+TI   FIGYA +S  YR
Sbjct  673  KKAEKTPYELWKGRKPSYTYLRMWGCLAKVAVPPPKKVKIGPKTIDCIFIGYAHNSNAYR  732

Query  185  FYCPK------HTTRIVESRNAKFLED  247
            F   +      H   I+ESRNA F ED
Sbjct  733  FLVYESNIPDIHKNTIMESRNASFFED  759



>ref|XP_006344599.1| PREDICTED: uncharacterized protein LOC102579723 [Solanum tuberosum]
Length=1145

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  86   SEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLEDDLISG  262
            +E  +YNPHE KLD RT+S + IGY + SKGY FY P H++R VES N +F+E   +SG
Sbjct  53   AEYTVYNPHETKLDSRTVSGYLIGYPEKSKGYMFYYPNHSSRTVESSNTRFIEHGKVSG  111



>gb|EZA50979.1| Copia protein [Cerapachys biroi]
Length=193

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
             TP+EL++G KP + H+R +G    V   NP++ K +PR+I   FIGYA +SKGYR + P
Sbjct  72   NTPYELWQGEKPDIGHLRTFGSKVFVLNKNPNKGKFEPRSIEGIFIGYADASKGYRVWIP  131

Query  197  KHTTRIVESRNAKFLE  244
            K  ++IV +R+ KFLE
Sbjct  132  KD-SKIVIARDVKFLE  146



>gb|ABI34376.1| Polyprotein, putative [Solanum demissum]
Length=380

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K +P TP +L+ G KPSL H+RVWGCP+ V       +KL+P+T    FIG  + +KG 
Sbjct  45   SKFVPLTPIQLWTGHKPSLKHVRVWGCPAHV--LKGKTEKLEPKTEVCVFIGCPKGTKGG  102

Query  182  RFYCPKHTTRIVESRNAKFLEDDLIS  259
             FY PK    IV + NAKFLE D ++
Sbjct  103  MFYNPKEKKVIVTT-NAKFLEKDFLA  127



>emb|CAN68929.1| hypothetical protein VITISV_044375 [Vitis vinifera]
Length=974

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  86   SEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLEDDL  253
            +EVR YNP  KKLDP+TIS FF+GY   S+G  FYCP HTTRI+ES  A + ED++
Sbjct  212  AEVRPYNPQSKKLDPKTISGFFVGYYIGSRGSGFYCPSHTTRIIESDRAVYFEDEV  267



>ref|XP_010089825.1| hypothetical protein L484_022341 [Morus notabilis]
 gb|EXB38441.1| hypothetical protein L484_022341 [Morus notabilis]
Length=145

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            TK++PKTP E++ G K SL H+R+WGC + V   +    KL+ R+    F+GY + +KG 
Sbjct  28   TKSVPKTPHEVWTGRKTSLNHIRIWGCLAHV--LDKEANKLEARSEVCIFVGYLRGTKGG  85

Query  182  RFYCPKHTTRIVESRNAKFLEDDLIS  259
             FY PK   ++V S NA FLE+  I+
Sbjct  86   YFYNPKE-NKVVVSTNATFLEESYIN  110



>emb|CAE05252.2| OSJNBb0115I09.14 [Oryza sativa Japonica Group]
Length=853

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   HMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFL  241
             +  +    + +I+NP  KKLDP+T+S  FIGY ++SKGYRFYCP   T+ +E+R+A FL
Sbjct  546  QLHTYSIEFQAKIFNPQLKKLDPKTVSCHFIGYPETSKGYRFYCPDRVTKFLETRHAVFL  605

Query  242  EDDLISG  262
            E++ + G
Sbjct  606  ENNEVCG  612



>emb|CAX68207.1| Copia-like retrotransposon [Helianthus annuus]
Length=1358

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            ++ IP +P+EL+KG KP+L H+RVWGC +  R+ +P   KL  R   + FIGYA  SK Y
Sbjct  695  SRVIPTSPYELWKGRKPNLEHLRVWGCLAYYRVPDPKTLKLGERAFKSVFIGYASHSKSY  754

Query  182  RFYCPKHTTRIVESRNAKFLED  247
            R      +  +VESR+ +F E+
Sbjct  755  RL-LDDESGIVVESRDVEFFEN  775



>gb|ABA99012.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=342

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  89   EVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLEDDLISG  262
            E +++NP+  KL+P+T+S  FIGY++ SKGYRFYCP   T+ VE+ +  FLED++I G
Sbjct  193  EAKVFNPNLGKLNPKTVSCHFIGYSERSKGYRFYCPNSCTKFVETIHTVFLEDEMIRG  250



>gb|ABF95851.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1075

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
             K    TP+EL+KG KP+L  ++VWGC ++V I    ++KL P+T+   FIGYAQ+S  Y
Sbjct  538  AKGTEVTPYELWKGRKPNLNFLKVWGCLAKVNIPVVKKRKLGPKTVDCVFIGYAQNSLAY  597

Query  182  RFYCPKHTT------RIVESRNAKFLED  247
            RF   K  T       ++ESR+  F ED
Sbjct  598  RFLVVKSETTEVRENTVMESRDTTFFED  625



>ref|WP_036673399.1| hypothetical protein, partial [Pediococcus pentosaceus]
Length=325

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 3/88 (3%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+ KTP+EL+ G  P   ++R+WGCP+ V+       KLD R+   +F+GY ++S GY
Sbjct  162  SKAVNKTPYELWMGRPPKYSYLRIWGCPAYVK--QAVGGKLDSRSTLCYFVGYPKNSVGY  219

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGR  265
             FY P   T++  SRNA FLE + +  R
Sbjct  220  YFYHPTE-TKVFVSRNATFLEKEFLLDR  246



>emb|CAN75131.1| hypothetical protein VITISV_024973 [Vitis vinifera]
Length=862

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  83   PSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLEDDLI  256
            P+EV+IY+P  KK D RT   +FIGY   SKGY+FYC    TR+VES+ AKFL+ D++
Sbjct  455  PTEVKIYDPSLKKTDSRTTRCYFIGYPSHSKGYKFYCSTRGTRVVESQVAKFLDLDVV  512



>ref|XP_004150929.1| PREDICTED: uncharacterized protein LOC101213227 [Cucumis sativus]
Length=513

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 3/77 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++ +TP+EL KG K SL H R+WGCP+ V + NP  KKL+ R+   FFIGY + S+G 
Sbjct  417  SKSVSETPYELEKGRKGSLRHFRIWGCPAHVLVQNP--KKLEHRSKLCFFIGYPKESRGG  474

Query  182  RFYCPKHTTRIVESRNA  232
             FY P+   +I+ S NA
Sbjct  475  LFYDPQE-NKILVSTNA  490



>emb|CAN59916.1| hypothetical protein VITISV_016016 [Vitis vinifera]
Length=310

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +2

Query  71   VWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLEDD  250
            V  CP E R Y P+EKKLD RT S +F+GY++ S+G++FY P  T    E+ NAKF+ED 
Sbjct  28   VRSCPXEARXYKPNEKKLDSRTXSCYFVGYSKRSRGFKFYDPS-TRSFFETGNAKFIEDV  86

Query  251  LISGRD  268
             +SGR+
Sbjct  87   ELSGRE  92



>emb|CAN78764.1| hypothetical protein VITISV_003317 [Vitis vinifera]
Length=1375

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 17/88 (19%)
 Frame = +2

Query  5    KAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYR  184
            KA+ +TP+EL+   KPS+ H+ VWGC  E R Y P+EKKLD +T+S +F+G+        
Sbjct  634  KAVAQTPYELWTSKKPSIRHLHVWGCSVEARPYKPNEKKLDSKTVSYYFVGF--------  685

Query  185  FYCPKHTTRIVESRNAKFLEDDLISGRD  268
            F+         E+ N KF+ED  +SGR+
Sbjct  686  FF---------ETSNXKFIEDVELSGRE  704



>emb|CAN68020.1| hypothetical protein VITISV_003621 [Vitis vinifera]
Length=1180

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 26/89 (29%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+PKTPFEL+                +E RIYNPHEKKLD RT+S +FIGY   SKG 
Sbjct  618  SKAVPKTPFELW---------------TAEARIYNPHEKKLDSRTVSGYFIGYPDKSKG-  661

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
                      IVE+ NA+FLE+  ISG +
Sbjct  662  ----------IVETGNARFLENGEISGSN  680



>emb|CAN64685.1| hypothetical protein VITISV_020338 [Vitis vinifera]
Length=1213

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 12/89 (13%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K + KTP+EL+   KPS+ H+ VWGCP+EVR Y P+EK   P           + S+G+
Sbjct  297  SKVVAKTPYELWTRKKPSIRHLHVWGCPTEVRPYKPNEKNWTP-----------ELSRGF  345

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            +FY P  T    E+ NAKF+ED  +SGR+
Sbjct  346  KFYDPS-TRSFFETGNAKFIEDVELSGRE  373



>gb|AAR01713.1| putative Gag and Pol polyprotein, 3'-partial [Oryza sativa Japonica 
Group]
Length=217

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  33   KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  92

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  93   KSEVPDMHVGTIMESRDATFFE  114



>ref|XP_010099335.1| hypothetical protein L484_000113 [Morus notabilis]
 gb|EXB77770.1| hypothetical protein L484_000113 [Morus notabilis]
Length=294

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +KA+P TP+E + G K SL H R+WGCP+ V        KL  R+    F+GY + +KGY
Sbjct  28   SKAVPGTPYERWSGKKSSLGHTRIWGCPTHV--LRKKTGKLASRSELCLFVGYPKGTKGY  85

Query  182  RFYCPKHTTRIVESRNAKFLEDDLI  256
             FY P      V S NA FLE+D +
Sbjct  86   IFYSPTDQKTFV-STNAHFLEEDFV  109



>emb|CAE04792.1| OSJNBb0018J12.5 [Oryza sativa Japonica Group]
Length=1320

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R+WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRIWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVLDMHVGTIIESRDATFFE  721



>gb|ABA98797.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1243

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  581  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  640

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A FLE
Sbjct  641  KSEVPDMHVGTIMESRDATFLE  662



>gb|AAP94586.1| putative retrotransposon RIRE1 poly protein [Zea mays]
Length=1309

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            TP+E FKG KP L H+R WGC ++V +  P ++KL P+T+   F+GYA +S  YRF    
Sbjct  658  TPYEGFKGRKPDLSHLRTWGCLAKVNVPLPKKRKLGPKTVDCVFLGYAHNSAAYRFLVVH  717

Query  200  HTTR------IVESRNAKFLE  244
              T       I+ESR+  F E
Sbjct  718  SETSEIAVNVIMESRDVTFFE  738



>ref|XP_008388960.1| PREDICTED: DNA polymerase zeta catalytic subunit-like [Malus 
domestica]
Length=2068

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +2

Query  5     KAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYR  184
             K I ++P+E++KG KP+   ++VWG  ++V++  P   KL P+TI   FIGYA +S  YR
Sbjct  1797  KXIBESPYEIWKGHKPTYKTLKVWGXLAKVQVPLPKRTKLGPKTIDXVFIGYANNSAAYR  1856

Query  185   FYCPK------HTTRIVESRNAKFLED  247
             F   K      H   I+ES +A+F ED
Sbjct  1857  FLVVKSXISDIHVNTILESADAEFFED  1883



>ref|XP_009348351.1| PREDICTED: uncharacterized protein LOC103939989 [Pyrus x bretschneideri]
Length=911

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            K+PFE+ KG    L H R++GC   V +   H  KL+PR I   F+GY+ S KGY+ Y P
Sbjct  698  KSPFEIMKGRTADLTHFRIFGCTCYVHVQANHRDKLEPRAIKCVFMGYSSSQKGYKCYNP  757

Query  197  KHTTRIVESRNAKFLEDDLI  256
             HT ++V SR+ +F  D+L+
Sbjct  758  -HTGKLVVSRDVRF--DELV  774



>emb|CAN76565.1| hypothetical protein VITISV_010942 [Vitis vinifera]
Length=839

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            T +EL+KG KPS  +++VW C ++V +  P + K+ P+TI   FIGYA +S  Y F   K
Sbjct  334  TSYELWKGHKPSYKYLKVWECLTKVVLQKPKQVKIGPKTIDCIFIGYANNSSAYHFLVHK  393

Query  200  ------HTTRIVESRNAKFLED  247
                  H   I+ESRNA F E+
Sbjct  394  SSIPDIHEDTIIESRNASFFEN  415



>emb|CAN83369.1| hypothetical protein VITISV_011463 [Vitis vinifera]
Length=1156

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +2

Query  65   MRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLE  244
            ++  GC +EVR Y P+EKKLD RT+S +F+GY++ SKG++FY P   +   E+ NAKF+E
Sbjct  579  LKDMGCLAEVRPYKPNEKKLDSRTVSCYFVGYSERSKGFKFYDPSSRS-FFETGNAKFIE  637

Query  245  DDLISGRD  268
            D  ++GR+
Sbjct  638  DVELTGRE  645



>emb|CAN65627.1| hypothetical protein VITISV_032735 [Vitis vinifera]
Length=1285

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++ KTP EL+ G KPSL H+R+WGCP+ V        KL+ +    FFIGY + +KG 
Sbjct  586  SKSVFKTPTELWTGRKPSLKHVRMWGCPTHV--LKGKTDKLETKIEFCFFIGYPRGTKGS  643

Query  182  RFYCPKHTTRIVESRNAKFLEDDLI  256
             FY PK   +I+ S NA +LE+D I
Sbjct  644  LFYSPKD-KKIIVSTNAHYLEEDYI  667



>gb|AAN64998.1| Putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF95728.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1040

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  593  KTPYEIWTGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  652

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  653  KSEVPDMHVGTIMESRDATFFE  674



>gb|ABF98935.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=593

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  395  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  454

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  455  KSEVPDMHVGTIMESRDATFFE  476



>ref|XP_006494292.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like, partial [Citrus sinensis]
Length=1304

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            TP+EL+K  KP+L ++RVWGC + VR+  P  KKL  R I   F+GYA+ SK YRF   +
Sbjct  126  TPYELWKKKKPNLSYLRVWGCRAIVRLPEPKIKKLGERGIECIFLGYAEHSKAYRFLVTE  185

Query  200  -----HTTRIVESRNAKFLED  247
                     IVESR+A F E+
Sbjct  186  PNSFVEINTIVESRDAIFYEN  206



>gb|AAK12626.1| unknown protein [Aedes aegypti]
Length=1298

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            ++++PKTPFE++ G KP L H+RV+G P+ V + +    K+DP+     F+GY+   KGY
Sbjct  617  SRSVPKTPFEMWWGRKPDLGHLRVFGSPAYVHVPDVKRSKMDPKAKRLIFVGYSMEHKGY  676

Query  182  RFYCPKHTTRIVESRNAKFLEDD  250
            RF     T  I  SR+A+F+E +
Sbjct  677  RF-VDTETDCITISRDARFIEQE  698



>emb|CAD39988.3| OSJNBb0045P24.6 [Oryza sativa Japonica Group]
Length=982

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  445  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  504

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  505  KSEVPDMHVGTIMESRDATFFE  526



>gb|AAX92916.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=713

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  33   KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  92

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  93   KSEVPDMHVGTIMESRDATFFE  114



>gb|AAS01934.1| putative Integrase core domain containing protein [Oryza sativa 
Japonica Group]
Length=1180

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  518  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  577

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  578  KSEVPDMHVGTIMESRDATFFE  599



>gb|ABF96953.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1197

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  535  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  594

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  595  KSEVPDMHVGTIMESRDATFFE  616



>emb|CAE03908.2| OSJNBb0015G09.2 [Oryza sativa Japonica Group]
Length=1039

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  449  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  508

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  509  KSEVPDMHVGTIMESRDATFFE  530



>emb|CAE02325.2| OSJNBb0112E13.7 [Oryza sativa Japonica Group]
Length=1342

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVLDMHVGTIMESRDATFFE  721



>emb|CAD40744.2| OSJNBa0072D21.4 [Oryza sativa Japonica Group]
Length=1319

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|ABF97861.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=764

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  64   KTPYEIWIGRKPSLSYLRTWGCLTKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  123

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  124  KSEVPDMHVGTIMESRDATFFE  145



>ref|XP_010110117.1| hypothetical protein L484_003433 [Morus notabilis]
 gb|EXC25220.1| hypothetical protein L484_003433 [Morus notabilis]
Length=231

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++PKTP EL+ G K SL H+R+WGCP+ V        KL+P +    F+GY Q ++G 
Sbjct  63   SKSVPKTPLELWNGQKLSLRHIRIWGCPTHV--LRQKTGKLEPWSEVCIFVGYPQGTRGG  120

Query  182  RFYCPKHTTRIVESRNAKFLEDD  250
             FY  +   ++  S NA FLE D
Sbjct  121  LFYS-QADQKVFVSTNATFLEHD  142



>emb|CAD40198.2| OSJNBb0043H09.7 [Oryza sativa Japonica Group]
Length=1302

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>emb|CAE04541.2| OSJNBa0040D17.9 [Oryza sativa Japonica Group]
Length=1319

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|ABA97938.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1320

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|ABA96419.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1095

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  433  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  492

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  493  KSEVPDMHVGTIMESRDATFFE  514



>emb|CAE03994.1| OSJNBb0089B03.8 [Oryza sativa Japonica Group]
Length=1113

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  433  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  492

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  493  KSEVPDMHVGTIMESRDATFFE  514



>gb|AAR01682.1| putative gag and pol protein [Oryza sativa Japonica Group]
Length=1302

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAU44026.2| putative polyprotein [Oryza sativa Japonica Group]
Length=1391

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  729  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  788

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  789  KSEVPDMHVGTIMESRDATFFE  810



>gb|AAT58810.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1320

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEIPDMHVGTIMESRDATFFE  721



>gb|AAR01716.1| putative Gag and Pol polyprotein [Oryza sativa Japonica Group]
Length=1302

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAK84454.1|AC087192_15 putative polyprotein [Oryza sativa Japonica Group]
Length=1308

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAP54573.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1320

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAT77367.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAU10767.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1320

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAN61480.1| Putative polyprotein from transposon TNT [Oryza sativa Japonica 
Group]
Length=1911

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>emb|CAE05795.1| OSJNBb0046K02.5 [Oryza sativa Japonica Group]
Length=1356

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVLDMHVGTIMESRDATFFE  721



>gb|ABF98853.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1320

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAT69606.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAU90098.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1320

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAT38001.1| Putative polyprotein [Oryza sativa Japonica Group]
Length=1297

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEIPDMHVGTIMESRDATFFE  721



>gb|AAK71544.1|AC087852_4 putative polyprotein [Oryza sativa Japonica Group]
Length=1308

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAX96832.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1320

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>emb|CAE03086.1| OSJNBa0017B10.1 [Oryza sativa Japonica Group]
 emb|CAD41412.2| OSJNBb0078D11.12 [Oryza sativa Japonica Group]
Length=1320

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>emb|CAH65951.1| H0716A07.9 [Oryza sativa Indica Group]
Length=1216

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  536  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  595

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  596  KSEVLDMHVGTIMESRDATFFE  617



>gb|ABA98136.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1249

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAP53927.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1297

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|ABA91250.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1320

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|ABA96779.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1468

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  727  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  786

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  787  KSEVPDMHVGTIMESRDATFFE  808



>gb|EEE51974.1| hypothetical protein OsJ_33644 [Oryza sativa Japonica Group]
Length=679

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  380  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  439

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  440  KSEVPDMHVGTIMESRDATFFE  461



>gb|AAV31347.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1059

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  749  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  808

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  809  KSEVPDMHVGTIMESRDATFFE  830



>gb|AAT93941.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1433

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVLDMHVGTIMESRDATFFE  721



>gb|ABA98555.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1361

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  725  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  784

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  785  KSEVPDMHVGTIMESRDATFFE  806



>gb|ABA99751.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1805

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17    KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
             KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  1125  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  1184

Query  197   K------HTTRIVESRNAKFLE  244
             K      H   I+ESR+A F E
Sbjct  1185  KSEVPDMHVGTIMESRDATFFE  1206



>gb|AAP68369.1| putative polyprotein, 3'-partial [Oryza sativa Japonica Group]
Length=691

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  486  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  545

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  546  KSEVPDMHVGTIMESRDATFFE  567



>gb|ABA95768.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1151

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  511  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  570

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  571  KSEVPDMHVGTIMESRDATFFE  592



>gb|ABA93952.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1336

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAR87214.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1393

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  717  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  776

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  777  KSEVPDMHVGTIMESRDATFFE  798



>gb|ABF98943.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1460

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|ABI34306.1| Polyprotein, putative [Solanum demissum]
Length=1691

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            TPFEL+KG+KPSL ++RVWGC + VR+ +P   KL  +  +  F+GYA +S  YRF+  +
Sbjct  646  TPFELWKGYKPSLGYLRVWGCLAFVRLMDPKITKLGKKVTTCAFLGYASNSTAYRFFNLE  705

Query  200  HTTRIVESRNAKFLED  247
                ++ES +A F E+
Sbjct  706  DNI-VIESGDAIFHEN  720



>gb|ABA93737.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1579

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17    KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
             KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  926   KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  985

Query  197   K------HTTRIVESRNAKFLE  244
             K      H   I+ESR+A F E
Sbjct  986   KSEVPDMHVGTIMESRDATFFE  1007



>gb|ABF97537.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1397

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  717  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  776

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  777  KSEVPDMHVGTIMESRDATFFE  798



>gb|ABA91402.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=2027

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  835  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  894

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  895  KSEVPDMHVGTIMESRDATFFE  916



>gb|AAT93940.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1861

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17    KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
             KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  1054  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  1113

Query  197   K------HTTRIVESRNAKFLE  244
             K      H   I+ESR+A F E
Sbjct  1114  KSEVPDMHVGTIMESRDATFFE  1135



>ref|XP_010110617.1| hypothetical protein L484_000603 [Morus notabilis]
 gb|EXC27156.1| hypothetical protein L484_000603 [Morus notabilis]
Length=246

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K+IPKTP EL+ G KP L H+R+WGCP+ V        KL+P++    F+GY   +K  
Sbjct  32   SKSIPKTPLELWCGRKPRLRHVRIWGCPAHV--LKGKTGKLEPKSEICMFVGYLDGTKRG  89

Query  182  RFYCPKHTTRIVESRNAKFLEDDLI  256
             FY P+   ++  S NA FLE D +
Sbjct  90   FFYSPED-QKVFVSTNATFLEHDYM  113



>emb|CAE01299.2| OSJNBa0020P07.16 [Oryza sativa Japonica Group]
Length=1314

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  612  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  671

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  672  KSEVLDMHVGIIMESRDATFFE  693



>gb|ABF98465.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1210

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  573  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  632

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  633  KSEVPDMHVGTIMESRDATFFE  654



>gb|AAK50117.1|AC087797_2 putative gag-pol polyprotein [Oryza sativa Japonica Group]
Length=1198

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  573  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  632

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  633  KSEVPDMHVGTIMESRDATFFE  654



>gb|AAG03096.2|AC073405_12 putative polyprotein [Oryza sativa Japonica Group]
 gb|AAW56890.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1274

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLVV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVSDMHVGTIMESRDAIFFE  721



>gb|ABA99473.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1287

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  601  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  660

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  661  KSEVPDMHVGTIMESRDAIFFE  682



>gb|AAX96807.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA92798.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1234

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    + KL P+T+   F+GYA  S  YRF   
Sbjct  625  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKSKLGPKTVDCIFLGYAHHSIAYRFLIV  684

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  685  KSEVPDMHVGTIMESRDATFFE  706



>ref|XP_007032925.1| Uncharacterized protein TCM_019054 [Theobroma cacao]
 gb|EOY03851.1| Uncharacterized protein TCM_019054 [Theobroma cacao]
Length=391

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  119  KLDPRTISAFFIGYAQSSKGYRFYCPKHTTRIVESRNAKFLEDDLISGRD  268
            KLDP+TIS +++GYA+ SK Y+ Y   H  RIVESRNAKFLE+DLI   D
Sbjct  65   KLDPKTISGYYVGYAERSKRYKCYYLSHNIRIVESRNAKFLENDLIRRND  114



>gb|ABA98024.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=727

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  296  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAYHSIAYRFLIV  355

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  356  KSEVPDMHVGTIMESRDATFFE  377



>emb|CAE03764.2| OSJNBa0013K16.13 [Oryza sativa Japonica Group]
Length=1264

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAYHSIAYRFLLV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>ref|XP_010087941.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXB30863.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=403

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 8/79 (10%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K+IPKTP EL+ G KPSL H+R+WGCP+ V       +KL+P++    F+GY   +KG 
Sbjct  228  SKSIPKTPLELWCGQKPSLRHVRIWGCPAHV--LKGKTEKLEPKSEVCMFVGYPDGTKGD  285

Query  182  RFYCPK------HTTRIVE  220
             FY P+        TR+VE
Sbjct  286  FFYSPEDQKISPQPTRVVE  304



>gb|AAT44162.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1302

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    + KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKHKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAX95047.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=2266

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  218  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPIRKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  277

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  278  KSEVLDMHVGTIMESRDATFFE  299



>gb|ABG22406.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=2188

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  140  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPIRKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  199

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  200  KSEVLDMHVGTIMESRDATFFE  221



>ref|XP_002442065.1| hypothetical protein SORBIDRAFT_08g008672 [Sorghum bicolor]
 gb|EES15903.1| hypothetical protein SORBIDRAFT_08g008672 [Sorghum bicolor]
Length=831

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            +TP+EL+ G  P++ H+R +GC +  ++  PH+KKLD R+    FIGY   SK YR Y P
Sbjct  119  RTPYELWNGHTPAVQHLRTFGCIAHTKVTTPHQKKLDDRSRRTVFIGYEPGSKAYRVYDP  178

Query  197  KHTTRIVESRNAKFLE  244
              T R+  SR+  F E
Sbjct  179  T-TRRVHISRDVVFDE  193



>emb|CAI44606.1| P0650D04.10 [Oryza sativa Japonica Group]
Length=1194

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  595  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAYHSIAYRFLIV  654

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  655  KSEVPDMHVGTIMESRDATFFE  676



>gb|ABA91445.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1320

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC  +V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLVKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|ABA93525.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1235

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  573  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAYHSIAYRFLIV  632

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  633  KSEVPDMHVGTIMESRDATFFE  654



>gb|ABA99836.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1302

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KP+L ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPTLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFSIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>ref|XP_010095473.1| hypothetical protein L484_014900 [Morus notabilis]
 gb|EXB60447.1| hypothetical protein L484_014900 [Morus notabilis]
Length=181

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K+I KTP EL+ G KPSL H+R+WGCP+ V        KL+P++    F+GY   +K  
Sbjct  39   SKSILKTPLELWCGRKPSLRHVRIWGCPAHV--LKGKTGKLEPKSEVCMFVGYPDGTKEG  96

Query  182  RFYCPKHTTRIVESRNAKFLEDDLI  256
             FY P+   ++  S NA FLE D +
Sbjct  97   FFYSPED-QKVFVSTNATFLEHDYM  120



>gb|AAT39267.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT85181.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1297

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+  F E
Sbjct  700  KSEVPDMHVGTIMESRDGTFFE  721



>emb|CAE02547.1| OSJNBb0069N01.13 [Oryza sativa Japonica Group]
Length=727

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 6/80 (8%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  346  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  405

Query  197  K------HTTRIVESRNAKF  238
            K      H   I+ESR+A F
Sbjct  406  KSEVPDMHVGTIMESRDATF  425



>gb|AAX95374.1| Integrase core domain, putative [Oryza sativa Japonica Group]
 gb|ABA92908.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1393

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +   ++ KL P+T+   F+GYA  +  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAQVNVPITNKHKLGPKTVDCVFLGYAYHNIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPNMHVGTIMESRDATFFE  721



>gb|AAX96109.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1350

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +   ++ KL P+T+   F+GYA  +  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAQVNVPITNKHKLGPKTVDCVFLGYAYHNIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPNMHVGTIMESRDATFFE  721



>gb|AAV43866.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAV44157.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1046

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC +++ +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  384  KTPYEIWIGRKPSLSYLRTWGCLAKINVPITKKRKLGPKTMDCVFLGYAHHSIAYRFLIV  443

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  444  KSEVPDMHVGTIMESRDAIFFE  465



>ref|XP_009803853.1| PREDICTED: uncharacterized protein LOC104249176 [Nicotiana sylvestris]
Length=220

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++P TP EL+ G KPSL H+RVWGCP+ V        KL+ RT    FIG  + +KG 
Sbjct  32   SKSVPSTPVELWTGHKPSLQHIRVWGCPTHV--LKGKVDKLESRTEVCLFIGCPKGTKGG  89

Query  182  RFYCPKH  202
             FYCP  
Sbjct  90   LFYCPNE  96



>gb|AAR13298.1| gag-pol polyprotein [Phaseolus vulgaris]
Length=1290

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+EL+KG++P+L ++RVWG  ++V + +P ++K+  +T    F+GYA+ S  YRF   
Sbjct  639  KTPYELWKGYQPNLKYLRVWGSLAKVMLPDPKKRKIGSKTSDCMFLGYAEHSAAYRFLVL  698

Query  197  K----HTTRIVESRNAKFLE  244
                     IVE++NA+F E
Sbjct  699  NSDIIERNTIVETKNAEFFE  718



>gb|ACB59199.1| copia-like protein [Brassica oleracea]
Length=975

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            +PFE+   +KPSL HM+++GC   V +      KL+ R+  A F+GY+ S KGY+ Y P 
Sbjct  376  SPFEVLNRYKPSLEHMKIFGCLCFVMVPGELRNKLEARSSKAMFVGYSSSQKGYKCYDP-  434

Query  200  HTTRIVESRNAKFLED  247
            +T R++ SR  KF+E+
Sbjct  435  NTRRVLVSREVKFVEE  450



>gb|ABA93820.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1166

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  504  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDRVFLGYAHHSIAYRFLIV  563

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A + E
Sbjct  564  KSEVPDMHIGTIMESRDATYFE  585



>emb|CAD40924.3| OSJNBa0033G16.12 [Oryza sativa Japonica Group]
Length=1320

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ES +A F E
Sbjct  700  KSEVPDMHVGTIMESHDATFFE  721



>gb|ADN33807.1| ty1-copia retrotransposon protein [Cucumis melo subsp. melo]
Length=1038

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = +2

Query  5    KAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYR  184
            K + KTP+EL+KG  P+L +++VWGC ++V +    +  + P+T    FI YAQ+S  YR
Sbjct  670  KRLDKTPYELWKGHAPNLSYLKVWGCLAKVPLPALKKTTVGPKTFDCIFIEYAQNSAAYR  729

Query  185  FYCPKHTTRIVESRNAKFLE  244
            F C    T I ESR+ +F E
Sbjct  730  FMCLNDKT-INESRDVEFFE  748



>gb|AAP20858.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1302

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KP L ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  640  KTPYEIWIGRKPLLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  699

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  700  KSEVPDMHVGTIMESRDATFFE  721



>gb|AAW57815.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1109

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+ +   F+GYA  S  YRF   
Sbjct  604  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKIMDCVFLGYAHHSIAYRFLIV  663

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  664  KSKVHDMHVGTIMESRDATFFE  685



>gb|AAV85747.1| Integrase core domain, putative [Oryza sativa Japonica Group]
 gb|AAX92956.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA92827.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1184

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 56/89 (63%), Gaps = 3/89 (3%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGY  181
            +K++ KTP+E++ G +PSL  +++WGC  EV +      KL P++   FF+GY + +KGY
Sbjct  617  SKSVDKTPYEIWTGKRPSLSFLKIWGC--EVYVKRLQSDKLTPKSDKCFFVGYPKETKGY  674

Query  182  RFYCPKHTTRIVESRNAKFLEDDLISGRD  268
             FY  +   ++  +R+  FLE + IS +D
Sbjct  675  YFY-NQEEGKVFVARHGVFLEKEFISRKD  702



>gb|ABA95219.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=909

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  319  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITQKRKLGPKTVDCVFLGYAHHSIAYRFLIV  378

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ES +A F E
Sbjct  379  KSEVPDMHVGTIMESLDATFFE  400



>gb|ABF96702.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1518

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KP L ++R WGC ++V +    ++KL P+T+   F+GYA  S  YRF   
Sbjct  856  KTPYEIWIGRKPLLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHSIAYRFLIV  915

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I+ESR+A F E
Sbjct  916  KSEVPDMHVGTIMESRDATFFE  937



>emb|CAN66959.1| hypothetical protein VITISV_013138 [Vitis vinifera]
Length=1234

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            +P+EL+KG KP++ + +VWGC +  +  +P++ KL PR I   F+GYA +SK YR     
Sbjct  626  SPYELWKGRKPNIGYFKVWGCLAYCKKTDPNKTKLGPRAIKCAFVGYASNSKAYRLL-DL  684

Query  200  HTTRIVESRNAKFLEDDL  253
             +  I+ESR  +F E+ L
Sbjct  685  ESNVIIESREVEFFENLL  702



>gb|AAM22635.1|AF434192_2 Gag and Pol [Zea mays]
Length=1264

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E + G KPSL ++R WGC ++V +    ++KL PRT+   F+GYA  S  YRF   
Sbjct  602  KTPYEKWVGRKPSLSYLRTWGCMAKVNVPINKKRKLGPRTVDCVFLGYASCSIAYRFLVV  661

Query  197  K------HTTRIVESRNAKFLE  244
            K      +   I+ESR+A F E
Sbjct  662  KSEVPDVYVDTIMESRDATFFE  683



>emb|CAN82637.1| hypothetical protein VITISV_028818 [Vitis vinifera]
Length=1114

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            +P+EL+KG KP++ + +VWGC +  +  +P++ KL PR I   F+GYA +SK YR     
Sbjct  538  SPYELWKGRKPNIGYFKVWGCLTYCKKTDPNKTKLGPRAIKCAFVGYASNSKAYRLL-DL  596

Query  200  HTTRIVESRNAKFLEDDL  253
             +  I+ESR  +F E+ L
Sbjct  597  ESNVIIESREVEFFENLL  614



>ref|XP_002461816.1| hypothetical protein SORBIDRAFT_02g008720 [Sorghum bicolor]
 gb|EER98337.1| hypothetical protein SORBIDRAFT_02g008720 [Sorghum bicolor]
Length=859

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    TKAIP-KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKG  178
            +KAI  KTP++L+ G  PS+ H+R +GC + V++  PH KKL+ R+    F+GY   SK 
Sbjct  149  SKAIGGKTPYQLWNGSTPSVQHLRTFGCIAHVKVNTPHLKKLEDRSRRMVFVGYEPGSKA  208

Query  179  YRFYCPKHTTRIVESRNAKFLE  244
            YR Y P  T R+  SR+  F E
Sbjct  209  YRAYDPS-TRRVHISRDVVFDE  229



>emb|CAN77568.1| hypothetical protein VITISV_010611 [Vitis vinifera]
Length=1067

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            +P+EL+KG KP++ + +VWGC +  +  +P++ KL PR I   F+GYA +SK YR     
Sbjct  403  SPYELWKGRKPNIGYFKVWGCLAYCKKTDPNKTKLGPRAIKCAFVGYASNSKAYRL-LDL  461

Query  200  HTTRIVESRNAKFLEDDL  253
             +  I+ESR  +F E+ L
Sbjct  462  ESNVIIESREVEFFENLL  479



>emb|CAN61066.1| hypothetical protein VITISV_004412 [Vitis vinifera]
Length=1054

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    TKAIPKTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTIS  142
            TKA  KTP+EL+ G KPSL H  +WGCP+E R Y PHEKKLD +T++
Sbjct  509  TKAAAKTPYELWTGRKPSLKHFHIWGCPAEARPYKPHEKKLDSKTVN  555



>emb|CAN66710.1| hypothetical protein VITISV_006397 [Vitis vinifera]
Length=1105

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            +P+EL+KG KP++ + +VWGC +  +  +P++ KL PR I   F+GYA +SK YR     
Sbjct  441  SPYELWKGRKPNIGYFKVWGCLAYCKKTDPNKTKLXPRAIKCAFVGYASNSKAYRLL-DL  499

Query  200  HTTRIVESRNAKFLEDDL  253
                I+ESR  +F E+ L
Sbjct  500  EXNXIIESREVEFFENLL  517



>emb|CAN62884.1| hypothetical protein VITISV_039744 [Vitis vinifera]
Length=1136

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query  20   TPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCPK  199
            +P+EL+KG KP++ + +VWGC +  +  +P++ KL PR I   F+GYA +SK YR     
Sbjct  493  SPYELWKGRKPNIGYFKVWGCLAYCKKTDPNKTKLGPRAIKCAFVGYASNSKAYRL-LDL  551

Query  200  HTTRIVESRNAKFLEDDL  253
             +  I+ESR  +F E+ L
Sbjct  552  ESNVIIESREVEFFENLL  569



>gb|AAT38005.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT58813.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1198

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  17   KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKGYRFYCP  196
            KTP+E++ G KPSL ++R WGC ++V +    ++KL P+T+   F+GYA  +  YRF   
Sbjct  574  KTPYEIWIGRKPSLSYLRTWGCLAKVNVPITKKRKLGPKTVDCVFLGYAHHNIAYRFLIV  633

Query  197  K------HTTRIVESRNAKFLE  244
            K      H   I++SR+A F E
Sbjct  634  KSEVPDMHVGTIMKSRDATFFE  655



>ref|XP_002449917.1| hypothetical protein SORBIDRAFT_05g025655 [Sorghum bicolor]
 gb|EES08905.1| hypothetical protein SORBIDRAFT_05g025655 [Sorghum bicolor]
Length=846

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    TKAIP-KTPFELFKGWKPSLFHMRVWGCPSEVRIYNPHEKKLDPRTISAFFIGYAQSSKG  178
            +KAI  KTP++L+ G  PS+ H+R +GC + V++  PH KKL+ R+    F+GY   SK 
Sbjct  144  SKAIGGKTPYQLWNGSTPSVQHLRTFGCIAHVKVNTPHLKKLEDRSRRMVFVGYEPGSKA  203

Query  179  YRFYCPKHTTRIVESRNAKFLE  244
            YR Y P  T R+  SR+  F E
Sbjct  204  YRAYDPS-TRRVHISRDVVFDE  224



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519803866020