BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6763_g1_i1 len=1569 path=[1547:0-1568]

Length=1569
                                                                      Score     E

ref|XP_006346349.1|  PREDICTED: uncharacterized protein LOC102599039    706   0.0      
ref|XP_009800229.1|  PREDICTED: uncharacterized protein LOC104246161    701   0.0      
ref|XP_009591971.1|  PREDICTED: uncharacterized protein LOC104088913    701   0.0      
ref|XP_004230726.1|  PREDICTED: uncharacterized protein LOC101248432    683   0.0      
ref|XP_011088736.1|  PREDICTED: uncharacterized protein LOC105169880    669   0.0      
gb|KDO47960.1|  hypothetical protein CISIN_1g042451mg                   642   0.0      
ref|XP_002270096.1|  PREDICTED: uncharacterized protein LOC100243866    640   0.0      Vitis vinifera
ref|XP_006422895.1|  hypothetical protein CICLE_v10028186mg             639   0.0      
ref|XP_008236392.1|  PREDICTED: uncharacterized protein LOC103335165    627   0.0      
ref|XP_004292046.1|  PREDICTED: uncharacterized protein LOC101304648    625   0.0      
ref|XP_009346864.1|  PREDICTED: uncharacterized protein LOC103938571    621   0.0      
emb|CDO97233.1|  unnamed protein product                                622   0.0      
ref|XP_010271363.1|  PREDICTED: uncharacterized protein LOC104607417    617   0.0      
ref|XP_008456175.1|  PREDICTED: uncharacterized protein LOC103496192    593   0.0      
ref|XP_002313152.1|  hypothetical protein POPTR_0009s09710g             593   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004140810.1|  PREDICTED: uncharacterized protein LOC101204288    593   0.0      
gb|EYU37619.1|  hypothetical protein MIMGU_mgv1a004098mg                584   0.0      
ref|XP_010105048.1|  hypothetical protein L484_001489                   581   0.0      
gb|KEH44063.1|  hypothetical protein MTR_1g107165                       578   0.0      
ref|XP_010040228.1|  PREDICTED: uncharacterized protein LOC104429021    567   0.0      
ref|XP_011001359.1|  PREDICTED: uncharacterized protein LOC105108658    565   0.0      
gb|KCW63679.1|  hypothetical protein EUGRSUZ_G01325                     564   0.0      
gb|KDP45337.1|  hypothetical protein JCGZ_09586                         562   0.0      
ref|XP_002524643.1|  conserved hypothetical protein                     561   0.0      Ricinus communis
ref|XP_004496924.1|  PREDICTED: uncharacterized protein LOC101504693    555   0.0      
gb|KHN06775.1|  hypothetical protein glysoja_021321                     545   0.0      
ref|XP_007143070.1|  hypothetical protein PHAVU_007G041300g             538   0.0      
ref|XP_003555280.1|  PREDICTED: uncharacterized protein LOC100809854    536   0.0      
gb|KHN42347.1|  hypothetical protein glysoja_020059                     532   0.0      
ref|XP_010691652.1|  PREDICTED: uncharacterized protein LOC104904930    520   2e-176   
ref|NP_179106.1|  uncharacterized protein                               514   3e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467282.1|  PREDICTED: uncharacterized protein LOC104747350    509   2e-172   
ref|XP_006297389.1|  hypothetical protein CARUB_v10013412mg             509   2e-172   
ref|XP_010488940.1|  PREDICTED: uncharacterized protein LOC104766698    509   3e-172   
ref|XP_009136265.1|  PREDICTED: uncharacterized protein LOC103860415    508   7e-172   
gb|KFK39994.1|  hypothetical protein AALP_AA3G316400                    508   1e-171   
ref|XP_010517991.1|  PREDICTED: uncharacterized protein LOC104793...    506   7e-171   
emb|CDX93155.1|  BnaA03g38770D                                          504   1e-170   
ref|XP_002885950.1|  hypothetical protein ARALYDRAFT_480385             504   3e-170   
ref|XP_006409603.1|  hypothetical protein EUTSA_v10022642mg             501   3e-169   
ref|XP_010547975.1|  PREDICTED: uncharacterized protein LOC104819551    500   2e-168   
emb|CDX89649.1|  BnaC03g45630D                                          491   3e-165   
ref|XP_007199336.1|  hypothetical protein PRUPE_ppa023959mg             466   6e-157   
ref|XP_007042559.1|  Iq-domain 14, putative                             407   6e-133   
ref|XP_010065954.1|  PREDICTED: uncharacterized protein LOC104453130    385   1e-124   
ref|XP_006844316.1|  hypothetical protein AMTR_s00143p00072070          336   4e-105   
ref|XP_009396031.1|  PREDICTED: uncharacterized protein LOC103981143    333   9e-104   
ref|XP_009411075.1|  PREDICTED: uncharacterized protein LOC103992902    328   5e-102   
ref|XP_009394624.1|  PREDICTED: uncharacterized protein LOC103980065    330   1e-101   
ref|XP_008787216.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    325   8e-101   
dbj|BAJ91384.1|  predicted protein                                      317   1e-97    
ref|XP_006664886.1|  PREDICTED: uncharacterized protein LOC102708677    287   7e-86    
ref|XP_004983966.1|  PREDICTED: uncharacterized protein LOC101771341    287   2e-85    
ref|XP_010936570.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    277   1e-82    
gb|AAP46203.1|  hypothetical protein                                    274   9e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465099.1|  hypothetical protein SORBIDRAFT_01g032040          270   6e-79    Sorghum bicolor [broomcorn]
ref|NP_001143132.1|  uncharacterized protein LOC100275610               265   3e-77    Zea mays [maize]
tpg|DAA45866.1|  TPA: hypothetical protein ZEAMMB73_487927              264   9e-77    
gb|ACN28466.1|  unknown                                                 224   4e-64    Zea mays [maize]
gb|KDO44840.1|  hypothetical protein CISIN_1g010902mg                   178   1e-45    
ref|XP_002520802.1|  conserved hypothetical protein                     177   1e-45    Ricinus communis
ref|XP_006435832.1|  hypothetical protein CICLE_v10031321mg             177   2e-45    
ref|XP_011076640.1|  PREDICTED: uncharacterized protein LOC105160840    175   1e-44    
ref|XP_010264527.1|  PREDICTED: uncharacterized protein LOC104602506    175   1e-44    
ref|XP_002315128.1|  hypothetical protein POPTR_0010s19040g             174   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_011015267.1|  PREDICTED: uncharacterized protein LOC105118903    173   4e-44    
ref|XP_011084862.1|  PREDICTED: uncharacterized protein LOC105167009    173   4e-44    
ref|XP_009595199.1|  PREDICTED: uncharacterized protein LOC104091541    173   5e-44    
gb|AFK35231.1|  unknown                                                 162   1e-43    
gb|ACR35868.1|  unknown                                                 165   1e-43    Zea mays [maize]
emb|CDP13959.1|  unnamed protein product                                172   2e-43    
ref|XP_009779966.1|  PREDICTED: uncharacterized protein LOC104229087    171   2e-43    
emb|CDX84502.1|  BnaC03g49980D                                          170   5e-43    
ref|XP_010031155.1|  PREDICTED: uncharacterized protein LOC104421033    168   3e-42    
ref|XP_006364239.1|  PREDICTED: uncharacterized protein LOC102580045    168   3e-42    
ref|XP_002864886.1|  hypothetical protein ARALYDRAFT_496617             167   5e-42    
gb|KHN44714.1|  hypothetical protein glysoja_032053                     166   1e-41    
ref|XP_008456894.1|  PREDICTED: uncharacterized protein LOC103496708    165   2e-41    
ref|XP_006828143.1|  hypothetical protein AMTR_s00023p00065960          166   3e-41    
ref|XP_003545215.1|  PREDICTED: uncharacterized protein LOC100809574    165   4e-41    
gb|KHN25988.1|  hypothetical protein glysoja_050267                     165   4e-41    
gb|KHG20135.1|  WD repeat-containing 63                                 164   5e-41    
ref|XP_007163587.1|  hypothetical protein PHAVU_001G246900g             164   6e-41    
ref|XP_004248565.1|  PREDICTED: uncharacterized protein LOC101247075    164   8e-41    
ref|XP_008374374.1|  PREDICTED: uncharacterized protein LOC103437659    163   1e-40    
ref|XP_004500524.1|  PREDICTED: uncharacterized protein LOC101511037    163   1e-40    
ref|XP_010444349.1|  PREDICTED: uncharacterized protein LOC104727051    163   1e-40    
ref|XP_010257014.1|  PREDICTED: uncharacterized protein LOC104597257    163   2e-40    
emb|CDM81492.1|  unnamed protein product                                163   2e-40    
ref|XP_006394187.1|  hypothetical protein EUTSA_v10005630mg             162   4e-40    
ref|XP_010461490.1|  PREDICTED: uncharacterized protein LOC104742215    162   4e-40    
ref|NP_201224.1|  uncharacterized protein                               162   4e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007008846.1|  Neuronal PAS domain-containing protein 4           161   6e-40    
gb|EMT23899.1|  hypothetical protein F775_12028                         161   6e-40    
emb|CDY43798.1|  BnaA06g23340D                                          161   8e-40    
ref|XP_009150495.1|  PREDICTED: uncharacterized protein LOC103873840    161   8e-40    
ref|XP_006281974.1|  hypothetical protein CARUB_v10028198mg             161   1e-39    
gb|KGN50707.1|  hypothetical protein Csa_5G218240                       160   1e-39    
ref|XP_003518418.1|  PREDICTED: uncharacterized protein LOC100782905    160   2e-39    
gb|KHN38553.1|  hypothetical protein glysoja_004218                     160   2e-39    
ref|XP_010692911.1|  PREDICTED: uncharacterized protein LOC104905948    160   2e-39    
ref|XP_002455140.1|  hypothetical protein SORBIDRAFT_03g004970          159   4e-39    Sorghum bicolor [broomcorn]
ref|XP_004491000.1|  PREDICTED: uncharacterized protein LOC101506372    159   5e-39    
gb|EYU20073.1|  hypothetical protein MIMGU_mgv1a005096mg                158   6e-39    
ref|XP_003601000.1|  hypothetical protein MTR_3g071950                  158   7e-39    
gb|KFK28103.1|  hypothetical protein AALP_AA8G472900                    158   1e-38    
ref|XP_007141723.1|  hypothetical protein PHAVU_008G219800g             157   2e-38    
ref|XP_008456895.1|  PREDICTED: uncharacterized protein LOC103496...    157   2e-38    
ref|XP_003565376.1|  PREDICTED: uncharacterized protein LOC100833162    157   2e-38    
ref|XP_004307694.1|  PREDICTED: uncharacterized protein LOC101292...    156   3e-38    
ref|XP_004968295.1|  PREDICTED: uncharacterized protein LOC101780551    156   3e-38    
ref|XP_004146480.1|  PREDICTED: uncharacterized protein LOC101220377    155   5e-38    
ref|NP_001131444.1|  uncharacterized protein LOC100192776               155   7e-38    Zea mays [maize]
ref|XP_008799809.1|  PREDICTED: uncharacterized protein LOC103714371    155   1e-37    
ref|XP_010520952.1|  PREDICTED: uncharacterized protein LOC104799957    154   1e-37    
ref|XP_003616715.1|  hypothetical protein MTR_5g083500                  153   3e-37    
ref|XP_004166119.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    153   4e-37    
ref|XP_010937956.1|  PREDICTED: uncharacterized protein LOC105057163    153   5e-37    
ref|XP_006294080.1|  hypothetical protein CARUB_v10023075mg             152   7e-37    
ref|NP_001042108.1|  Os01g0165100                                       152   8e-37    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059236.1|  Os07g0231800                                       151   1e-36    Oryza sativa Japonica Group [Japonica rice]
gb|KDP44690.1|  hypothetical protein JCGZ_01190                         149   2e-36    
gb|EAY84599.1|  hypothetical protein OsI_05967                          151   2e-36    Oryza sativa Indica Group [Indian rice]
ref|XP_007219049.1|  hypothetical protein PRUPE_ppa004684mg             150   4e-36    
ref|XP_008233824.1|  PREDICTED: uncharacterized protein LOC103332843    149   6e-36    
ref|XP_010087031.1|  hypothetical protein L484_012275                   148   2e-35    
ref|XP_006411295.1|  hypothetical protein EUTSA_v10016559mg             148   2e-35    
ref|XP_002879866.1|  hypothetical protein ARALYDRAFT_483093             147   4e-35    
ref|XP_006643787.1|  PREDICTED: uncharacterized protein LOC102702045    147   5e-35    
ref|XP_003557361.1|  PREDICTED: uncharacterized protein LOC100822668    146   7e-35    
ref|XP_010508870.1|  PREDICTED: uncharacterized protein LOC104785370    145   1e-34    
ref|XP_008776289.1|  PREDICTED: uncharacterized protein LOC103696439    145   2e-34    
ref|XP_004307695.1|  PREDICTED: uncharacterized protein LOC101292...    145   2e-34    
ref|XP_010517460.1|  PREDICTED: uncharacterized protein LOC104792899    144   3e-34    
ref|XP_002278107.1|  PREDICTED: uncharacterized protein LOC100263...    144   3e-34    Vitis vinifera
gb|AAD25673.1|  hypothetical protein                                    142   5e-34    Arabidopsis thaliana [mouse-ear cress]
ref|NP_181570.2|  uncharacterized protein                               143   7e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505767.1|  PREDICTED: uncharacterized protein LOC104782517    143   8e-34    
ref|XP_010921044.1|  PREDICTED: uncharacterized protein LOC105044746    142   2e-33    
gb|AAM76762.1|  hypothetical protein                                    141   4e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534631.1|  PREDICTED: uncharacterized protein LOC104810...    140   8e-33    
emb|CDX74793.1|  BnaA05g05390D                                          139   1e-32    
ref|XP_008804150.1|  PREDICTED: uncharacterized protein LOC103717503    139   2e-32    
ref|XP_010658215.1|  PREDICTED: uncharacterized protein LOC100263...    139   3e-32    
ref|XP_009143218.1|  PREDICTED: uncharacterized protein LOC103866952    137   7e-32    
emb|CDY18872.1|  BnaC04g04780D                                          136   2e-31    
ref|XP_009406907.1|  PREDICTED: uncharacterized protein LOC103989693    132   6e-30    
gb|KFK29797.1|  hypothetical protein AALP_AA7G180800                    126   5e-29    
ref|XP_010485309.1|  PREDICTED: uncharacterized protein LOC104763662    122   4e-28    
gb|EMS47870.1|  hypothetical protein TRIUR3_17972                       119   1e-25    
ref|XP_006657576.1|  PREDICTED: uncharacterized protein LOC102720614    112   4e-23    
ref|XP_010534632.1|  PREDICTED: uncharacterized protein LOC104810...    110   1e-22    
gb|KHN31316.1|  hypothetical protein glysoja_022970                     107   9e-22    
gb|EMT01982.1|  hypothetical protein F775_12130                       97.4    1e-18    
ref|XP_008456896.1|  PREDICTED: uncharacterized protein LOC103496...  88.2    1e-15    
gb|EMS57742.1|  hypothetical protein TRIUR3_24153                     80.9    6e-13    
gb|AFK40645.1|  unknown                                               69.3    4e-10    
gb|AET79249.1|  hypothetical protein                                  63.5    1e-07    
ref|XP_001775879.1|  predicted protein                                58.5    1e-05    
ref|XP_001768066.1|  predicted protein                                57.0    4e-05    
ref|XP_001783656.1|  predicted protein                                56.6    4e-05    
ref|XP_001782680.1|  predicted protein                                53.5    5e-04    



>ref|XP_006346349.1| PREDICTED: uncharacterized protein LOC102599039 [Solanum tuberosum]
Length=536

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/457 (74%), Positives = 388/457 (85%), Gaps = 7/457 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSSDKPFLPLVLQLLQE+ISRSPTAHDS CPRS LQKL PD VSW+LDSHSP
Sbjct  78    IWVSDTCPLSSDKPFLPLVLQLLQEIISRSPTAHDSACPRSHLQKLQPDPVSWILDSHSP  137

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFFNL+ L+RLFW+ A DAP+  G+LYFHS+LAPNLE FS K AP VLRTFF+TVG
Sbjct  138   ESFSSFFNLIFLTRLFWMFAFDAPAAVGSLYFHSLLAPNLEAFSCKHAP-VLRTFFITVG  196

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
             TDVELCFMRTFGYMLAKWLILREVGGVGL+SLTP    YLG SY+TEA+GLW+LKGYAPV
Sbjct  197   TDVELCFMRTFGYMLAKWLILREVGGVGLKSLTPLASHYLGFSYATEAHGLWMLKGYAPV  256

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
             +AMK T    ++  FPVIEAKE AL+Y LAH QLEAVIQFEYTVG++DGFIQV ARLDNI
Sbjct  257   KAMKPTRMNFDKFQFPVIEAKEIALKYTLAHQQLEAVIQFEYTVGFYDGFIQVRARLDNI  316

Query  712   RLHVARLGFNKSQD--DAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             RL VARLGFNK+ D  D+Y+ EKHFPSRIRVWVGPE+GA+YVGGLSLG+STNN+E+E E 
Sbjct  317   RLGVARLGFNKNDDEEDSYLQEKHFPSRIRVWVGPEIGANYVGGLSLGRSTNNVEREFEM  376

Query  886   HKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
              ++ KG+FG+SK P++K  A+MATK+KMKNWRWDQ+ EGNA VY+A L D+ +G E+ATW
Sbjct  377   QRVLKGNFGNSKQPEVKTRAKMATKSKMKNWRWDQEAEGNAAVYEAILYDHVSGCEIATW  436

Query  1066  KPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
             KP NGDD     +MNN   RY G NR F+KKG LV AGEE G  VGWRLSKEM GSVLKW
Sbjct  437   KPVNGDDKNNQ-LMNNFRGRYFGGNRAFSKKGGLVFAGEECGEEVGWRLSKEMEGSVLKW  495

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             R+GG+VWL+YWPN+V +SYYETR VEWCDEVDLPLIP
Sbjct  496   RVGGQVWLSYWPNNVKSSYYETRLVEWCDEVDLPLIP  532



>ref|XP_009800229.1| PREDICTED: uncharacterized protein LOC104246161 [Nicotiana sylvestris]
Length=534

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/457 (74%), Positives = 389/457 (85%), Gaps = 7/457 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD CHLSSDKPFLPLVLQLLQE+ISRSPTA+DS CPRSQLQKL PD VSW+LDSHSP
Sbjct  76    IWVSDTCHLSSDKPFLPLVLQLLQEIISRSPTANDSCCPRSQLQKLQPDPVSWILDSHSP  135

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFFNL+ L+RLFW+ A DAP E G+LYFHS+LAPNLE FS K AP VLRTFF++VG
Sbjct  136   ESFSSFFNLIFLTRLFWMFAFDAPPEVGSLYFHSLLAPNLETFSCKHAP-VLRTFFISVG  194

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
             TDVELCFMRTFGYMLAKWLILREVGGVGL+SL+P    YLG SY+TEA+GLWILKGYAPV
Sbjct  195   TDVELCFMRTFGYMLAKWLILREVGGVGLKSLSPLASHYLGFSYATEAHGLWILKGYAPV  254

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
             +AMK T   G++  FPVIEAKE AL+Y LAH QLEAVIQFEYTVG++DGFIQV ARLDNI
Sbjct  255   KAMKPTRMNGDKIQFPVIEAKEIALKYTLAHQQLEAVIQFEYTVGFYDGFIQVRARLDNI  314

Query  712   RLHVARLGFNKSQDD--AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             RL V RLGFNK++++  +Y+ EKHFPSRIRVWVGPEVGA+YVGGLSLG+STNN+E+E E 
Sbjct  315   RLGVTRLGFNKNEEEEGSYLQEKHFPSRIRVWVGPEVGANYVGGLSLGRSTNNVEREFEM  374

Query  886   HKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
              ++ KG+FG+ K P++KA A+MAT++KMKNWRWDQ+ EGNA VY+A L D+ +G E+ATW
Sbjct  375   QRVLKGNFGNPKQPEVKARAKMATRSKMKNWRWDQEAEGNAAVYEAILYDHVSGCEIATW  434

Query  1066  KPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
             KP  GDD     +MNN   RY G NR FTKKG LV AGEE G  + WRLSKEM GSVLKW
Sbjct  435   KPSTGDDRNNQ-LMNNFRGRYFGGNRAFTKKGGLVFAGEECGEEIVWRLSKEMEGSVLKW  493

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             R+GG+VWL+YWPN+V +SYYETR VEWCDEVDLPLIP
Sbjct  494   RVGGQVWLSYWPNNVKSSYYETRLVEWCDEVDLPLIP  530



>ref|XP_009591971.1| PREDICTED: uncharacterized protein LOC104088913 [Nicotiana tomentosiformis]
Length=534

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/457 (73%), Positives = 388/457 (85%), Gaps = 7/457 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD CHLSSDKPFLPLVLQLLQE+ISRSPTAHDS CPRSQLQKL PD  SW+L+SHSP
Sbjct  76    IWVSDTCHLSSDKPFLPLVLQLLQEIISRSPTAHDSCCPRSQLQKLQPDPFSWILESHSP  135

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFFNL+ L+RLFW+ A DAP E G+LYFHS+LAPNLE FS K AP VLRTFF++VG
Sbjct  136   ESFSSFFNLIFLTRLFWMFAFDAPPEVGSLYFHSLLAPNLETFSCKHAP-VLRTFFISVG  194

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
             TDVELCFMRTFGYMLAKWLILREVGGVGL+SLTP    YLG SY+TEA+GLWILKGYAPV
Sbjct  195   TDVELCFMRTFGYMLAKWLILREVGGVGLKSLTPVASHYLGFSYATEAHGLWILKGYAPV  254

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
             +AMK T   G++  FPVIEAKE AL+Y LAH QLEAVIQFEYTVG++DGFIQV ARLDN+
Sbjct  255   KAMKPTRMNGDKIQFPVIEAKEIALKYTLAHQQLEAVIQFEYTVGFYDGFIQVRARLDNM  314

Query  712   RLHVARLGFNKSQDD--AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             RL VARLGFNK++++  +Y+ EKHFPSRIRVWVGPEVGA+YVGGLSLG+STNN+E+E E 
Sbjct  315   RLGVARLGFNKNEEEEGSYLQEKHFPSRIRVWVGPEVGANYVGGLSLGRSTNNVEREFEM  374

Query  886   HKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
              ++ KG+FG+ K P++KA A+MAT++KMKNWRWDQ+ EGNA +Y+A L D+ +  E+ATW
Sbjct  375   QRVLKGNFGNPKQPEVKARAKMATRSKMKNWRWDQEAEGNAAIYEAILYDHVSSSEIATW  434

Query  1066  KPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
             KP  GDD     +MNN   RY G NR FTKKG LV AGEE G  V WRLSKEM GSVLKW
Sbjct  435   KPSTGDDRNNQ-LMNNFRGRYFGGNRAFTKKGGLVFAGEECGEEVVWRLSKEMEGSVLKW  493

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             R+GG+VWL+YWPN+V +SYYETR VEWCDEVDLPLIP
Sbjct  494   RVGGQVWLSYWPNNVKSSYYETRLVEWCDEVDLPLIP  530



>ref|XP_004230726.1| PREDICTED: uncharacterized protein LOC101248432 [Solanum lycopersicum]
Length=536

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/457 (72%), Positives = 382/457 (84%), Gaps = 7/457 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LS DKPFLPLVLQLLQE+ISR+PTAHDS C RS  QKL PD VSW+LDSHSP
Sbjct  78    IWVSDTCPLSPDKPFLPLVLQLLQEIISRAPTAHDSACSRSHFQKLQPDPVSWILDSHSP  137

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFF+L+ L+RLFW+   DAP   G+LYFHS+LAPNLE FS K APV LRTFF+TVG
Sbjct  138   ESFSSFFDLIFLTRLFWMFTFDAPPAVGSLYFHSLLAPNLEAFSCKHAPV-LRTFFITVG  196

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
             TDVELCFMRTFGYMLAKWLILREVGGVGL+SLTP    YLG SY+TEA+GLWILKGYAPV
Sbjct  197   TDVELCFMRTFGYMLAKWLILREVGGVGLKSLTPLASHYLGFSYATEAHGLWILKGYAPV  256

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
             +AMK T    ++  FPVI++KE AL+Y LAH QLEAVIQFEYTVG++DGFIQV ARLDNI
Sbjct  257   KAMKPTRMNIDKFQFPVIKSKEIALKYTLAHQQLEAVIQFEYTVGFYDGFIQVRARLDNI  316

Query  712   RLHVARLGFNKSQD--DAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             RL VARLGFNK++D  D+Y+ EKHFPSRIRVWVGPE+GA+YVGGLSLG+STNN+E+E E 
Sbjct  317   RLCVARLGFNKNEDEEDSYLLEKHFPSRIRVWVGPEIGANYVGGLSLGRSTNNVEREFEM  376

Query  886   HKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
              K+ KG+FG+SK  ++K  A+MATK+KMKNWRWD + EGNA VY++ L D+ +G E+ATW
Sbjct  377   QKVLKGNFGNSKQSQVKTRAKMATKSKMKNWRWDLEAEGNAAVYESILYDHVSGCEIATW  436

Query  1066  KPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
             KP NGDD     +MNN   RY G NR F+KKG LV AG+E G  VGWRLSKEM GSVLKW
Sbjct  437   KPVNGDDKNNQ-LMNNFRGRYFGGNRAFSKKGGLVFAGDECGEEVGWRLSKEMEGSVLKW  495

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             R+GG+VWL+YWPN+V +SYYETR VEWCDEVDLPLIP
Sbjct  496   RVGGQVWLSYWPNNVKSSYYETRLVEWCDEVDLPLIP  532



>ref|XP_011088736.1| PREDICTED: uncharacterized protein LOC105169880 [Sesamum indicum]
Length=532

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/457 (69%), Positives = 378/457 (83%), Gaps = 10/457 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +W SD C LSSDKPFLPLVLQLLQE++SRSP AHDSTCPRSQLQKL+ + +SW+LDSHS 
Sbjct  80    IWASDTCPLSSDKPFLPLVLQLLQEIVSRSPNAHDSTCPRSQLQKLNSEPLSWILDSHST  139

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFFNL+ L+RLFW+C CDAPSE G+ YFHS+LAPNL+ FS K APV LR FFV VG
Sbjct  140   ESFSSFFNLIFLTRLFWICVCDAPSEVGSFYFHSLLAPNLDTFSCKDAPV-LRNFFVAVG  198

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
             TDVELCF+RTFGYMLAKWLILR+V  VGLQSLTP   + LG SY+ E++GLW+LKGYAPV
Sbjct  199   TDVELCFVRTFGYMLAKWLILRDVE-VGLQSLTPSPTKNLGFSYAMESHGLWVLKGYAPV  257

Query  532   RAMKCTLHRGERNPFP-VIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDN  708
             ++M+C    G R+ FP VI+AK+S L+YALAH QLEAVIQ EYTVG++D FIQVNAR+DN
Sbjct  258   KSMQCMQSSGPRSQFPAVIDAKDSLLKYALAHQQLEAVIQLEYTVGFYDNFIQVNARVDN  317

Query  709   IRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETH  888
             +R+HV +LGFNK+ D+ +++EKHFPSRIRVWVGPEVGASYVGGLSLG+ST+N+E+E+E  
Sbjct  318   LRIHVVKLGFNKNSDENFLEEKHFPSRIRVWVGPEVGASYVGGLSLGRSTDNMEREMEMQ  377

Query  889   KIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWK  1068
             K  KGS G  KVP +KA ARMAT+TK+KNWRWDQD EGNA ++DA LCDN +G+E++TWK
Sbjct  378   KTLKGSSGKLKVPMVKATARMATRTKIKNWRWDQDVEGNAAIFDAILCDNTSGVEISTWK  437

Query  1069  PDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWR  1248
             P  G  G   +   N   RY G  R FTK G L++AGEE G GVGWRL+KEM GSVLKWR
Sbjct  438   PPIG-RGQMGI---NFRSRYSGGARPFTKSGGLIMAGEEYGGGVGWRLNKEMEGSVLKWR  493

Query  1249  IGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             IGGEVWL+YWPN   +SY ETRC+ WCDEVD+PLIPT
Sbjct  494   IGGEVWLSYWPNDFTSSYCETRCIAWCDEVDVPLIPT  530



>gb|KDO47960.1| hypothetical protein CISIN_1g042451mg [Citrus sinensis]
Length=529

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/454 (66%), Positives = 366/454 (81%), Gaps = 9/454 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD+C LSS+KPFLPLVLQLLQE+I+RSPT HDS+CPRSQLQKL P+ +SW++DSHSP
Sbjct  76    MWVSDKCLLSSEKPFLPLVLQLLQEIITRSPTVHDSSCPRSQLQKLKPEPISWIMDSHSP  135

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFFNL+ L+RLFW CACDAPS  G+ YF+S+L+PN+E  +   APV LRTF   VG
Sbjct  136   ESFSSFFNLLFLTRLFWSCACDAPSVVGSFYFNSVLSPNIEALTCNHAPV-LRTFLENVG  194

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D EL FMRT GY+ AKWLILREVG VGLQ++ P   Q LG+SY+TEA+G WILKGYAPV
Sbjct  195   VDAELSFMRTLGYITAKWLILREVG-VGLQTIAPLPDQQLGLSYATEAHGFWILKGYAPV  253

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AMK T        FP+IEAKES LRYALAH QLEAVIQ EY+V + DG+IQVNAR+DN+
Sbjct  254   SAMKVTRSNEHNGKFPIIEAKESVLRYALAHQQLEAVIQLEYSVVFHDGYIQVNARVDNL  313

Query  712   RLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
             R HVA+LGF ++ D  + +E+HFPSR+RVWVGPEVG++YV G++LG+STNN E+EVET +
Sbjct  314   RFHVAKLGFKRNDDMEFNEERHFPSRVRVWVGPEVGSTYVAGMTLGRSTNNGEREVETQR  373

Query  892   IWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
             I KG++G++K+PK+KA ARM TKT+M+NWRWDQD EGNA V+DA LCDN TG E  TWK 
Sbjct  374   ILKGNYGNTKIPKVKARARMTTKTRMRNWRWDQDVEGNAAVFDAVLCDNTTGQEFPTWKC  433

Query  1072  DNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
             DN  DG +    N    RY GANR FTK G LV   +E G GV WRLS+EM GSVLKWRI
Sbjct  434   DNNGDGGSRSFKN----RYSGANRPFTKSGGLVFGRDEYGEGVTWRLSREMEGSVLKWRI  489

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             GG++WL+YWPN+V +SY+ETRC++WCDEVDLPLI
Sbjct  490   GGQIWLSYWPNNVKSSYFETRCIDWCDEVDLPLI  523



>ref|XP_002270096.1| PREDICTED: uncharacterized protein LOC100243866 [Vitis vinifera]
 emb|CAN67723.1| hypothetical protein VITISV_006022 [Vitis vinifera]
Length=526

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/457 (66%), Positives = 366/457 (80%), Gaps = 12/457 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C L+SDKPFLPL+LQL+QE++SRSPTAHDSTCPRSQLQKL P+ V+W+LDSHSP
Sbjct  75    LWVSDACPLASDKPFLPLLLQLVQEIVSRSPTAHDSTCPRSQLQKLRPEPVAWVLDSHSP  134

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+ SSFFNLV L+RLFWLC CDAPSE G+LYF S+L P++E+FS   A V LRTF V++G
Sbjct  135   ESLSSFFNLVFLTRLFWLCVCDAPSEVGSLYFDSLLTPHIELFSCNHAHV-LRTFLVSIG  193

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP-QYLGISYSTEAYGLWILKGYAPVRA  537
              D ELCFMR+ GYMLAKWLILREVG VGLQ LTP   LG SY+ EA+GLW LK YAPV A
Sbjct  194   VDAELCFMRSVGYMLAKWLILREVG-VGLQMLTPVPKLGFSYAMEAHGLWTLKAYAPVMA  252

Query  538   MKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRL  717
             M  T  +G+   +  IEAKES LRYALAH QLE VIQ EY+V + DG+IQVN R++N+R 
Sbjct  253   MTRTRFKGQEKQYSAIEAKESVLRYALAHQQLEVVIQLEYSVAFHDGYIQVNTRVNNLRF  312

Query  718   HVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIW  897
             H+ +LGF+K+ D  Y+DE+HFPSRIRVW+GPE+G++YV  LSLG+ST NIEKEV+T +  
Sbjct  313   HIVKLGFSKNDDMDYIDERHFPSRIRVWIGPEIGSTYVASLSLGRSTENIEKEVKTQRTV  372

Query  898   KGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
             KG+FG  K+ ++KA AR++T+T+ KNWRWDQD EGNA +++A LC+N +G+EVAT KP N
Sbjct  373   KGNFGKMKISRVKATARLSTRTRTKNWRWDQDAEGNAAIFEAVLCENNSGMEVATNKPPN  432

Query  1078  ----GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
                 GD        N LG+RY GANR F+K G LV AG+E G GV WRLSKEM GSVLKW
Sbjct  433   TISEGDKWE-----NGLGKRYSGANRMFSKSGGLVFAGDEYGEGVEWRLSKEMEGSVLKW  487

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             RIGG++WL+YWPN + TSY+ETRCVEWCDEVDLPLIP
Sbjct  488   RIGGQIWLSYWPNEIKTSYFETRCVEWCDEVDLPLIP  524



>ref|XP_006422895.1| hypothetical protein CICLE_v10028186mg [Citrus clementina]
 gb|ESR36135.1| hypothetical protein CICLE_v10028186mg [Citrus clementina]
Length=529

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/454 (66%), Positives = 366/454 (81%), Gaps = 9/454 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQLLQE+I+RSPTAHDS+CPRSQLQKL P+ +SW++DSHSP
Sbjct  76    MWVSDTCLLSSEKPFLPLVLQLLQEIITRSPTAHDSSCPRSQLQKLKPEPISWIMDSHSP  135

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFFNL+ L+RLFW CACDAPS  G+ YF+S+L+PN+E  +   APV LRTF  TVG
Sbjct  136   ESFSSFFNLLFLTRLFWSCACDAPSVVGSFYFNSVLSPNIEALACNHAPV-LRTFLETVG  194

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D EL F RT GY+ AK LILREVG VGLQ++ P   Q LG+SY+ EA+G WILKGYAPV
Sbjct  195   VDAELSFTRTLGYITAKLLILREVG-VGLQTIAPLPDQQLGLSYAAEAHGFWILKGYAPV  253

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AMK T        FP+IEAKES LRYALAH QLEAVIQ EY+V + DG+IQVNAR+DN+
Sbjct  254   SAMKVTRSNEHNGKFPIIEAKESVLRYALAHQQLEAVIQLEYSVVFHDGYIQVNARVDNL  313

Query  712   RLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
             R HVA+LGF ++ D  + +E+HFPSR+RVWVGPEVG++YV G++LG+STNN E+EVET +
Sbjct  314   RFHVAKLGFKRNDDMEFNEERHFPSRVRVWVGPEVGSTYVAGMTLGRSTNNGEREVETQR  373

Query  892   IWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
             I KG++G++K+PK+KA ARM TKT+M+NWRWDQD EGNA V+DA LCDN TG E+AT K 
Sbjct  374   ILKGNYGNTKIPKVKARARMTTKTRMRNWRWDQDVEGNAAVFDAVLCDNTTGQELATRKC  433

Query  1072  DNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
             DN  DG ++   N    RY GANR FTK G LV   +E G GV WRLS+EM GSVLKWRI
Sbjct  434   DNNGDGGSSSFRN----RYSGANRPFTKSGGLVFGRDEYGEGVTWRLSREMEGSVLKWRI  489

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             GG++WL+YWPN+V +SY+ETRC++WCDEVDLPLI
Sbjct  490   GGQIWLSYWPNNVKSSYFETRCIDWCDEVDLPLI  523



>ref|XP_008236392.1| PREDICTED: uncharacterized protein LOC103335165 [Prunus mume]
Length=531

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/456 (67%), Positives = 369/456 (81%), Gaps = 13/456 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSSDKP+LPL+LQLL+E+ISRSPTAHDSTCPRSQLQ L PD  SW++DSHSP
Sbjct  78    IWVSDTCSLSSDKPYLPLLLQLLREIISRSPTAHDSTCPRSQLQTLKPDPFSWIMDSHSP  137

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FS+FF+LV ++RLFWLCACD+P+E G+LYF S+LAPNLE    K AP  LR F +TVG
Sbjct  138   ESFSTFFDLVFVTRLFWLCACDSPTEVGSLYFKSLLAPNLEALLCKQAPA-LRKFLITVG  196

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D ELCFMRT GYMLAKW ILREVG VGLQ+LT    Q LG SY+TEA G W+LK YAPV
Sbjct  197   LDAELCFMRTVGYMLAKWCILREVG-VGLQTLTSSPSQNLGFSYATEACGFWVLKAYAPV  255

Query  532   RAMKCT--LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLD  705
               M+ T  ++  ++N FP +E ++S L+YALAH QLEAV+Q EY+VG++DGFIQV AR+D
Sbjct  256   MGMRTTRSVNLNQKNQFPALETRDSVLKYALAHQQLEAVVQVEYSVGFYDGFIQVTARVD  315

Query  706   NIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             N+R HV  LGFNK+ D  Y +EK+FPSR+RVWVGPEVGA+YV GLSLG+ST+N E+EV+T
Sbjct  316   NLRFHVVNLGFNKNDDVDYAEEKYFPSRVRVWVGPEVGANYVNGLSLGRSTDNGEREVKT  375

Query  886   HKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
              +I KGSF  SKVPK+K+ A ++T+ + +NWRWDQD EGNA V+DA LCDN TG EVATW
Sbjct  376   QRITKGSFAKSKVPKVKSAAGVSTRMRKRNWRWDQDAEGNAAVFDAVLCDNMTGHEVATW  435

Query  1066  KPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
              P  G+        + L +RY GANR FTKKGSLV++G+E G GVGWRL++EM GSVLKW
Sbjct  436   NPAIGEQS------DGLRQRYSGANRPFTKKGSLVLSGDEYGDGVGWRLNREMEGSVLKW  489

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             RIGG+VWL+YWPN VN+SY+ETRCVEWCDEVDLPLI
Sbjct  490   RIGGKVWLSYWPNEVNSSYFETRCVEWCDEVDLPLI  525



>ref|XP_004292046.1| PREDICTED: uncharacterized protein LOC101304648 [Fragaria vesca 
subsp. vesca]
Length=535

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/459 (68%), Positives = 367/459 (80%), Gaps = 13/459 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPL+LQLLQE+ISRSPTAHDSTCPRSQLQ L PD +SW++DSHSP
Sbjct  76    LWVSDTCCLSSEKPFLPLLLQLLQEIISRSPTAHDSTCPRSQLQALKPDPLSWVMDSHSP  135

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FS+FF+LV ++RLFWLCACDAPSE G+LYF S+LAPN+E   SK AP  LRTF +TVG
Sbjct  136   ESFSTFFDLVFITRLFWLCACDAPSEVGSLYFKSLLAPNIEGLMSKHAPA-LRTFLITVG  194

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP------QYLGISYSTEAYGLWILKGY  522
              D ELCFMRT GYMLAKW +LR+VG VGLQ+LT       Q LG SY+ EA G W+LKGY
Sbjct  195   VDAELCFMRTLGYMLAKWCMLRQVG-VGLQTLTSLTAPSHQNLGFSYANEACGFWVLKGY  253

Query  523   APVRAMKCTLHRG-ERNPFPVIEA-KESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
             APV  M+ T     + N FPV+E  K+S L+YALAH QLEAV+Q EY+VG++DGFIQV A
Sbjct  254   APVLGMRTTRSVNVQTNQFPVMETTKDSVLKYALAHQQLEAVVQVEYSVGFYDGFIQVTA  313

Query  697   RLDNIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKE  876
              +DN+R HV  LGFNK+ D  Y DEK+FPSRIRVWVGPEVGA+YV GLSLG+ST+N EKE
Sbjct  314   HVDNLRFHVVTLGFNKNNDVDYADEKYFPSRIRVWVGPEVGANYVHGLSLGRSTDNGEKE  373

Query  877   VETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
             V+  KI K SFG SK P++KA  RM+T+T+ KNWRWDQD EGNA V+DA LCDN TG EV
Sbjct  374   VKMQKIMKSSFGKSKNPRVKAAMRMSTRTRKKNWRWDQDAEGNAAVFDAVLCDNVTGNEV  433

Query  1057  ATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
             AT  P  G+        N+L RRY+GANR FTK GSLV++G+E G GVGWRLS+EM GSV
Sbjct  434   ATCNPSIGEKRENN---NSLRRRYQGANRAFTKTGSLVLSGDEYGEGVGWRLSREMEGSV  490

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             LKWRIGG+VWL+YWPN VNTSY ETRCVEWCDEVDLPLI
Sbjct  491   LKWRIGGKVWLSYWPNEVNTSYCETRCVEWCDEVDLPLI  529



>ref|XP_009346864.1| PREDICTED: uncharacterized protein LOC103938571 [Pyrus x bretschneideri]
Length=532

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/458 (68%), Positives = 362/458 (79%), Gaps = 14/458 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDS-TCPRSQLQKLHPDRVSWMLDSHS  177
             +WVSD C LSSDKP+LPL+LQLLQE+ISRSPTAH S TCPRSQLQ L PD  SW++DSHS
Sbjct  76    IWVSDMCSLSSDKPYLPLLLQLLQEIISRSPTAHGSGTCPRSQLQALKPDPFSWIMDSHS  135

Query  178   PETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTV  357
             PE+FS FF+LV ++RLFWLCACD+PSE G+LYF S+LAPNLE    K AP  LRTF +T 
Sbjct  136   PESFSMFFDLVFITRLFWLCACDSPSEVGSLYFKSLLAPNLEALLCKHAPA-LRTFLITA  194

Query  358   GTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAP  528
             G D ELCFMRT GYMLAKW ILR+VG VGLQ LT    Q LG SY+TEA GLW+LKGYAP
Sbjct  195   GVDAELCFMRTLGYMLAKWCILRDVG-VGLQMLTSSPSQNLGFSYATEACGLWVLKGYAP  253

Query  529   VRAMKCTLHRG---ERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNAR  699
             V  MK T       ++N FP +E ++S L+Y LAH QLEAV+Q EY+VG++DGFIQV AR
Sbjct  254   VMGMKTTRSAASVNQKNQFPALETRDSVLKYTLAHQQLEAVVQVEYSVGFYDGFIQVTAR  313

Query  700   LDNIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEV  879
             +DN+R HV  LGFNK  D  Y +EK+FPSRIRVWVGPEVGA+YV GLSLG+ST N EKEV
Sbjct  314   VDNLRFHVVNLGFNKDDDVDYAEEKYFPSRIRVWVGPEVGANYVNGLSLGRSTYNGEKEV  373

Query  880   ETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVA  1059
             +T ++ KG F  SKVPKMKA ARM+T+ + +NWRWDQD EGNA V+DA LCDN TG EVA
Sbjct  374   KTQRVMKGGFEKSKVPKMKATARMSTRMRKRNWRWDQDAEGNAAVFDAVLCDNTTGHEVA  433

Query  1060  TWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVL  1239
             TWKPD   DG  +     L RRY GANR FTK GSLV++G+E G GVGWRLS+EM GSVL
Sbjct  434   TWKPDT--DGGNS---EGLRRRYEGANRPFTKTGSLVLSGDEYGDGVGWRLSREMEGSVL  488

Query  1240  KWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             KWRIGG+VWL+YW N V +SY+ETRCVEWCDEVDLPLI
Sbjct  489   KWRIGGKVWLSYWANEVKSSYFETRCVEWCDEVDLPLI  526



>emb|CDO97233.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/467 (67%), Positives = 361/467 (77%), Gaps = 25/467 (5%)
 Frame = +1

Query  7     VSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPET  186
             VSD+CHL+ DKPFLPLVLQLLQE+ISRSP AHDSTCPRSQLQKL P+ ++W+LDSHSPE+
Sbjct  81    VSDKCHLAQDKPFLPLVLQLLQEIISRSPNAHDSTCPRSQLQKLKPEPIAWILDSHSPES  140

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             FSSFF+L+ L+RLFW+C  DAPSE G+LYFHS+LAPNL  FS K AP VLRTFFV+VGTD
Sbjct  141   FSSFFHLIFLARLFWICVFDAPSEVGSLYFHSLLAPNLGAFSCKQAP-VLRTFFVSVGTD  199

Query  367   VELCFMRTFGYMLAKWLILREVGGV--GLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
             VELC MR FGYMLAK LI R+VGG+  GL++L P     LG SY+TE++GLWILKGY PV
Sbjct  200   VELCLMRAFGYMLAKSLIFRQVGGLEAGLKALAPSASHRLGFSYATESHGLWILKGYTPV  259

Query  532   RAMKCTLHRGERNP----FPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNAR  699
              AM C      RNP    FPVIE KESALRY+L H QLEAVIQ EY V + D FI+V+A 
Sbjct  260   TAMDCAT--SNRNPNMHQFPVIEPKESALRYSLGHQQLEAVIQLEYKVEFCDAFIRVHAL  317

Query  700   LDNIRLHVARLGFNKSQ----DDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNI  867
             +DNIRLHV +LGF   +    DD   +E+HFPSR+RVWVGPE+GASYVGGLSLG+ST N+
Sbjct  318   VDNIRLHVVKLGFKSKESGDDDDVLRNERHFPSRVRVWVGPEIGASYVGGLSLGRSTGNV  377

Query  868   EKEVETHKIWKGSFG-DSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQT  1044
             E+EVE  KI+KGS G +   PK+  VARMAT+TKMKNWRWDQD EGNA ++D  LCDN T
Sbjct  378   EREVEIQKIFKGSSGKEITTPKVMGVARMATRTKMKNWRWDQDVEGNAGIFDGMLCDNTT  437

Query  1045  GIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIA---GEESGTGVGWRLS  1215
             G EVATWKP  G      + +N+  RR    NR FTK G +V A         GVGWRL+
Sbjct  438   GKEVATWKPSTGGR-ENDLAVNSFMRR----NRAFTKSGGVVFAGEECCGGNGGVGWRLN  492

Query  1216  KEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             KEM GSVLKWRIGG+VWLTYWPN V +SYYET+CVEWCDEVDLPLIP
Sbjct  493   KEMEGSVLKWRIGGQVWLTYWPNDVKSSYYETKCVEWCDEVDLPLIP  539



>ref|XP_010271363.1| PREDICTED: uncharacterized protein LOC104607417 [Nelumbo nucifera]
Length=525

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/455 (65%), Positives = 366/455 (80%), Gaps = 11/455 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LS+DKPFLPL+LQLLQE+I+RSP+ HD+TCPRSQLQ+L P+ +SW+LDSHSP
Sbjct  77    LWVSDPCPLSADKPFLPLLLQLLQEIIARSPSTHDTTCPRSQLQRLKPEPISWILDSHSP  136

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FS+FFNLV L RLFWLC CDAPSE G+LYF ++L PNLE  SS     V+RTF ++VG
Sbjct  137   ESFSNFFNLVFLCRLFWLCVCDAPSEVGSLYFKTLLPPNLEALSSNKH--VIRTFLMSVG  194

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D ELCFMRT GYMLAKWL+LRE+G VGLQSLTP     LG SY+TE++G WILK YAP+
Sbjct  195   VDAELCFMRTLGYMLAKWLMLRELG-VGLQSLTPLPSYRLGFSYATESHGFWILKAYAPI  253

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              +M  T   G+++ +P++E KES LRYALAH QLEAVIQ EY+VG++DGF+QVNAR+DNI
Sbjct  254   LSMPRTCVNGQQDQYPLLETKESVLRYALAHQQLEAVIQLEYSVGFYDGFLQVNARVDNI  313

Query  712   RLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
             R HVA+LG +K+    Y +EKHFPSRIR+WVGPE+G++YV  LSLG+ST+N E+EVET K
Sbjct  314   RFHVAKLGLSKNDYGEYTEEKHFPSRIRIWVGPEIGSTYVASLSLGRSTDNPEREVETQK  373

Query  892   IWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
                GSFG SKVPK+KA A  + +T+M+NWRW+QD +GNA V++A LCDN +GIEVATWKP
Sbjct  374   TMHGSFGKSKVPKVKAKATSSARTRMRNWRWEQDADGNAAVFEAVLCDNVSGIEVATWKP  433

Query  1072  DNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
               G +      +N L RRY G NR F K G ++ AG+E G GVGWRLSKEM GSVLKWRI
Sbjct  434   AKGGNP-----VNGLRRRYSGPNRPFNKSGGVIFAGDEYGEGVGWRLSKEMEGSVLKWRI  488

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             GG+VWL+YWPN + + Y+ETRCV+WCDEVDLPLIP
Sbjct  489   GGKVWLSYWPNDLKSPYFETRCVDWCDEVDLPLIP  523



>ref|XP_008456175.1| PREDICTED: uncharacterized protein LOC103496192 [Cucumis melo]
Length=526

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/459 (62%), Positives = 349/459 (76%), Gaps = 8/459 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVS+ C LSSDKPFLPL+LQLLQE+ISRSP    STCPRS+LQKL PD V+W++DSHSP
Sbjct  69    LWVSNACSLSSDKPFLPLILQLLQEIISRSPAGQKSTCPRSRLQKLKPDPVAWIMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FS FFNL+ L RLFW+CACDAP+E G+ YF  +L+P+LE  SS  APV LRTF +T+G
Sbjct  129   ESFSGFFNLIFLIRLFWVCACDAPAEIGSFYFKYLLSPHLEALSSNHAPV-LRTFLITIG  187

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLT----PQYLGISYSTEAYGLWILKGYAP  528
              D ELCF RT GY++AKWLILREVG VGLQ+LT     + LG +Y+TEA+GLWILKG+AP
Sbjct  188   VDAELCFTRTLGYVIAKWLILREVG-VGLQTLTHAPPKRSLGFTYATEAHGLWILKGHAP  246

Query  529   VRAMKCTLH--RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARL  702
             V  M+ T     G +  FP+IEAKESALRYALAH QLEAVIQ EY+V Y +G++ V AR+
Sbjct  247   VMGMRVTRGGGAGRKYQFPLIEAKESALRYALAHQQLEAVIQLEYSVKYQEGYVHVGARV  306

Query  703   DNIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVE  882
             DNIRLHVARL      D  Y +E+HF SR+RVWVGPEVGA+YVG +SLG+ST N+E+EV+
Sbjct  307   DNIRLHVARLALGSVDDVEYAEERHFVSRVRVWVGPEVGANYVGAMSLGRSTENVEREVK  366

Query  883   THKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
               KI K  +G +K+  +KA AR +T+TKM+NWRWDQ+ EGNA V++A LCDN TG EVA 
Sbjct  367   VQKILKSRYGKAKMSTVKATARTSTRTKMRNWRWDQEAEGNAAVFEAVLCDNTTGNEVAM  426

Query  1063  WKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
              K + G +        +   RY G +R F+K G +V  G+E G  VGWRLSKE  GSVLK
Sbjct  427   KKNNGGSEKGEEGGGESFANRYGGTDRAFSKSGGVVFGGDEYGEEVGWRLSKETEGSVLK  486

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             WRIGG++WLTY+PN +   Y+ETR VEWCDEVDLPLIPT
Sbjct  487   WRIGGQIWLTYYPNEMRIPYFETRFVEWCDEVDLPLIPT  525



>ref|XP_002313152.1| hypothetical protein POPTR_0009s09710g [Populus trichocarpa]
 gb|EEE87107.1| hypothetical protein POPTR_0009s09710g [Populus trichocarpa]
Length=530

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/458 (66%), Positives = 362/458 (79%), Gaps = 11/458 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C L+S+KPFLPLVLQLLQE+I RSPTAH+STCPRSQLQKL PD VSW++DSH+P
Sbjct  76    LWVSDTCPLNSEKPFLPLVLQLLQEIIVRSPTAHNSTCPRSQLQKLKPDPVSWIMDSHTP  135

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFF+LV ++RLFWLCA DAP+EAG+L F S+L P+LE  S K APV LRTF +TVG
Sbjct  136   ESFSSFFSLVFITRLFWLCAFDAPTEAGSLCFESVLGPHLETLSCKQAPV-LRTFLLTVG  194

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D ELCFMR  GYMLAKWLILREVG VGLQ+L P   Q +G+SY+TEAYGLW+LKGYAP+
Sbjct  195   VDAELCFMRAVGYMLAKWLILREVG-VGLQTLAPLASQQVGLSYATEAYGLWVLKGYAPI  253

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AM  T  R   N F ++EAK++ L+YALAHHQLEAVIQ EY V ++DG+IQVNAR++N+
Sbjct  254   LAMNPTCPR--NNKFCILEAKDTVLKYALAHHQLEAVIQLEYAVRFYDGYIQVNARVNNL  311

Query  712   RLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
             R HV RLGF K++   Y DE+HF SR RVWVGPE+GA+YVGGL LG+ST N EKEVE  +
Sbjct  312   RFHVVRLGFKKNEGVDYDDERHFVSRARVWVGPEIGATYVGGLCLGRSTYNGEKEVEVQR  371

Query  892   IWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
             I KGS+G++KVP++K  + MATKT+MK+WR DQD EGNAVV+DA L DN TG EVAT KP
Sbjct  372   ILKGSYGEAKVPQVKTRSGMATKTRMKSWRCDQDVEGNAVVFDAVLYDNMTGQEVATRKP  431

Query  1072  DNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
               GD     V   N    G R  G NR FTK G +V AG+E G GV WRLSKE  GSVLK
Sbjct  432   I-GDGNSVGVGGRNGKSFGTRCNGPNRPFTKTGGVVFAGDEYGEGVEWRLSKETEGSVLK  490

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             WR+GG+VW++Y P+ V +S++ETR VEWCDEVDLP+IP
Sbjct  491   WRLGGQVWVSYCPSEVKSSHFETRSVEWCDEVDLPIIP  528



>ref|XP_004140810.1| PREDICTED: uncharacterized protein LOC101204288 [Cucumis sativus]
 ref|XP_004171904.1| PREDICTED: uncharacterized LOC101204288 [Cucumis sativus]
 gb|KGN57493.1| hypothetical protein Csa_3G199550 [Cucumis sativus]
Length=522

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/458 (62%), Positives = 349/458 (76%), Gaps = 12/458 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVS+ C LSSDKPFLPL+LQLLQE+ISRSP    STCPRS+LQKL PD VSW++DSHSP
Sbjct  69    LWVSNACPLSSDKPFLPLILQLLQEIISRSPAGQKSTCPRSRLQKLKPDPVSWIMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FS FFNL+ L RLFW+CACDAP+E G+ YF+ +L+P+LE  SS  APV LRTF +T+G
Sbjct  129   ESFSGFFNLIFLIRLFWVCACDAPAEIGSFYFNYLLSPHLEALSSNHAPV-LRTFLITIG  187

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLT----PQYLGISYSTEAYGLWILKGYAP  528
              D ELCF RT GY++AKWLILREVG VGLQ+LT     + LG +Y+TEA+GLWILKG+ P
Sbjct  188   VDAELCFTRTLGYVIAKWLILREVG-VGLQTLTHTPPKRSLGFTYATEAHGLWILKGHTP  246

Query  529   VRAMKCTLHRG--ERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARL  702
             V  M+ T   G   +  FP+IEAKESALRYALAH QLEAVIQ EY+V Y +G++ V AR+
Sbjct  247   VMGMRVTRAGGGGRKYQFPLIEAKESALRYALAHQQLEAVIQLEYSVKYHEGYVHVGARV  306

Query  703   DNIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVE  882
             DNIRLHVARL      D  Y +E+HF SR+RVW+GPEVGA+YVG +SLG+ST N+E+EV+
Sbjct  307   DNIRLHVARLALGSVDDVEYAEERHFVSRVRVWIGPEVGANYVGAMSLGRSTENVEREVK  366

Query  883   THKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
               KI KG +G +K+  +KA AR +T+TKM+NWRWDQ+ EGNA V++A LCDN TG EVA 
Sbjct  367   VQKILKGRYGKAKMSTVKATARTSTRTKMRNWRWDQEAEGNAAVFEAVLCDNTTGNEVAM  426

Query  1063  WKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
              K   G +      +N    RY G NR F+K G +V AG+E G  VGWRLSKE  GSVLK
Sbjct  427   KKNSGGSENGEEGFVN----RYSGTNRAFSKSGGVVFAGDEYGEEVGWRLSKETDGSVLK  482

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             WRIG ++WLTY+PN +   Y+ETR VEWCDEVDLPL+P
Sbjct  483   WRIGTQIWLTYYPNEMRIPYFETRFVEWCDEVDLPLLP  520



>gb|EYU37619.1| hypothetical protein MIMGU_mgv1a004098mg [Erythranthe guttata]
Length=544

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/467 (66%), Positives = 363/467 (78%), Gaps = 18/467 (4%)
 Frame = +1

Query  1     VWVSDECHLSSDK-----PFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWML  165
             +W SD C LSS        FLPLVLQLLQE+++R+P AHDSTCPRSQLQKL P+ VSW+L
Sbjct  80    IWSSDTCPLSSSDDDRSPTFLPLVLQLLQEIVTRAPNAHDSTCPRSQLQKLKPEPVSWIL  139

Query  166   DSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTF  345
             DSHSPE+FSSFF+L+ L+RLFW C CDAPSE G  YFHS+L PNLE FS K AP VLR F
Sbjct  140   DSHSPESFSSFFSLIFLTRLFWTCVCDAPSEVGCFYFHSMLTPNLEGFSCKHAP-VLRNF  198

Query  346   FVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLT---PQYLGISYSTEAYGLWILK  516
             F+TVGTDVELCF+RTFGYMLAKWLIL++V   GL+SLT    + LG SY+ E++GLWILK
Sbjct  199   FLTVGTDVELCFVRTFGYMLAKWLILKDVEA-GLKSLTLLPSKNLGFSYAVESHGLWILK  257

Query  517   GYAPVRAMKCTL-HRGERN-PFP-VIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQ  687
             GY+PV++M+C     G++N  FP VIEA+ES L+YALAH QLEAVIQ EYTV +FD FIQ
Sbjct  258   GYSPVKSMQCMQSSSGQKNRQFPGVIEARESLLKYALAHQQLEAVIQLEYTVRFFDNFIQ  317

Query  688   VNARLDNIRLHVARLGF--NKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTN  861
             VNAR+DNIR+HV +LGF  N   D    DEKHFPSRIRVWVGPE+GA YVGGLSL +ST+
Sbjct  318   VNARVDNIRIHVVKLGFKNNSDNDQNLADEKHFPSRIRVWVGPEIGAGYVGGLSLARSTD  377

Query  862   NIEKEVETHKIWKG-SFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDN  1038
             N E+E+E  K  KG + G+SKVP +   A+MAT+TK+KNWR +QD EGNA V+DA LCDN
Sbjct  378   NTEREMEMQKTLKGITSGNSKVPSVTETAKMATRTKIKNWRCEQDVEGNAAVFDAILCDN  437

Query  1039  QTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSK  1218
              TG+E+ATW+P  G  G    +  N   RY G+ R FTK G ++ AGEE G GVGWRLSK
Sbjct  438   TTGVEIATWRPPVGGGGGVMGL--NFRGRYTGSGRPFTKSGGMIFAGEEYGEGVGWRLSK  495

Query  1219  EMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             EM GSVLKWRIGGEV +TY PN V  SYYETRC+EWCDEVDLPLIP+
Sbjct  496   EMEGSVLKWRIGGEVCVTYLPNDVACSYYETRCIEWCDEVDLPLIPS  542



>ref|XP_010105048.1| hypothetical protein L484_001489 [Morus notabilis]
 gb|EXC03761.1| hypothetical protein L484_001489 [Morus notabilis]
Length=537

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/468 (65%), Positives = 354/468 (76%), Gaps = 29/468 (6%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDST--CPRSQLQKLHPDRVSWMLDSH  174
             +WVSD CHLSS+KPFLPLVLQLLQE +SRSPTAH ST  CPRSQLQKL PD VSW++DSH
Sbjct  77    LWVSDTCHLSSEKPFLPLVLQLLQETVSRSPTAHYSTTPCPRSQLQKLKPDVVSWIMDSH  136

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
             SPE+FSSFF+LVLL+RLFWLCACDAP+E G+LYF ++LAPN+E   S      LR FF T
Sbjct  137   SPESFSSFFSLVLLTRLFWLCACDAPTEVGSLYFRALLAPNIETVVSSKNSRALRAFFAT  196

Query  355   VGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP--------QYLGISYSTEAYGLWI  510
             VG D EL FMRT GYMLAKW IL+EV GVGLQ LTP          LG SY+TEA+G W 
Sbjct  197   VGVDAELRFMRTVGYMLAKWCILKEV-GVGLQMLTPLTTWSEKNNNLGFSYATEAHGFWT  255

Query  511   LKGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQV  690
             LKGYAP+  MK T        FPV       L+Y LAH QLEAVIQFEYTVG+++G IQV
Sbjct  256   LKGYAPIAGMKLTSGSARNIQFPV-------LKYVLAHQQLEAVIQFEYTVGFYEGLIQV  308

Query  691   NARLDNIRLHVARLGFNKSQDDAYV---DEKHFPSRIRVWVGPEVGASYVGGLSLGQST-  858
             NAR+DN+RLHV +LG+NK  DD  V   +E+HFPSRIRVWVGPEVGA+YV GLSLG+S+ 
Sbjct  309   NARVDNLRLHVTKLGYNKDNDDDDVELGEERHFPSRIRVWVGPEVGANYVAGLSLGRSSE  368

Query  859   NNIEKEVETHKIWKGSFGDSKV--PKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLC  1032
              + E+EVETH I KGSFG SK+  PK+KA +R   +T+ ++WRWDQD EGNA V+DA LC
Sbjct  369   KHGEREVETHSIVKGSFGISKMLSPKVKATSRTLRRTRQRSWRWDQDAEGNAAVFDAVLC  428

Query  1033  DNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRL  1212
             D  TG EVATWKP  G D            RY G +R FTK G LV+AG++ G  VGWRL
Sbjct  429   DGATGSEVATWKPSTGGDD-----HGGFRDRYNGTDRVFTKSGGLVLAGDDYGEEVGWRL  483

Query  1213  SKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             SKEM GSVLKWRIGG+VW++YWPN VN+SY+ETRCVEWCDEVDLPLIP
Sbjct  484   SKEMEGSVLKWRIGGKVWVSYWPNEVNSSYFETRCVEWCDEVDLPLIP  531



>gb|KEH44063.1| hypothetical protein MTR_1g107165 [Medicago truncatula]
Length=524

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/452 (63%), Positives = 349/452 (77%), Gaps = 8/452 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKP-FLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHS  177
             +W+S++C LSS+ P FLPL+LQLLQE+IS SPTAHDSTCPRSQLQKL P+ ++W++DSH+
Sbjct  75    LWISEKCTLSSENPNFLPLLLQLLQEIISNSPTAHDSTCPRSQLQKLKPEPIAWIIDSHT  134

Query  178   PETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTV  357
             PE+ S FFNLV   RLFWLCACDAPSEAG+LYFHS+LAP LE   SK    VLRTFF+TV
Sbjct  135   PESLSIFFNLVFTIRLFWLCACDAPSEAGSLYFHSLLAPVLETALSKKLASVLRTFFITV  194

Query  358   GTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRA  537
             G D ELCFMRT GY++AKW I+RE+G VGLQ+L P     SY+TE++G WILKGYAPV  
Sbjct  195   GVDTELCFMRTLGYIIAKWCIIRELG-VGLQTLVPSNPKFSYATESHGFWILKGYAPVMT  253

Query  538   MKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRL  717
             MK   + G+   F  I+AKES +RY LAHHQLEA +Q EYTVG++DGFI+VN R+DN+RL
Sbjct  254   MKLARNYGQNGKFQGIDAKESIIRYGLAHHQLEAHVQLEYTVGFYDGFIRVNTRVDNMRL  313

Query  718   HVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIW  897
             HVARLGF    D  +VDEKHFPSR RVWVGPE+GASYV GLSLG+ST N E+EVE  K+ 
Sbjct  314   HVARLGFKHGDDVDFVDEKHFPSRARVWVGPEIGASYVAGLSLGRSTENNEREVEIEKVV  373

Query  898   KGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
              G+F  S + K+KA A+ + + + K+WR DQD EGNA ++D  L DN TG EV +WKP  
Sbjct  374   NGNFEKSDISKVKASAKSSRRMRTKSWRMDQDAEGNAAIFDVVLHDNMTGQEVGSWKP-T  432

Query  1078  GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGG  1257
             GDD      ++ L  RY GANR F+K GS+VIAG+E G  VGWRLSKEM GSVLKWRIGG
Sbjct  433   GDDP-----IHGLRGRYVGANRPFSKSGSVVIAGDEYGEEVGWRLSKEMEGSVLKWRIGG  487

Query  1258  EVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             E W++Y P+    S++ETRC+EWCDEVDLPLI
Sbjct  488   EFWVSYLPDQAKGSHFETRCIEWCDEVDLPLI  519



>ref|XP_010040228.1| PREDICTED: uncharacterized protein LOC104429021 [Eucalyptus grandis]
 gb|KCW45367.1| hypothetical protein EUGRSUZ_L00953 [Eucalyptus grandis]
Length=528

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/458 (63%), Positives = 348/458 (76%), Gaps = 17/458 (4%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSSDKPFLPL+LQLLQE+I RSPT  +S+CPRSQLQKL PD VSW+++SH+P
Sbjct  78    LWVSDACPLSSDKPFLPLLLQLLQEIILRSPTTRESSCPRSQLQKLRPDPVSWIMESHTP  137

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+ SSFFNLV L+R+FW C+ D PSE G+ YF S+L PNLE  S K AP VLRTF  +VG
Sbjct  138   ESLSSFFNLVFLTRMFWACSFDVPSEIGSFYFQSLLTPNLEALSCKHAP-VLRTFLWSVG  196

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D E CFMRT GYMLAKWL+LREV GVGLQ+LTP   Q L  SY+TEA+GLWILKGYAPV
Sbjct  197   ADAEECFMRTLGYMLAKWLVLREV-GVGLQALTPLPVQGLSFSYATEAHGLWILKGYAPV  255

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AMK T    +   FPV+EA++S L+Y L+H QLEAV+Q EY+V + DG+IQVN R+DNI
Sbjct  256   AAMKLTRSNDQMKKFPVLEAQDSVLKYVLSHQQLEAVVQLEYSVKFCDGYIQVNTRVDNI  315

Query  712   RLHVARLGFNKSQDD---AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVE  882
             RLHVA LGF K   +   A+  E+HFPSR RVWVGPEVGA+YVGGLSLG+ST+N E+E+ 
Sbjct  316   RLHVANLGFGKESSEDGLAFAGERHFPSRARVWVGPEVGATYVGGLSLGRSTSNGERELV  375

Query  883   THKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
             T ++ K +FG SK P++KA  + +T+ K+++WRWDQD+EGNA V+DA L D+ TG EVA 
Sbjct  376   TQRVMKSTFGKSKAPEVKATGKTSTRAKLRDWRWDQDSEGNAAVFDAVLHDSTTGQEVAM  435

Query  1063  WKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
               P  G+            +RY  ANR FTK G LV AG+E G  VGWRL +EM GSVLK
Sbjct  436   SCPSKGE---------GFRKRYAAANRPFTKSGGLVFAGDEYGESVGWRLGREMEGSVLK  486

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             WRIGG+VWL+Y  N V +SYYETR VEWCDE+DLPLIP
Sbjct  487   WRIGGQVWLSYVANDVKSSYYETRVVEWCDEIDLPLIP  524



>ref|XP_011001359.1| PREDICTED: uncharacterized protein LOC105108658 [Populus euphratica]
Length=537

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/460 (63%), Positives = 354/460 (77%), Gaps = 12/460 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C L+S+KPFLPLVLQLLQE+I RSPTA +STCPRSQLQKL PD VSW++DSH+P
Sbjct  76    LWVSDTCPLNSEKPFLPLVLQLLQEIIVRSPTAPNSTCPRSQLQKLKPDPVSWIMDSHTP  135

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFF+LV ++RLFWLCA DAP+EAG+L F S+L P+LE  S K APV LRTF +TVG
Sbjct  136   ESFSSFFSLVFITRLFWLCAFDAPTEAGSLCFESVLGPHLETLSCKQAPV-LRTFLLTVG  194

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGI-SYSTEAYGLWILKGYAP  528
              D ELCFMR  GYM+AKWL+LREVG VGLQ+L P   Q +G+ SY+TEAYGLW+LKGYAP
Sbjct  195   VDAELCFMRAMGYMMAKWLLLREVG-VGLQTLAPLASQQVGLLSYATEAYGLWVLKGYAP  253

Query  529   VRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDN  708
             + AM  T  R   N F ++ AK++ L+YALAHHQLEAVIQ EY V ++DG+IQV AR++N
Sbjct  254   ILAMNPTCPRN--NKFCILGAKDTVLKYALAHHQLEAVIQLEYAVRFYDGYIQVIARVNN  311

Query  709   IRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETH  888
             +R HV RLGF K++     D++HF SR RVWVGPE+GA+YVGGL LG+ST N EKEVE  
Sbjct  312   LRFHVVRLGFKKNEGVDNDDDRHFVSRARVWVGPEIGATYVGGLCLGRSTYNGEKEVEIQ  371

Query  889   KIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWK  1068
             +I KGS G++KVP++K  + MATKT+MK+WR DQD EGNAVV+DA L DN  G EVA  K
Sbjct  372   RILKGSHGEAKVPQVKTRSGMATKTRMKSWRCDQDVEGNAVVFDAVLYDNMMGQEVAARK  431

Query  1069  P----DNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
             P    +    G       + G R  G NR FTK G +V AG+E G GV WRLSKE  GSV
Sbjct  432   PIGDGNGVGVGVGGRNGKSFGTRCNGPNRPFTKTGGVVFAGDEYGEGVEWRLSKETEGSV  491

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             LKWRIGG+VW++Y P+ V +S++ETR VEWCDEVDLP+IP
Sbjct  492   LKWRIGGQVWVSYCPSEVKSSHFETRSVEWCDEVDLPIIP  531



>gb|KCW63679.1| hypothetical protein EUGRSUZ_G01325 [Eucalyptus grandis]
Length=528

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/458 (62%), Positives = 346/458 (76%), Gaps = 17/458 (4%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSSDKPFLPL+LQLLQE+I RSPT  +S+CPRSQLQKL PD VSW+++SH+P
Sbjct  78    LWVSDACPLSSDKPFLPLLLQLLQEIILRSPTTRESSCPRSQLQKLRPDPVSWIMESHTP  137

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+ SSFFNLV L+R+FW C+ D PSE G+ YF  +L PNLE  S K AP VLRTF  +VG
Sbjct  138   ESLSSFFNLVFLTRMFWACSFDVPSEIGSFYFQFLLVPNLEALSCKHAP-VLRTFLWSVG  196

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D E CFMRT GYMLAKWL+LREV GVGLQ+LTP   Q L  SY+TEA+GLWILKGYAPV
Sbjct  197   ADAEECFMRTLGYMLAKWLVLREV-GVGLQTLTPLPVQGLSFSYATEAHGLWILKGYAPV  255

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AMK T    +   FPV+EA++S L+Y L+H QLEAV+Q EY+V + DG+IQVN R+DNI
Sbjct  256   AAMKLTRSNDQMKKFPVLEAQDSVLKYVLSHQQLEAVVQLEYSVKFCDGYIQVNTRVDNI  315

Query  712   RLHVARLGFNKSQDD---AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVE  882
             RLHV  LGF K   +   A+  E+HFPSR RVWVGPEVGA+YVGGLSLG+ST+N E+E+ 
Sbjct  316   RLHVMNLGFGKESSEDGLAFAGERHFPSRARVWVGPEVGATYVGGLSLGRSTSNGERELV  375

Query  883   THKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
             T ++ K +FG SK P++KA  + +T+ K+++WRWDQD+EGNA V+DA L D+ TG EVA 
Sbjct  376   TQRVMKSTFGKSKAPEVKATGKTSTRAKLRDWRWDQDSEGNAAVFDAVLHDSTTGQEVAM  435

Query  1063  WKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
               P  G+            RRY  ANR FTK G LV AG+E G  VGWRL +EM GSVLK
Sbjct  436   SCPSKGE---------GFRRRYAAANRPFTKSGGLVFAGDEYGESVGWRLGREMEGSVLK  486

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             WRIGG+VWL+Y  N V +SYYETR VEWCDE+DLPLIP
Sbjct  487   WRIGGQVWLSYVANDVKSSYYETRVVEWCDEIDLPLIP  524



>gb|KDP45337.1| hypothetical protein JCGZ_09586 [Jatropha curcas]
Length=536

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/461 (62%), Positives = 350/461 (76%), Gaps = 13/461 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C L+SDKPFLPL LQLLQE+I+RSP A +STCPRSQLQKL PD +SW++DSHSP
Sbjct  78    LWVSDTCPLNSDKPFLPLFLQLLQEIITRSPMAQNSTCPRSQLQKLKPDPISWIMDSHSP  137

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSSFFNLV L+RLFWLC CDAPSE G+ YF S+L PNLE  SS+  P VLRTF VTVG
Sbjct  138   ESFSSFFNLVFLTRLFWLCVCDAPSEVGSFYFESLLGPNLEALSSEKGP-VLRTFLVTVG  196

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D ELCFMRT GYML KWLIL++VG  GL  L P   Q +  SY+TEA+G W+LKGYAP+
Sbjct  197   VDAELCFMRTIGYMLTKWLILKQVGS-GLHLLGPLVGQQVRFSYATEAHGFWVLKGYAPI  255

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AM      G    FPVIEA++S L+YALAH QLEAVIQ EY+V + DG+I+V AR+DN+
Sbjct  256   LAMNVAKCSGNYK-FPVIEARDSVLKYALAHQQLEAVIQLEYSVTFSDGYIRVIARVDNL  314

Query  712   RLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
             R HVA+LGFN+ +D  Y +E+HF SR RVW GPEVGA+YV G SLG+ST+N E+EVE  +
Sbjct  315   RFHVAKLGFNRKEDVDYAEERHFVSRARVWAGPEVGATYVVGFSLGRSTDNGEREVEMQR  374

Query  892   IWKGSFG-DSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWK  1068
             + KG+F  +SK PK+K  A+MAT+T++KNWRWDQD EGN+V++DA L  N TG EVATWK
Sbjct  375   VRKGNFDEESKAPKVKTRAKMATRTRIKNWRWDQDAEGNSVIFDAVLY-NDTGYEVATWK  433

Query  1069  PDNGD-----DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS  1233
               N D     +       +     + G  R FTK   +V AG+E G GV WRL+KEM GS
Sbjct  434   MMNNDVSDGSNNNGNSNNSRNRYNWNGHRRPFTKTRGMVFAGDEYGEGVEWRLNKEMEGS  493

Query  1234  VLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             VLKWRIGG+VW++YWP+ V +SY+ETRCVEWCDEVDLPLIP
Sbjct  494   VLKWRIGGQVWVSYWPSEVKSSYFETRCVEWCDEVDLPLIP  534



>ref|XP_002524643.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37662.1| conserved hypothetical protein [Ricinus communis]
Length=535

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/458 (61%), Positives = 347/458 (76%), Gaps = 9/458 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSP-TAHDSTCPRSQLQKLHPDRVSWMLDSHS  177
             +WVSD C L+++KPFLPL+LQLL+E+I+RSP  A  STCPRSQLQKL P+ +SW++DSH+
Sbjct  79    LWVSDTCPLNAEKPFLPLLLQLLEEIITRSPMAAQSSTCPRSQLQKLKPEPISWIMDSHT  138

Query  178   PETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTV  357
             PE+FS FFNLV + RLFWLC  DAPSE G+LYF S+L PNL+    + APV L+TF VTV
Sbjct  139   PESFSCFFNLVFIMRLFWLCVFDAPSEVGSLYFESLLGPNLDALKCERAPV-LKTFLVTV  197

Query  358   GTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAP  528
             G D ELCFMRT GYML KWLILREVG VGL  L P   Q +  SY+TEA+G W LKGYA 
Sbjct  198   GADAELCFMRTLGYMLTKWLILREVG-VGLHVLAPALGQQVKFSYATEAHGFWALKGYAS  256

Query  529   VRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDN  708
             + AM       + + FPV+EA+++ L+YALAH QLEAV+Q EY+V ++D +I+V AR+DN
Sbjct  257   ILAMDIANSPRKSSKFPVVEARDTVLKYALAHQQLEAVLQLEYSVNFYDSYIRVIARIDN  316

Query  709   IRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETH  888
             +R HVA+LGF K+++  Y +E+H  SR++VWVGPEVGA+YV GLSLG+ST+N E+E+E  
Sbjct  317   LRFHVAKLGFKKNENADYGEERHLVSRVKVWVGPEVGATYVAGLSLGRSTDNGERELEMK  376

Query  889   KIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWK  1068
             K+ KGS  +SK  K+K  AR AT+TKMKNWRWDQD EGN V++DA L +N  G EVA W 
Sbjct  377   KVVKGSVENSKASKVKTRARTATRTKMKNWRWDQDAEGNTVIFDAVLHNNINGQEVAAWN  436

Query  1069  P--DNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
                DN  DG       N   +++G NR FTK   LV AG+E G GV WRLSKEM GSVLK
Sbjct  437   SNIDNTSDGGDGKSSGN-ENKFKGPNRPFTKTRGLVFAGDEYGEGVEWRLSKEMEGSVLK  495

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             WRIGGEVW++YWP+ V +SY+ETRCVEWCDEVDLPLIP
Sbjct  496   WRIGGEVWVSYWPSEVKSSYFETRCVEWCDEVDLPLIP  533



>ref|XP_004496924.1| PREDICTED: uncharacterized protein LOC101504693 [Cicer arietinum]
Length=562

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/458 (62%), Positives = 351/458 (77%), Gaps = 13/458 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKP-FLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHS  177
             +W+S++C +SS  P +LPL+LQLLQE+IS SPTAHDSTCPRSQLQKL P+ ++W++DSH+
Sbjct  106   LWISEKCTISSQNPNYLPLLLQLLQEIISNSPTAHDSTCPRSQLQKLKPEPIAWIIDSHT  165

Query  178   PETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTV  357
             PE+ S FFNLV   RLFWLCACDAPSEAG+LYFHS+LAP LE  SSK    VLRTFF+TV
Sbjct  166   PESLSIFFNLVFTIRLFWLCACDAPSEAGSLYFHSLLAPILETASSKKLASVLRTFFITV  225

Query  358   GTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP----QYLGISYSTEAYGLWILKGYA  525
             G D ELCFMRT GY++AKW ILRE+G VGLQ+L P         SY+ E++GLWILKGYA
Sbjct  226   GVDTELCFMRTLGYIIAKWCILRELG-VGLQTLVPLPWCSNPKFSYAAESHGLWILKGYA  284

Query  526   PVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLD  705
             P+  MK     G ++ F  I+AKES +RY LAHHQLEA +Q EYTVG++DGFIQV+AR+D
Sbjct  285   PIMTMKLAGSNGNKSQFHGIDAKESVIRYGLAHHQLEAHVQLEYTVGFYDGFIQVHARVD  344

Query  706   NIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             NIRLHVARLGF    +  +V+EKHFPSR RVWVGPE+GA+YVGGLSLG+ST N E+EVE 
Sbjct  345   NIRLHVARLGFKHGDEVDFVEEKHFPSRARVWVGPEIGATYVGGLSLGRSTENSEREVEI  404

Query  886   HKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
              KI +G+F  S++ K+KA A+ + + + +NWR DQD EGNA ++DA L DN TG EV +W
Sbjct  405   EKIVRGNFEKSQISKVKASAKSSRRMRNRNWRMDQDAEGNAAIFDAVLHDNMTGQEVGSW  464

Query  1066  KPDN--GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVL  1239
             KP +  GDD       N L  RY GANR FTK GS+VIAG+E G  +GWRLSK+M GSVL
Sbjct  465   KPSSKTGDDWG-----NGLRGRYVGANRPFTKSGSVVIAGDEYGEEIGWRLSKDMEGSVL  519

Query  1240  KWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             KWRIGGE  +TY  +    S++ETR +EWCDEVDLPLI
Sbjct  520   KWRIGGEFCVTYLSDQSKGSHFETRSIEWCDEVDLPLI  557



>gb|KHN06775.1| hypothetical protein glysoja_021321 [Glycine soja]
Length=530

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/455 (62%), Positives = 352/455 (77%), Gaps = 11/455 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVS++CHLSS+KPFLPL+LQLLQE+IS SPTAHDSTCPRSQLQKL PD ++W++DSH+P
Sbjct  78    LWVSEKCHLSSEKPFLPLLLQLLQEIISHSPTAHDSTCPRSQLQKLKPDPIAWIMDSHTP  137

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+ S+FFNLV   RLFWLCA  AP EAG+LYFHS+LAP L+  SSK A  VLRTFF+TVG
Sbjct  138   ESLSTFFNLVFTMRLFWLCAFHAPPEAGSLYFHSLLAPVLQTASSKLASSVLRTFFITVG  197

Query  361   TDVELCFMRTFGYMLAKWLILRE--VGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVR  534
              D ELCFMRT GY++ K  +++E  VG +GL++L P     SY+ EA+GLWILKGYAPV 
Sbjct  198   VDTELCFMRTLGYIITKLHLIKELDVGLLGLKTLLPS-PKFSYANEAHGLWILKGYAPVM  256

Query  535   AMKCT-LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              MK    +  ++  F  I+AKES LRY+LAHHQLEA +Q +YTVG++DGFIQV AR+DNI
Sbjct  257   TMKLARTNTVQKTQFSGIDAKESILRYSLAHHQLEAHVQLDYTVGFYDGFIQVRARVDNI  316

Query  712   RLHVARLGFNKSQD-DAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETH  888
             RLH+ARLGF+++ D D +V+EKHFPSR+RVWVGPE+G++Y  GLSLG+ST N E EVET 
Sbjct  317   RLHLARLGFSQNDDVDDFVEEKHFPSRVRVWVGPEIGSTYCAGLSLGRSTENKECEVETK  376

Query  889   KIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWK  1068
             +I +G+F  S+   +KA+A+ + +T+ ++WR DQD EGNA ++D  L DN TG EV +W+
Sbjct  377   RIVEGNFEKSQGSNVKALAKSSRRTRSRSWRMDQDAEGNAAIFDVVLHDNTTGQEVGSWR  436

Query  1069  PDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWR  1248
             P  GDD       + L  RY  ANR F K GS+VIAG+E G  VGWRLSKEM GSVLKWR
Sbjct  437   P-KGDDP-----AHGLRGRYVRANRAFNKSGSVVIAGDEYGEEVGWRLSKEMEGSVLKWR  490

Query  1249  IGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             IGGE W++Y PN    SY+ETR +EWCDEVDLPLI
Sbjct  491   IGGEFWVSYLPNQAKGSYFETRYIEWCDEVDLPLI  525



>ref|XP_007143070.1| hypothetical protein PHAVU_007G041300g [Phaseolus vulgaris]
 gb|ESW15064.1| hypothetical protein PHAVU_007G041300g [Phaseolus vulgaris]
Length=524

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/453 (61%), Positives = 340/453 (75%), Gaps = 6/453 (1%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVS++CHLSS  PFLPL+LQLLQE+IS SP AHDSTCPRSQLQKL PD ++W++DSH+P
Sbjct  73    LWVSEKCHLSSQNPFLPLLLQLLQEIISHSPNAHDSTCPRSQLQKLKPDPIAWIMDSHTP  132

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+ S+FFNLV   RLFWLCA  AP EAG+LYFHS+L P LE  SSK A + LRTFF+TVG
Sbjct  133   ESLSTFFNLVFTMRLFWLCAFHAPPEAGSLYFHSLLTPTLETASSKLASI-LRTFFITVG  191

Query  361   TDVELCFMRTFGYMLAKWLILREVG-GVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRA  537
              D ELCFMRT GY++ K  +++E+  G+GL++L P     SY+TEA+GLWILKGY+PV +
Sbjct  192   VDTELCFMRTLGYIITKLHMIKELSTGLGLKTLLPSPR-FSYATEAHGLWILKGYSPVMS  250

Query  538   MKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRL  717
             MK      +++ F  I+AKES LRYALAHHQLEA +Q EY+VG+ DGFI V AR+DNIRL
Sbjct  251   MKLARSNAKKSQFCGIDAKESILRYALAHHQLEAHVQIEYSVGFRDGFIHVRARVDNIRL  310

Query  718   HVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIW  897
              VARLGFN++ +  +V+EKHFPSR+RVWVGPE+GA+Y  GLSLG+ST N E EVE  K+ 
Sbjct  311   QVARLGFNQNDEVDFVEEKHFPSRVRVWVGPEIGATYCAGLSLGRSTENKESEVEVQKVV  370

Query  898   KGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
             KGS   S+   + A AR + +T+ ++WR DQ+ EGNA ++D  L D+ TG+EV  WK   
Sbjct  371   KGSLEKSQGSNVVASARSSRRTRSRSWRMDQEAEGNAAIFDVVLHDSGTGVEVGAWK---  427

Query  1078  GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGG  1257
             G        +N L  RY   NR FTK G++VI G+E G  VGWRLSKEM GSVLKWRIGG
Sbjct  428   GTSETGDAHVNGLRGRYVRGNRAFTKSGAVVIGGDEYGEEVGWRLSKEMEGSVLKWRIGG  487

Query  1258  EVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             E WLTY PN    SY+ETR +EWCDEVDLPLIP
Sbjct  488   EFWLTYLPNQTQASYFETRYIEWCDEVDLPLIP  520



>ref|XP_003555280.1| PREDICTED: uncharacterized protein LOC100809854 [Glycine max]
Length=528

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/457 (60%), Positives = 348/457 (76%), Gaps = 13/457 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVS++CHLSS+KPFLPL+LQLLQE+IS SPTAHDSTCPRSQLQKL+P+ ++W++DSH+P
Sbjct  74    LWVSEKCHLSSEKPFLPLLLQLLQEIISHSPTAHDSTCPRSQLQKLNPEPIAWIMDSHTP  133

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+ S+FFNLV   RLFWLCAC AP EAG+LYFH +LAP+L+  SSK A  VLRTFF+TVG
Sbjct  134   ESLSTFFNLVFTMRLFWLCACHAPPEAGSLYFHYLLAPSLQTASSKLASSVLRTFFITVG  193

Query  361   TDVELCFMRTFGYMLAKWLILREVG-GVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRA  537
              D ELCFMRT GY++ K  +++E+  G+GL+++ P     SY+ E +GLWILKGYAPV  
Sbjct  194   VDTELCFMRTLGYIITKLHMIKELSVGLGLKTIFPSPR-FSYANETHGLWILKGYAPVMT  252

Query  538   MKCTLHRG-ERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIR  714
             MK       +++ F  I+AKES LRY+LAHHQLEA +Q EYTVG+FD FIQV AR+DNIR
Sbjct  253   MKLARSNNVKKSQFSGIDAKESILRYSLAHHQLEAHVQLEYTVGFFDAFIQVRARVDNIR  312

Query  715   LHVARLGFNKSQD-DAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
             LHVARLGF ++ D D +V+EKHFPSR+RVWVGPE+GA+Y  GLSLG+ST N E EVET +
Sbjct  313   LHVARLGFTQNDDVDDFVEEKHFPSRVRVWVGPEIGATYCAGLSLGRSTENKESEVETKR  372

Query  892   IWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
             + +G+   S+   +KA+A+ + +T+ ++WR DQD EGNA ++D  L DN TG E+ +W+P
Sbjct  373   VVEGNLEKSQGSNVKALAKSSRRTRSRSWRMDQDAEGNAAIFDVVLHDNTTGQEMGSWRP  432

Query  1072  ---DNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
                  GD G      + L  RY  ANR F K GS+VIAG+E G  VGWRL KEM GSV+K
Sbjct  433   ISETGGDPG------HGLRGRYARANRAFNKSGSVVIAGDEYGEEVGWRLCKEMEGSVMK  486

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             WRIGGE W++Y PN    S +ETR +EWCDEVDLPLI
Sbjct  487   WRIGGEFWVSYLPNQAKGSSFETRYMEWCDEVDLPLI  523



>gb|KHN42347.1| hypothetical protein glysoja_020059 [Glycine soja]
Length=528

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/457 (60%), Positives = 347/457 (76%), Gaps = 13/457 (3%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVS++CHLSS+KPFLPL+LQLLQE+IS SPTAHDSTCPRSQLQKL+P+ ++W++DSH+P
Sbjct  74    LWVSEKCHLSSEKPFLPLLLQLLQEIISHSPTAHDSTCPRSQLQKLNPEPIAWIMDSHTP  133

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+ S+FFNLV   RLFWLCA  AP EAG+LYFH +LAP+L+  SSK A  VLRTFF+TVG
Sbjct  134   ESLSTFFNLVFTMRLFWLCAFHAPPEAGSLYFHYLLAPSLQTASSKLASSVLRTFFITVG  193

Query  361   TDVELCFMRTFGYMLAKWLILREVG-GVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRA  537
              D ELCFMRT GY++ K  +++E+  G+GL+++ P     SY+ E +GLWILKGYAPV  
Sbjct  194   VDTELCFMRTLGYIITKLHMIKELSVGLGLKTIFPSPR-FSYANETHGLWILKGYAPVMT  252

Query  538   MKCTLHRG-ERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIR  714
             MK       +++ F  I+AKES LRY+LAHHQLEA +Q EYTVG+FD FIQV AR+DNIR
Sbjct  253   MKLARSNNVKKSQFSGIDAKESILRYSLAHHQLEAHVQLEYTVGFFDAFIQVRARVDNIR  312

Query  715   LHVARLGFNKSQD-DAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
             LHVARLGF ++ D D +V+EKHFPSR+RVWVGPE+GA+Y  GLSLG+ST N E EVET +
Sbjct  313   LHVARLGFTQNDDVDDFVEEKHFPSRVRVWVGPEIGATYCAGLSLGRSTENKESEVETKR  372

Query  892   IWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
             + +G+   S+   +KA+A+ + +T+ ++WR DQD EGNA ++D  L DN TG E+ +W+P
Sbjct  373   VVEGNLEKSQGSNVKALAKSSRRTRSRSWRMDQDAEGNAAIFDVVLHDNTTGQEMGSWRP  432

Query  1072  ---DNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
                  GD G      + L  RY  ANR F K GS+VIAG+E G  VGWRL KEM GSV+K
Sbjct  433   ISETGGDPG------HGLRGRYARANRAFNKSGSVVIAGDEYGEEVGWRLCKEMEGSVMK  486

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             WRIGGE W++Y PN    S +ETR +EWCDEVDLPLI
Sbjct  487   WRIGGEFWVSYLPNQAKGSSFETRYMEWCDEVDLPLI  523



>ref|XP_010691652.1| PREDICTED: uncharacterized protein LOC104904930 [Beta vulgaris 
subsp. vulgaris]
Length=529

 Score =   520 bits (1339),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 328/459 (71%), Gaps = 10/459 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSP-TAHDS--TCPRSQLQKLHPDRVSWMLDS  171
             +W+S  C LSS KPFLPLVLQL+QE+I+R+P T HD   T   SQ  K+  D ++ +LD+
Sbjct  71    IWISSPCFLSSHKPFLPLVLQLVQEIINRTPITYHDHIHTHHGSQPIKVKSDAIALILDT  130

Query  172   HSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFV  351
              SPE+FS FFN++L +RLFWLCACDAPS+ G+LYFHS+LAPNLE+ S      ++++F  
Sbjct  131   FSPESFSGFFNILLFTRLFWLCACDAPSDVGSLYFHSLLAPNLELLSRASHMPMVKSFMT  190

Query  352   TVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSL--TPQYLGISYSTEAYGLWILKGYA  525
             TVG DVEL   R  GYMLAKWLI RE+  VGL SL   P  LG+SY+ EA G+W++KGY 
Sbjct  191   TVGVDVELSISRAVGYMLAKWLIAREM-RVGLSSLLPLPSNLGLSYACEASGIWLMKGYV  249

Query  526   PVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLD  705
             P+ AMK T    +   F  + AKESALRY+LAH QLEA IQ EY V +F+G+IQV+AR+D
Sbjct  250   PIWAMKRTCSSDKSEGFLFVGAKESALRYSLAHQQLEAHIQLEYGVRFFEGYIQVSARVD  309

Query  706   NIRLHVARLGFNKSQDDAYV---DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKE  876
             NIRLHV +LGFN ++D+  V   +E +FPSRI  WVGPE+G++YV  LSLG+ST N E+E
Sbjct  310   NIRLHVVKLGFNNNEDNTDVEFREELYFPSRIEFWVGPELGSNYVTSLSLGKSTINTERE  369

Query  877   VETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
             VET K+ KGSFG  K PK+K ++R +TK KMKNWR DQD +GN  ++DA   DN +GIEV
Sbjct  370   VETQKLVKGSFGKMKNPKVKTMSRTSTKMKMKNWRCDQDVQGNTAIFDAVFYDNTSGIEV  429

Query  1057  ATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
                K   G         ++L +RY   NR F K G LV  G E G  V WRLSKEM GSV
Sbjct  430   YNTKLSGGATTSNK-SRDDLSKRYSRVNRPFMKSGGLVFTGNEYGEDVKWRLSKEMEGSV  488

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             LKWRIG ++WLTYWP+ V +SYYETRC+EW +EVDLPLI
Sbjct  489   LKWRIGSKIWLTYWPSDVESSYYETRCIEWINEVDLPLI  527



>ref|NP_179106.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD03359.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL91197.1| unknown protein [Arabidopsis thaliana]
 gb|AAU95456.1| At2g15020 [Arabidopsis thaliana]
 gb|AEC06360.1| uncharacterized protein AT2G15020 [Arabidopsis thaliana]
Length=526

 Score =   514 bits (1324),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 250/473 (53%), Positives = 339/473 (72%), Gaps = 36/473 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVS+ C LSS+KPFLPLVLQLLQE+I+RSPT HD  C + +  ++ P  VSW++DSHSP
Sbjct  69    IWVSNTCPLSSEKPFLPLVLQLLQELITRSPTTHDGACTKFEQLEIKPSPVSWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL+RLFWLC  DAPSE G+ +F  +L P++   + + AP VLRTF V++G
Sbjct  129   ESFSSVFNLILLTRLFWLCVFDAPSEVGSFFFQHLLGPHVNALTCQHAP-VLRTFLVSLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQ----SLTPQY-LGISYSTEAYGLWILKG  519
              D ELC +R   Y L+KW+I +E+  G +GL+    SL P++ LG SY+TEA+GLWILKG
Sbjct  188   VDAELCIVRAASYALSKWMISKEIGLGNLGLKQFSSSLMPRHSLGFSYATEAHGLWILKG  247

Query  520   YAPVRAMKCTLHRGER-----NPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFI  684
             Y P+ +M  T +           FP +E KE+ LRYAL+H Q E ++QFEY+V +++ +I
Sbjct  248   YFPILSMNVTNNSSNEVHNKIVKFPFVEPKEAVLRYALSHQQAEILVQFEYSVKFYENYI  307

Query  685   QVNARLDNIRLHVARLGFNKSQ-------DDAYVDEKHFPSRIRVWVGPEVGASYVGGLS  843
             +VNAR+DNIR+HV++LGF+K          D Y +E++FPSR+RVW+GPE+G+S+V GLS
Sbjct  308   KVNARVDNIRIHVSKLGFHKGGVGVENQIADCYSEERYFPSRVRVWLGPELGSSHVSGLS  367

Query  844   LGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVYD  1020
             LG+ST N E+++E  ++ KG+FG  KV P++KA ARMATK K+K+WR +Q++EGNA V+D
Sbjct  368   LGRSTKNEERDIEVTRVLKGNFGKGKVAPRVKARARMATKRKVKDWRIEQESEGNAAVFD  427

Query  1021  ATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGV  1200
             A L D ++G EV T KP    +G   V               FTK G +V   +E G  V
Sbjct  428   AVLYDRESGQEVTTVKPKPNQEGLKNV---------------FTKSGGMVFGRDEYGDEV  472

Query  1201  GWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             GWR+ +EM GSVLKWR+GG++WLTYWPN +NT +YETRCVEWCDEVDLPL+PT
Sbjct  473   GWRVGREMEGSVLKWRLGGKIWLTYWPNKLNTLFYETRCVEWCDEVDLPLLPT  525



>ref|XP_010467282.1| PREDICTED: uncharacterized protein LOC104747350 [Camelina sativa]
Length=528

 Score =   509 bits (1312),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/474 (53%), Positives = 337/474 (71%), Gaps = 37/474 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQLL+E+IS SPT  D    +S+L ++ P  VSW++DSHSP
Sbjct  69    IWVSDTCLLSSEKPFLPLVLQLLRELISHSPTTRDGARTKSELLEIKPGPVSWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL RLFWLC  DAPSE G+ +F ++L P++   + + AP VLRTF V++G
Sbjct  129   ESFSSVFNLILLVRLFWLCVFDAPSEVGSFFFQNLLGPHVNALTCQQAP-VLRTFLVSLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQ----SLTPQY--LGISYSTEAYGLWILK  516
              D ELC +R   Y L+KW+I +EV  G +GL+    SL P +  LG SY+TEA+GLWILK
Sbjct  188   VDAELCIVRAASYALSKWMISKEVGLGNLGLKQFSSSLIPSHRSLGFSYATEAHGLWILK  247

Query  517   GYAPVRAMKCTLHRGER-----NPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGF  681
             GY P+ +MK T +   +       FP +E KE+ LRYAL+H Q E ++QFEY+V + + +
Sbjct  248   GYFPILSMKVTNNSSNQIQNKIVKFPFVEPKEAVLRYALSHQQAEILVQFEYSVKFHENY  307

Query  682   IQVNARLDNIRLHVARLGFNKSQ-------DDAYVDEKHFPSRIRVWVGPEVGASYVGGL  840
             I+VNAR+DNIR+H+++LGF            D Y +E++FPSR+RVW+GPE+G+S+V GL
Sbjct  308   IKVNARVDNIRIHMSKLGFQNGGVGLENKIADCYSEERYFPSRVRVWLGPEIGSSHVSGL  367

Query  841   SLGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVY  1017
             SLG+ST N E+EVE  ++ KG+FG  KV P++KA ARM+TK K+K+W+ +QD+EGNA V+
Sbjct  368   SLGRSTKNEEREVEVTRVLKGNFGKGKVAPRVKARARMSTKRKVKDWKIEQDSEGNAAVF  427

Query  1018  DATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTG  1197
             DA L D ++G EV   KP+   +G   V               FTK G +V   +E G  
Sbjct  428   DAVLYDRESGQEVTMVKPNPNQEGLKNV---------------FTKSGGMVFGRDEYGDE  472

Query  1198  VGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             VGWR+ +EM GSVLKWR+GG++WLTYWPN +NTS+YETRCVEWCDEVDLPL+PT
Sbjct  473   VGWRVGREMEGSVLKWRMGGKIWLTYWPNKLNTSFYETRCVEWCDEVDLPLLPT  526



>ref|XP_006297389.1| hypothetical protein CARUB_v10013412mg [Capsella rubella]
 gb|EOA30287.1| hypothetical protein CARUB_v10013412mg [Capsella rubella]
Length=537

 Score =   509 bits (1312),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 256/474 (54%), Positives = 341/474 (72%), Gaps = 37/474 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRS-QLQKLHPDRVSWMLDSHS  177
             +WVSD C LSS+KPFLPLVLQLL+E+IS SPT+ +  C +S +L ++ P  VSW++DSHS
Sbjct  78    IWVSDTCLLSSEKPFLPLVLQLLRELISHSPTSREGACTKSSELLEIKPGPVSWVMDSHS  137

Query  178   PETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTV  357
             PE+FSS FNL+LL RLFWLC  +APSE G+ +F  +L P++   + + APV LRTF V++
Sbjct  138   PESFSSVFNLILLMRLFWLCVFNAPSEVGSFFFQHLLGPHVNALTCQQAPV-LRTFLVSL  196

Query  358   GTDVELCFMRTFGYMLAKWLILREVG--GVGLQ----SLTP-QYLGISYSTEAYGLWILK  516
             G D ELC +R   Y L+KW+I +EVG   +GL+    SL P Q LG SY+TEA+GLWILK
Sbjct  197   GVDAELCIVRAASYALSKWMISKEVGLGNLGLKQFSNSLMPRQSLGFSYATEAHGLWILK  256

Query  517   GYAPVRAMKCTLH-----RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGF  681
             GY P+ +M  T +     + +   FP +E KE+ LRYAL+H Q+E ++QFEY+V + + +
Sbjct  257   GYFPILSMNVTNNSSNELQNKIVKFPFVEPKEAVLRYALSHQQVEVLVQFEYSVKFHESY  316

Query  682   IQVNARLDNIRLHVARLGFNK------SQ-DDAYVDEKHFPSRIRVWVGPEVGASYVGGL  840
             I+VNAR+DNIR+HV++LGF K      SQ  D Y +EK+FPSR+RVW+GPE+G+S+V GL
Sbjct  317   IKVNARVDNIRIHVSKLGFQKGGVGVESQIADCYSEEKYFPSRVRVWLGPEIGSSHVSGL  376

Query  841   SLGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVY  1017
             SLG+ST N E+EVE  ++ KG+FG  KV P++KA ARM+TK K+K+WR +QD+EGNA V+
Sbjct  377   SLGRSTKNEEREVEVTRVLKGNFGKGKVAPRVKARARMSTKKKVKDWRIEQDSEGNAAVF  436

Query  1018  DATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTG  1197
             DA L D  +G EV T KP+   +G   V               FTK G +V   +E G  
Sbjct  437   DAVLYDKDSGQEVTTGKPNPNGEGLKNV---------------FTKSGGMVFGKDEYGDE  481

Query  1198  VGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             VGWR+ +EM GSVLKWR+GG++WLTYWPN +NTS+YETRCVEW DEVDLPL+PT
Sbjct  482   VGWRVGREMEGSVLKWRMGGKIWLTYWPNKLNTSFYETRCVEWSDEVDLPLLPT  535



>ref|XP_010488940.1| PREDICTED: uncharacterized protein LOC104766698 [Camelina sativa]
Length=528

 Score =   509 bits (1311),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 250/474 (53%), Positives = 337/474 (71%), Gaps = 37/474 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQ+L+E+IS SPT  D    +S+L ++ P  VSW++DSHSP
Sbjct  69    IWVSDTCLLSSEKPFLPLVLQVLRELISHSPTTRDGARTKSELLEIKPGPVSWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL RLFWLC  DAPSE G+ +F ++L P++   + + AP VLRTF V++G
Sbjct  129   ESFSSVFNLILLVRLFWLCVFDAPSEVGSFFFQNLLGPHVNALTCQQAP-VLRTFLVSLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQ----SLTPQY--LGISYSTEAYGLWILK  516
              D ELC +R   Y L+KW+I +EV  G +GL+    SL P +  LG SY+TEA+GLWILK
Sbjct  188   VDAELCIVRAASYALSKWMISKEVGLGNLGLKQFSSSLMPSHPSLGFSYATEAHGLWILK  247

Query  517   GYAPVRAMKCTLHRGER-----NPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGF  681
             GY P+ +M  T +   +       FP +E KE+ LRYAL+H Q E ++QFEY+V + + +
Sbjct  248   GYFPILSMNVTNNSSNQIQNKIVKFPFVEPKEAVLRYALSHQQAEILVQFEYSVKFHENY  307

Query  682   IQVNARLDNIRLHVARLGFNKSQ-------DDAYVDEKHFPSRIRVWVGPEVGASYVGGL  840
             I+VNAR+DNIR+H+++LGF            D Y +E++FPSR+RVW+GPE+G+S+V GL
Sbjct  308   IKVNARVDNIRIHMSKLGFQNGGVGLENKIADCYSEERYFPSRVRVWLGPEIGSSHVSGL  367

Query  841   SLGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVY  1017
             SLG+ST N E+EVE  ++ KG+FG  KV P++KA ARM+TK K+K+W+ +QD+EGNA V+
Sbjct  368   SLGRSTKNEEREVEVTRVLKGNFGKGKVAPRVKARARMSTKRKVKDWKIEQDSEGNAAVF  427

Query  1018  DATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTG  1197
             DA L D ++G EV T KP+   +G   V               FTK G +V   +E G  
Sbjct  428   DAVLYDRESGQEVTTVKPNRNQEGLKNV---------------FTKSGGMVFGRDEYGDE  472

Query  1198  VGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             VGWR+ +EM GSVLKWR+GG++WLTYWPN +NTS+YETRCVEWCDEVDLPL+PT
Sbjct  473   VGWRVGREMEGSVLKWRMGGKIWLTYWPNKLNTSFYETRCVEWCDEVDLPLLPT  526



>ref|XP_009136265.1| PREDICTED: uncharacterized protein LOC103860415 [Brassica rapa]
Length=524

 Score =   508 bits (1308),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 248/473 (52%), Positives = 335/473 (71%), Gaps = 38/473 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQLLQE+IS SPT  +STC +S+  ++    VSW++DSHSP
Sbjct  69    IWVSDTCALSSEKPFLPLVLQLLQELISYSPTTGESTCTKSEPLEIKSGPVSWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL+RLFWLC  DAPSE G+ +F  +L P+++  + + AP VLRTF  ++G
Sbjct  129   ESFSSVFNLILLTRLFWLCVFDAPSEVGSFFFQHLLGPHVKSLTCQHAP-VLRTFLASLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQSLTP----QYLGISYSTEAYGLWILKGY  522
              D ELC +R   Y L+KW+I +EV  G +GL+ +T     Q LG SY+TEA+GLW LKGY
Sbjct  188   VDAELCIVRAASYALSKWMISKEVGLGNLGLKQITSPLPHQSLGFSYATEAHGLWSLKGY  247

Query  523   APVRAMKCT-------LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGF  681
              P+ +M  T       +H  +   FP +E KE+ LRYAL+H   E ++QFEY+V + + +
Sbjct  248   FPILSMNLTNNISSSEMHNNKIIKFPFVEPKEAVLRYALSHQHAEVIVQFEYSVTFHENY  307

Query  682   IQVNARLDNIRLHVARLGFNKSQD------DAYVDEKHFPSRIRVWVGPEVGASYVGGLS  843
             I+VNAR+DNIR+HV++LGF+K +       + Y DEK+FPSR++VWVGPEVG+++V GLS
Sbjct  308   IKVNARVDNIRVHVSKLGFHKGRGMENQIAECYSDEKYFPSRVQVWVGPEVGSNHVSGLS  367

Query  844   LGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVYD  1020
             LG+ST N E+EVE  ++ KG+FG  KV P++KA AR++T+ K+K+WR +Q+ EGNA V+D
Sbjct  368   LGRSTKNEEREVEVMRVLKGNFGKGKVAPRVKARARISTRRKIKDWRIEQECEGNAAVFD  427

Query  1021  ATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGV  1200
             A L D ++G EV T KP+                   G    FTK G +V   +E G G 
Sbjct  428   AVLYDRESGQEVMTVKPNQ-----------------EGMKNVFTKSGGMVFGRDEYGDGA  470

Query  1201  GWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             GWR+ +EM GSVLKWR+GG++WLTYWPN + TS+YETRCVEWCDEVDLPL+PT
Sbjct  471   GWRVGREMEGSVLKWRMGGKIWLTYWPNKLCTSFYETRCVEWCDEVDLPLVPT  523



>gb|KFK39994.1| hypothetical protein AALP_AA3G316400 [Arabis alpina]
Length=523

 Score =   508 bits (1307),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 247/472 (52%), Positives = 336/472 (71%), Gaps = 37/472 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQLL+E+IS SPT   ++C +S+L ++ P  V+W++DSHSP
Sbjct  69    IWVSDTCPLSSEKPFLPLVLQLLRELISHSPTTRHNSCTKSELLEIKPGPVNWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL+RLFWLC  DAPSE G+ +F  +L P +   + +  P VLRTF V++G
Sbjct  129   ESFSSIFNLILLTRLFWLCVFDAPSEVGSFFFQHLLGPQVNALTCQGLP-VLRTFLVSLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQSL---TPQY-LGISYSTEAYGLWILKGY  522
              D ELC +R   Y L+KW+I +EV  G +GL+ L   +P + LG SY+TEA+GLWILKGY
Sbjct  188   VDTELCIVRAASYALSKWIISKEVGLGNLGLKQLSIASPSHSLGFSYATEAHGLWILKGY  247

Query  523   APVRAMKCTLHRGERN------PFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFI  684
              P+ +M  T +            FP++E KE+ LRYAL+H   E V+QFEY+V + + +I
Sbjct  248   FPILSMNVTNNNTSNELHNKIIKFPIVEPKETVLRYALSHQHAEVVVQFEYSVIFHENYI  307

Query  685   QVNARLDNIRLHVARLGFNKSQD------DAYVDEKHFPSRIRVWVGPEVGASYVGGLSL  846
             +VNAR+DNIR+HV++LGF+K+Q       D Y +E +FPSR++VWVGPE+G+S+V GLSL
Sbjct  308   RVNARVDNIRIHVSKLGFHKAQGVENKIADCYSEETYFPSRVQVWVGPEIGSSHVSGLSL  367

Query  847   GQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVYDA  1023
             G+ST N E+E+E  ++ KG+FG  KV P++KA ARM+TK K+K+WR +Q++EGNA V++A
Sbjct  368   GRSTKNEEREIEVTRVLKGNFGKGKVAPRVKARARMSTKRKVKDWRIEQESEGNAAVFNA  427

Query  1024  TLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVG  1203
              L D ++G EV T KP                  + G    FTK G +V   +E G  VG
Sbjct  428   VLYDRESGQEVTTVKPS-----------------HEGFKNVFTKSGGMVFGRDEYGDEVG  470

Query  1204  WRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             WR+ +EM GSVLKWR+GG++WLTYWPN +NT +YETRCVEWCDEVDLPL+PT
Sbjct  471   WRVGREMEGSVLKWRMGGKIWLTYWPNKLNTLFYETRCVEWCDEVDLPLLPT  522



>ref|XP_010517991.1| PREDICTED: uncharacterized protein LOC104793341 isoform X1 [Camelina 
sativa]
 ref|XP_010517999.1| PREDICTED: uncharacterized protein LOC104793341 isoform X2 [Camelina 
sativa]
Length=528

 Score =   506 bits (1302),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 249/474 (53%), Positives = 336/474 (71%), Gaps = 37/474 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQLL+E+IS SPT  D    +S+L ++ P  VSW++DSHSP
Sbjct  69    IWVSDTCLLSSEKPFLPLVLQLLRELISHSPTTRDGARTKSELLEIKPGPVSWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL RLFWLC  DAPSE G+ +F ++L P++   + + AP VLRTF V++G
Sbjct  129   ESFSSVFNLILLVRLFWLCVFDAPSEVGSFFFQNLLGPHVNALTCQQAP-VLRTFLVSLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQ----SLTPQY--LGISYSTEAYGLWILK  516
              D ELC +R   Y L+KW+I +EV  G +GL+    SL P +  LG SY+TEA+GLWILK
Sbjct  188   VDAELCIVRAASYALSKWMISKEVGLGNLGLKQFSSSLMPSHRSLGFSYATEAHGLWILK  247

Query  517   GYAPVRAMKCTLHRGER-----NPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGF  681
             GY P+ +M  T +   +       FP +E KE+ LRYAL+H Q E ++QFEY+V + + +
Sbjct  248   GYFPILSMNVTNNSSNQIQNKIVKFPFVEPKEAVLRYALSHQQAEILVQFEYSVKFHENY  307

Query  682   IQVNARLDNIRLHVARLGFNKSQ-------DDAYVDEKHFPSRIRVWVGPEVGASYVGGL  840
             I+VNAR+D+IR+H+++LGF            D Y +E++FPSR+RVW+GPE+G+ +V GL
Sbjct  308   IKVNARVDDIRIHMSKLGFQNGGVGLENKIADCYSEERYFPSRVRVWLGPEIGSCHVSGL  367

Query  841   SLGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVY  1017
             SLG+ST N E+EVE  ++ KG+FG  KV P++KA ARM+TK K+K+W+ +QD+EGNA V+
Sbjct  368   SLGRSTKNEEREVEVTRVLKGNFGKGKVAPRVKARARMSTKRKVKDWKIEQDSEGNAAVF  427

Query  1018  DATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTG  1197
             DA L D ++G EV T KP+   +G   V               FTK G +V   +E G  
Sbjct  428   DAVLYDRESGQEVTTVKPNPNQEGLKNV---------------FTKSGGMVFGRDEYGDE  472

Query  1198  VGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             VGWR+ +EM GSVLKWR+GG++WLTYWPN +NTS+YETRCVEWCDEVDLPL+PT
Sbjct  473   VGWRVGREMEGSVLKWRMGGKIWLTYWPNKLNTSFYETRCVEWCDEVDLPLLPT  526



>emb|CDX93155.1| BnaA03g38770D [Brassica napus]
Length=524

 Score =   504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 247/473 (52%), Positives = 334/473 (71%), Gaps = 38/473 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQLLQE+IS SPT  +STC +S+  ++    VSW++DSHSP
Sbjct  69    IWVSDTCALSSEKPFLPLVLQLLQELISYSPTTGESTCTKSEPLEIKSGPVSWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL+RLFWLC  DAPSE G+ +F  +L P+++  + + AP VLRTF  ++G
Sbjct  129   ESFSSVFNLILLTRLFWLCVFDAPSEVGSFFFQHLLGPHVKSLTCQHAP-VLRTFLASLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQSLTP----QYLGISYSTEAYGLWILKGY  522
              D ELC +R   Y L+KW+I +EV  G +GL+ +T     Q LG SY+TEA+GLW LKGY
Sbjct  188   VDAELCIVRAASYALSKWMISKEVGLGNLGLKQITSPLPHQSLGFSYATEAHGLWSLKGY  247

Query  523   APVRAMKCT-------LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGF  681
              P+ +M  T       +H  +   FP +E KE+ LRYAL+H   E ++QFEY+V + + +
Sbjct  248   FPILSMNLTNNNSSSEMHNNKIIKFPFVEPKEAVLRYALSHQHAEVIVQFEYSVTFHENY  307

Query  682   IQVNARLDNIRLHVARLGFNKSQD------DAYVDEKHFPSRIRVWVGPEVGASYVGGLS  843
             I+VNAR+DNIR+HV++LGF+K +       + Y DEK+FPSR++VWVGPEVG+++V GLS
Sbjct  308   IKVNARVDNIRVHVSKLGFHKGRGMENQIAECYSDEKYFPSRVQVWVGPEVGSNHVSGLS  367

Query  844   LGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVYD  1020
             LG+ST N E+EVE  ++ KG+FG  KV P++KA AR++T+ K+K+WR +Q+ EGNA V+D
Sbjct  368   LGRSTKNEEREVEVMRVLKGNFGKGKVAPRVKARARISTRRKIKDWRIEQECEGNAAVFD  427

Query  1021  ATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGV  1200
             A L D ++G EV T KP+                   G    FTK G +V   +E G G 
Sbjct  428   AVLYDRESGQEVMTVKPNQ-----------------EGMKNVFTKSGGMVFGRDEYGDGA  470

Query  1201  GWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
              WR+ +EM GSVLKWR+GG++WLTYWPN + TS+YETRCVEWCDEVDLPL+PT
Sbjct  471   EWRVGREMEGSVLKWRMGGKIWLTYWPNKLCTSFYETRCVEWCDEVDLPLVPT  523



>ref|XP_002885950.1| hypothetical protein ARALYDRAFT_480385 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62209.1| hypothetical protein ARALYDRAFT_480385 [Arabidopsis lyrata subsp. 
lyrata]
Length=526

 Score =   504 bits (1297),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 246/473 (52%), Positives = 335/473 (71%), Gaps = 36/473 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQLLQE+I+ SPT+    C + +  ++ P  VSW++DSHSP
Sbjct  69    IWVSDTCPLSSEKPFLPLVLQLLQELITHSPTSRAGACTKFEQLEIKPGPVSWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL+RLFWLC  DAPSE G+ +F  +L P++   + + AP VLRTF V++G
Sbjct  129   ESFSSVFNLILLTRLFWLCVFDAPSEVGSFFFQHLLGPHVNALTCQHAP-VLRTFLVSLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQ----SLTPQY-LGISYSTEAYGLWILKG  519
              D ELC +R   Y L+KW+I +E+  G +GL+    SL P++ LG SY+TEA+GLWILKG
Sbjct  188   VDAELCIVRAASYALSKWMISKEIGLGNLGLKQLSSSLMPRHSLGFSYATEAHGLWILKG  247

Query  520   YAPVRAMKCTLHRGERN-----PFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFI  684
             Y P+ +M  T +           FP +E KE+ LRYAL+H Q E ++QFEY+V +++ +I
Sbjct  248   YFPILSMNVTNNSSNEVHNKIIKFPFVEPKEAVLRYALSHQQAEILVQFEYSVRFYENYI  307

Query  685   QVNARLDNIRLHVARLGFNKSQ-------DDAYVDEKHFPSRIRVWVGPEVGASYVGGLS  843
             +VNAR+DNIR+HV++LGFNK          D Y +E++FPSR+RVW+GPE+G+S+V GLS
Sbjct  308   KVNARVDNIRIHVSKLGFNKGGVGVENQIADCYSEERYFPSRVRVWLGPELGSSHVSGLS  367

Query  844   LGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVYD  1020
             LG+ST N E+++E  ++ KG+FG  KV P++KA ARM+TK K+K+WR +Q++EGNA V+D
Sbjct  368   LGKSTKNEERDIEVTRVLKGNFGKGKVAPRVKARARMSTKRKVKDWRIEQESEGNAAVFD  427

Query  1021  ATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGV  1200
             A L D ++G EV T  P    +G   V               FTK G +V   +  G  V
Sbjct  428   AVLYDRESGQEVTTVMPKPNQEGLKNV---------------FTKSGGMVFGRDAYGDEV  472

Query  1201  GWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             GWR+ +EM GSVLKWR+GG++WLTYWPN +NT +YETRCVEWCDEVDLPL+PT
Sbjct  473   GWRVGREMEGSVLKWRMGGKIWLTYWPNKLNTLFYETRCVEWCDEVDLPLLPT  525



>ref|XP_006409603.1| hypothetical protein EUTSA_v10022642mg [Eutrema salsugineum]
 gb|ESQ51056.1| hypothetical protein EUTSA_v10022642mg [Eutrema salsugineum]
Length=523

 Score =   501 bits (1291),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 247/472 (52%), Positives = 334/472 (71%), Gaps = 37/472 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVLQLL+E+IS SPT  DS C +S L ++ P  V+W++DSHSP
Sbjct  69    IWVSDTCLLSSEKPFLPLVLQLLRELISHSPTTRDSACTKSDLLEVKPGPVNWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL+RLF LCA DAPSE G+ +F  +L P++   + + AP VL+ F V+VG
Sbjct  129   ESFSSVFNLILLTRLFRLCAFDAPSEVGSFFFQHLLGPHVNSLTCQHAP-VLKKFLVSVG  187

Query  361   TDVELCFMRTFGYMLAKWLILREVG--GVGLQSLT---PQY-LGISYSTEAYGLWILKGY  522
              D ELC +R   Y L+KW+I +EVG   +GL+ L    P++ LG SY+TEA+GLWILKGY
Sbjct  188   VDPELCIVRAASYALSKWMISKEVGLENLGLKQLRSSLPRHPLGFSYATEAHGLWILKGY  247

Query  523   APVRAMKCTLHRGERN------PFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFI  684
              P+ +M  T +            FP++E KE+ LRYAL+H Q+E ++Q++Y+V + + +I
Sbjct  248   YPILSMNVTGNNSSNEVHNNIIKFPIVEPKEAVLRYALSHQQVEIIVQYDYSVRFHENYI  307

Query  685   QVNARLDNIRLHVARLGFNKSQD------DAYVDEKHFPSRIRVWVGPEVGASYVGGLSL  846
             +VNAR+DNIR+HV++LG +K         D Y +EK+FPSR+RVWVGPE+G+S+V GLSL
Sbjct  308   KVNARVDNIRIHVSKLGLHKGGGMENQIADCYSEEKYFPSRVRVWVGPEIGSSHVSGLSL  367

Query  847   GQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVYDA  1023
             G+ST N E+EVE  ++ KG+FG  KV P++KA ARM+T+ K+K+WR +QD+EGNA V+DA
Sbjct  368   GRSTKNEEREVEVMRVLKGNFGKGKVAPRVKARARMSTRRKIKDWRIEQDSEGNAAVFDA  427

Query  1024  TLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVG  1203
              L D ++G EV   KP+                   G    FTK G +V   +E G  VG
Sbjct  428   VLYDRESGQEVTNVKPNP-----------------EGFKNVFTKSGGMVFGRDEYGDEVG  470

Query  1204  WRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             WR+ +EM GSVLKWR+GG++WLTYWPN +NTS+YETRCVEWCDEVD PL+ T
Sbjct  471   WRVGREMEGSVLKWRMGGKIWLTYWPNKLNTSFYETRCVEWCDEVDFPLLHT  522



>ref|XP_010547975.1| PREDICTED: uncharacterized protein LOC104819551 [Tarenaya hassleriana]
Length=536

 Score =   500 bits (1287),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/467 (53%), Positives = 334/467 (72%), Gaps = 21/467 (4%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSP--TAHDSTCPRSQLQKLHPDRVSWMLDSH  174
             +W+SD C LSS+KPFLPLVLQLL+E+IS SP  T   S C   +L ++ PD V W++DSH
Sbjct  74    IWISDTCPLSSEKPFLPLVLQLLRELISLSPVTTRDGSACGNPRLLEIKPDPVRWVMDSH  133

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
             SPE+FS  FNL+ L+RLFWLC CDAP+E G+ + H++  P++E  + +  PV LRTFFV+
Sbjct  134   SPESFSCVFNLIFLTRLFWLCVCDAPTEIGSFFLHNLFGPHVEALTGQHTPV-LRTFFVS  192

Query  355   VGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP----QYLGISYSTEAYGLWILKGY  522
             VG DVELC  R   Y LAKWLI +EVG +GL+ L+     Q +G SY+TEA+GLW+LKGY
Sbjct  193   VGVDVELCITRAASYALAKWLISKEVG-MGLKQLSSPLPRQRIGFSYATEAHGLWVLKGY  251

Query  523   APVRAMKCT------LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFI  684
              P  +M  T       H+  +  FP+++ KE+ LRYAL+H Q EAV+QFEY+V + + +I
Sbjct  252   FPTVSMSVTHCSSNDFHKITK--FPIMDPKETVLRYALSHQQAEAVVQFEYSVKFHESYI  309

Query  685   QVNARLDNIRLHVARLGFNKSQ---DDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQS  855
             +VNAR+DNIR+HVA+LGF+K     D  Y +E++FPSR+RV +GPE+G++ V GLSLG+S
Sbjct  310   RVNARVDNIRVHVAKLGFHKGTEVTDMDYSEERYFPSRVRVSIGPEIGSANVTGLSLGRS  369

Query  856   TNNIEKEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCD  1035
             TNN E+E+E  K+ KGSFG  KVP++KA ARM+T+ K+K+W+ ++D EGN  V+DA L D
Sbjct  370   TNNEEREIEVTKVIKGSFGKVKVPRVKARARMSTRRKLKDWKIERDCEGNGAVFDAILYD  429

Query  1036  NQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLS  1215
             N+TG EV   +P N  +G      N      +G    FTK G +V  G+E G  VGWR+ 
Sbjct  430   NETGGEVTETRPYNYYEGDHNNNNNINYD--KGFKNTFTKNGGMVFGGDEFGDEVGWRIG  487

Query  1216  KEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
             +EM GSVLKWRI G++WL+YWPN ++T +YETR VEW DEVDLPL+P
Sbjct  488   REMEGSVLKWRIRGKIWLSYWPNKLHTPFYETRFVEWSDEVDLPLVP  534



>emb|CDX89649.1| BnaC03g45630D [Brassica napus]
Length=524

 Score =   491 bits (1265),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 337/473 (71%), Gaps = 38/473 (8%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSS+KPFLPLVL LLQE+IS SPT  +STC +S+  ++    VSW++DSHSP
Sbjct  69    IWVSDTCALSSEKPFLPLVLLLLQELISYSPTTGESTCTKSEPLEIKSGPVSWVMDSHSP  128

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FSS FNL+LL+RLFWLC  DAPSE G+ +F  +L P+++  + + AP VLRTF V++G
Sbjct  129   ESFSSVFNLILLTRLFWLCVFDAPSEVGSFFFQHLLGPHVKSLTCQHAP-VLRTFLVSLG  187

Query  361   TDVELCFMRTFGYMLAKWLILREV--GGVGLQSLTP----QYLGISYSTEAYGLWILKGY  522
              D ELC +R   Y L+KW+I +EV  G +GL+ +T     Q LG SY+TEA+GLW LKGY
Sbjct  188   VDAELCIVRAASYALSKWMISKEVGLGNLGLKQITSPLPHQSLGFSYATEAHGLWSLKGY  247

Query  523   APVRAMKCT-------LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGF  681
              P+ +M  T       +H  +   FP++E KE+ LRYAL+H   E ++QFEY+V + + +
Sbjct  248   FPILSMNLTNNNSSSEIHNNKIIKFPIVEPKEAVLRYALSHQHAEVIVQFEYSVTFHENY  307

Query  682   IQVNARLDNIRLHVARLGFNKSQD------DAYVDEKHFPSRIRVWVGPEVGASYVGGLS  843
             I+VNAR+DNIR+HV++LGF+K +       D Y DEK+FPSR++VWVGPE+G+++V GLS
Sbjct  308   IKVNARVDNIRVHVSKLGFHKGRRMENQIADCYSDEKYFPSRVQVWVGPEIGSNHVSGLS  367

Query  844   LGQSTNNIEKEVETHKIWKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVYD  1020
             LG+ST N E+EVE  ++ KG+FG  KV P++KA AR++T+ K+K+WR DQ++EGNA V+D
Sbjct  368   LGRSTKNEEREVEVMRVLKGNFGKGKVAPRVKARARISTRRKIKDWRIDQESEGNAAVFD  427

Query  1021  ATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGV  1200
             A L D ++G EV T KP+                   G    FTK G +V   +E G G 
Sbjct  428   AVLYDRESGQEVVTVKPNQ-----------------EGMKNVFTKSGGMVFGRDEYGDGA  470

Query  1201  GWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             GWR+ +EM GSVLKWR+GG++WLTYWPN + TS+YETRCVEWCDEVDLPL+PT
Sbjct  471   GWRVGREMEGSVLKWRMGGKIWLTYWPNKLCTSFYETRCVEWCDEVDLPLVPT  523



>ref|XP_007199336.1| hypothetical protein PRUPE_ppa023959mg, partial [Prunus persica]
 gb|EMJ00535.1| hypothetical protein PRUPE_ppa023959mg, partial [Prunus persica]
Length=422

 Score =   466 bits (1199),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 225/346 (65%), Positives = 278/346 (80%), Gaps = 7/346 (2%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +WVSD C LSSDKP+L L+LQLL+E+ISRSPT+HDSTCPRSQLQ L PD  SW++DSHSP
Sbjct  78    IWVSDTCSLSSDKPYLHLLLQLLREIISRSPTSHDSTCPRSQLQTLKPDPFSWIMDSHSP  137

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E+FS+FF+LV ++RLFWLCACD+P+E G+LYF S+LAPNLE    K AP  LRTF +TVG
Sbjct  138   ESFSTFFDLVFVTRLFWLCACDSPTEVGSLYFKSLLAPNLEALLCKQAPA-LRTFLITVG  196

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPV  531
              D ELCFMRT GYMLAKW ILREVG VGLQ+LT    Q LG SY+TEA G W+LK YAPV
Sbjct  197   VDAELCFMRTVGYMLAKWCILREVG-VGLQTLTSSPSQNLGFSYATEACGFWVLKAYAPV  255

Query  532   RAMKCT--LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLD  705
               M+ T  ++  ++N FP +E ++S L+YALAH QLEAV+Q EY+VG++DGFIQV A +D
Sbjct  256   MGMRTTRSVNLNQKNQFPGLETRDSVLKYALAHQQLEAVVQVEYSVGFYDGFIQVTAHVD  315

Query  706   NIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             N+R HV  LGFNK+ D  Y +EK+FPSR+RVWVGPEVGA+YV GLSLG+ST+N E+EV+T
Sbjct  316   NLRFHVVNLGFNKNDDVDYAEEKYFPSRVRVWVGPEVGANYVNGLSLGRSTDNGEREVKT  375

Query  886   HKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDA  1023
              +I KGSF  SK PK+K   R++T+ + +NWRWDQD EGNA V+DA
Sbjct  376   QRITKGSFVKSKSPKVKTAGRVSTRMRKRNWRWDQDAEGNAAVFDA  421



>ref|XP_007042559.1| Iq-domain 14, putative [Theobroma cacao]
 gb|EOX98390.1| Iq-domain 14, putative [Theobroma cacao]
Length=492

 Score =   407 bits (1046),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 202/310 (65%), Positives = 241/310 (78%), Gaps = 6/310 (2%)
 Frame = +1

Query  436   GVGLQSLTP---QYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIEAKESAL  606
              VGLQ+LTP   Q+LGISY+TEA+G W LKGYAPV AMK T    +++ FP I AKES L
Sbjct  182   SVGLQTLTPLPRQHLGISYATEAHGFWTLKGYAPVNAMKLTHSSNQKSIFPAIGAKESLL  241

Query  607   RYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNKSQDDA-YVDEKHFP  783
             RYALAH QLEAVIQ EY+VG++DG+IQVNA +DN+R HVA+LGF K +DD  Y +E+HFP
Sbjct  242   RYALAHQQLEAVIQLEYSVGFYDGYIQVNACVDNLRFHVAKLGFRKKEDDMDYFEERHFP  301

Query  784   SRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGDSKVPKMKAVARMATKT  963
             SRIRVWVGPEVG++YV GLSLG+STNN E+E+ET +I KGS      P++KA +R++ + 
Sbjct  302   SRIRVWVGPEVGSTYVYGLSLGRSTNNGEREIETQRIVKGSIRKLNNPQVKARSRVSLRN  361

Query  964   KMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANR  1143
             KMKNWRWDQD EGNA V+DA LCDN TG E+AT K  + + G      N+L  RY G NR
Sbjct  362   KMKNWRWDQDAEGNAAVFDAVLCDNVTGHEIATCK--SLNYGNGGNGDNSLQNRYYGVNR  419

Query  1144  GFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVE  1323
              FTK G LV AG++ G  V WRLS+EM GSVLKWRIGGEVWL+YWPN+V TSY ETRCVE
Sbjct  420   PFTKTGGLVFAGDDYGERVAWRLSREMEGSVLKWRIGGEVWLSYWPNNVGTSYIETRCVE  479

Query  1324  WCDEVDLPLI  1353
             WCDEVDLPLI
Sbjct  480   WCDEVDLPLI  489


 Score =   101 bits (251),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
            +WVSD C L S++PFLPLVLQLLQE+I+RSP+  DSTCPRSQLQ+L P+ +SW+++SHSP
Sbjct  107  LWVSDTCPLLSEQPFLPLVLQLLQEIINRSPSVPDSTCPRSQLQRLKPEPISWIMESHSP  166

Query  181  ETFS  192
            ++FS
Sbjct  167  DSFS  170



>ref|XP_010065954.1| PREDICTED: uncharacterized protein LOC104453130 [Eucalyptus grandis]
Length=457

 Score =   385 bits (988),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/324 (59%), Positives = 236/324 (73%), Gaps = 16/324 (5%)
 Frame = +1

Query  403   LAKWLILREVGGVGLQSLTP---QYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNP  573
             L+ +  L EVG VGLQ+LTP   Q L  SY+TEA+GLWILKGYAPV AMK T    +   
Sbjct  140   LSSFFNLVEVG-VGLQTLTPLPVQGLSFSYATEAHGLWILKGYAPVAAMKLTRSNDQMKK  198

Query  574   FPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNKSQD  753
             FPV+EA++S L+Y L+H QLEAV+Q EY+V + DG+IQVN R+DNIRLHV  LGF K   
Sbjct  199   FPVLEAQDSVLKYVLSHQQLEAVVQLEYSVKFCDGYIQVNTRVDNIRLHVMNLGFGKESS  258

Query  754   D---AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGDSKV  924
             +   A+  E+HFPSR RVWVGPEVGA+YVGGLSLG+ST+N E+E+ T ++ K +FG SK 
Sbjct  259   EDGLAFAGERHFPSRARVWVGPEVGATYVGGLSLGRSTSNGERELVTQRVMKSTFGKSKA  318

Query  925   PKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVV  1104
             P++KA  + +T+ K+++WRWDQD+EGNA V+DA L D+ TG EVA   P  G+       
Sbjct  319   PEVKATGKTSTRAKLRDWRWDQDSEGNAAVFDAVLHDSTTGQEVAMSCPSKGE-------  371

Query  1105  MNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPN  1284
                  RRY  ANR FTK G LV AG+E G  VGWRL +EM GSVLKWRIGG+VWL+Y  N
Sbjct  372   --GFRRRYAAANRPFTKSGGLVFAGDEYGESVGWRLGREMEGSVLKWRIGGQVWLSYVAN  429

Query  1285  HVNTSYYETRCVEWCDEVDLPLIP  1356
              V +SYYETR VEWCDE+DLPLIP
Sbjct  430   DVKSSYYETRVVEWCDEIDLPLIP  453


 Score = 93.6 bits (231),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
            +WVSD C LSSDKPFLPL+LQLLQE+I RSPT  +S+CPRSQLQKL PD VSW+++SH+P
Sbjct  78   LWVSDACPLSSDKPFLPLLLQLLQEIILRSPTTRESSCPRSQLQKLRPDPVSWIMESHTP  137

Query  181  ETFSSFFNLV  210
            E+ SSFFNLV
Sbjct  138  ESLSSFFNLV  147



>ref|XP_006844316.1| hypothetical protein AMTR_s00143p00072070 [Amborella trichopoda]
 gb|ERN05991.1| hypothetical protein AMTR_s00143p00072070 [Amborella trichopoda]
Length=521

 Score =   336 bits (862),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 202/459 (44%), Positives = 284/459 (62%), Gaps = 28/459 (6%)
 Frame = +1

Query  1     VWVSDECHL---SSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDS  171
             +WVS+ C L   S ++  LPL+LQLL+E I+R+P +H  + PR  LQ      V+  L +
Sbjct  72    LWVSNPCPLLTNSMERTLLPLLLQLLEETIARAPDSHMPS-PRVFLQP----SVAAALLA  126

Query  172   HSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFV  351
                 T S+FFN     RLFWLCA DAP++ G+LYF + LA  L++ S K A   +R+FF+
Sbjct  127   QPYTTLSAFFNFAFACRLFWLCAFDAPADVGSLYFRT-LASGLDVGSCKEA---MRSFFL  182

Query  352   TVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGIS---YSTEAYGLWILKGY  522
              VG D+EL FMR   Y L K L+L+++G     S   +  G S   Y     G   LKGY
Sbjct  183   AVGADLELQFMRALAYALTKSLLLKDLG----SSQPDKERGASSYSYIRATSGFLALKGY  238

Query  523   APVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARL  702
             AP+ A++      +R    ++E  +S LRY LAH QLE ++QFEY+V            +
Sbjct  239   APLLALRRATK--QRACEGLLETGKSVLRYVLAHQQLEVIVQFEYSVKVRGDHAMFRLWV  296

Query  703   DNIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEV--GASYVGGLSLGQSTNNIEKE  876
             DN+R+ V RLGF  +++   + EKHFPSRI V +GPEV  G S VG LSL +ST N E++
Sbjct  297   DNVRVDVTRLGFGAAEE--LIGEKHFPSRISVMIGPEVSSGGSVVG-LSLSKSTANPERK  353

Query  877   VETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
             VE  +  KGSFG SK+P + A+A  +T+ ++++W  +Q  EG+ VV+DA LCDN +G EV
Sbjct  354   VENKRTVKGSFGKSKIPTVNAMASTSTRERLRSWNVEQYAEGSTVVFDAALCDNTSGSEV  413

Query  1057  ATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
             A+ K   G    +    ++  RRY G +R F K G +++ G E G GV WRL KE+VGSV
Sbjct  414   ASLK--QGVVSGSGEPKSSFRRRYSGTHRAFNKMGGVILTGNECGEGVSWRLLKEVVGSV  471

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             +KW++G +VW++Y+PN  NTSY+ETR VEW +EV L +I
Sbjct  472   MKWKLGAKVWVSYFPNDCNTSYFETRYVEWFEEVSLHVI  510



>ref|XP_009396031.1| PREDICTED: uncharacterized protein LOC103981143 [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   333 bits (853),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 175/382 (46%), Positives = 243/382 (64%), Gaps = 18/382 (5%)
 Frame = +1

Query  235   CACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLAKW  414
             CA DAP+EAG L+F ++ AP       +   + LR   + VG DVE  FMR+ GYML+KW
Sbjct  139   CATDAPAEAGFLFFSALDAPLERALCCR---LALRGVLLAVGPDVEERFMRSLGYMLSKW  195

Query  415   LILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIEAK  594
              + R++ G   + L P     SY+ + +GLW+LKG+AP+ AM      G   P   +EA 
Sbjct  196   CLFRQLQGSAAKRLLPAGFCPSYAADRHGLWVLKGFAPLPAMGRVDASGVTGPG--LEAT  253

Query  595   ESALRYALAHHQLEAVIQFEYTVGYFDG-FIQVNARLDNIRLHVARLGFNKSQD------  753
             +SALRYALAH QLEAV+Q EYT+   D  FI+V+ R+DNIRL V  L + +++D      
Sbjct  254   DSALRYALAHQQLEAVVQLEYTICTRDPRFIRVSVRVDNIRLRVVGLRYGRNKDEETGRE  313

Query  754   -DAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGDSKVPK  930
              D    E+HFPSR RVWVGPE+G  Y  G SLG+S+ N E+++E  +  KG FG  K   
Sbjct  314   ADDLEGERHFPSRARVWVGPELGTPYATGPSLGRSSGNPERQIEATRTVKGRFGSGKAAG  373

Query  931   MKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP-DNGDDGPTAVVM  1107
             +KA AR AT+ + ++WRW+Q+ EG+A V++  LCD+ TG EVA W P ++G   P+A   
Sbjct  374   IKAAARTATRLQGRSWRWEQEAEGSAAVFEGVLCDHATGTEVAAWTPAEDGGGNPSA---  430

Query  1108  NNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNH  1287
               + RRY G  R F+K G +V+AG+E    V WR+ +EM G V+ WR+GG VW++Y+ N 
Sbjct  431   -GMRRRYSGWGRAFSKAGGVVVAGDELAEAVEWRVGREMEGRVVMWRVGGRVWVSYFANE  489

Query  1288  VNTSYYETRCVEWCDEVDLPLI  1353
             V T Y+ETR VEW +EV+L L+
Sbjct  490   VKTGYFETRSVEWREEVELALV  511



>ref|XP_009411075.1| PREDICTED: uncharacterized protein LOC103992902 [Musa acuminata 
subsp. malaccensis]
Length=529

 Score =   328 bits (842),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 213/465 (46%), Positives = 284/465 (61%), Gaps = 27/465 (6%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSP  180
             +W+SD   +S   P +PL+LQLL+E +S SP++   +       KL  + VS  L     
Sbjct  68    LWLSDP--VSPSTPHIPLLLQLLRESVSISPSSFSLS-----SMKLDQEAVSGALGED--  118

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E   +F +L LL RLFWLCA +AP++AG L+F ++ AP  +    +   + LR   + +G
Sbjct  119   EQARAFLSLALLLRLFWLCATEAPADAGFLFFRALDAPLEQALGCQ---LALRGVLLALG  175

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
              DVE  FMR+ GYML KW ILRE+ G G   L P     SY+ E +GLW+L+G+APV AM
Sbjct  176   PDVEESFMRSVGYMLCKWCILRELQGSGSSRLLPPGCCPSYAAERHGLWVLRGFAPVPAM  235

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDG-FIQVNARLDNIRL  717
                   G     P +EAK+S LRYALAH QLEAV+Q EY V   D  FI+V+ R+DNIRL
Sbjct  236   ARVGVTGSTG-GPKLEAKDSVLRYALAHQQLEAVVQLEYNVCMRDPRFIRVSVRVDNIRL  294

Query  718   HVARLGFNKSQD-----------DAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNN  864
             HV RL F + +D           D  V E+HFPSR RVWVGPE+G+SY  G SLG+S+ N
Sbjct  295   HVVRLRFGRRKDGEDREEAGDDEDDVVGERHFPSRARVWVGPELGSSYATGPSLGRSSGN  354

Query  865   IEKEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQT  1044
              E+EVE  +  KG FG  K   +KA AR AT+ + ++WRW+Q+ EG A V++  L D  T
Sbjct  355   PEREVEAMRTVKGRFGGGKTAGVKAAARTATRARARSWRWEQEAEGGAGVFEGVLHDGAT  414

Query  1045  GIEVATWKP--DNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSK  1218
             G EVA W+P    G  G        + RRY G  R F+K G +V+AG+E    V WR+ +
Sbjct  415   GTEVAAWRPVVGAGGGGGGGDPRGGMRRRYSGWGRAFSKAGGVVVAGDEVPEAVEWRVGR  474

Query  1219  EMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             EM G V++WRI G VW++Y+ N V T Y+ETR VEW ++VDL LI
Sbjct  475   EMEGRVVRWRIAGRVWVSYFANDVKTGYFETRSVEWREDVDLALI  519



>ref|XP_009394624.1| PREDICTED: uncharacterized protein LOC103980065 [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   330 bits (845),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/395 (46%), Positives = 249/395 (63%), Gaps = 8/395 (2%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E  +SFF+LV   RLFW CA +AP++AG L+F ++ +P  +    +   + LR   +++G
Sbjct  189   EQTASFFSLVFFLRLFWTCATEAPADAGFLFFRALDSPFEQALGCR---IALRGVLLSLG  245

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
              DVE  FMR+ GYML KW ILRE+ G   + L P     SY+ E +GLW+LKG+APV AM
Sbjct  246   PDVEERFMRSLGYMLTKWCILRELQGGDPRGLLPVGCCPSYAAERHGLWVLKGFAPVPAM  305

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDG-FIQVNARLDNIRL  717
                   G     P +E ++S LRY LA  QLEAV+Q E  V   D  FI+V+ R+D++RL
Sbjct  306   ARFGSSGSTGS-PNLEPRDSVLRYTLADQQLEAVVQLESRVCMRDPRFIRVSVRVDSVRL  364

Query  718   HVAR--LGFNKSQDDAYVD-EKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETH  888
             +V R   G  K  DD  ++ E+HFPSR RVWVGPE+G+SY  G SLG+S+ N E+EVE  
Sbjct  365   NVVRHRFGRRKEVDDGVLEAERHFPSRARVWVGPELGSSYATGPSLGRSSGNPEQEVEAT  424

Query  889   KIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWK  1068
             +  KG FG+ K   +KA AR AT+ + ++W W+Q+ EG A V+D  L D  TG EVA  +
Sbjct  425   RTVKGRFGEGKAAGVKATARTATRARGRSWLWEQEAEGGAGVFDGVLHDGATGAEVAASR  484

Query  1069  PDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWR  1248
             P+ G  G  A     +  RY G+ R F+K G +V+AG+E    + WR+ +EM G V++WR
Sbjct  485   PEIGAGGGEADRRAGMRLRYSGSGRAFSKAGGVVVAGDELPETIEWRVGREMEGRVVRWR  544

Query  1249  IGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             +G  VW++Y+ N V T Y ETR VEW +EVDL L+
Sbjct  545   LGVRVWVSYFANEVKTGYCETRSVEWREEVDLALV  579



>ref|XP_008787216.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103705328 
[Phoenix dactylifera]
Length=504

 Score =   325 bits (832),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 241/380 (63%), Gaps = 15/380 (4%)
 Frame = +1

Query  235   CACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLAKW  414
             CACDAP++AG L+F + L P LE   +      LR F +  G D E  FMR+ GYMLAKW
Sbjct  125   CACDAPADAGFLFFRA-LGPVLE--RALDCRRALRKFLLAAGPDAEERFMRSLGYMLAKW  181

Query  415   LILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIEAK  594
              +LRE+       L P     SY+ EA+GLW+LKG+APV AM      G  +    +E K
Sbjct  182   CLLRELQPAAGHRL-PAACCPSYAAEAHGLWVLKGFAPVPAMA---RVGTGSSSTHLEPK  237

Query  595   ESALRYALAHHQLEAVIQFEYTVGYFDG-FIQVNARLDNIRLHVARLGFN-KSQDDAYVD  768
              S LRYALAH QLEAV+Q EYTV   D  FI++  R++NIRLHV RL F  K ++D   D
Sbjct  238   GSVLRYALAHQQLEAVVQLEYTVCMRDPRFIKIGVRVNNIRLHVVRLRFGRKDEEDESAD  297

Query  769   ---EKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGD--SKVPKM  933
                E+HFPSR+R+WVGPE G++Y  G SLG+S+ N E+EVET +   G  G   SK P +
Sbjct  298   VEDERHFPSRVRLWVGPEAGSAYATGPSLGRSSGNPEREVETVRTVVGRLGGGGSKAPGI  357

Query  934   KAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNN  1113
              A AR + +++ ++WRW+Q+ EG A V+D  LCD  TG EVA W+P  G  G        
Sbjct  358   NAKARASVRSRGRSWRWEQEVEGGAGVFDGVLCDLSTGAEVAAWRPAGGGGGGGDPRGGM  417

Query  1114  LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVN  1293
               RRY GA R F+K G +V+AG+E   G      +EM G V++WRIGG VW++Y+PN V 
Sbjct  418   R-RRYSGAGRAFSKAGGVVVAGDELAEGXELESGEEMEGRVVRWRIGGRVWVSYFPNEVK  476

Query  1294  TSYYETRCVEWCDEVDLPLI  1353
             TSYYETRCVEW +EV+LPL+
Sbjct  477   TSYYETRCVEWGEEVELPLV  496



>dbj|BAJ91384.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04721.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 252/410 (61%), Gaps = 25/410 (6%)
 Frame = +1

Query  190   SSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDV  369
             S FF+L LL RLFWLCA +AP++ G L+F S L  ++E   +  AP  L    + VG DV
Sbjct  139   SPFFSLALLMRLFWLCAMEAPADLGFLFFQS-LGKDIERALAGCAPAALGALLLAVGPDV  197

Query  370   ELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM---  540
             E  FMR+ GYMLAKW +LRE+         P    +SY+TE +GLW+L+GYAPV A+   
Sbjct  198   EERFMRSLGYMLAKWCLLREMQSAPKPPAKPDVACLSYATEVHGLWVLRGYAPVLAVPRV  257

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYF-DGFIQVNARLDNIRL  717
                         P    +E ALRY L H QLEAV Q EY V    D FI V  R+DNIR+
Sbjct  258   AGATSTATITALPHELPEEPALRYGLVHQQLEAVAQVEYAVSVRGDSFIVVGVRVDNIRV  317

Query  718   HVARLGFNKSQD-----------DAYVD-EKHFPSRIRVWVGPEVGASYVGGLSLGQSTN  861
              V RLG+ K  D           D  +D E+HFPSRIR+WVGP  G+SY  G SLG+ST 
Sbjct  318   RVVRLGYRKKGDAGGEEEGDVDEDHVLDGERHFPSRIRLWVGPRFGSSYATGPSLGRSTG  377

Query  862   NIEKEVETHKIWKGSF-GDSKV---PKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATL  1029
             N E+EVET +  KG+F G +K+   P++KA  R +++ + ++WRW+Q+ EG+A V++  L
Sbjct  378   NPEREVETTRTVKGAFSGATKLGGDPRVKAKMRSSSRARSRSWRWEQEAEGSAGVFEGVL  437

Query  1030  CDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWR  1209
             CD  TG EV++W+P + +  P     + + RRY G  R F+K   LV+AG+E    V WR
Sbjct  438   CDPATGTEVSSWRPGSREGDPR----SGMRRRYGGPGRAFSKMRGLVVAGDELPEEVTWR  493

Query  1210  LSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             + +E  G  ++WR+G +VWL+Y PN V + ++ETRCVEW  EV+LPL+ T
Sbjct  494   VGREAEGRTMRWRLGLKVWLSYLPNEVRSRHFETRCVEWAHEVELPLMAT  543



>ref|XP_006664886.1| PREDICTED: uncharacterized protein LOC102708677 [Oryza brachyantha]
Length=555

 Score =   287 bits (735),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 188/463 (41%), Positives = 265/463 (57%), Gaps = 33/463 (7%)
 Frame = +1

Query  52    LVLQLLQEVISRSP-----TAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFNLVLL  216
             L+ +LL EVI  SP     + +    P  +L +     V  M ++      +SFF+L LL
Sbjct  90    LLARLLDEVIMLSPFIPCMSGNHGGLPEPKLDEEVVAGVFDMAETDGTAPAASFFSLALL  149

Query  217   SRLFWLCACDAPSEAGALYFHSILAPNLE--MFSSKPAPVVLRTFFVTVGTDVELCFMRT  390
              RLFWLCAC+AP + G L+F + L  ++E  + + +PA   L     +VG DVE  FMR+
Sbjct  150   LRLFWLCACEAPGDTGFLFFQA-LGADIERALGNCRPA---LGQLLCSVGPDVEQQFMRS  205

Query  391   FGYMLAKWLILREV---GGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRG  561
              GYM AK  +LRE+         +L    L +SY+TE +GL ILKGYAPV AM       
Sbjct  206   LGYMFAKLCLLREMQAESAARQTALPAACLSLSYATEVHGLLILKGYAPVIAMYRVTSAA  265

Query  562   --ERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDG-FIQVNARLDNIRLHVARL  732
                    P    +E ALRY LAH QLE V   EY +   +  F+ ++ R+DN+R+ VARL
Sbjct  266   WTPIAALPHEAPEEPALRYGLAHQQLEVVAHLEYAICARNKRFMTISVRVDNVRVRVARL  325

Query  733   GFNKSQ---------DDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             G  K +         DDA   E+HFPSR+R+WVGP  GASY  G SLG+ST N E+ VE 
Sbjct  326   GLRKDETDTGGEDVDDDAMDSERHFPSRLRLWVGPRFGASYATGPSLGRSTGNPERHVEM  385

Query  886   HKIWKGSF-GDSKV------PKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQT  1044
              +  +G+F G +K+      P++KA  R + +   ++WRW+Q+ EG+A V++  LCD  T
Sbjct  386   TRTVRGTFAGTTKLANGVVLPRVKAKMRSSARRCNRSWRWEQEAEGSAGVFEGVLCDPVT  445

Query  1045  GIEVATWKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEM  1224
             G E+A+W+  NG     A   N + RRY G  R FTK   LV+AG++    V WR+  E 
Sbjct  446   GTEIASWRDSNGGTAGAADPRNGMRRRYGGPGRAFTKMWGLVVAGDDLPEEVTWRVGMEA  505

Query  1225  VGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
              G  + WR+G + W++Y PN V + ++ETRC+EW  EV+LPL+
Sbjct  506   EGRTVPWRVGLKAWVSYMPNGVRSRHFETRCIEWAHEVELPLV  548



>ref|XP_004983966.1| PREDICTED: uncharacterized protein LOC101771341 [Setaria italica]
Length=578

 Score =   287 bits (734),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 203/500 (41%), Positives = 283/500 (57%), Gaps = 54/500 (11%)
 Frame = +1

Query  1     VWVSDECHLSSDKPFLPLVLQLL-QEVISRSP--------TAHDSTCPRSQLQKLHPDRV  153
             +W SD   +SS  P    +L  L  +V+ RSP            +    S   ++  + V
Sbjct  79    LWTSDGFAVSSPVPVRLQLLVQLLNDVLDRSPYVPCLGANAVEFAGVDASSEARVDAEVV  138

Query  154   SWMLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAP-NLEMFSSKPAPV  330
             S ++ +   + F++FF+L LL RLFWLCA DAP++AG L+F  + A     + + +PA  
Sbjct  139   SAVMGAAGTDAFAAFFSLALLLRLFWLCALDAPADAGYLFFRDLGAGIERALGACRPA--  196

Query  331   VLRTFFVTVGTDVELCFMRTFGYMLAKWLILREV---GGVGLQSLTPQ------YLGISY  483
              L  F   VG DVE  FMR+ GYMLAKW +LRE+    G   ++  P+         +SY
Sbjct  197   -LAAFLCFVGPDVEERFMRSLGYMLAKWCLLREMQAATGSAAKAEVPRRRRALPAACLSY  255

Query  484   STEAYGLWILKGYAPVRAMKCTLHRGERN----PFPVIEAKESALRYALAHHQLEAVIQF  651
             + EA+GLW+LKGYAPV AM         +    P  V E  E ALRY L H QLEAV+Q 
Sbjct  256   AAEAHGLWVLKGYAPVLAMARVTAAASTSITASPHEVPE--EPALRYGLVHQQLEAVVQL  313

Query  652   EYTVGYFDG-FIQVNARLDNIRLHVARLGFNKSQDDA----------------YVDEKHF  780
             EY V   DG F+ V+ R+DN+R+ VARL F K  +DA                   E+HF
Sbjct  314   EYAVRVRDGRFLAVSVRVDNVRVRVARLAFRKDDEDAGGGATDDDAEDAGDDVMDGERHF  373

Query  781   PSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF--------GDSKVPKMK  936
             PSRIR+WVGP  GASY  G SLG+ST N E++VE  +  KG+F        G+   P+MK
Sbjct  374   PSRIRLWVGPRFGASYATGPSLGRSTGNPERDVEMTRTIKGAFSGATKLANGNVNAPRMK  433

Query  937   AVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNNL  1116
             A  R + +T+ ++WRW+Q+ EG+A +++  L D  TG EV+ W+P  G  G  A   N +
Sbjct  434   AKMRSSARTRSRSWRWEQEAEGSAGLFEGVLYDPVTGTEVSAWRPGTGGSG-AADPRNGM  492

Query  1117  GRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNT  1296
              RRY G  R F+K   LV+AG+E    + WR+ +E  G  L+WR+G + W++Y PN V +
Sbjct  493   RRRYGGPGRAFSKMRGLVVAGDELPEEMTWRVGREEEGRTLRWRLGLKAWVSYLPNEVRS  552

Query  1297  SYYETRCVEWCDEVDLPLIP  1356
              ++ETRC EW  EV+LPL+P
Sbjct  553   RHFETRCAEWAHEVELPLVP  572



>ref|XP_010936570.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105056164 
[Elaeis guineensis]
Length=506

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 170/380 (45%), Positives = 218/380 (57%), Gaps = 44/380 (12%)
 Frame = +1

Query  235   CACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLAKW  414
             CA DAP++AG L+F S L P LE   +      LR F +  G D E  F+R+ GYMLAKW
Sbjct  156   CAYDAPADAGFLFFRS-LGPALER--ALDCRWALRGFLLAAGPDAEERFVRSLGYMLAKW  212

Query  415   LILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIEAK  594
              +LRE+   G     P     SY+ EA+GLW+LKG+APV AM      G  +    +EAK
Sbjct  213   CLLRELQ-PGAGRRLPATCCPSYAAEAHGLWVLKGFAPVSAMAPV---GTASLGTNLEAK  268

Query  595   ESALRYALAHHQLEAVIQFEYTVGYFDG-FIQVNARLDNIRLHVARLGFNK----SQDDA  759
              S LRYALAH QLEAV+Q EYTV   D  FI++  R+DNIRLHV  L F +     + D 
Sbjct  269   GSVLRYALAHQQLEAVVQLEYTVCLRDPRFIKIGVRVDNIRLHVVGLRFGRRNEEEESDG  328

Query  760   YVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGD--SKVPKM  933
               DE+HFPSR+R+WVGPE GA+Y  G SLG+S+ N E+EVET +   G FG   SK P +
Sbjct  329   VEDERHFPSRVRLWVGPEAGAAYAIGPSLGRSSGNPEREVETVRTITGRFGGARSKAPGI  388

Query  934   KAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNN  1113
             KA AR + +++ ++WRW+Q+ EG A V+D  LCD  TG EVA W+P  G  G        
Sbjct  389   KAKARTSARSRGRSWRWEQEAEGGAGVFDGVLCDASTGAEVAGWRPARGGGGGGGGDPR-  447

Query  1114  LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVN  1293
                               +   E  G  V W             R+GG VW++Y+PN V 
Sbjct  448   ----------------GGMRRREMEGRVVRW-------------RVGGRVWVSYFPNEVK  478

Query  1294  TSYYETRCVEWCDEVDLPLI  1353
             TSYYETR VEW +EV+L L+
Sbjct  479   TSYYETRSVEWREEVELALV  498



>gb|AAP46203.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96214.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAY90211.1| hypothetical protein OsI_11778 [Oryza sativa Indica Group]
Length=565

 Score =   274 bits (701),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 185/426 (43%), Positives = 254/426 (60%), Gaps = 39/426 (9%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAP-NLEMFSSKPAPVVLRTFFVTV  357
             ++ +SFF+L LL RLFWLCA +AP++ G L+F ++ A     +   +PA   L  F  ++
Sbjct  135   DSAASFFSLTLLLRLFWLCATEAPADTGFLFFQALGADIQRALVDCRPA---LALFLASL  191

Query  358   GTDVELCFMRTFGYMLAKWLILREVGGVGLQ-----SLTPQYLG---ISYSTEAYGLWIL  513
             G DVE  FMR+ GYMLAK  +LRE+     Q     +  P+ L    +SY+TE +GLW+L
Sbjct  192   GPDVEERFMRSLGYMLAKLCLLREMQADADQPAPAATRRPRALPAACLSYATEVHGLWVL  251

Query  514   KGYAPVRAM-KCTLHRGERNP---FPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDG-  678
             +GYAPV AM + T       P    P    +E ALRY L H QLE V Q EY V    G 
Sbjct  252   RGYAPVLAMPRVTCAASTTAPITALPHEAPEEPALRYGLVHQQLEVVAQLEYAVRARRGE  311

Query  679   -FIQVNARLDNIRLHVARLGFNKSQDDAYV-----------DEKHFPSRIRVWVGPEVGA  822
              F+ V  R+DN+R+ VARLGF +   DA              E+HFPSR+R+WVGP  GA
Sbjct  312   RFMTVAVRVDNVRVRVARLGFRRDDADADADGGDAHDDAMDGERHFPSRLRLWVGPRFGA  371

Query  823   SYVGGLSLGQSTNNIEKEVETHKIWKGSF---GDSKV------PKMKAVARMATKTKMKN  975
             SY  G SLG+ST N E++VET +  KG+F   G +K+      P++KA  R + + + ++
Sbjct  372   SYATGPSLGRSTGNPEQDVETTRTVKGAFAAAGATKLANGGVPPRIKAKTRSSARARNRS  431

Query  976   WRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVV-MNNLGRRYRGANRGFT  1152
             WRW+Q+ EG+A V++  LCD  TG E++ W+ DN ++   A    N + RRY G  R F+
Sbjct  432   WRWEQEAEGSAGVFEGVLCDPATGTEISAWRGDNNNNNGGAGDPRNGMRRRYGGPGRAFS  491

Query  1153  KKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCD  1332
             K   LV+AG+E    V WR+ +E  G  L WR+G + WLTY PN V + ++ETRCVEW  
Sbjct  492   KMRGLVVAGDELPEEVTWRVGREAEGRTLPWRVGLKAWLTYLPNQVRSHHFETRCVEWAH  551

Query  1333  EVDLPL  1350
             EVDLPL
Sbjct  552   EVDLPL  557



>ref|XP_002465099.1| hypothetical protein SORBIDRAFT_01g032040 [Sorghum bicolor]
 gb|EER92097.1| hypothetical protein SORBIDRAFT_01g032040 [Sorghum bicolor]
Length=603

 Score =   270 bits (691),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 176/422 (42%), Positives = 235/422 (56%), Gaps = 56/422 (13%)
 Frame = +1

Query  235   CACDAPSEAGALYFHSILAPNLE--MFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLA  408
             CA DAP++AG L+F   L P +E  +   +PA   L  F  +VG DVE  FMR+ GYML+
Sbjct  180   CALDAPADAGYLFFRD-LGPEIERGLGECRPA---LGVFLRSVGPDVEGRFMRSLGYMLS  235

Query  409   KWLILREVGGVGLQSLTPQYLG--------------ISYSTEAYGLWILKGYAPVRAMKC  546
             KW +LRE+       +                    +SY+TE +GLW+L+GYAPV AM  
Sbjct  236   KWCLLREIQDAAAAGVGSAVAAAPRRRRRRALPAACLSYATEVHGLWVLRGYAPVLAMPR  295

Query  547   TLHRG---------ERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDG-FIQVNA  696
              +  G           +P  V E  E ALRY LAH QLEAV Q EY V   D  F+ V+ 
Sbjct  296   VVVTGPAASASASIAASPHEVPE--EPALRYGLAHQQLEAVAQLEYAVRARDRRFVTVSV  353

Query  697   RLDNIRLHVARLGFNKSQDDAYV-------------DEKHFPSRIRVWVGPEVGASYVGG  837
             R+DN+R+ VARL F K  D                  E HFPSRIRVWVGP  GASY  G
Sbjct  354   RVDNVRVRVARLAFRKDDDGDEEEDADAGVDDDVLDGESHFPSRIRVWVGPRFGASYATG  413

Query  838   LSLGQSTNNIEKEVETHKIWKGSFGDSK---------VPKMKAVARMATKTKMKNWRWDQ  990
              SLG+ST N E++VE  +  KG+F  +           P++KA  R + +T+ ++WRW+Q
Sbjct  414   PSLGRSTGNPERDVELTRTVKGAFAGATKPANGGGGGAPRIKAKMRSSARTRNRSWRWEQ  473

Query  991   DTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNN--LGRRYRGANRGFTKKGS  1164
             + EG+A V++  L D  TG EV+ W+P  G  G  A    N  + RRY G  R F+K   
Sbjct  474   EAEGSAGVFEGVLYDPVTGTEVSAWRPGGGGSGTGAADPRNGIMRRRYGGPGRAFSKMRG  533

Query  1165  LVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
             LV+AG+E    + WR+ +E  G  L+WR+G + W++Y PN V + ++ETRCVEW  EVDL
Sbjct  534   LVVAGDELPEEMTWRVGREAEGRTLRWRLGLKAWVSYAPNEVRSRHFETRCVEWAHEVDL  593

Query  1345  PL  1350
             PL
Sbjct  594   PL  595



>ref|NP_001143132.1| uncharacterized protein LOC100275610 [Zea mays]
 gb|ACG29240.1| hypothetical protein [Zea mays]
Length=592

 Score =   265 bits (678),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 201/503 (40%), Positives = 282/503 (56%), Gaps = 57/503 (11%)
 Frame = +1

Query  1     VWVSDECHLSSD-KPFLPLVLQLLQEVISRSP------TAHDSTCPRSQLQKLHPDRVSW  159
             +W S+    SS   P + L++QLL EV++ SP         D     +   K+  + VS 
Sbjct  88    LWASEGFAASSPVAPRVQLLVQLLNEVLALSPYVPCLGAGVDGLGGDASEAKVDAETVSA  147

Query  160   ML---DSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLE--MFSSKPA  324
             ++   ++      ++FF+L LL RLFWLCA DAP++AG L+F  + +  +E  +   +PA
Sbjct  148   VVGAAEAGPSAPAAAFFSLALLLRLFWLCATDAPADAGYLFFRDLRS-EIERGLGECRPA  206

Query  325   PVVLRTFFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSL---TPQ------YLGI  477
                L  F  +VG DVE  FMR+ GYMLAKW +LR++      +     P+         +
Sbjct  207   ---LAVFLRSVGPDVEDRFMRSLGYMLAKWCLLRDMQAAARSAAKLEAPRRRRALPAACL  263

Query  478   SYSTEAYGLWILKGYAPVRAMKCTLHRGERN--PFPVIEAKESALRYALAHHQLEAVIQF  651
             SY+TE +GLWILKGYAPV AM         +    P    +E ALRY LAH QLEAV Q 
Sbjct  264   SYATEVHGLWILKGYAPVLAMPRVTGPASTSIAASPHELPEEPALRYGLAHQQLEAVAQL  323

Query  652   EYTVGYFDG-FIQVNARLDNIRLHVARLGFNKSQ-----------------DDAYVDEKH  777
             EY     D  F+ V+ R+DN+R+ VARL F  +                  DD    E H
Sbjct  324   EYAARVRDRRFVTVSVRVDNVRVRVARLAFRSNDGGGNDGEEAEEDDDAGVDDIMDGESH  383

Query  778   FPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF-GDSK------VPKMK  936
             FPSR+R+WVGP  GASY  G SLG+ST N E++VE  +  KG+F G +K      VP++K
Sbjct  384   FPSRVRLWVGPRFGASYATGPSLGRSTGNPERDVEMTRTVKGAFSGATKPANGGVVPRIK  443

Query  937   AVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP----DNGDDGPTAVV  1104
             A  R + +T+ ++WRW+Q+ EG+A V++  L D  TG EV+ W+P      G  GPT   
Sbjct  444   AKMRSSARTRSRSWRWEQEAEGSAGVFEGVLYDPVTGTEVSAWRPAGTGGGGGTGPTDP-  502

Query  1105  MNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPN  1284
              N + RRY G  R F+K   LV+AG+E    + WR+ +E  G  L+WR+G + W+TY PN
Sbjct  503   RNGMRRRYGGPGRAFSKMRGLVVAGDELPEEMTWRVGREAEGRTLRWRLGLKAWVTYLPN  562

Query  1285  HVNTSYYETRCVEWCDEVDLPLI  1353
                + ++ETRC+EW  EVDLPL+
Sbjct  563   EARSRHFETRCIEWAHEVDLPLL  585



>tpg|DAA45866.1| TPA: hypothetical protein ZEAMMB73_487927 [Zea mays]
Length=590

 Score =   264 bits (675),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 200/502 (40%), Positives = 275/502 (55%), Gaps = 55/502 (11%)
 Frame = +1

Query  1     VWVSDECHLSSD-KPFLPLVLQLLQEVISRSP------TAHDSTCPRSQLQKLHPDRVSW  159
             +W S+    SS   P + L++QLL EV++ SP         D     +   K+  + VS 
Sbjct  86    LWASEGFAASSPVAPRVQLLVQLLNEVLALSPYVPCLGAGVDGLGGDASEAKVDAETVSA  145

Query  160   ML---DSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLE--MFSSKPA  324
             ++   ++      ++FF+L LL RLFWLCA DAP++AG LYF   L   +E  +   +PA
Sbjct  146   VVGAAEAGPSAPGAAFFSLALLLRLFWLCATDAPADAGYLYFRD-LGSEIERGLGECRPA  204

Query  325   PVVLRTFFVTVGTDVELCFMRTFGYMLAKWLILRE---VGGVGLQSLTPQ------YLGI  477
                L  F  +VG DVE  FMR+ GYMLAKW +LRE   V G   +   P+         +
Sbjct  205   ---LAVFLRSVGPDVEDRFMRSLGYMLAKWCLLREIQAVAGSAAKLEAPRRRRALPAACL  261

Query  478   SYSTEAYGLWILKGYAPVRAMKCTLHRGERN--PFPVIEAKESALRYALAHHQLEAVIQF  651
             SY+TE +GL ILKGYAPV AM         +    P    +E ALRY LAH QLEAV Q 
Sbjct  262   SYATEVHGLLILKGYAPVLAMPRVTGPASTSIAASPHELPEEPALRYGLAHQQLEAVAQL  321

Query  652   EYTVGYFDG-FIQVNARLDNIRLHVARLGFNKSQDDAYV-----------------DEKH  777
             EY     D  F+ V+ R+DN+R+ VA L F  +                        E H
Sbjct  322   EYAARVRDRRFVTVSVRVDNVRVRVAPLAFRSNDGGGNDGEEAEDDDDAGVDDIMDGESH  381

Query  778   FPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF-GDSK------VPKMK  936
             FPSRIR+WVGP  GASY  G SLG+ST N E++VE  +  KG+F G +K      VP++K
Sbjct  382   FPSRIRLWVGPRFGASYATGPSLGRSTGNPERDVEMTRTVKGAFSGATKPANGGVVPRIK  441

Query  937   AVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVM---  1107
             A  R + +T+ ++WRW+Q+ EG+A V++  L D  TG EV+ W+P     G         
Sbjct  442   AKMRSSARTRSRSWRWEQEAEGSAGVFEGVLYDPVTGTEVSAWRPAGTGGGGGTGATDPR  501

Query  1108  NNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNH  1287
             N + RRY G  R F+K   LV+AG+E    + WR+ +E  G  L+WR+G + W+TY PN 
Sbjct  502   NGMRRRYGGPGRAFSKMRGLVVAGDELPEEMTWRVGREAEGRTLRWRLGLKAWVTYLPNE  561

Query  1288  VNTSYYETRCVEWCDEVDLPLI  1353
               + ++ETRC+EW  EVDLPL+
Sbjct  562   ARSRHFETRCIEWAHEVDLPLL  583



>gb|ACN28466.1| unknown [Zea mays]
Length=370

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 151/363 (42%), Positives = 203/363 (56%), Gaps = 39/363 (11%)
 Frame = +1

Query  382   MRTFGYMLAKWLILRE---VGGVGLQSLTPQY------LGISYSTEAYGLWILKGYAPVR  534
             MR+ GYMLAKW +LRE   V G   +   P+         +SY+TE +GL ILKGYAPV 
Sbjct  1     MRSLGYMLAKWCLLREIQAVAGSAAKLEAPRRRRALPAACLSYATEVHGLLILKGYAPVL  60

Query  535   AMKCTLHRGERN--PFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDG-FIQVNARLD  705
             AM         +    P    +E ALRY LAH QLEAV Q EY     D  F+ V+ R+D
Sbjct  61    AMPRVTGPASTSIAASPHELPEEPALRYGLAHQQLEAVAQLEYAARVRDRRFVTVSVRVD  120

Query  706   NIRLHVARLGFNKSQDDAYV-----------------DEKHFPSRIRVWVGPEVGASYVG  834
             N+R+ VA L F  +                        E HFPSRIR+WVGP  GASY  
Sbjct  121   NVRVRVAPLAFRSNDGGGNDGEEAEDDDDAGVDDIMDGESHFPSRIRLWVGPRFGASYAT  180

Query  835   GLSLGQSTNNIEKEVETHKIWKGSF-GDSK------VPKMKAVARMATKTKMKNWRWDQD  993
             G SLG+ST N E++VE  +  KG+F G +K      VP++KA  R + +T+ ++WRW+Q+
Sbjct  181   GPSLGRSTGNPERDVEMTRTVKGAFSGATKPANGGVVPRIKAKMRSSARTRSRSWRWEQE  240

Query  994   TEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVM---NNLGRRYRGANRGFTKKGS  1164
              EG+A V++  L D  TG EV+ W+P     G         N + RRY G  R F+K   
Sbjct  241   AEGSAGVFEGVLYDPVTGTEVSAWRPAGTGGGGGTGATDPRNGMRRRYGGPGRAFSKMRG  300

Query  1165  LVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
             LV+AG+E    + WR+ +E  G  L+WR+G + W+TY PN   + ++ETRC+EW  EVDL
Sbjct  301   LVVAGDELPEEMTWRVGREAEGRTLRWRLGLKAWVTYLPNEARSRHFETRCIEWAHEVDL  360

Query  1345  PLI  1353
             PL+
Sbjct  361   PLL  363



>gb|KDO44840.1| hypothetical protein CISIN_1g010902mg [Citrus sinensis]
Length=498

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 128/436 (29%), Positives = 216/436 (50%), Gaps = 38/436 (9%)
 Frame = +1

Query  52    LVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFNLVLLSRLFW  231
             L+   +++V++  P   +S    S L+ L  D +S          F   FNL  L+ LF 
Sbjct  93    LLTNFIEDVLNYGP---NSAKNNSLLKFLKFDSMS---------NFKDIFNLAFLTLLFL  140

Query  232   LCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLAK  411
             +C  +AP++  +   ++I     E+   +P     +     +G+++E  +MR+    +  
Sbjct  141   ICIYEAPADLRSGCLNTIKN---ELAGCQPRAAS-KLLMKQLGSNLEEQWMRSINLAITN  196

Query  412   WLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIEA  591
             W++  +     + + +P +   SY+   +GLW +  + PV AM         NP     +
Sbjct  197   WILELQATHRTITTPSPLF---SYALSTFGLWKIHLFCPVIAMDIV---SSSNP-----S  245

Query  592   KESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNKS---QDDAY  762
              +  L ++L +HQLE VIQF Y V   + ++ +   +DNIR  + RL  NK+   +    
Sbjct  246   LDERLLFSLNYHQLEGVIQFNYKVIIQEKWVNLMLNIDNIRCDIIRL-VNKTLMNERGVG  304

Query  763   VDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGD-SKVPKMKA  939
             VDEKHFPSRI + + P +  + +  +S+ +S+ N  +E+E  K  +GSF   +    +K 
Sbjct  305   VDEKHFPSRISLQLTPTMQTN-ILSVSVSKSSENPTREIEIEKTIEGSFDPPNSFLGLKV  363

Query  940   VARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-GDDGPTAVVMNNL  1116
              A   T   MK W+++Q   G + + +  L D+  G EV + KP       P A   +  
Sbjct  364   SAGETTTLSMKPWKFEQSVYGYSAILNWFLHDSMDGREVFSSKPAKMALLNPKAWFKD--  421

Query  1117  GRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNT  1296
               RY  A R FT++G ++ AG+E G  V W+  K + G  ++W I G +WLTYWPN   T
Sbjct  422   --RYSSAYRPFTRQGGVIFAGDEYGERVWWKFDKSVAGRTMEWEIRGWIWLTYWPNKHRT  479

Query  1297  SYYETRCVEWCDEVDL  1344
              Y ETR +E+ + + L
Sbjct  480   FYNETRRLEFREIIHL  495



>ref|XP_002520802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41511.1| conserved hypothetical protein [Ricinus communis]
Length=497

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/392 (31%), Positives = 194/392 (49%), Gaps = 24/392 (6%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   FNL  L+  F +C  +AP++  +    S L   L     +      ++    +G++
Sbjct  125   FKDMFNLAFLTVSFLICIYEAPADLRSECLAS-LKTELTNCRLREGS---KSLMKIIGSN  180

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MR+    +  W    EV    L++ +P +   SYS   +  W ++ Y PV AM  
Sbjct  181   LEEQWMRSINLAITNWTSELEVTNRILKTPSPLF---SYSFSTFEFWKVQLYCPVIAMDI  237

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                    NP       +  L ++L HHQLE VIQF Y V   + ++ V A +DNIR  V 
Sbjct  238   ---ESSSNPL-----ADERLLFSLRHHQLEGVIQFNYRVIIQEKWVDVIATIDNIRCDVI  289

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             RL      ++     +EKHFPSRI + + P +  + +  +S+G+S++N  +E+E  K  +
Sbjct  290   RLVNETLMAKQGVGTEEKHFPSRISLHLTP-IMQTNITSVSVGKSSDNPTREIELEKSIE  348

Query  901   GSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
              SF   +    +K        T MK W++++   G + + +  L D+  G EV++ KP  
Sbjct  349   TSFDPPNTFLGLKLSVGETVSTSMKPWKFEESVHGYSAILNWFLHDSMDGREVSSSKPSK  408

Query  1078  -GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIG  1254
                  P A   +    RY  A+R FTK+G +V A +E G G+ W++ K  +G  + W I 
Sbjct  409   MALINPKAWFKD----RYASAHRPFTKQGGVVFARDEYGNGIKWKVDKSAIGKTMDWEIK  464

Query  1255  GEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             G +WLTYWPN   T Y ETR +E+ + V L +
Sbjct  465   GWIWLTYWPNKYRTFYSETRRLEFREIVRLTI  496



>ref|XP_006435832.1| hypothetical protein CICLE_v10031321mg [Citrus clementina]
 ref|XP_006486240.1| PREDICTED: uncharacterized protein LOC102608546 [Citrus sinensis]
 gb|ESR49072.1| hypothetical protein CICLE_v10031321mg [Citrus clementina]
Length=498

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 126/435 (29%), Positives = 214/435 (49%), Gaps = 36/435 (8%)
 Frame = +1

Query  52    LVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFNLVLLSRLFW  231
             L+   +++V++  P   +S    S L+ L  D +S          F   FNL  L+ LF 
Sbjct  93    LLTNFIEDVLNYGP---NSAKNNSLLKFLKFDSMS---------NFKDIFNLAFLTLLFL  140

Query  232   LCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLAK  411
             +C  +AP++  +   ++I     E+   +P     +     +G+++E  +MR+    +  
Sbjct  141   ICIYEAPADLRSGCLNTIKN---ELAGCQPRAAS-KLLMKQLGSNLEEQWMRSINLAITN  196

Query  412   WLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIEA  591
             W++  +     + + +P +   SY+   +GLW +  + PV AM         NP     +
Sbjct  197   WILELQATHRTITTPSPLF---SYALSTFGLWKIHVFCPVIAMDIV---SSSNP-----S  245

Query  592   KESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNKSQDD--AYV  765
              +  L ++L +HQLE VIQF Y V   + ++ +   +DNIR  + RL      ++    V
Sbjct  246   LDERLLFSLNYHQLEGVIQFNYKVIIQEKWVNLMLNIDNIRCDIIRLVNETLMNERGVGV  305

Query  766   DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGD-SKVPKMKAV  942
             DEKHFPSRI + + P +  + +  +S+ +S+ N  +E+E  K  +GSF   +    +K  
Sbjct  306   DEKHFPSRISLQLTPTMQTN-ILSVSVSKSSENPTREIEIEKTIEGSFDPPNSFLGLKVS  364

Query  943   ARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-GDDGPTAVVMNNLG  1119
             A   T   MK W+++Q   G + + +  L D+  G EV + KP       P A   +   
Sbjct  365   AGETTTLSMKPWKFEQSVYGYSAILNWFLHDSMDGREVFSSKPAKMALLNPKAWFKD---  421

Query  1120  RRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTS  1299
              RY  A R FT++G ++ AG+E G  V W+  K + G  ++W I G +WLTYWPN   T 
Sbjct  422   -RYSSAYRPFTRQGGVIFAGDEYGERVWWKFDKSVAGRTMEWEIRGWIWLTYWPNKHRTF  480

Query  1300  YYETRCVEWCDEVDL  1344
             Y ETR +E+ + + L
Sbjct  481   YNETRRLEFREIIHL  495



>ref|XP_011076640.1| PREDICTED: uncharacterized protein LOC105160840 [Sesamum indicum]
Length=495

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 196/404 (49%), Gaps = 31/404 (8%)
 Frame = +1

Query  178   PETFS-------SFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVL  336
             P+T+S         FN   LS  F +C  +AP++       S L    + F+ + +  V 
Sbjct  111   PQTYSENDSLMKDIFNFSFLSLTFIICIYEAPTDLRG----SCLNTLRDNFACRKSRGVS  166

Query  337   RTFFVTVGTDVELCFMRTFGYMLAKWL--ILREVGGVGLQSLTPQYLGISYSTEAYGLWI  510
             R     +G+++E  +MR+    +  W+  I R    V L+ L+P +   SYS   +GLW 
Sbjct  167   RLLMRVLGSNIEEQWMRSINLAITNWITEIDRAANNVALRRLSPLF---SYSLSTFGLWK  223

Query  511   LKGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQV  690
             ++ Y PV AM      G         + +  L ++L +HQLE VIQ  Y V   + +I+V
Sbjct  224   VQLYCPVMAMNVDKCSGG--------SPDDRLLFSLNYHQLEGVIQLNYRVAVQEKWIEV  275

Query  691   NARLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNN  864
                 DNIR  V +L  +    +  A   EKHFPSRI + + P    + V  +S+ +S+ N
Sbjct  276   MVNTDNIRCDVVKLLTDTLLQERGAGTSEKHFPSRISLQITPATLQANVISISVSKSSEN  335

Query  865   IEKEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQT  1044
               +E+   K  + SF       +   A     T +K W+++Q   GN  + +  L D+  
Sbjct  336   PPREIGLEKGVEASFQPPNAVGLHFSAGETVTTSLKPWKFEQSVYGNTAILNWFLHDSVD  395

Query  1045  GIEVATWKPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKE  1221
             G EV + KP       P A   N    RY  A R FT++G ++ AG+E G  V W++ K 
Sbjct  396   GREVFSSKPSKFAMLHPKAWFKN----RYSSAQRPFTRQGGVIFAGDEYGERVSWKVDKG  451

Query  1222  MVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
              +G  ++W I G +WLTYWPN   T Y E+R +E+ + V L L+
Sbjct  452   CMGRSMEWEIKGWIWLTYWPNKHRTFYTESRRLEFREVVCLTLV  495



>ref|XP_010264527.1| PREDICTED: uncharacterized protein LOC104602506 [Nelumbo nucifera]
 ref|XP_010264528.1| PREDICTED: uncharacterized protein LOC104602506 [Nelumbo nucifera]
 ref|XP_010264529.1| PREDICTED: uncharacterized protein LOC104602506 [Nelumbo nucifera]
Length=510

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 126/413 (31%), Positives = 205/413 (50%), Gaps = 34/413 (8%)
 Frame = +1

Query  142   PDRVSWMLDSHSPETFSSF---FNLVLLSRLFWLCACDAPSE--AGALYFHSILAPNLEM  306
             P + +  L+  + ET S+F   F++   S  F +C  +AP +  +G L     L  +L  
Sbjct  119   PSKNTSFLNIPTLETISNFKDIFDITFFSLAFLVCIYEAPKDIRSGCL---DTLKNHLTR  175

Query  307   FSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYS  486
               S+ A    +     +G+++E  +MR+    +  W I  +     L +  P +   SY+
Sbjct  176   SQSREAS---KQLMRLLGSNIEEQWMRSLNLAITNWTIELQESHHALTTTLPLF---SYA  229

Query  487   TEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVG  666
                 GLW  + Y PV AM+                 +  + ++L +HQLE VIQF Y V 
Sbjct  230   ISTVGLWKAQLYCPVVAMETENSSN---------TADKRVLFSLKYHQLECVIQFGYKVI  280

Query  667   YFDGFIQVNARLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGL  840
               D ++ V   +DNIR  V RL      ++  A V EKHFPSRI + + P +  + V  +
Sbjct  281   VRDEWVDVMVNVDNIRCDVTRLVSETLMAERGAGVAEKHFPSRISLQLTPTLQTN-VLSV  339

Query  841   SLGQSTNNIEKEVETHKIWKGSFGDSKVPKM--KAVARMATKTKMKNWRWDQDTEGNAVV  1014
             ++ +S++N  +E+ T K  +  F D   P +  K  A       +K W+++Q  +GN   
Sbjct  340   TVSKSSDNPSREIGTEKALEAGF-DPPNPYLGVKVSASETVTMSLKPWKFEQSVDGNGAN  398

Query  1015  YDATLCDNQTGIEVATWKPDNGD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESG  1191
              +  L D++ G EV++ KP       P A   N    RY  A+R FT++G ++ AG+E G
Sbjct  399   LNWFLHDSKDGREVSSKKPSMLKLVQPKAWFKN----RYCSAHRPFTREGGVIFAGDEYG  454

Query  1192  TGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
               V W++ +  +G+ ++W I G +WLTYWPN   T Y ETR +E+ + V LP+
Sbjct  455   ESVLWKVDRSAIGTTMEWEIKGWIWLTYWPNKYRTIYNETRRLEFRETVHLPI  507



>ref|XP_002315128.1| hypothetical protein POPTR_0010s19040g [Populus trichocarpa]
 gb|EEF01299.1| hypothetical protein POPTR_0010s19040g [Populus trichocarpa]
Length=500

 Score =   174 bits (441),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 218/450 (48%), Gaps = 38/450 (8%)
 Frame = +1

Query  25    LSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFN  204
             L  D+    L + L+++V+     A + +C  S  + L  D V     SH  +TF    N
Sbjct  84    LLDDETISSLSINLIEDVLGY---ASNKSC-SSSTKVLKTDSVL----SHLKDTF----N  131

Query  205   LVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFM  384
             L  L+    +C  +AP++  +      LA      +        ++    +G+++E  +M
Sbjct  132   LAFLTLSLLICIYEAPADLRS----ECLASLKNQLTDSQLRGASKSLMKIMGSNLEEQWM  187

Query  385   RTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGE  564
             R+    +  W+   +     L++ +P +   SYS    GLW ++ Y PV AM        
Sbjct  188   RSLNLAITNWIAELQASHHTLKTPSPLF---SYSFSTPGLWKVQLYCPVIAMDI---ESS  241

Query  565   RNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNK  744
              NP P  E     L ++L +HQLE VIQF Y V   + ++ V    DNIR  V RL    
Sbjct  242   SNP-PAHER----LLFSLKYHQLECVIQFNYKVIVQENWVDVIVNTDNIRCDVVRLVNET  296

Query  745   --SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGD-  915
               ++  A  DEKHFPSRI + + P +  + +  +S+G+S+ N  +E+E  K  + SF   
Sbjct  297   LMTEQGAGTDEKHFPSRISLHLTPILQTNIIS-VSVGKSSANPTREIEMEKGIETSFDPP  355

Query  916   SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPT  1095
             +    +K  A       +K W+++Q   G + + +  L DN  G EV + KP       T
Sbjct  356   NSFLGLKVSAGETVSMSLKPWKFEQSVYGTSAIMNWFLHDNMDGREVFSNKPPR-----T  410

Query  1096  AVVMNN--LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWL  1269
             A++        RY  + R FT++G ++ AG+E G  V W++ K  +G  ++W I G +WL
Sbjct  411   ALIKPKAWFKNRYSSSYRPFTRQGGVIFAGDEYGKSVQWKVDKSTMGKTMEWEIKGWIWL  470

Query  1270  TYWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             TYWPN   T+Y ETR +++ + + L + P+
Sbjct  471   TYWPNKYRTAYSETRRLQFKEILHLSIPPS  500



>ref|XP_011015267.1| PREDICTED: uncharacterized protein LOC105118903 [Populus euphratica]
Length=500

 Score =   173 bits (439),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 134/449 (30%), Positives = 215/449 (48%), Gaps = 36/449 (8%)
 Frame = +1

Query  25    LSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFN  204
             L  D+    L + L+++V+     A D +C  S  + L  D V     SH  +TF    N
Sbjct  84    LLDDETISSLSINLIEDVLGY---ASDKSC-SSSTKVLKTDSVL----SHLKDTF----N  131

Query  205   LVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFM  384
             L  L+    +C  +AP++  +      LA      +        +     +G+++E  +M
Sbjct  132   LAFLTLSLLICIYEAPADLRS----ECLASLKNQLTDSQLREASKLLMKIMGSNLEEQWM  187

Query  385   RTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGE  564
             R+    +  W+   +     L++ +P +   SYS    GLW ++ Y PV AM        
Sbjct  188   RSINLAITNWIAELQASHHTLKTPSPLF---SYSFSTPGLWKVQLYCPVIAMDI---ESS  241

Query  565   RNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNK  744
              NP P  E     L ++L +HQLE VIQF Y V   + ++ V    DNIR  V RL    
Sbjct  242   SNP-PAHER----LLFSLKYHQLECVIQFNYKVIVQENWVDVIVNTDNIRCDVVRLVNET  296

Query  745   --SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGD-  915
               ++     DEKHFPSRI + + P +  + +  +S+G+S+ N  +E+ET K  + SF   
Sbjct  297   LMTEQGVGTDEKHFPSRISLHLTPILQTNIIS-VSVGKSSANPTREIETEKGIEASFDPP  355

Query  916   SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPD-NGDDGP  1092
             +    +K  A       +K W+++Q   G +   +  L DN  G EV + KP       P
Sbjct  356   NSFLGLKVSAGETVSMSLKPWKFEQSVYGYSATMNWFLHDNMDGREVFSNKPPRTAFIKP  415

Query  1093  TAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLT  1272
              A   N    RY  + R FT++G ++ AG+E G  V W++ K  +G  ++W I G +WLT
Sbjct  416   KAWFKN----RYSSSYRPFTRQGGVIFAGDEYGKSVQWKVDKSTMGKTMEWEIKGWIWLT  471

Query  1273  YWPNHVNTSYYETRCVEWCDEVDLPLIPT  1359
             YWPN   T+Y ETR +++ + + L + P+
Sbjct  472   YWPNKYRTAYSETRRLQFKEILHLSIPPS  500



>ref|XP_011084862.1| PREDICTED: uncharacterized protein LOC105167009 [Sesamum indicum]
Length=495

 Score =   173 bits (439),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 127/439 (29%), Positives = 214/439 (49%), Gaps = 40/439 (9%)
 Frame = +1

Query  52    LVLQLLQEVISRSPTAHDSTCPRS-QLQKLHPDRVSWMLDSHSPETFSSFFNLVLLSRLF  228
             L+   +++V++ SP    + CP + +L +L          S  P      FN   LS  F
Sbjct  92    LISNFIEDVLNYSP----NKCPNARKLPRL----------SLEPHNLKDVFNFSFLSLTF  137

Query  229   WLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLA  408
              +C  +AP +       S L    + FS   +  V +     +G++VE  +MR+    + 
Sbjct  138   LICIYEAPRDVRT----SCLNTLKDQFSCPKSRQVSKLLMRLLGSNVEELWMRSINLAIT  193

Query  409   KWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIE  588
              W+   +     ++  TP  L  SYS    GLW ++ Y PV AM       E++  P+ +
Sbjct  194   NWISELQAANSAIK--TPSSL-FSYSFSTLGLWKVQLYCPVIAMNV-----EKSSGPLSD  245

Query  589   AKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNK--SQDDAY  762
              +   L ++L +HQLE VIQ  + V   + +I+V   +DNIR  V +L  +   S+  A 
Sbjct  246   DR---LLFSLNYHQLEGVIQLNHKVVVREKWIEVMVNIDNIRCDVIKLVTDTLMSERGAG  302

Query  763   VDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGDSKVPKMKAV  942
               EKHFPSRI + + P + A+ +      +S+ N  +E+   K  + SF       +   
Sbjct  303   TAEKHFPSRIALQITPTLQANIISISV-SKSSENPTREISVEKAIEASFEPPNTVGLNFS  361

Query  943   ARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNN--L  1116
             A   +   ++ W+++Q   GN+ + +  L D+  G EV + KP        A++ +    
Sbjct  362   AGETSTVSLRPWKFEQSVYGNSAILNWFLHDSVDGREVFSSKP-----SKLALIHHKAWF  416

Query  1117  GRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNT  1296
               RY  A+R FT++G ++ AG+E G  V WR+ K+ +G  ++W + G +WLTYWPN   +
Sbjct  417   KNRYTNADRAFTREGGVIFAGDEYGESVCWRVDKDCMGRSMEWEMRGWIWLTYWPNKHRS  476

Query  1297  SYYETRCVEWCDEVDLPLI  1353
              Y ET+ +E+ + V L LI
Sbjct  477   FYSETKRLEFREVVCLSLI  495



>ref|XP_009595199.1| PREDICTED: uncharacterized protein LOC104091541 [Nicotiana tomentosiformis]
Length=493

 Score =   173 bits (438),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 135/456 (30%), Positives = 211/456 (46%), Gaps = 46/456 (10%)
 Frame = +1

Query  10    SDECHLSSDKPFLPLVLQLLQEVISRSPTAHDST---CPRSQLQKLHPDRVSWMLDSHSP  180
             S+   L  D+P   L++  +Q+V+   P  + S+    P+              +D +S 
Sbjct  74    SNSTKLLDDEPIFNLLINFIQDVLKYGPNKNSSSFLKIPK--------------MDFNS-  118

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
               F   FN   L+  F +C  +AP +  ++  +++       FS   +    +     +G
Sbjct  119   -CFKEIFNFSFLTLAFIICIYEAPIDLRSICINTLK----NQFSCPQSRHASKLLVKILG  173

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
             ++ E  +MR+    +  W++  E+      S+       SYS    GLW ++ Y PV AM
Sbjct  174   SNPEEEWMRSVNLAITNWIV--EIQESLNHSIKTPCKLFSYSFSTVGLWKVQLYCPVIAM  231

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                               +  LR++L  HQLE VIQ  Y V   + +I+V    DNIR  
Sbjct  232   DIDTSTSS--------LSDDNLRFSLNFHQLEGVIQLNYRVIIREKWIEVMVNTDNIRFD  283

Query  721   VARLGFNKS---QDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
             V RL  N+S   +  A + EKHFPSRI + + P +  + V  +S+ +S++N  +E+   K
Sbjct  284   VVRL-VNESLMEERGAGISEKHFPSRISLQLTPTLQTN-VLSISVTKSSDNPLREIGMEK  341

Query  892   IWKGSFGDSKVPKM--KAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
               +  F D   P M  K  A       MK W+++Q   GN    +  L D+  G EV + 
Sbjct  342   SIEAGF-DPPNPYMGLKVSASETVTMSMKPWKFEQSVNGNGANLNWFLHDSGNGKEVFSS  400

Query  1066  KPDNGD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
             KP       P A   N    RY  A R FTK+G ++ A +E G  V W++ K  +G  ++
Sbjct  401   KPSVFSLIQPKAWFKN----RYSSAYRPFTKQGGVIFAKDEYGESVIWKVDKRAMGKSME  456

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             W + G VWLTYWPN   TSY ETR +E+ + + L L
Sbjct  457   WELKGRVWLTYWPNKHITSYSETRRLEFQEVLHLNL  492



>gb|AFK35231.1| unknown [Medicago truncatula]
Length=132

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 96/130 (74%), Gaps = 6/130 (5%)
 Frame = +1

Query  964   KMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLGRRYRGANR  1143
             + K+WR DQD EGNA ++D  L DN TG EV +WKP  GDD      ++ L  RY GANR
Sbjct  2     RTKSWRMDQDAEGNAAIFDVVLHDNMTGQEVGSWKP-TGDD-----PIHGLRGRYVGANR  55

Query  1144  GFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVE  1323
              F+K GS+VIAG+E G  VGWRLSKEM GSVLKWRIGGE W++Y P+    S++ETRC+E
Sbjct  56    PFSKSGSVVIAGDEYGEEVGWRLSKEMEGSVLKWRIGGEFWVSYLPDQAKGSHFETRCIE  115

Query  1324  WCDEVDLPLI  1353
             WCDEVDLPLI
Sbjct  116   WCDEVDLPLI  125



>gb|ACR35868.1| unknown [Zea mays]
Length=215

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 129/205 (63%), Gaps = 10/205 (5%)
 Frame = +1

Query  769   EKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF-GDSK------VP  927
             E HFPSRIR+WVGP  GASY  G SLG+ST N E++VE  +  KG+F G +K      VP
Sbjct  4     ESHFPSRIRLWVGPRFGASYATGPSLGRSTGNPERDVEMTRTVKGAFSGATKPANGGVVP  63

Query  928   KMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVM  1107
             ++KA  R + +T+ ++WRW+Q+ EG+A V++  L D  TG EV+ W+P     G      
Sbjct  64    RIKAKMRSSARTRSRSWRWEQEAEGSAGVFEGVLYDPVTGTEVSAWRPAGTGGGGGTGAT  123

Query  1108  ---NNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYW  1278
                N + RRY G  R F+K   LV+AG+E    + WR+ +E  G  L+WR+G + W+TY 
Sbjct  124   DPRNGMRRRYGGPGRAFSKMRGLVVAGDELPEEMTWRVGREAEGRTLRWRLGLKAWVTYL  183

Query  1279  PNHVNTSYYETRCVEWCDEVDLPLI  1353
             PN   + ++ETRC+EW  EVDLPL+
Sbjct  184   PNEARSRHFETRCIEWAHEVDLPLL  208



>emb|CDP13959.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 132/437 (30%), Positives = 208/437 (48%), Gaps = 38/437 (9%)
 Frame = +1

Query  52    LVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFNLVLLSRLFW  231
             L+L  +++++S SP    + CP   L KL            S       FN   LS  F 
Sbjct  88    LLLNFVEDILSYSP----NRCP--SLLKLP--------SIDSSLNLKDIFNFSFLSLTFL  133

Query  232   LCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYMLAK  411
             +C  +APS+  +      L+     FS   +  V R     +G++VE  +MR+    +  
Sbjct  134   ICIYEAPSDIRS----ECLSTLKNQFSCPRSRDVSRMLMRVLGSNVEEQWMRSINLAITN  189

Query  412   WLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPVIEA  591
             W++  +     L++ +P Y   SYS  A+GLW ++ Y PV AM         NP P    
Sbjct  190   WIVELQASSHSLKAPSPLY---SYSNSAFGLWKVQLYCPVIAMDV---ETSSNPSP----  239

Query  592   KESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNKSQDD--AYV  765
              +  L ++L +HQLE VIQ  Y+V   + +I+V    DNIR  V RL      ++  A  
Sbjct  240   -DDRLLFSLNYHQLEGVIQLNYSVIVREKWIEVLVNTDNIRCDVIRLVNEALMNERGAGT  298

Query  766   DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGDSK-VPKMKAV  942
              EKHFPSRI + + P V  + +      +S+ N ++E+   +  + S   +     +   
Sbjct  299   AEKHFPSRISLHITPTVQTNIISISV-SKSSQNPKREIGLERAIEASLEPTNPFVGINFS  357

Query  943   ARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-GDDGPTAVVMNNLG  1119
             A       ++ W+++Q   GN+ + +  L D+  G EV++ KP       P A   N   
Sbjct  358   AGETMTMSLRPWKFEQSVYGNSAILNWFLHDSADGKEVSSSKPSKFALLQPKAWFKN---  414

Query  1120  RRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTS  1299
              RY  A R F K G ++ AG+E G  V W++ +  VG +++W I G +WLTYWPN   T 
Sbjct  415   -RYATAYRPFNKDGGVIFAGDEYGDKVCWKVDRGAVGKLMEWEIRGWIWLTYWPNKHRTL  473

Query  1300  YYETRCVEWCDEVDLPL  1350
             Y ETR  E+ + ++L L
Sbjct  474   YSETRRAEFREVLNLML  490



>ref|XP_009779966.1| PREDICTED: uncharacterized protein LOC104229087 [Nicotiana sylvestris]
Length=493

 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 136/454 (30%), Positives = 215/454 (47%), Gaps = 42/454 (9%)
 Frame = +1

Query  10    SDECHLSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETF  189
             S+   L  ++    L++  +Q+V+   P  + S    S L+    D  S+         F
Sbjct  74    SNSTKLLDNESVFNLLINFIQDVLKYCPNKNSS----SFLKIPKMDFNSY---------F  120

Query  190   SSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDV  369
                FN   L+  F +C  +AP++  ++  +++       FS   +    +     +G++ 
Sbjct  121   KEIFNFSFLTLAFIICIYEAPTDLRSICINTLK----NQFSCPQSRQASKLLVKILGSNS  176

Query  370   ELCFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             E  +MR+    +  W++ ++E     ++  TP  L  SYS    GLW ++ Y PV AM  
Sbjct  177   EEEWMRSVNLAITNWIMEIQESLNNSIK--TPCKL-FSYSFSTVGLWKVQLYCPVIAMDI  233

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                             +  LR++L  HQLE VIQ  Y V   + +I+V    DNIR  V 
Sbjct  234   ETSTSN--------LSDDNLRFSLNFHQLEGVIQLNYKVIIREKWIEVMVNTDNIRFDVI  285

Query  727   RLGFNKS---QDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIW  897
             RL  N+S   +  A + EKHFPSRI + + P +  + V  +S+ +S++N  +E+   K  
Sbjct  286   RL-VNESLMEERGAGISEKHFPSRISLQLTPTIQTN-VLSISVTKSSDNPLREIGMEKSI  343

Query  898   KGSFGDSKVPKM--KAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
             +G F D   P M  K  A       MK W+++Q   GN+   +  L D+  G EV + KP
Sbjct  344   EGGF-DPPNPYMGLKVSASETVTMSMKPWKFEQSVNGNSANLNWFLHDSGNGKEVFSTKP  402

Query  1072  DNGD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWR  1248
                    P A   N    RY    R FTK+G ++ A +E G  V W++ K  +G  ++W 
Sbjct  403   SVFSLIQPKAWFKN----RYSSVYRPFTKQGGVIFAKDEYGESVIWKVDKRAMGKTMEWE  458

Query  1249  IGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             + G VWLTYWPN   TSY ETR +E+ + + L L
Sbjct  459   LKGRVWLTYWPNKHITSYAETRRLEFQEVLHLNL  492



>emb|CDX84502.1| BnaC03g49980D [Brassica napus]
Length=502

 Score =   170 bits (431),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 132/472 (28%), Positives = 225/472 (48%), Gaps = 63/472 (13%)
 Frame = +1

Query  1     VWVS-DECHLSSDKP-------FLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVS  156
             +W S  E +++S+ P          L+   ++ +++   T++ S C   ++ K  P  ++
Sbjct  71    LWTSKQELNINSNSPNPFDEQTITSLLFSFVESILTY--TSNSSNCSTIKVPKPDPSMIN  128

Query  157   WMLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHS----ILAPNLEMFSSKPA  324
              + D          FN V+L+  F +C  +AP     LY        L  +L    ++ A
Sbjct  129   GLKD---------IFNTVILTLSFLVCVYEAP-----LYLRENCLITLRNHLVTCHARQA  174

Query  325   PVVLRTFFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGL  504
                L      +G+++E  +MR+    +  W+I R+       + TP +   SY+   YGL
Sbjct  175   TTSLMKL---LGSNLEEQWMRSVNLAITNWIIERKDNRSNKTTTTPLF---SYAFSTYGL  228

Query  505   WILKGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFI  684
             W ++ Y P+ AM+      ER+  P  +++   L ++L  +QLE V+QF + V   D +I
Sbjct  229   WKVQLYCPIEAMEV-----ERSSNPTADSR---LLFSLKFNQLEGVMQFNHKVVVRDKWI  280

Query  685   QVNARLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQST  858
              V  ++DNIR  V +L   +  S+  A   EKHFPSRI + + P +   ++       S 
Sbjct  281   DVIVKIDNIRYDVIKLVNERLMSRKGAGEHEKHFPSRISLQITPTLQTDFISVSVSKSSN  340

Query  859   NNIEKEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDA  1023
             N   +E E  +  +GSF       ++   R A+   M  W+++Q   G     N ++YD+
Sbjct  341   NP-GREFEVERSIEGSFDPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDS  399

Query  1024  TLCDNQTGIEVATWKPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGT  1194
             ++     G EV T KP          +M+       RY  A R FT++G ++ AG+E G 
Sbjct  400   SVG----GREVFTTKPSRFS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGE  449

Query  1195  GVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              V W++ K  +G  ++W I G +WLTYWPN   T Y+ETR +E+   + L +
Sbjct  450   SVVWKIGKGAMGRRMEWEIKGSIWLTYWPNKYKTFYHETRRLEFTQNLQLTI  501



>ref|XP_010031155.1| PREDICTED: uncharacterized protein LOC104421033 [Eucalyptus grandis]
 gb|KCW50424.1| hypothetical protein EUGRSUZ_J00165 [Eucalyptus grandis]
Length=502

 Score =   168 bits (426),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 116/400 (29%), Positives = 203/400 (51%), Gaps = 31/400 (8%)
 Frame = +1

Query  178   PETFSSF---FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFF  348
             P +FS+F   F+L  ++  F +C  +AP++  +   H + +  +   S   + ++++   
Sbjct  124   PWSFSNFGDIFDLAFVTLAFLICVYEAPADLRSWCLHGLKSHLVNCISKDASKLLMKM--  181

Query  349   VTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAP  528
               +G+++E  +MR+    +  W++ ++ G   +++ +P +   SY+  A+G+W +  Y P
Sbjct  182   --IGSNLEEQWMRSVNLAITNWILEQQSGHHTIKTPSPLF---SYALSAFGIWKVHLYCP  236

Query  529   VRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDN  708
             V A          NP       +  L ++L ++QLE VIQF Y +   + ++ V    DN
Sbjct  237   VIATDVV---STSNPL-----TDERLAFSLNYNQLEGVIQFNYKLMIQENWVDVFVDTDN  288

Query  709   IRLHVARLG----FNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKE  876
             IR  + RL      N+  + A   EKHFPSRI + + P +  + +  +S+G+S+ N  +E
Sbjct  289   IRFDIVRLVSETLMNEQGEGA--SEKHFPSRISLRLTPALQNNILS-VSVGKSSENATRE  345

Query  877   VETHKIWKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIE  1053
             + T K  +  F   +    +K  A     T MK W++++   G +      L D   G E
Sbjct  346   IATEKAIEAGFEPPNSYLGLKISAGETVTTSMKPWKFEESVLGYSADMHWFLHDPTDGRE  405

Query  1054  VATWKPDNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVG  1230
             V++ KP       P A   +    RY  A R FT++G +V AG+E G GV WRL K   G
Sbjct  406   VSSSKPSRLSLLNPKAWFKD----RYSSAYRPFTRQGGVVFAGDEYGEGVRWRLCKSARG  461

Query  1231  SVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
               ++W + G +WL+YWPN   TS+ ETR +E+ + + L +
Sbjct  462   KTMEWELRGWIWLSYWPNKHRTSHSETRRLEFRETLYLTI  501



>ref|XP_006364239.1| PREDICTED: uncharacterized protein LOC102580045 [Solanum tuberosum]
Length=501

 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 123/394 (31%), Positives = 190/394 (48%), Gaps = 23/394 (6%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   FN   L+  F +C  +AP++  +    + L        S+ A  +L  F   +G++
Sbjct  124   FKEIFNFSFLTLAFIICIYEAPADLRSTCIIA-LKNQFSCSQSREASKLLVRF---LGSN  179

Query  367   VELCFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMK  543
             +E  +MR+    +  W++ +         ++       SYS    GLW ++ Y PV AM 
Sbjct  180   IEEQWMRSVNLAITNWILEIHSSSNHHDHAMKTPCPLFSYSFSTQGLWKVQLYCPVIAMD  239

Query  544   CTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHV  723
                              + +LR++L  HQLE VIQ  + V   + +I+V    DNIR  V
Sbjct  240   AETSTCS-------SLSDESLRFSLNFHQLEGVIQLNHRVIVREKWIEVMVNTDNIRCDV  292

Query  724   ARLGFNKS---QDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
              RL  N+S   +  A V EKHFPSRI + + P +  S V  +S+ +S++N  +E+ T K 
Sbjct  293   VRL-VNESLMAERGAGVSEKHFPSRISLQLTPTL-QSNVLSISVNKSSDNPLREIGTEKT  350

Query  895   WKGSFGDSKV-PKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
              +  F        +K  A     T MK W+++Q   G+ V  +  L D+  G EV + KP
Sbjct  351   IEAGFDPPNTYIGLKVSAGETVVTTMKPWKFEQSVNGDGVNLNWFLHDSGNGREVFSSKP  410

Query  1072  DNGD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWR  1248
                    P A   N    RY   NR FTK+G ++ AG+E G  V W++ K  +G  ++W 
Sbjct  411   SVFSLIQPKAWFKN----RYSSVNRPFTKQGGVIFAGDEYGESVCWKVDKRAIGKTMEWE  466

Query  1249  IGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             + G +WLTYWPN   T Y ETR +E+ + + L L
Sbjct  467   LKGRLWLTYWPNKHITPYAETRRLEFREVLHLNL  500



>ref|XP_002864886.1| hypothetical protein ARALYDRAFT_496617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41145.1| hypothetical protein ARALYDRAFT_496617 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   167 bits (424),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 126/409 (31%), Positives = 203/409 (50%), Gaps = 45/409 (11%)
 Frame = +1

Query  166   DSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFH----SILAPNLEMFSSKPAPVV  333
             +S   +     FN V+L+ LF +C  +AP     LY      + L  +L    ++ A V 
Sbjct  125   NSSKIDGLKDIFNAVILTLLFVVCVYEAP-----LYLRENCLNTLKNHLVTCHARQATVS  179

Query  334   LRTFFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWIL  513
             L      +G+++E  +MRT    L  W+I +       ++ TP +   SY+  AYGLW +
Sbjct  180   LMKL---LGSNLEEQWMRTVNLALTNWIIEKRRCE-STKTTTPLF---SYAVSAYGLWKV  232

Query  514   KGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVN  693
             + Y PV AM+      ER+  P  +++   L ++L  +QLE V+QF + V   D +I V 
Sbjct  233   QLYCPVEAMEI-----ERSSNPTADSR---LLFSLKFNQLEGVMQFNHKVVVRDKWIDVI  284

Query  694   ARLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNI  867
              ++DNIR  V +L   K  S+  A   EKHFPSRI + + P +   ++       S N  
Sbjct  285   VKIDNIRYDVIKLVNEKLMSRRGAGEHEKHFPSRISLQLTPTLQTDFISVSVSKSSNNP-  343

Query  868   EKEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLC  1032
              +E E  +  +GSF       ++   R A+   M  W+++Q   G     N ++YD+++ 
Sbjct  344   GREFEVERSIEGSFDPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSVG  403

Query  1033  DNQTGIEVATWKPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVG  1203
                 G EV + KP          +M+       RY  A R FT++G ++ AG+E G  V 
Sbjct  404   ----GREVFSTKPSRFS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGESVV  453

Query  1204  WRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             W++ K  +G  ++W I G +WLTYWPN   T Y+ETR +E+   ++L +
Sbjct  454   WKIGKGALGRTMEWEIKGFIWLTYWPNKYKTFYHETRRLEFTQLLNLTI  502



>gb|KHN44714.1| hypothetical protein glysoja_032053 [Glycine soja]
Length=502

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 135/453 (30%), Positives = 215/453 (47%), Gaps = 46/453 (10%)
 Frame = +1

Query  25    LSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFN  204
             L+ D+    L++  ++E++      H S  P  +  KL  D VS          F   FN
Sbjct  84    LNDDETLSNLLVNFIEEILHYGSNKH-SIIPYIKFPKL--DSVS---------NFQDIFN  131

Query  205   LVLLSRLFWLCACDAPSE--AGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             L  L+ LF +C  +APS+  +G L   S L   L    S+ A   L      +G+++E  
Sbjct  132   LAFLTLLFLVCIYEAPSDLRSGCL---STLKEQLAGCQSRQASKFLMKL---LGSNLEEQ  185

Query  379   FMRTFGYMLAKWLI-LREVGGVGLQSL-TPQYLGISYSTEAYGLWILKGYAPVRAMKCTL  552
             +MR+    +  W++ ++E       +  TP  L  SY+   +GLW ++ Y PV  M    
Sbjct  186   WMRSVNLAITNWIVEIQEAHHTDHTTFRTPSPL-FSYAFSTFGLWKVQLYCPVINMDVV-  243

Query  553   HRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARL  732
                  N  P  E     L+++L + QLE V+QF Y V   + ++++   +DNIR  V +L
Sbjct  244   ---NANNHPADER----LQFSLKYQQLEGVLQFNYKVTIRERWVEIVVNIDNIRCDVFKL  296

Query  733   --GFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGS  906
                    +  A   EKHFPSRI + + P +    V  +S+G+S+ N   E    K  + S
Sbjct  297   VNDILMRERGAGAAEKHFPSRISLQLTPTIQQQ-VLTVSVGKSSENPRIEFGVEKGIEAS  355

Query  907   FGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGD  1083
             F   +    +   A  +T   +K W+++Q   G +   +  L D+  G EV + KP    
Sbjct  356   FEPPNPYIGLSVSAGESTTVSLKPWKFEQSVHGYSANLNWFLHDSTDGKEVFSTKP----  411

Query  1084  DGPTAVVMNN----LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
                + V + N       RY  A R FT++G ++ AG+E G  V W++ K  VG  ++W I
Sbjct  412   ---SKVALFNPKSWFKDRYSSAYRPFTRQGGVIFAGDEYGESVCWKVDKGAVGKTMEWEI  468

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              G +W+TYWPN   T Y+ETR  E+ + V L +
Sbjct  469   RGWIWITYWPNKHKTFYHETRRFEFRETVYLKI  501



>ref|XP_008456894.1| PREDICTED: uncharacterized protein LOC103496708 [Cucumis melo]
Length=496

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/388 (29%), Positives = 191/388 (49%), Gaps = 22/388 (6%)
 Frame = +1

Query  196   FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVEL  375
              FNL  L+ +F +C  +AP +   L  + ++A    + +S    +  +     +G+ +E 
Sbjct  127   IFNLAFLTLIFLICIYEAPID---LRSNCLMALKYHLANSTSRQIS-KVLMKLLGSTLEQ  182

Query  376   CFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
              ++R+    L  W+   +  G  L++ +P +   SYS   YGLW ++ Y P+ AM     
Sbjct  183   QWVRSLNLALTNWISELKASGRTLKTPSPMF---SYSFSTYGLWKVQLYCPIIAMDNI--  237

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
                 NP     + +  L+++L +HQLE V+QF Y     + +I +   +DNIR  + RL 
Sbjct  238   ENSSNP-----SSDERLQFSLNYHQLEGVLQFNYKAVVREKWIDMRVHVDNIRCDIVRLV  292

Query  736   FNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
                   +  V   EKHFPSRI + + P    + +  +S+ +S++N   E+ T K ++  F
Sbjct  293   NETLLSERGVGGSEKHFPSRISLQLTPTFHTN-IMSVSVSKSSSNPHIEIGTEKTFEAGF  351

Query  910   GDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-GDD  1086
               +  P +K          +K W+++Q   GNA   +  L D+  G EVA+ KP      
Sbjct  352   ESAPYPGLKLAVGETVTVSLKPWKFEQLVHGNAATLNWYLHDSSDGKEVASTKPSKLALI  411

Query  1087  GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVW  1266
              P A   +    RY  A R F ++G ++ AG+E G  V W++     G  ++W I G +W
Sbjct  412   NPKAWFRD----RYSSATRPFNRQGGVIFAGDEYGDSVWWKIDGTARGKTMEWEIRGWIW  467

Query  1267  LTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +TYWPN   T Y ET+ +E+ + + L +
Sbjct  468   VTYWPNKHKTFYTETKRLEFKEILQLSI  495



>ref|XP_006828143.1| hypothetical protein AMTR_s00023p00065960 [Amborella trichopoda]
 gb|ERM95559.1| hypothetical protein AMTR_s00023p00065960 [Amborella trichopoda]
Length=526

 Score =   166 bits (419),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 133/464 (29%), Positives = 216/464 (47%), Gaps = 40/464 (9%)
 Frame = +1

Query  1     VWVSDECHLSSD--KPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSH  174
             +W S+ C L+    KP+      L    I+       +T P   +  +H       +   
Sbjct  85    LWSSNPCELNPQTLKPYQQTTFSLFLNFITHVLHYSSNTKPSPTIVNVH-------ITPK  137

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
              P+ F  FFNL   S    +C  +AP +   +   +         +   +    + F   
Sbjct  138   DPK-FPEFFNLCFASMSLCVCIYEAPQDIRNICLRTFQ----RHLTHNKSKQTQKHFLQA  192

Query  355   VGTDVELCFMRTFGYMLAKWLILREVG-GVGLQSLTPQYLGISYSTEAYGLWILKGYAPV  531
             +G+++E  +MR+        L +  +G G+ L+ L P     SY+T  +G W L+ Y P+
Sbjct  193   IGSNLEEQWMRSLA------LAITNIGPGIALE-LGP----YSYATPIFGAWKLRLYCPI  241

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AMK     GE +      + +  L ++L HH LE V+Q  Y++ +   ++ V   +DNI
Sbjct  242   AAMK---QVGESSG---ECSTDDRLLFSLRHHHLETVLQLRYSLAFQHNWVDVFMSIDNI  295

Query  712   RLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             R  +  L  +    +  A  +EKHFPSRI ++V P   A+ +  +S+ +S++N   E+ T
Sbjct  296   RCDIVPLVTDALLERRGAGEEEKHFPSRISLYVTPIDDANLLS-VSVFKSSDNPTHEIGT  354

Query  886   HK-IWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
              + I  G         +K  A  +    MK WR++Q  EG++      L D+  G EV +
Sbjct  355   ERGIETGFDAPQSYFGVKVSATDSNSMSMKPWRFEQSAEGSSGTMSWFLHDSMDGREVFS  414

Query  1063  WKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
              +P         V   +   RY  A R FTK+G +V A +E G G+ WRL KE+ G +  
Sbjct  415   SRPSKMTLIQPKVWFRD---RYCNAYRPFTKQGGVVFARDEYGEGIAWRLRKEVKGMLTN  471

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIPT*SLCQ  1374
             W I G V++TYWPN   T + ET+ VE+ + V L L+   S C+
Sbjct  472   WEIKGSVYVTYWPNKYRTFFCETKFVEFQEIVQLGLVEK-SFCE  514



>ref|XP_003545215.1| PREDICTED: uncharacterized protein LOC100809574 [Glycine max]
Length=502

 Score =   165 bits (417),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 134/453 (30%), Positives = 215/453 (47%), Gaps = 46/453 (10%)
 Frame = +1

Query  25    LSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFN  204
             L+ D+    L++  ++E++      H S  P  +  KL  D VS          F   FN
Sbjct  84    LNDDETLSNLLVNFIEEILHYGSNKH-SIIPYIKFPKL--DSVS---------NFKDIFN  131

Query  205   LVLLSRLFWLCACDAPSE--AGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             L  ++ LF +C  +APS+  +G L   S L   L    S+ A   L      +G+++E  
Sbjct  132   LAFVTLLFLVCIYEAPSDLRSGCL---STLKEQLAGCQSRQASKFLMKL---LGSNLEEQ  185

Query  379   FMRTFGYMLAKWLI-LREVGGVGLQSL-TPQYLGISYSTEAYGLWILKGYAPVRAMKCTL  552
             +MR+    +  W++ ++E       +  TP  L  SY+   +GLW ++ Y PV  M    
Sbjct  186   WMRSVNLAITNWIVEIQEAHHTDHTTFRTPSPL-FSYAFSTFGLWKVQLYCPVINMDVV-  243

Query  553   HRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARL  732
                  N  P  E     L+++L + QLE V+QF Y V   + ++++   +DNIR  V +L
Sbjct  244   ---NANNHPADER----LQFSLKYQQLEGVLQFNYKVTIRERWVEIVVNIDNIRCDVFKL  296

Query  733   --GFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGS  906
                    +  A   EKHFPSRI + + P +    V  +S+G+S+ N   E    K  + S
Sbjct  297   VNDILMRERGAGAAEKHFPSRISLQLTPTIQQQ-VLTVSVGKSSENPRIEFGVEKGIEAS  355

Query  907   FGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGD  1083
             F   +    +   A  +T   +K W+++Q   G +   +  L D+  G EV + KP    
Sbjct  356   FEPPNPYIGLSVSAGESTTVSLKPWKFEQSVHGYSANLNWFLHDSTDGKEVFSTKP----  411

Query  1084  DGPTAVVMNN----LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
                + V + N       RY  A R FT++G ++ AG+E G  V W++ K  VG  ++W I
Sbjct  412   ---SKVALFNPKSWFKDRYSSAYRPFTRQGGVIFAGDEYGESVCWKVDKGAVGKTMEWEI  468

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              G +W+TYWPN   T Y+ETR  E+ + V L +
Sbjct  469   RGWIWITYWPNKHKTFYHETRRFEFRETVYLKI  501



>gb|KHN25988.1| hypothetical protein glysoja_050267 [Glycine soja]
Length=487

 Score =   165 bits (417),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 120/397 (30%), Positives = 191/397 (48%), Gaps = 22/397 (6%)
 Frame = +1

Query  163   LDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRT  342
             LDS +   FS  FNL   + LF +C  +AP+        S L  +L  F S+ A      
Sbjct  107   LDSITSNNFSDVFNLSFFTLLFLVCIYEAPAADFRSGCISNLKDHLTGFQSRQAS---HK  163

Query  343   FFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGY  522
                 +G+++E  +MR+    +  W+   E      ++  P +   SY+    GLW ++ Y
Sbjct  164   IMKLLGSNLEEHWMRSLNLAVTNWVGELEAHNNPFRTPCPLF---SYAFSTIGLWKVQLY  220

Query  523   APVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARL  702
              P+  M   +   + NP          L+++L +H +E V+QF + V   + + ++   +
Sbjct  221   CPLLVMD--VENSKSNP------ASERLQFSLRYHHVEGVLQFNHKVLIKEEWAEIMVDI  272

Query  703   DNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKE  876
             DNIR  V +L      SQ      EKHFPSRI + + P +    V  LS+G+S+ N  KE
Sbjct  273   DNIRCDVIKLVNESLMSQRGVGAAEKHFPSRISLQLTPTL-QDQVLSLSVGKSSENPRKE  331

Query  877   VETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
             +   K  + SF  S    +K  A  ++   +K W++++   G +   +  L D+  G EV
Sbjct  332   IGVDKSVEASFEPSNPLALKVSAGESSTVSLKPWKFEESVYGYSANLNWFLHDSVDGKEV  391

Query  1057  ATWKPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS  1233
              + KP       P +   N    RY  A R F K+G ++ AG+E G  V W++ K  +G 
Sbjct  392   FSSKPSKFAMLNPKSWFKN----RYSSAYRPFNKEGGVIFAGDEYGEKVWWKVDKGAIGK  447

Query  1234  VLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
              ++W I G +WLTYWPN   T Y ETR +E+ + V L
Sbjct  448   TMEWEIRGWIWLTYWPNKRVTFYNETRRLEFREIVHL  484



>gb|KHG20135.1| WD repeat-containing 63 [Gossypium arboreum]
Length=498

 Score =   164 bits (416),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 188/384 (49%), Gaps = 22/384 (6%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   FNL  L+    +C  +AP++  +   +S+        +S  + V  ++    +G++
Sbjct  124   FKDIFNLAFLTLALLICIYEAPADLRSACLNSLK----NQLTSCQSRVASKSLMKLLGSN  179

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MR+    +  W+   +    GL   TP  L  SY+   +G W ++ Y PV AM  
Sbjct  180   LEEQWMRSLNLAITNWIAEIQATQRGLVMKTPSPL-FSYAIATFGFWKVQLYCPVMAMDL  238

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                    NP       +  L ++L +HQLE VIQF Y V   + ++ V   +DNIR  + 
Sbjct  239   V---NSSNP-----CADERLLFSLNYHQLEGVIQFNYKVIVQEKWVDVMVNIDNIRCDIK  290

Query  727   RLGFNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             RL      ++  V  D+KHFPSRI + + P +  + V  +S+ +ST+N  +E+   +  +
Sbjct  291   RLVNETLLNERGVGADDKHFPSRISLQLTPTIQCN-VLSVSVSKSTDNPTREIGLERSIE  349

Query  901   GSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
              SF   +    +K  A   T   MK W+++Q  +G +      L D+  G EV + +P  
Sbjct  350   TSFDPPNTFLGLKVSAGETTTVSMKPWKFEQSVDGYSGTLHWFLHDSIDGREVVSSRPSK  409

Query  1078  GD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIG  1254
                  P A   +    RY    R FT++G ++ AG++ G  + W++ K  +G  ++W I 
Sbjct  410   LSLINPKAWFKD----RYSSVYRPFTRQGGVIFAGDDYGERIWWKVDKSAMGKTMEWEIR  465

Query  1255  GEVWLTYWPNHVNTSYYETRCVEW  1326
             G +W+TYWPN   T Y ET+ +E+
Sbjct  466   GWIWVTYWPNKHRTFYTETKRLEF  489



>ref|XP_007163587.1| hypothetical protein PHAVU_001G246900g [Phaseolus vulgaris]
 gb|ESW35581.1| hypothetical protein PHAVU_001G246900g [Phaseolus vulgaris]
Length=510

 Score =   164 bits (416),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/389 (31%), Positives = 195/389 (50%), Gaps = 25/389 (6%)
 Frame = +1

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
             S    S  FNL   + LF +C  +AP+        S L  +L  F S+ A  +L      
Sbjct  133   STPNLSDVFNLSFFTLLFLVCIYEAPAADFRSRCISNLKDHLTGFESRKASNILMKL---  189

Query  355   VGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVR  534
             +G++VE  +MR+    +  W+  +E      ++  P +   SY+  A GLW ++ Y P+ 
Sbjct  190   LGSNVEELWMRSVNLAVTNWVGEQEAHSNPFKTPCPLF---SYAFSASGLWKVQLYCPLI  246

Query  535   AMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIR  714
              M   +   + NP          L+++L +H +EAV+QF + V     ++++   +DNIR
Sbjct  247   VMD--VENSKSNP------ASERLQFSLKYHHVEAVLQFNHKVLIKKEWVEIMVDIDNIR  298

Query  715   LHVARLGFNKS---QDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
               V +L  N+S   +  A   EKHFPSRI + + P V  + V  LS+G+S+ N  KE   
Sbjct  299   CDVIKL-VNESLMKERGADAGEKHFPSRICLQLTPIV-QNQVLSLSVGKSSENPRKEFGV  356

Query  886   HKIWKGSFGDSKVP-KMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
              K  + SF  S +P  ++  A  +T   +K W++++   G +   +  L D+  G EV +
Sbjct  357   DKSVEASFEPSSIPVGLRVSAGESTTVSLKPWKFEESVYGYSANLNWFLHDSVDGKEVFS  416

Query  1063  WKPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVL  1239
              KP       P +   N    RY  A R FT++G ++ AG+E G  V W++ KE +G  +
Sbjct  417   SKPSKCAMINPKSWFKN----RYSSALRPFTRQGGVIFAGDEYGEKVWWKVDKEAIGKTI  472

Query  1240  KWRIGGEVWLTYWPNHVNTSYYETRCVEW  1326
             +  I G +WLTYWPN   T + ETR +E+
Sbjct  473   EIEIRGWIWLTYWPNKRITFHTETRRLEF  501



>ref|XP_004248565.1| PREDICTED: uncharacterized protein LOC101247075 [Solanum lycopersicum]
Length=501

 Score =   164 bits (415),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 195/399 (49%), Gaps = 33/399 (8%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   FN   L+  F +C  +AP++   L    I+A     FS   +    +     +G++
Sbjct  124   FKEIFNFSFLTLAFIICIYEAPAD---LRSTCIIALK-NQFSCSQSRQASKLLVRILGSN  179

Query  367   VELCFMRTFGYMLAKWLILREVGGV------GLQSLTPQYLGISYSTEAYGLWILKGYAP  528
              E  +MR+    +  W++  E+          +++  P +   SYS    GLW ++ Y P
Sbjct  180   TEEQWMRSVNLAITNWIL--EINSSSNHHDHAMRTPCPLF---SYSFSTQGLWKVQLYCP  234

Query  529   VRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDN  708
             V AM+      E + +  +   + +LR++L  HQLE VIQ  + V   + +I+V    DN
Sbjct  235   VIAMEV-----ETSTYSSLS--DESLRFSLNFHQLEGVIQLNHRVIVREKWIEVMVNTDN  287

Query  709   IRLHVARLGFNKS---QDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEV  879
             IR  V RL  N+S   +  A V EKHFPSRI + + P +  S V  +S+ +S++N  +E+
Sbjct  288   IRCDVVRL-VNESLMAERGAGVSEKHFPSRISLQLTPTL-QSNVLSISVNKSSDNPLREI  345

Query  880   ETHKIWKGSFGDSKVPK-MKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
                K  +  F        +K  A     T MK W+++Q   G+    +  L D+  G EV
Sbjct  346   GIEKTVEAGFDPPNTYMGLKVSAGETVVTTMKPWKFEQSVNGDGANLNWFLHDSGNGREV  405

Query  1057  ATWKPDNGD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS  1233
              + KP       P A   N    RY   NR FTK+G ++ AG+E G  V W++ K  +G 
Sbjct  406   FSSKPSVFSLIQPKAWFKN----RYSSVNRPFTKQGGVIFAGDEYGESVCWKVDKRAIGK  461

Query  1234  VLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              ++W + G +WLTYWPN   T Y ETR +E+ + + L L
Sbjct  462   TMEWELKGRLWLTYWPNKHITPYAETRRLEFREVLHLKL  500



>ref|XP_008374374.1| PREDICTED: uncharacterized protein LOC103437659 [Malus domestica]
Length=496

 Score =   163 bits (413),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 200/402 (50%), Gaps = 25/402 (6%)
 Frame = +1

Query  160   MLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLR  339
              L   S   F   FNL  ++ +F +C  +AP+   + + +++       +S + +  +++
Sbjct  114   FLKFDSIANFGDVFNLAFVTLVFLVCIYEAPAGLRSGWLNTLKNYLANCWSRQSSKTLMK  173

Query  340   TFFVTVGTDVELCFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILK  516
                  +G+++E  +MR+    +  W++ L+   G  +++ +P +   SY   A+GLW ++
Sbjct  174   L----LGSNLEEEWMRSINLAITNWILELQATQGTLMKTPSPLF---SYGFSAFGLWKVQ  226

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              Y P+ AM                + +  L+++L  HQLE V+QF Y V   + +I V  
Sbjct  227   LYCPLIAMDIAKSSNJ--------SVDERLQFSLNFHQLEGVLQFNYNVMVQERWIDVML  278

Query  697   RLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
              +DNIR  V  L   +  ++  A V EKHFPSRI + V P    + V  +S+G+S+ N  
Sbjct  279   NIDNIRCDVISLVNERLMNEQGAGVSEKHFPSRISLQVTPTTQTN-VLSVSVGKSSENPA  337

Query  871   KEVETHKIWKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTG  1047
              E+   K  +GSF   +    +K  A       +K W++++   G +   +  L D+  G
Sbjct  338   IEIGKEKGIEGSFEPPNPYLALKVSASETITMSLKPWKFEESVYGYSANLNWFLHDSVDG  397

Query  1048  IEVATWKPDNGD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEM  1224
              EV + KP       P A   +    RY  A R FT++G +V AG+E G GV W++ K  
Sbjct  398   REVFSSKPSKFQLINPKAWFKD----RYSSAYRPFTRQGGVVFAGDEYGEGVIWKVDKAA  453

Query  1225  VGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +G  + W + G +WLTYWPN   T Y ETR +E+ + + L +
Sbjct  454   MGRTMDWEVRGWIWLTYWPNKHKTFYTETRRLEFREILTLTI  495



>ref|XP_004500524.1| PREDICTED: uncharacterized protein LOC101511037 [Cicer arietinum]
Length=494

 Score =   163 bits (413),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 124/397 (31%), Positives = 201/397 (51%), Gaps = 31/397 (8%)
 Frame = +1

Query  184   TFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGT  363
               S+ FNL   + L  +C  +AP    A    SIL  +L  F S+ A  +L      +G+
Sbjct  122   NLSNIFNLTFFTLLLLICIYEAPKNIRATCI-SILKDHLTGFQSRQASNLLMKI---LGS  177

Query  364   DVELCFMRTFGYMLAKWLILREVGGV--GLQSL--TPQYLGISYSTEAYGLWILKGYAPV  531
             +++  +MR+    +  W     VG     +Q++  TP  L  SY+   YGLW ++ Y P 
Sbjct  178   NLQEQWMRSVNLGITNW-----VGEARDQIQNIFATPCSL-FSYAFSTYGLWKVQLYCPA  231

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
               M   + + + NP          L+++L +HQ+E V+QF Y V   + ++++   +DNI
Sbjct  232   LCMD--VEKSKSNP-------PERLQFSLKYHQVEGVLQFNYKVVIEEKWLEIMVNVDNI  282

Query  712   RLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             R  V +L  +    +  A V EKHFPSRI + + P +    V  LS+G+S+ N +KE+  
Sbjct  283   RCDVTKLVNDSLVKERGAGVGEKHFPSRISLQLTPTLQNQVVS-LSVGKSSENPQKEIGI  341

Query  886   HKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
              K  + SF       +K  +  +T   +K W+++Q   G +  ++  L D+  G EV + 
Sbjct  342   DKGIEASFNPPNPLGLKVSSSESTTVSLKPWKFEQSVYGYSANFNWFLHDSMDGKEVFSS  401

Query  1066  KPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
             KP       P +   N    RY  A R FT++G ++ AG+E G  V W++ K  +G  ++
Sbjct  402   KPSKCALINPKSWFKN----RYSSAYRPFTRQGGVIFAGDEYGERVMWKVDKGAIGKTME  457

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             W I G +WLTYWPN   T Y ETR +E+ + V L ++
Sbjct  458   WEIRGWIWLTYWPNKRVTLYNETRRLEFHEIVHLDVV  494



>ref|XP_010444349.1| PREDICTED: uncharacterized protein LOC104727051 [Camelina sativa]
Length=503

 Score =   163 bits (413),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 122/398 (31%), Positives = 197/398 (49%), Gaps = 44/398 (11%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFH----SILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             FN V+L+  F +C  +AP     LY      + L  +L     + A + L      +G++
Sbjct  135   FNAVILTLSFVVCVYEAP-----LYLRENCLNTLKNHLVTCHVRQAVISLMKL---LGSN  186

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MRT       W+I +        + TP +   SY+  AYGLW ++ Y PV AM+ 
Sbjct  187   LEEQWMRTVNLAFTNWIIEQRRSQSTKNTTTPLF---SYAVSAYGLWKVQLYCPVEAMEI  243

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                  ER+  P+ +++   L ++L  +QLE V+QF + V   D +I V  ++DNIR  V 
Sbjct  244   -----ERSSNPMADSR---LLFSLKFNQLEGVMQFNHKVIVRDKWIDVIVKIDNIRYDVI  295

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             +L   K  S+  A   EKHFPSRI + + P +   ++       S N   +E E  +  +
Sbjct  296   KLVNEKLMSRRGAGEHEKHFPSRISLQLTPTLQTDFISVSVSKSSNNP-GREFEVERSIE  354

Query  901   GSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVATW  1065
             GSF       ++   R A+   M  W+++Q   G     N ++YD+++     G EV + 
Sbjct  355   GSFDPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSVG----GREVFST  410

Query  1066  KPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
             KP          +M+       RY  A R FT++G ++ AG+E G  V W++ K  +G  
Sbjct  411   KPSRFS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGETVVWKIGKGALGRR  464

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             ++W I G +WLTYWPN   T Y+ETR +E+   ++L +
Sbjct  465   MEWEIKGFIWLTYWPNKYKTFYHETRRLEFTQLLNLTI  502



>ref|XP_010257014.1| PREDICTED: uncharacterized protein LOC104597257 [Nelumbo nucifera]
Length=496

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/384 (30%), Positives = 190/384 (49%), Gaps = 24/384 (6%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   FNL  LS  F +C  +AP +  +   +S L  NL    S  A  +L      +G +
Sbjct  124   FKDIFNLAFLSLTFLICIYEAPGDLRSGCLNS-LRNNLSSSQSNEASKLLMRL---LGPN  179

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MR+    +  W+I  +     L++ +P +   SY+    GLW ++ Y PV AM  
Sbjct  180   LEEQWMRSLNLAITNWIIELKEPRHTLRTPSPLF---SYAISTVGLWKVQLYCPVVAMMK  236

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
               +    +        +  L+++L +HQLE VIQF Y V   + ++ V   +DNIR  V 
Sbjct  237   VENSSSNS--------DERLQFSLKYHQLEGVIQFGYKVIAREKWVDVMVSVDNIRCDVI  288

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             +L      ++  A   EK+FPSR+ + + P     +V  +++ +S++N  +E+   K  +
Sbjct  289   QLVPETLMAERGAGAAEKYFPSRVSLQLTPTF-QPHVLSVTVSKSSDNPTREIGLEKTIE  347

Query  901   GSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
               F   +    +K  A       +K W+++Q   G++   +  L  +  G EV++ KP  
Sbjct  348   AGFDPPNSYLGLKVSAAETVTLSLKPWKFEQSVHGSSANLNWFLHGSIDGREVSSKKPSL  407

Query  1078  GD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIG  1254
              +   P A   +    RY  ANR FT++G +V AG+E G  V W+L +  +G  L+W I 
Sbjct  408   LELVQPRAWFKD----RYSNANRPFTRQGGVVFAGDEYGESVRWKLDRRAIGKTLEWEIK  463

Query  1255  GEVWLTYWPNHVNTSYYETRCVEW  1326
             G +WLTYWPN   T Y ETR +E+
Sbjct  464   GSIWLTYWPNKYRTFYSETRKLEF  487



>emb|CDM81492.1| unnamed protein product [Triticum aestivum]
Length=508

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/392 (30%), Positives = 190/392 (48%), Gaps = 22/392 (6%)
 Frame = +1

Query  184   TFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGT  363
             +FS+ FN+V LS  F +C  +AP +       S+        +S       +T    +GT
Sbjct  132   SFSNAFNIVFLSLAFLVCIYEAPRDLRRGCLDSLRT----QLTSPKCRGAAKTLVKMLGT  187

Query  364   DVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMK  543
             ++E  +M+T    +  W++         ++ +P +   SY+ +A GLW ++ Y PV AM 
Sbjct  188   NLEDQWMQTMNLAVTNWMVEMRSSHHAPRAASPLF---SYALQASGLWKVQLYCPVIAM-  243

Query  544   CTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHV  723
                  G  +P     A++  L ++L + QLE V+Q  Y     D +I +  ++DNIR  V
Sbjct  244   -----GMEDP-AAAAAQDERLLFSLTYQQLEGVVQLAYKTVRRDNWIDIEVKVDNIRCDV  297

Query  724   ARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIW  897
               L      ++     +EKHFPSR+ + + P +  + V  +S+ +S++N   E    K +
Sbjct  298   DPLVSETLMAERGYGSEEKHFPSRVMLQITP-MQQTDVLSVSVSKSSDNPTHEFGIEKGF  356

Query  898   KGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
             +GSF       +KA    +    MK W+++Q   GN    +  L D   G EV   KP  
Sbjct  357   EGSFDPPNSFGLKASVAESLTLAMKPWKFEQSVHGNTATLNWFLHDGMNGREVCASKPSK  416

Query  1078  GDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIG  1254
                  P A   +    RY  A R FTK+G ++ A +E G  V W++    +G  + W I 
Sbjct  417   LSLLQPRAWFRD----RYSNAYRPFTKQGGIIFARDEYGDSVNWKVCGAALGKTMDWEIR  472

Query  1255  GEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             G +WLTYWPN   TS+ ETR +E+ + + LPL
Sbjct  473   GWIWLTYWPNKQRTSHSETRWLEFRECLQLPL  504



>ref|XP_006394187.1| hypothetical protein EUTSA_v10005630mg [Eutrema salsugineum]
 gb|ESQ31473.1| hypothetical protein EUTSA_v10005630mg [Eutrema salsugineum]
Length=502

 Score =   162 bits (410),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 127/446 (28%), Positives = 214/446 (48%), Gaps = 51/446 (11%)
 Frame = +1

Query  55    VLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFNLVLLSRLFWL  234
             ++ LL   +    T   ++C  S ++   PD  S M++          FN V+L+  F +
Sbjct  93    IISLLFSFVESILTYTSNSCNYSTIKIPKPD--SEMING-----LKEIFNTVILTLSFVV  145

Query  235   CACDAPSEAGALYFH----SILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYM  402
             C  +AP     LY      + L  +L    ++ A + L      +G+++E  +MR+    
Sbjct  146   CVYEAP-----LYLRENCLNTLKNHLVTSRARQATITLMKL---LGSNLEEQWMRSVNLA  197

Query  403   LAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNPFPV  582
             +  W++          + T  +   SYS  AYGLW ++ Y P+ AM+      ER+  P+
Sbjct  198   ITNWMVEHRRCRSPKTTTTTLF---SYSVSAYGLWKVQLYCPIEAMEV-----ERSSNPM  249

Query  583   IEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNK--SQDD  756
              +++   L ++L  +QLE V+QF + V   D +I V  ++DNIR  V +L   +  S+  
Sbjct  250   ADSR---LLFSLKFNQLEGVMQFNHRVVVRDKWIDVIVKIDNIRYDVIKLVNERLMSRKG  306

Query  757   AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGDSKVPKMK  936
             A   EKHFPSRI + + P +   ++       S N   +E E  +  +GSF       ++
Sbjct  307   AGEHEKHFPSRISLQLTPTLQTDFISVSVSKSSNNP-GREFEVERSIEGSFDPPNSLGLR  365

Query  937   AVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVATWKPDNGDDGPTAV  1101
                R A+   M  W+++Q   G     N ++YD+++     G EV + KP          
Sbjct  366   VAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSVG----GREVFSTKPSRFS------  415

Query  1102  VMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLT  1272
             +M+       RY  A R FT++G ++ AG+E G  V W++ K  +G  ++W I G +WLT
Sbjct  416   IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGESVVWKIGKGAMGKRMEWEIKGSIWLT  475

Query  1273  YWPNHVNTSYYETRCVEWCDEVDLPL  1350
             YWPN   T Y+ETR +E+   + L +
Sbjct  476   YWPNKYKTFYHETRRLEFTQLLHLTI  501



>ref|XP_010461490.1| PREDICTED: uncharacterized protein LOC104742215 [Camelina sativa]
Length=503

 Score =   162 bits (410),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 197/398 (49%), Gaps = 44/398 (11%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFH----SILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             FN V+L+  F +C  +AP     LY      + L  +L     + A + L      +G++
Sbjct  135   FNAVILTLSFVVCVYEAP-----LYLRENCLNTLKNHLVTCHVRQAVISLMKL---LGSN  186

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MRT       W+I +        + +P +   SY+  AYGLW ++ Y PV AM+ 
Sbjct  187   LEEQWMRTVNLAFTNWIIEQRRSQSTKNTTSPLF---SYAVSAYGLWKVQLYCPVEAMEV  243

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                  ER+  P+ +++   L ++L  +QLE V+QF + V   D +I V  ++DNIR  V 
Sbjct  244   -----ERSSNPMADSR---LLFSLKFNQLEGVMQFNHKVIVRDKWIDVIVKIDNIRYDVI  295

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             +L   K  S+  A   EKHFPSRI + + P +   ++       S N   +E E  +  +
Sbjct  296   KLVNEKLMSRRGAGEHEKHFPSRISLQLTPTLQTDFISVSVSKSSNNP-GREFEVERSIE  354

Query  901   GSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVATW  1065
             GSF       ++   R A+   M  W+++Q   G     N ++YD+++     G EV + 
Sbjct  355   GSFDPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSVG----GREVFST  410

Query  1066  KPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
             KP          +M+       RY  A R FT++G ++ AG+E G  V W++ K  +G  
Sbjct  411   KPSRFS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGETVVWKIGKGALGRK  464

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             ++W I G +WLTYWPN   T Y+ETR +E+   ++L +
Sbjct  465   MEWEIKGFIWLTYWPNKYKTFYHETRRLEFTQLLNLTI  502



>ref|NP_201224.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09850.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97852.1| uncharacterized protein AT5G64190 [Arabidopsis thaliana]
Length=502

 Score =   162 bits (409),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 195/397 (49%), Gaps = 44/397 (11%)
 Frame = +1

Query  202   NLVLLSRLFWLCACDAPSEAGALYFH----SILAPNLEMFSSKPAPVVLRTFFVTVGTDV  369
             N V+L+  F +C  +AP     LY      + L  +L    ++ A + L      +G+++
Sbjct  135   NTVILTLSFVVCVYEAP-----LYLRENCLNTLKNHLITCHTRRATISLMKL---LGSNL  186

Query  370   ELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCT  549
             E  +MRT       W+I +        + TP +   SY+  AYGLW ++ Y PV AM+  
Sbjct  187   EEQWMRTVNLAFTNWIIEQRRSQSTKITTTPLF---SYAVSAYGLWKVQLYCPVEAMEV-  242

Query  550   LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVAR  729
                 ER+  P  +++   L ++L  +QLE V+QF + V   D +I V  ++DNIR  V +
Sbjct  243   ----ERSSNPTADSR---LLFSLKFNQLEGVMQFNHKVVVRDNWIDVIVKIDNIRYDVIK  295

Query  730   LGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKG  903
             L   K  S+  A   EKHFPSRI + + P +   ++       S N   +E E  +  +G
Sbjct  296   LVNEKLMSRRGAGEHEKHFPSRISLQLTPTLQTDFISVSVSKSSNNP-GREFEVERSIEG  354

Query  904   SFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVATWK  1068
             SF       ++   R A+   M  W+ +Q   G     N ++YD+++     G EV + K
Sbjct  355   SFDPPNSLGLRVAGREASTMTMTPWKLEQSVLGYTANLNWILYDSSVG----GREVFSTK  410

Query  1069  PDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVL  1239
             P          +M+       RY  A R FT++G ++ AG+E G  V W++ K  +G  +
Sbjct  411   PSRFS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGESVVWKIGKGALGGTM  464

Query  1240  KWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +W I G +WLTYWPN   T Y+ETR +E+   ++L +
Sbjct  465   EWEIKGFIWLTYWPNKYKTFYHETRRLEFTQLLNLTI  501



>ref|XP_007008846.1| Neuronal PAS domain-containing protein 4 [Theobroma cacao]
 gb|EOY17656.1| Neuronal PAS domain-containing protein 4 [Theobroma cacao]
Length=498

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 112/382 (29%), Positives = 188/382 (49%), Gaps = 24/382 (6%)
 Frame = +1

Query  196   FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVEL  375
              FNL  L+  F +C  +AP +  +   ++ L   L     + A    ++    +G+++E 
Sbjct  127   IFNLSFLTLAFLICIYEAPVDLRSACLNT-LKHQLACSQLREAS---KSLMRLLGSNLEE  182

Query  376   CFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTL  552
              +MR+    +  W++ L+      +++ +P +   SY+   +GLW ++ Y PV AM    
Sbjct  183   QWMRSINLAITNWIVELQATHRTLMKTPSPLF---SYAISTFGLWKVQLYCPVIAMDIES  239

Query  553   HRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARL  732
                           +  L ++L +HQLE VIQ  Y V   + +I V   +DNIR ++ RL
Sbjct  240   SSNA-------SVDDQRLLFSLHYHQLEGVIQVNYKVIVQEKWIDVMLNIDNIRCNIIRL  292

Query  733   GFNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGS  906
                   ++  V  D+KHFPSR+ + + P +  S +  +S+ +ST N  +E+E  K  + S
Sbjct  293   VNETLMNERGVGADDKHFPSRVSLQITPTL-QSNILSVSVSKSTENPAREIEIEKSIETS  351

Query  907   FGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-G  1080
             F   +    +K      T   MK W+++Q   G +   +  L D+  G EV + KP    
Sbjct  352   FDPPNSFLGLKVSVGETTTMSMKPWKFEQSVNGYSGTLNWFLHDSVDGREVVSSKPSKLA  411

Query  1081  DDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGE  1260
                P A   +    RY   +R FT++G ++ AG+E G  V W++ K  +G  ++W I G 
Sbjct  412   LINPKAWFKD----RYSNVHRPFTRQGGVIFAGDEYGEKVWWKVDKSAMGKTMEWEIRGW  467

Query  1261  VWLTYWPNHVNTSYYETRCVEW  1326
             +WLTYWPN   T Y ETR +E+
Sbjct  468   IWLTYWPNKHRTFYNETRRLEF  489



>gb|EMT23899.1| hypothetical protein F775_12028 [Aegilops tauschii]
Length=508

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 117/392 (30%), Positives = 189/392 (48%), Gaps = 22/392 (6%)
 Frame = +1

Query  184   TFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGT  363
             +FS  FN+V LS  F +C  +AP +      H  L       +        +T    +G 
Sbjct  132   SFSDGFNIVFLSLAFLVCIYEAPRDLR----HGCLDSLRTQLTGPKCRGAAKTLVKMLGA  187

Query  364   DVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMK  543
             ++E  +M+T    +  W++         ++ +P++   SY+ +A GLW ++ Y PV AM 
Sbjct  188   NLEDQWMQTMNLAVTNWMVELRSSHHTPRAASPRF---SYALQASGLWKVQLYCPVIAM-  243

Query  544   CTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHV  723
                  G  +P   + A++  L ++L + QLE V+Q  Y     D +I +  ++DNIR  V
Sbjct  244   -----GMEDPAAAV-AQDERLLFSLTYQQLEGVVQLAYKTVRRDNWIDIEVKVDNIRCDV  297

Query  724   ARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIW  897
               L      ++     +EKHFPSR+ + + P +  + V  +S+ +S++N   E    K +
Sbjct  298   DPLVSETLMAERGYGSEEKHFPSRVMLQITP-MQQTDVLSVSVSKSSDNPTHEFGIEKGF  356

Query  898   KGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
             +GSF       +KA    +    MK W+++Q   GN    +  L D   G EV   KP  
Sbjct  357   EGSFDPPHSFGLKASVAESLTLAMKPWKFEQSVHGNTATLNWFLHDGMNGREVCASKPSK  416

Query  1078  -GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIG  1254
                  P A   +    RY  A R FTK+G ++ A +E G  V W++    +G  + W I 
Sbjct  417   LSLLQPRAWFRD----RYSNAYRPFTKQGGIIFARDEYGDSVNWKVCGAALGKTMDWEIR  472

Query  1255  GEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             G +WLTYWPN   TS+ ETR +E+ + + LPL
Sbjct  473   GWIWLTYWPNKQRTSHSETRWLEFRECLQLPL  504



>emb|CDY43798.1| BnaA06g23340D [Brassica napus]
Length=502

 Score =   161 bits (407),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 119/390 (31%), Positives = 191/390 (49%), Gaps = 44/390 (11%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHS----ILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             FN V+L+  F +C  +AP     LY        L  +L    ++ A   L      +G++
Sbjct  134   FNTVILTLSFLVCVYEAP-----LYLRENCLITLRNHLVTCHARQATTSLMKL---LGSN  185

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MR+    +  W+I R+       + TP +   SY+   YGLW ++ Y P+ AM+ 
Sbjct  186   LEEQWMRSVNLAITNWIIERKDNRSNTTTTTPLF---SYAFSTYGLWKVQLYCPIEAMEV  242

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                  ER+  P     +S L ++L  +QLE V+QF + V   D +I V  ++DNIR  V 
Sbjct  243   -----ERSSNP---RADSRLLFSLKFNQLEGVMQFNHKVVVRDKWIDVIVKIDNIRYDVI  294

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             +L   +  S+  A   EKHFPSRI + + P +   ++       S N   +E E  +  +
Sbjct  295   KLVNERLMSRKGAGEHEKHFPSRISLQITPTLQTDFISVSVSKSSNNP-GREFEVERSIE  353

Query  901   GSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVATW  1065
             GSF       ++   R A+   M  W+++Q   G     N ++YD+++     G EV T 
Sbjct  354   GSFDPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSVG----GREVFTT  409

Query  1066  KPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
             KP          +M+       RY  A R FT++G ++ AG+E G  V W++ K  +G  
Sbjct  410   KPSRFS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGESVVWKIGKGAMGRR  463

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEW  1326
             ++W I G +WLTYWPN   T Y+ETR +++
Sbjct  464   MEWEIKGSIWLTYWPNKYKTFYHETRRLDF  493



>ref|XP_009150495.1| PREDICTED: uncharacterized protein LOC103873840 [Brassica rapa]
Length=503

 Score =   161 bits (407),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 119/390 (31%), Positives = 191/390 (49%), Gaps = 44/390 (11%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHS----ILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             FN V+L+  F +C  +AP     LY        L  +L    ++ A   L      +G++
Sbjct  135   FNTVILTLSFLVCVYEAP-----LYLRENCLITLRNHLVTCHARQATTSLMKL---LGSN  186

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MR+    +  W+I R+       + TP +   SY+   YGLW ++ Y P+ AM+ 
Sbjct  187   LEEQWMRSVNLAITNWIIERKDNRSNTTTTTPLF---SYAFSTYGLWKVQLYCPIEAMEV  243

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                  ER+  P     +S L ++L  +QLE V+QF + V   D +I V  ++DNIR  V 
Sbjct  244   -----ERSSNP---RADSRLLFSLKFNQLEGVMQFNHKVVVRDKWIDVIVKIDNIRYDVI  295

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             +L   +  S+  A   EKHFPSRI + + P +   ++       S N   +E E  +  +
Sbjct  296   KLVNERLMSRKGAGEHEKHFPSRISLQITPTLQTDFISVSVSKSSNNP-GREFEVERSIE  354

Query  901   GSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVATW  1065
             GSF       ++   R A+   M  W+++Q   G     N ++YD+++     G EV T 
Sbjct  355   GSFDPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSVG----GREVFTT  410

Query  1066  KPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
             KP          +M+       RY  A R FT++G ++ AG+E G  V W++ K  +G  
Sbjct  411   KPSRFS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGESVVWKIGKGAMGRR  464

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEW  1326
             ++W I G +WLTYWPN   T Y+ETR +++
Sbjct  465   MEWEIKGSIWLTYWPNKYKTFYHETRRLDF  494



>ref|XP_006281974.1| hypothetical protein CARUB_v10028198mg [Capsella rubella]
 gb|EOA14872.1| hypothetical protein CARUB_v10028198mg [Capsella rubella]
Length=502

 Score =   161 bits (407),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 123/408 (30%), Positives = 198/408 (49%), Gaps = 44/408 (11%)
 Frame = +1

Query  169   SHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFH----SILAPNLEMFSSKPAPVVL  336
             S   +  +  FN V+L+  F +C  +AP     LY      + L  +L     + A + L
Sbjct  124   SSKIDCLNDIFNAVILTLSFVVCVYEAP-----LYLRENCLNTLKNHLVTCQVRQAIISL  178

Query  337   RTFFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILK  516
                   +G+++E  +MRT       W+I +        + TP +   SY+  AY LW ++
Sbjct  179   MKL---LGSNLEEQWMRTVNLAFTNWIIEQRRCQSTKTTTTPLF---SYAVSAYELWKVQ  232

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              Y PV AM+      ER+  P  ++K   L ++L  +QLE V+QF + V   D +I V  
Sbjct  233   LYCPVEAMEV-----ERSSNPTADSK---LSFSLKFNQLEGVMQFNHKVVVRDRWIDVIV  284

Query  697   RLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
             ++DNIR  V +L   K  S+  A   EKHFPSRI + + P +   ++       S N   
Sbjct  285   KIDNIRYDVIKLVNEKLMSRRGAGEHEKHFPSRISLQLTPTLQTDFISVSVSKSSNNP-G  343

Query  871   KEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCD  1035
             +E E  +  +GSF       ++   R A+   M  W+++Q   G     N ++YD+++  
Sbjct  344   REFEVERSIEGSFDPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSV--  401

Query  1036  NQTGIEVATWKPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGW  1206
                G EV + KP          +M+       RY  A R FT++G ++ AG+E G  V W
Sbjct  402   --GGREVFSTKPSRFS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGESVVW  453

Query  1207  RLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             ++ K  +G  ++W I G +WLTYWPN   T Y+ETR +E+   ++L +
Sbjct  454   KIGKGALGRKIEWEIKGCIWLTYWPNKYKTFYHETRRLEFTQLLNLTI  501



>gb|KGN50707.1| hypothetical protein Csa_5G218240 [Cucumis sativus]
Length=498

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/381 (29%), Positives = 186/381 (49%), Gaps = 23/381 (6%)
 Frame = +1

Query  196   FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVEL  375
              FNL  L+ +F +C  +AP+        ++       +S + + V    F   +G+++E 
Sbjct  128   IFNLAFLTLIFLICIYEAPTSLRLDGLTTVKYHLANCWSRQTSKV----FMKLLGSNLEE  183

Query  376   CFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
              +MR+    +  W++  +     L++ +P +   SYS   +GLW ++ Y PV AM     
Sbjct  184   QWMRSINLAITNWILELKANCCTLKTPSPLF---SYSYSTHGLWKVQLYCPVIAMD----  236

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
               E +  P  + +   L+++L +HQLE V+QF Y     + +I +   +DNIR  V +L 
Sbjct  237   HIENSSSPSTDER---LQFSLNYHQLEGVLQFNYKAEVHEKWINLRVHVDNIRCGVIQLV  293

Query  736   FNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
              +   S+      EKHFPS+I + + P +  + +      +S+ N   EV T K  +  F
Sbjct  294   NDTLMSKRGVGRSEKHFPSKISLQITPTIQTNIISVSV-SKSSGNPRIEVGTEKTLEAGF  352

Query  910   -GDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-GD  1083
              G +  P +K          ++ W+++Q   GN  + +  L D+  G EVA  KP     
Sbjct  353   EGQNPYPCIKLAVGETATASLRPWKFEQMVHGNTGILNWYLHDSSDGKEVALRKPSRFAL  412

Query  1084  DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEV  1263
               P A   +    RY  A R F K+G ++ AG+E G G+ W++ +E  G  + W I G +
Sbjct  413   INPRAWFRD----RYTSAFRPFNKQGGVIFAGDEYGDGICWKIEREGRGKTMDWEIRGWI  468

Query  1264  WLTYWPNHVNTSYYETRCVEW  1326
             WLTYWPN   T Y ETR +E+
Sbjct  469   WLTYWPNKHKTFYTETRRLEF  489



>ref|XP_003518418.1| PREDICTED: uncharacterized protein LOC100782905 [Glycine max]
Length=501

 Score =   160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 215/453 (47%), Gaps = 47/453 (10%)
 Frame = +1

Query  25    LSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFN  204
             L+ D+    L++  ++E++      H  + P  +  KL  D VS          F   FN
Sbjct  84    LTDDETLSNLLVNFIEEILHYGTNKH--SIPYIKFPKL--DSVS---------NFQDIFN  130

Query  205   LVLLSRLFWLCACDAPSE--AGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             L  L+ LF +C  +APS+  +G L   + L   L    S+ A   L      +G+++E  
Sbjct  131   LAFLTLLFLVCIYEAPSDLRSGCL---NTLKEQLAGCQSRQASKFLMKL---LGSNLEEQ  184

Query  379   FMRTFGYMLAKWLI-LREVGGVGLQSL-TPQYLGISYSTEAYGLWILKGYAPVRAMKCTL  552
             +MR+    +  W++ +++       ++ TP  L  SY+   +GLW ++ Y PV  M    
Sbjct  185   WMRSVNLAITNWIVEIQQAHHTDHTTIRTPSPL-FSYAFSTFGLWKVQLYCPVINMDVV-  242

Query  553   HRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARL  732
                  N  P  E  E +L+Y     QLE V+QF Y V   + ++++   +DNIR  V +L
Sbjct  243   ---NANNHPADERLEFSLKY----QQLEGVLQFNYKVIIRERWVEIVVNIDNIRCDVLKL  295

Query  733   --GFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGS  906
                    +  A   EKHFPSRI + + P +    V  +S+G+S+ N   E    K  + S
Sbjct  296   VNDILMRERGAGAAEKHFPSRISLQLTPTLQHQ-VLTVSVGKSSENPRIEFGVEKGIEAS  354

Query  907   FGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGD  1083
             F   +    +   A  +T   +K W+++Q   G +   +  L D+  G EV + KP    
Sbjct  355   FEPPNPYIGLSVSAGESTTVSLKPWKFEQSVHGYSANLNWFLHDSTDGKEVFSTKP----  410

Query  1084  DGPTAVVMNN----LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
                + V + N       RY  A R FT++G ++ A +E G  V W++ K  VG  ++W I
Sbjct  411   ---SKVALFNPKSWFKDRYSSAYRPFTRQGGVIFARDEYGESVCWKVDKGAVGKTMEWEI  467

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              G +WLTYWPN   T Y+ETR +E+ + V L +
Sbjct  468   RGWIWLTYWPNKHKTFYHETRRLEFRETVYLKI  500



>gb|KHN38553.1| hypothetical protein glysoja_004218 [Glycine soja]
Length=501

 Score =   160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 215/453 (47%), Gaps = 47/453 (10%)
 Frame = +1

Query  25    LSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFN  204
             L+ D+    L++  ++E++      H  + P  +  KL  D VS          F   FN
Sbjct  84    LTDDETLSNLLVNFIEEILHYGTNKH--SIPYIKFPKL--DSVS---------NFQDIFN  130

Query  205   LVLLSRLFWLCACDAPSE--AGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             L  L+ LF +C  +APS+  +G L   + L   L    S+ A   L      +G+++E  
Sbjct  131   LAFLTLLFLVCIYEAPSDLRSGCL---NTLKEQLAGCQSRQASKFLMKL---LGSNLEEQ  184

Query  379   FMRTFGYMLAKWLI-LREVGGVGLQSL-TPQYLGISYSTEAYGLWILKGYAPVRAMKCTL  552
             +MR+    +  W++ +++       ++ TP  L  SY+   +GLW ++ Y PV  M    
Sbjct  185   WMRSVNLAITNWIVEIQQAHHTDHTTIRTPSPL-FSYAFSTFGLWKVQLYCPVINMDVV-  242

Query  553   HRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARL  732
                  N  P  E  E +L+Y     QLE V+QF Y V   + ++++   +DNIR  V +L
Sbjct  243   ---NANNHPADERLEFSLKY----QQLEGVLQFNYKVIIRERWVEIVVNIDNIRCDVLKL  295

Query  733   --GFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGS  906
                    +  A   EKHFPSRI + + P +    V  +S+G+S+ N   E    K  + S
Sbjct  296   VNDILMRERGAGAAEKHFPSRISLQLTPTLQHQ-VLTVSVGKSSENPRIEFGVEKGIEAS  354

Query  907   FGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGD  1083
             F   +    +   A  +T   +K W+++Q   G +   +  L D+  G EV + KP    
Sbjct  355   FEPPNPYIGLSVSAGESTTVSLKPWKFEQSVHGYSANLNWFLHDSTDGKEVFSTKP----  410

Query  1084  DGPTAVVMNN----LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
                + V + N       RY  A R FT++G ++ A +E G  V W++ K  VG  ++W I
Sbjct  411   ---SKVALFNPKSWFKDRYSSAYRPFTRQGGVIFARDEYGESVCWKVDKGAVGKTMEWEI  467

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              G +WLTYWPN   T Y+ETR +E+ + V L +
Sbjct  468   RGWIWLTYWPNKHKTFYHETRRLEFRETVYLKI  500



>ref|XP_010692911.1| PREDICTED: uncharacterized protein LOC104905948 [Beta vulgaris 
subsp. vulgaris]
Length=522

 Score =   160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 121/449 (27%), Positives = 214/449 (48%), Gaps = 44/449 (10%)
 Frame = +1

Query  25    LSSDKPFLPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFN  204
             L ++K    L+L  +Q+V+   P+           +++ P ++    + + P      FN
Sbjct  111   LGNEKTTYNLILNFIQDVLKYGPS-----------KQIQPIKIP---NINPPSYLKDIFN  156

Query  205   LVLLSRLFWLCACDAPSEAGALYFHSILA--PNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             +  L+ +F +C  +AP++   L F+ +LA    L    S+ A  +L     +  +++E  
Sbjct  157   VSFLTLVFLVCIYEAPTD---LRFNCLLALKDGLSTSQSREASKLLMRLLGS--SNIEEQ  211

Query  379   FMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHR  558
             +MR     +  W +  +     L+  +P +   S++    GLW ++ Y P+  M+     
Sbjct  212   WMRCLNLAITNWKMELKAANRILKGPSPLF---SHAFSTSGLWKVQLYCPIITMEIENTS  268

Query  559   GERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGF  738
             G         + +  L ++L +H LE VIQ  Y     + +I+V   +DNIRL V RL  
Sbjct  269   G---------SADERLAFSLNYHHLEGVIQLNYKAIVKEKWIEVMVNIDNIRLDVIRLVS  319

Query  739   NKSQDD--AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFG  912
              K  +D  A   EKHFPSRI + + P    + +  +S+ +S+ N ++++E  K  +GSF 
Sbjct  320   EKILNDRGAGTAEKHFPSRISLQLTP-APETDILSVSVSKSSENPKRQIEIEKTVEGSFE  378

Query  913   DSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGP  1092
                   ++  A   T T  K W++++  +G++   +  L D+  G EV + KP      P
Sbjct  379   PPNKVGVQVSAGETTTTTFKPWKFEETVKGDSGGLNWFLHDSSDGREVFSSKP-----SP  433

Query  1093  TAVVMNN--LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS-VLKWRIGGEV  1263
                         RY  A R FT++G ++ AG++ G  V W++ K  +G+  L W + G +
Sbjct  434   LTFFQPKAWFRHRYSSAYRPFTRQGGIIFAGDQYGETVCWKVHKSAIGNRSLDWDLSGCI  493

Query  1264  WLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              LTYWPN   T Y ETR  ++ + + L L
Sbjct  494   GLTYWPNKYRTFYNETRRAQFTETLQLTL  522



>ref|XP_002455140.1| hypothetical protein SORBIDRAFT_03g004970 [Sorghum bicolor]
 gb|EES00260.1| hypothetical protein SORBIDRAFT_03g004970 [Sorghum bicolor]
Length=501

 Score =   159 bits (402),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 116/391 (30%), Positives = 181/391 (46%), Gaps = 23/391 (6%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   FN+V LS  F +C  +AP +       S+     ++  SK      +     +G +
Sbjct  127   FKDVFNIVFLSLAFLVCIYEAPRDLRPGCLDSL---RTQLTGSKCRDAA-KNLVKMLGAN  182

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +M+T    +  W++            +P +   SY+  A GLW ++ Y PV AM  
Sbjct  183   LEDQWMQTMNLAVTNWIVELRSANQSSGVYSPLF---SYALSASGLWKVQLYCPVIAMGM  239

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                       P    ++  L ++L + Q+E VIQ  Y     D +I V  ++DNIR  V 
Sbjct  240   EE--------PAEATQDERLLFSLIYQQVECVIQLAYRTARRDNWIDVEVKVDNIRCDVD  291

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
              L      ++     +EKHFPSR+ + + P +  S V  +S+G+S +N   E    K ++
Sbjct  292   SLVSETLMAERGYGSEEKHFPSRVMLQITP-MQQSDVLSVSVGKSNDNPTHEFGIEKGFE  350

Query  901   GSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNG  1080
             GSF       +KA    +    MK W+++Q   GN    +  L D   G EV + KP   
Sbjct  351   GSFDPPNSFGLKASVTESLTLAMKPWKFEQSVHGNTATLNWFLHDGINGREVYSSKPSKL  410

Query  1081  DD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGG  1257
                 P A   +    RY  A R FTK+G ++ A +E G  V W++    +G  + W I G
Sbjct  411   SLLQPRAWFRD----RYSNAYRPFTKQGGVIFARDEYGDSVWWKICGATLGKTMNWEIRG  466

Query  1258  EVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              +WLTYWPN   T + ETR +E+ + + LPL
Sbjct  467   WIWLTYWPNKQRTFHSETRWLEFRECLQLPL  497



>ref|XP_004491000.1| PREDICTED: uncharacterized protein LOC101506372 [Cicer arietinum]
Length=501

 Score =   159 bits (401),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 115/393 (29%), Positives = 193/393 (49%), Gaps = 24/393 (6%)
 Frame = +1

Query  184   TFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGT  363
              FS  FNL  L+  F +C  +APS+      ++ L    E  SS  +    +     +G+
Sbjct  124   NFSDIFNLAFLTLFFLVCIYEAPSDLR----YNCLNTLKEKLSSCESRKSSKLLMKLLGS  179

Query  364   DVELCFMRTFGYMLAKWLI-LREVGGVGLQSL-TPQYLGISYSTEAYGLWILKGYAPVRA  537
             ++E  +MR+    +  W++ L+E+      +  TP  L  SY+   +GLW ++ Y P+ A
Sbjct  180   NLEEQWMRSINLAITNWIVELQEIASQCRSTFRTPSPL-FSYAFLTFGLWKVQLYCPLIA  238

Query  538   MKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRL  717
             M                A +  L+++L + QLE V+QF + V   D ++++   +DNIR 
Sbjct  239   MDIVSANNH--------AADERLQFSLKYQQLEGVLQFNHKVFIKDKWVEIMVNIDNIRC  290

Query  718   HVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
              V +L  +    +  A   EKHFPSRI + + P +    V  +S+G+S+ N   E+   K
Sbjct  291   DVFKLVDDTLMRERGAGACEKHFPSRISLQLTP-ILQHQVLSVSVGKSSENPTMEIGVEK  349

Query  892   IWKGSFGDSK-VPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWK  1068
               + SF  +     +   A  +T   +K W++++   G +   +  L D+  G EV + K
Sbjct  350   SLEASFQPTNPYIGLNVSAGESTTMSLKPWKFEESVYGYSANLNWFLHDSMDGKEVFSSK  409

Query  1069  PDNGD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
             P   +   P +   +    RY  A R FT++G ++ AG+E G  V W++ K   G  ++W
Sbjct  410   PSKFELINPKSWFKD----RYSSAYRPFTRQGGVIFAGDEYGESVCWKVDKNARGKTMEW  465

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
              I G +WLTY PN   T Y+ETR +E+ + V L
Sbjct  466   EIKGWIWLTYLPNKYRTFYHETRRLEFREIVHL  498



>gb|EYU20073.1| hypothetical protein MIMGU_mgv1a005096mg [Erythranthe guttata]
Length=497

 Score =   158 bits (400),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 126/393 (32%), Positives = 183/393 (47%), Gaps = 27/393 (7%)
 Frame = +1

Query  196   FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVEL  375
              FN  LL+  F +C  +AP++  A     IL   L    S+    VL      +G++ E 
Sbjct  123   IFNFSLLTLTFVVCVYEAPTDLRASCLE-ILKNELACAKSREVSKVLMRL---MGSNTEE  178

Query  376   CFMRTFGYMLAKWLILREVGGVGLQS-----LTPQYLGISYSTEAYGLWILKGYAPVRAM  540
              +MR+    +  W    E+      +      TP  L  SYS    GLW ++ Y PV AM
Sbjct  179   QWMRSMNLAITNWY--SEIDPTTNNNNPAVLKTPSSL-FSYSRSTLGLWKVQLYCPVIAM  235

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                   G   P P     +  L ++L +HQLE VIQ  Y V   + +IQV    DNIR  
Sbjct  236   DVEKSSG---PSP-----DDRLIFSLNYHQLEGVIQLNYRVSVQEKWIQVMVNTDNIRCD  287

Query  721   VARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
             V +L   K   +      EKHFPSRI + + P    S V  +S+ +S+ N  +E+   K 
Sbjct  288   VVKLLTEKLMKERGTGASEKHFPSRIALQITPTTLQSNVISISVSKSSENQPREIGVEKG  347

Query  895   WKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPD  1074
              + SF       +   A     T +K W+++Q   G+    +  L D+  G EV + KP 
Sbjct  348   IEASFEPPTAIGLHFSAGETVTTSLKPWKFEQSVYGSTANLNWFLHDSGDGREVFSSKPS  407

Query  1075  N-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
                   P A   N    RY  ANR FT++G +V AG+E G  V W++ +  +G  ++W +
Sbjct  408   KFALLQPKAWFKN----RYSSANRPFTRQGGVVFAGDEYGESVSWKVDRGCMGRCMEWEV  463

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              G +WLTYWPN   T Y ETR  ++ + V L L
Sbjct  464   NGWIWLTYWPNKHRTFYTETRKFQFKEIVTLTL  496



>ref|XP_003601000.1| hypothetical protein MTR_3g071950 [Medicago truncatula]
 gb|AES71251.1| hypothetical protein MTR_3g071950 [Medicago truncatula]
Length=495

 Score =   158 bits (400),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 130/466 (28%), Positives = 210/466 (45%), Gaps = 60/466 (13%)
 Frame = +1

Query  13    DECHLSSDKPFLP---------------LVLQLLQEVISRSPTAHDSTCPRSQLQKLHPD  147
             D  HL + KPF+P               L +  +Q+++       +   P  +  KL   
Sbjct  65    DPIHLWTSKPFMPSSKTTNLLDKETISNLFINFIQDILHY---GSNKNSPLIRFPKLD--  119

Query  148   RVSWMLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAP  327
                      S     + FNL   +    +C  +AP           L  +L    S+ A 
Sbjct  120   ---------SGPNLPNIFNLTFFTLFVLVCIYEAPKNISDACI-GFLKDHLTSTQSRQAS  169

Query  328   VVLRTFFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSL----TPQYLGISYSTEA  495
              +L      +G++++  +MR+    +  W     VG +  Q      TP  L  SY+   
Sbjct  170   NLLMKL---LGSNLQEQWMRSVNLAITNW-----VGEIEEQHQNMFRTPCSL-FSYAFST  220

Query  496   YGLWILKGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFD  675
              GLW ++ Y P   M   + + E +P          L ++L +HQ+E+V+QF Y V   +
Sbjct  221   SGLWKVQLYCPATCMD--VEKSESHP-------HDKLEFSLKYHQVESVLQFNYKVVVKE  271

Query  676   GFIQVNARLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLG  849
              ++++   +DNIR  V +L  +    +  A   EKHFPSRI + + P +  + V  LS+G
Sbjct  272   EWVEIMVNVDNIRCDVTKLVNDSLVKERGAGATEKHFPSRISLQLTPTI-QNQVMSLSVG  330

Query  850   QSTNNIEKEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATL  1029
             +ST N +KE+   K  + S        +K  A  +T   +K W+++Q   G +   +  L
Sbjct  331   KSTENPKKEIGIDKGIEASIEPPNPLGLKVSAGESTTVSLKPWKFEQSVYGYSANLNWFL  390

Query  1030  CDNQTGIEVATWKPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGW  1206
              D+  G EV + KP       P +   N    RY  A R FT++G ++ AG+E G  V W
Sbjct  391   HDSMDGKEVFSSKPSKCALINPKSWFKN----RYSSAYRPFTRQGGVIFAGDEYGERVWW  446

Query  1207  RLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
             ++ K  +G  ++W I G +WLTYWPN   T Y ETR +E+ + V L
Sbjct  447   KVDKGAIGKTMEWEIRGWIWLTYWPNKRVTLYNETRRMEFREIVYL  492



>gb|KFK28103.1| hypothetical protein AALP_AA8G472900 [Arabis alpina]
Length=499

 Score =   158 bits (399),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 118/393 (30%), Positives = 193/393 (49%), Gaps = 42/393 (11%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLE-MFSSKPAPVVLRTFFVTVGTDVEL  375
             FN V+L+  F +C  +AP     LY       NL+    +  A     +    +G+++E 
Sbjct  135   FNTVILTLSFVVCVYEAP-----LYLREDCLNNLKNHLVTAHARQATVSLMKLLGSNLEE  189

Query  376   CFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
              +MR+    +  W+I +        + TP +   SY+  AYGLW ++ Y P+ AM+    
Sbjct  190   QWMRSVNLAITNWIIDQSTK----TTTTPLF---SYAVSAYGLWKVQLYCPIEAMEV---  239

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
               ER+  P+ +++   L ++L  +QLE V+QF + V   D +I V   +DNIR  V +L 
Sbjct  240   --ERSSNPLADSR---LLFSLKFNQLEGVMQFNHRVVVRDKWIDVVVNIDNIRYDVIKLV  294

Query  736   FNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
               +  S+  A   EKHFPSRI + + P +   ++       S N   +E E  +  +GSF
Sbjct  295   NERLMSRRGAGEHEKHFPSRISLQLTPTLQTDFISVSVSKSSNNP-GREFEVERSIEGSF  353

Query  910   GDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVATWKPD  1074
                    ++   R A+   M  W+++Q   G     N ++YD+++     G EV T KP 
Sbjct  354   DPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSVG----GREVFTTKPS  409

Query  1075  NGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
                      +M+       RY  A R FT++G ++ AG+E G  V W++ K  +G  ++W
Sbjct  410   RCS------IMSPRSWFKDRYARAYRSFTRRGGVIFAGDEYGESVVWKIGKGAMGRRMEW  463

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
              I G +WLTYWPN   T Y+ETR +++   + L
Sbjct  464   EIKGFIWLTYWPNKYKTFYHETRRLDFTQLLHL  496



>ref|XP_007141723.1| hypothetical protein PHAVU_008G219800g [Phaseolus vulgaris]
 gb|ESW13717.1| hypothetical protein PHAVU_008G219800g [Phaseolus vulgaris]
Length=501

 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 124/410 (30%), Positives = 204/410 (50%), Gaps = 42/410 (10%)
 Frame = +1

Query  163   LDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFH--SILAPNLEMFSSKPAPVVL  336
             LDS S   F   FNL  L+ LF +C  +APS+   L ++  S L   L    S+ A  +L
Sbjct  119   LDSIS--NFQDIFNLAFLTLLFLVCIYEAPSD---LRYNCLSTLKEQLAGCESRQASKLL  173

Query  337   RTFFVTVGTDVELCFMRTFGYMLAKWLI-LREV---GGVGLQSLTPQYLGISYSTEAYGL  504
                   +G+++E  +MR+    +  W++ L+E    G +  ++ +P +   SY+    GL
Sbjct  174   MKL---LGSNLEEQWMRSVNLAITNWIVELQETHPNGHITFRTPSPLF---SYAFSTGGL  227

Query  505   WILKGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFI  684
             W ++ Y PV +M         +P       +  L+++L + QLE V+QF Y V   + ++
Sbjct  228   WKVQLYCPVISMDVV--NANNHP------PDKRLQFSLKYQQLEGVLQFNYKVIMKEKWV  279

Query  685   QVNARLDNIRLHVARLGFNKSQDD--AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQST  858
             ++   +DNIR  V +L  +    +  A   EKHFPSRI + + P +    V  +S+G+S+
Sbjct  280   EIVVNIDNIRCDVLKLVDDSMMRERGAGAAEKHFPSRISLQLTPTLQHQ-VLSVSVGKSS  338

Query  859   NNIEKEVETHKIWKGSFGDSKVPKM--KAVARMATKTKMKNWRWDQDTEGNAVVYDATLC  1032
              N   E    K  + SF D   P M     A  +T   +K W++++   G +   +  L 
Sbjct  339   ENPVIEFGVEKGIEASF-DPPNPYMGLSVSAGESTTVSLKPWKFEESVNGYSGNLNWFLH  397

Query  1033  DNQTGIEVATWKPDNGDDGPTAVVMNN----LGRRYRGANRGFTKKGSLVIAGEESGTGV  1200
             D+  G EV + KP       + V M N       RY    R FT++G ++ AG+E G  V
Sbjct  398   DSTDGKEVFSSKP-------SKVAMFNPKSWFKDRYSSVYRPFTRQGGVIFAGDEYGERV  450

Query  1201  GWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              W++ K +VG  ++W + G +WLTYWPN   T Y+ET+  ++ + V L +
Sbjct  451   CWKVDKGVVGKTMEWEVRGWIWLTYWPNKYKTFYHETKRFQFKETVYLKI  500



>ref|XP_008456895.1| PREDICTED: uncharacterized protein LOC103496710 isoform X1 [Cucumis 
melo]
Length=497

 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 118/387 (30%), Positives = 195/387 (50%), Gaps = 28/387 (7%)
 Frame = +1

Query  184   TFSS--FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTV  357
             TF+S   FNL+ L+ +F +C  +AP+        ++       +S + + V    F   +
Sbjct  122   TFTSKEIFNLIFLTLIFLICIYEAPTSLRLDGLTTVKYHLANCWSRQTSKV----FMKLL  177

Query  358   GTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRA  537
             G+++E  +MR+    +  W++  +     L++ +P +   SYS   +GLW ++ Y PV A
Sbjct  178   GSNLEEQWMRSINLAITNWILELKANCCTLKTPSPLF---SYSYSTHGLWKVQLYCPVIA  234

Query  538   MKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRL  717
             M       E +  P  + +   L+++L +HQLE V+QF Y     + +I +   +DNIR 
Sbjct  235   MD----HIENSSSPSTDER---LQFSLNYHQLEGVLQFNYKAEVHEKWINLRVHVDNIRC  287

Query  718   HVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHK  891
              + +L  +   S+      EKHFPSRI + + P +  + +      +S++N   EV T K
Sbjct  288   SIIQLVNDTLMSKRGVGRSEKHFPSRISLQITPNIQTNIISVSV-SKSSDNPRIEVGTEK  346

Query  892   IWKGSF-GDSKVPKMK-AVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATW  1065
               +  F G +  P +K AV   AT + +K W+++Q   GN  + +  L D+  G EVA  
Sbjct  347   SLEAGFEGQNPYPGIKLAVGETATAS-LKPWKFEQMVYGNTGILNWYLHDSSDGKEVALR  405

Query  1066  KPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
             KP       P A   +    RY  A R F K+G ++ A +E G G+ W++ +E     ++
Sbjct  406   KPSRFALINPRAWFRD----RYTSAFRPFNKQGGVIFA-DEYGDGICWKIEREAREKTME  460

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVE  1323
             W I G +WLTYWPN   T Y ETR +E
Sbjct  461   WEIRGWIWLTYWPNKHKTFYTETRRLE  487



>ref|XP_003565376.1| PREDICTED: uncharacterized protein LOC100833162 [Brachypodium 
distachyon]
Length=517

 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 112/393 (28%), Positives = 187/393 (48%), Gaps = 21/393 (5%)
 Frame = +1

Query  184   TFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGT  363
             +F+  FN+  LS  F +C  +AP +       ++ A   ++  SK      +T    +G 
Sbjct  140   SFNDAFNIAFLSLAFLVCIYEAPRDLRRGCLDTLRA---QLTGSK-CRGAAKTLVRMLGA  195

Query  364   DVELCFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
             ++E  +M+T    +  W++ L+      L    P     SY+ +A GLW ++ Y PV AM
Sbjct  196   NLEEQWMQTMNLAVTNWIVELQRSSRHPLIGAAPPMF--SYAVQASGLWKVQLYCPVIAM  253

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                   G  +P      ++  L ++L + QLE V+Q  Y     + ++ V  ++DNIR  
Sbjct  254   ------GMEDPAAAAATQDERLLFSLTYQQLEGVVQLAYRTVRRESWVDVEVKVDNIRCD  307

Query  721   VARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
             V  L      ++     +EKHFPSRI + + P +  + +  +SL +S++N   E    K 
Sbjct  308   VESLVSETLMAERGYGSEEKHFPSRIMLQITP-MQQTDILSVSLSRSSDNPTHEFGLEKG  366

Query  895   WKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPD  1074
              + SF       +KA    +    MK W+++Q   GN   +   L D   G EV + +P 
Sbjct  367   LEASFDPPNTFGLKASVAESLTLAMKPWKFEQSVHGNTATFSWFLHDGVNGREVYSSRPS  426

Query  1075  NGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
                   P A   +    RY    R FTK+G +V A +E G  V W++    +G  ++W +
Sbjct  427   KLSLLQPRAWFRD----RYSNVCRPFTKQGGVVFARDEYGDSVSWKVCGAALGKTMEWDV  482

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              G +W+TYWPN   TS+ ETR +++ + + LPL
Sbjct  483   RGWIWVTYWPNKQRTSHSETRWLQFRECLQLPL  515



>ref|XP_004307694.1| PREDICTED: uncharacterized protein LOC101292549 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=499

 Score =   156 bits (395),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 116/381 (30%), Positives = 194/381 (51%), Gaps = 25/381 (7%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             FNL LL+ +F +C  +AP+   +   + IL   L    S+ A    ++    +G+++E  
Sbjct  130   FNLSLLALVFLVCIYEAPAALRSRCLN-ILKNYLADCWSRQAS---KSLMKLLGSNLEEE  185

Query  379   FMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHR  558
             +MR+    +  W++  +     L++ +P +   SY+   +GLW ++ Y PV AM      
Sbjct  186   WMRSMNLAITNWIVEHQAEQRTLKTPSPLF---SYAISTFGLWKVQLYCPVIAMDI----  238

Query  559   GERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGF  738
              E++  P   + +  L+++L +HQLE V+QF Y V   + +I V   +DNIR  + RL  
Sbjct  239   -EKSSSP--SSGDERLQFSLNYHQLEGVLQFNYKVIVKERWIDVMLNVDNIRCDIVRL-V  294

Query  739   NKS---QDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
             N++   +  A   EKHFPSRI + V P   A+        +S+ N  +E+   K  +GSF
Sbjct  295   NETLMRERGAGTGEKHFPSRISLQVTPTRQANVASVSV-SKSSENPAREIGKEKGIEGSF  353

Query  910   -GDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGD-  1083
                +    ++  A       +K W++++   G +   +  L D+  G EV + KP     
Sbjct  354   EPPNPYLAIRVAANETITMSLKPWKFEESVYGYSANLNWFLHDSVDGREVFSSKPSKCKL  413

Query  1084  DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEV  1263
               P +   +    RY  A R FT++G ++ AG+E G GV W++ K  +G  ++W I G +
Sbjct  414   INPKSWFRD----RYSSAYRPFTRQGGVIFAGDEYGEGVMWKVDKAAMGKTMEWEIRGWI  469

Query  1264  WLTYWPNHVNTSYYETRCVEW  1326
             WLTYWPN   T Y ETR +E+
Sbjct  470   WLTYWPNKHRTFYTETRRLEF  490



>ref|XP_004968295.1| PREDICTED: uncharacterized protein LOC101780551 [Setaria italica]
Length=501

 Score =   156 bits (395),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 115/391 (29%), Positives = 183/391 (47%), Gaps = 23/391 (6%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   FN+V LS  F +C  +AP +       S+ A   ++  SK      +     +G +
Sbjct  127   FKDVFNIVFLSLAFLVCIYEAPRDLRPGCLDSLRA---QLTGSKCRDAA-KNLVKMLGAN  182

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +M+T    +  W+I            +P +   S++  A GLW ++ Y PV AM  
Sbjct  183   LEDQWMQTMNLAVTNWIIELRSSNHSFGVPSPLF---SHALSANGLWKVQLYCPVIAMGM  239

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                       P    ++  L ++L + Q+E+VIQ  Y     D +I V  ++DNIR  V 
Sbjct  240   EE--------PAEATQDERLLFSLVYQQVESVIQLAYRTVRRDNWIDVEVKVDNIRCDVD  291

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
              L      ++     +EKHFPSR+ + + P +  S V  +S+G+S +N   E    K ++
Sbjct  292   SLVSETLMAERGYGSEEKHFPSRVMLQITP-MQQSDVLSVSVGKSNDNPTHEFGIEKGFE  350

Query  901   GSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNG  1080
             GSF       +KA    +    ++ W+++Q   GN    +  L D   G EV + KP   
Sbjct  351   GSFDPPNSFGLKASVTESLTLAIRPWKFEQSVHGNTATLNWFLHDGVNGREVYSSKPSKL  410

Query  1081  DD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGG  1257
                 P A   +    RY  A R FTK+G ++ A +E G  V W++    +G  + W I G
Sbjct  411   SLLQPRAWFRD----RYSNAYRPFTKQGGVIFARDEYGDSVWWKICGATLGKTMNWEIRG  466

Query  1258  EVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              +WLTYWPN   T + ETR +E+ + + LPL
Sbjct  467   WIWLTYWPNKQRTFHSETRWLEFRECLQLPL  497



>ref|XP_004146480.1| PREDICTED: uncharacterized protein LOC101220377 [Cucumis sativus]
 gb|KGN50706.1| hypothetical protein Csa_5G218230 [Cucumis sativus]
Length=495

 Score =   155 bits (393),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 107/388 (28%), Positives = 190/388 (49%), Gaps = 23/388 (6%)
 Frame = +1

Query  196   FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVEL  375
              FNL  L+ +F +C  +AP+    L  + ++A    + +S    +  +     +G+ +E 
Sbjct  127   IFNLAFLTLVFLICIYEAPTN---LRSNCLMALKFYLANSISRQIS-KVLMKLLGSTLEQ  182

Query  376   CFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
              ++R+    L  W+   +  G   ++ +P +   SYS   YGLW ++ Y P+ AM     
Sbjct  183   RWVRSLNLALTNWISELKANGHTFKTPSPLF---SYSFSTYGLWKVQLYCPIIAMD----  235

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
                 N +    + +  L+++L +HQLE V+Q  Y     + +I +   +DNIR  + +L 
Sbjct  236   ----NIYSSNPSSDERLQFSLNYHQLEGVLQLNYKAVVREKWIDLRVHVDNIRCDIVQLV  291

Query  736   FNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
                   +  V   EKHFPS+I + + P    + +  +S+ +S++N   E+ T K ++  F
Sbjct  292   NETLLSERGVGGSEKHFPSQISLQLTPTFHTN-IMSVSVSKSSSNPHIEIGTEKTFEAGF  350

Query  910   GDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-GDD  1086
               +  P +K          +K W+++Q   GNA   D  L D+  G EVA+ KP      
Sbjct  351   ESAPYPGLKLAVGETVTVSLKPWKFEQSVHGNAATLDWYLHDSSDGREVASTKPSKLALI  410

Query  1087  GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVW  1266
              P A   +    RY  A+R F ++G ++ AG+E G  V W++  +  G  ++W I G + 
Sbjct  411   NPKAWFRD----RYSSASRPFNRQGGVIFAGDEYGDSVWWKIDGKARGKTMEWEIRGWIL  466

Query  1267  LTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +TYWPN   T Y ET+ +E+ + + L +
Sbjct  467   VTYWPNKHKTFYTETKRLEFKEILQLSI  494



>ref|NP_001131444.1| uncharacterized protein LOC100192776 [Zea mays]
 gb|ACF79849.1| unknown [Zea mays]
 gb|AFW80108.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_721333 [Zea 
mays]
Length=506

 Score =   155 bits (393),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 183/391 (47%), Gaps = 23/391 (6%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             FS  FN+  LS  F LC  + P +       S+ A          A  ++R     +G +
Sbjct  132   FSDVFNIAFLSLAFLLCIFEVPRDLRPGCLGSLGAQLTGSRCRDAAKSLVRM----LGAN  187

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +M+T    +  W++  E+      S  P  L  SY+  A GLW ++ Y PV AM  
Sbjct  188   LEDQWMQTMNLAVTNWIV--ELRSSSRSSGPPSPL-FSYAVSASGLWKVQLYCPVIAMG-  243

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
              +      P      ++  L ++L + Q+E VIQ  Y     D +I V  ++DN+R  V 
Sbjct  244   -MEEAAETP------QDERLLFSLIYQQVECVIQLAYRTTRRDNWIDVEVKVDNVRCDVD  296

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
              L      ++     +EKHFPSR+ + + P    S V  +S+G+S +N   E    K ++
Sbjct  297   SLVSETLMAERGYGSEEKHFPSRVMLQITP-TQQSDVLSVSVGKSNDNPTHEFGIEKGFE  355

Query  901   GSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNG  1080
             GSF       +KA    +    MK W+++Q   GN    +  L D   G EV + KP   
Sbjct  356   GSFEPPNAFGLKASVTESLTLAMKPWKFEQSVHGNTATLNWFLHDGVNGREVYSSKPSKI  415

Query  1081  DD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGG  1257
                 P A   +    RY  A R FTK+G ++ A +E G  V W++    +G  + W+I G
Sbjct  416   SLLQPKAWFRD----RYSNAYRPFTKQGGVIFARDEYGDSVWWKVCGAALGQTMNWQIRG  471

Query  1258  EVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              +WLTYWPN   T + ETR +E+ + + LPL
Sbjct  472   WIWLTYWPNKQRTFHNETRWLEFRECLQLPL  502



>ref|XP_008799809.1| PREDICTED: uncharacterized protein LOC103714371 [Phoenix dactylifera]
Length=496

 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 111/390 (28%), Positives = 190/390 (49%), Gaps = 23/390 (6%)
 Frame = +1

Query  190   SSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDV  369
             S  FNL  L+  F +C  +   +  A +  S+        S + + +++R     +G+++
Sbjct  125   SDIFNLAFLNLTFLVCLYELRRDLRAEFTDSLRLQLASSRSQEASKLLMRA----LGSNL  180

Query  370   ELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCT  549
             E  +MR+    +  W++  E+        +P  L  SY++    LW ++ Y P+ AM   
Sbjct  181   EEKWMRSISLGITNWMM--ELQASNSPFTSPSAL-FSYASSESRLWKVQLYCPMAAMSIE  237

Query  550   LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVAR  729
                    P       +  L ++L + Q E VIQ  Y + +   +I+V+  +DNIR  V  
Sbjct  238   -DSSTTTP-------DDRLDFSLKYQQFEGVIQLAYKIIFRPSWIEVSVSVDNIRCDVCP  289

Query  730   LGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKG  903
             L  +   ++     +EKHFPSRI + + P +  S V  +S+ +ST+N  +E+ T    +G
Sbjct  290   LVSDSLMTRRGYGPEEKHFPSRITLQLTPTL-QSDVLSVSVSKSTDNPIQEISTGTSLQG  348

Query  904   SFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-G  1080
             SF   K   +   A       MK WR++Q   GN+ + +  L     G E+ + KP    
Sbjct  349   SFEPPKALGLSVTAAETFTMSMKPWRFEQSVHGNSAILNWFLHGGINGREIFSSKPSKLM  408

Query  1081  DDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGE  1260
                P A   N    RY  A+R FT++G ++ AG+E G  V W++S+E +G  ++W + G 
Sbjct  409   LFRPKAWFRN----RYSKASRPFTRQGGVIFAGDEYGESVRWKVSEEALGKTMEWELRGR  464

Query  1261  VWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +WL+YWPN   T + E R +E+ + + L L
Sbjct  465   IWLSYWPNKQRTFHSEIRGLEFRELLYLSL  494



>ref|XP_010520952.1| PREDICTED: uncharacterized protein LOC104799957 [Tarenaya hassleriana]
Length=502

 Score =   154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 115/390 (29%), Positives = 188/390 (48%), Gaps = 41/390 (11%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLR----TFFVTVGTD  366
             FNLV L+  F +   + P+        S+    L   +       LR    +    +G++
Sbjct  131   FNLVFLTLSFLVSVYETPT--------SLRDDCLSFLNDHLVTCRLRQPSISLMKLLGSN  182

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MR+    +  WL+  +    G +     +   SY+    GLW ++ Y P+ AM+ 
Sbjct  183   LEEQWMRSVNLAVTNWLVGLQATNGGSRRFA-SWPSFSYAVSTSGLWKVQLYCPLVAMEV  241

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                  ER   P +++K   L ++L  HQLE V+QF Y V   + +I V  ++DNIR  V 
Sbjct  242   -----ERKSNPFVDSK---LLFSLNFHQLEGVMQFNYKVAVREKWIDVVVKIDNIRYDVI  293

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             RL   +  ++  A   EKHFPSRI + + P +  + +       S N   +E E  K  +
Sbjct  294   RLVSERLMARKGAGEQEKHFPSRISLQLTPTLQTNIISVSVSKSSNNP-GREFEVEKSIE  352

Query  901   GSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVATW  1065
             G+F       +    R A +  M  W+++Q   G     N ++YD++L     G EV + 
Sbjct  353   GAFNPPNSIGLTIATREAARVSMTPWKFEQSVLGYTANLNWLLYDSSLG----GREVFSS  408

Query  1066  KPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
             +P        +V+MN       RY  A R FT++G ++ AG+E G  V W++ +E +G  
Sbjct  409   RPSK-----LSVMMNPRSWFKDRYARAYRSFTRRGGVIFAGDEYGECVVWKVGREALGKT  463

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEW  1326
             ++W I G +WLTYWPN   T Y+ETR +++
Sbjct  464   MEWEIKGSIWLTYWPNTHKTFYHETRRLDF  493



>ref|XP_003616715.1| hypothetical protein MTR_5g083500 [Medicago truncatula]
 gb|AES99673.1| hypothetical protein MTR_5g083500 [Medicago truncatula]
Length=496

 Score =   153 bits (387),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 115/395 (29%), Positives = 194/395 (49%), Gaps = 28/395 (7%)
 Frame = +1

Query  184   TFSSFFNLVLLSRLFWLCACDAPSEA--GALYFHSILAPNLEMFSSKPAPVVLRTFFVTV  357
              FS  FNL  L+ LF +C  +APS+   G L   S L   L    S+ +  +L      +
Sbjct  119   NFSDIFNLAFLTLLFLVCIYEAPSDLRYGCL---SALKEQLSGCESRKSSKLLMKL---L  172

Query  358   GTDVELCFMRTFGYMLAKWLI-LREVGGVGLQSL-TPQYLGISYSTEAYGLWILKGYAPV  531
             G+++E  +MR+    +  W++ L+EV         TP  L  S++   +GLW ++ Y P+
Sbjct  173   GSNLEEKWMRSINLAITNWIVELKEVAKHHYSMFRTPSPL-FSHAFSTFGLWKVQLYCPL  231

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
               M                A +  L+++L + QLE V+QF +     + ++++   +DNI
Sbjct  232   INMDVVSANNH--------AADERLQFSLKYQQLEGVLQFNHKAFIKEKWVEIMVNIDNI  283

Query  712   RLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             R  V +L  +    +  A   EKHFPSRI + + P +    V  +S+G+S+ N   E+  
Sbjct  284   RCDVFKLVDDTLMKERGAGASEKHFPSRISLQLTPTLQHQ-VLSVSVGKSSENPIMEIGM  342

Query  886   HKIWKGSFGDSK-VPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
              K  + +F  +     +   A  +T   +K W++++   G +   +  L D+  G EV +
Sbjct  343   EKSVEATFQPTNPYIGLNVSAGESTTMSLKPWKFEESVYGYSANLNWFLHDSMDGKEVFS  402

Query  1063  WKPDNGD-DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVL  1239
              KP   +   P +   +    RY  A R FT++G ++ AG+E G  V W++ K   G ++
Sbjct  403   TKPSKFELINPKSWFRD----RYSSAYRPFTRQGGVIFAGDEYGESVCWKVDKSARGKIM  458

Query  1240  KWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
             +W I G +WLTY PN   T Y+ETR +E+ + V L
Sbjct  459   EWEIRGWIWLTYLPNKYRTFYHETRRLEFREIVHL  493



>ref|XP_004166119.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101220377 
[Cucumis sativus]
Length=495

 Score =   153 bits (387),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/388 (27%), Positives = 189/388 (49%), Gaps = 23/388 (6%)
 Frame = +1

Query  196   FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVEL  375
              FNL  L+ +F +C  +AP+    L  + ++A    + +S    +  +     +G+ +E 
Sbjct  127   IFNLAFLTLVFLICIYEAPTN---LRSNCLMALKFYLANSISRQIS-KVLMKLLGSTLEQ  182

Query  376   CFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
              ++R+    L  W+   +  G   ++ +P +   SYS   YGLW ++ Y P+ AM     
Sbjct  183   RWVRSLNLALTNWISELKANGHTFKTPSPLF---SYSFSTYGLWKVQLYCPIIAMD----  235

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
                 N +    + +  L+++L +HQLE V+Q  Y     + +I +   +DNIR  + +L 
Sbjct  236   ----NIYSSNPSSDERLQFSLNYHQLEGVLQLNYKAVVREKWIDLRVHVDNIRCDIVQLV  291

Query  736   FNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
                   +  V    KHFPS+I + + P    + +  +S+ +S++N   E+ T K ++  F
Sbjct  292   NETLLSERGVGGXRKHFPSQISLQLTPTFHTN-IMSVSVSKSSSNPHIEIGTEKTFEAGF  350

Query  910   GDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-GDD  1086
               +  P +K          +K W+++Q   GNA   D  L D+  G EVA+ KP      
Sbjct  351   ESAPYPGLKLAVGETVTVSLKPWKFEQSVHGNAATLDWYLHDSSDGREVASTKPSKLALI  410

Query  1087  GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVW  1266
              P A   +    RY  A+R F ++G ++ AG+E G  V W++  +  G  ++W I G + 
Sbjct  411   NPKAWFRD----RYSSASRPFNRQGGVIFAGDEYGDSVWWKIDGKARGKTMEWEIRGWIL  466

Query  1267  LTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +TYWPN   T Y ET+ +E+ + + L +
Sbjct  467   VTYWPNKHKTFYTETKRLEFKEILQLSI  494



>ref|XP_010937956.1| PREDICTED: uncharacterized protein LOC105057163 [Elaeis guineensis]
Length=499

 Score =   153 bits (386),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 112/386 (29%), Positives = 181/386 (47%), Gaps = 24/386 (6%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             + F   FNL  L+  F +C  +AP+        ++        S + + +++R     +G
Sbjct  122   DEFRDVFNLAFLTLAFLICIYEAPNNLRQGCLDTLRIQLASSRSREASKLLMRI----LG  177

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
             +++E  +MR+    +  W++  +      ++ +P +   SY+  A GLW ++ Y P+ AM
Sbjct  178   SNLEEQWMRSLNLAVTNWILEFQASNHSFKTPSPLF---SYAFSASGLWKVQLYCPIIAM  234

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                         P     +  L ++L + QLE VIQ  Y V + + +I V   +DNIR  
Sbjct  235   SIED--------PDTATHDERLLFSLKYQQLEGVIQLAYKVIFQENWIDVVVAVDNIRCD  286

Query  721   VARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
             V  L      ++     DEKHFPSRI + + P + +  +       S N    EV   K 
Sbjct  287   VNPLASETLMAERGYGSDEKHFPSRIALQLTPMLQSDVLSVSLSKSSENPTH-EVGKEKT  345

Query  895   WKGSFGDSKVPKMKAVARMATKT-KMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
             ++GS   S       V+   T T  MK W+++Q   GN  + +  L D   G EV + KP
Sbjct  346   FEGSLDPSNHNLGLNVSATETVTISMKPWKFEQSAHGNCAILNWFLHDVVKGREVFSSKP  405

Query  1072  DN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWR  1248
                    P A   +    RY  A+R FTK+G ++ A +  G  V W++ +  +G  ++W 
Sbjct  406   SKLALLQPRAWFRD----RYSSAHRPFTKQGGVIFASDVYGESVRWKMCRRALGKKMEWE  461

Query  1249  IGGEVWLTYWPNHVNTSYYETRCVEW  1326
             I G +WLTYWPN   TSY ETR +E+
Sbjct  462   IKGWIWLTYWPNRQKTSYCETRRLEF  487



>ref|XP_006294080.1| hypothetical protein CARUB_v10023075mg [Capsella rubella]
 gb|EOA26978.1| hypothetical protein CARUB_v10023075mg [Capsella rubella]
Length=496

 Score =   152 bits (385),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 115/389 (30%), Positives = 190/389 (49%), Gaps = 27/389 (7%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             FNL   + +F +C  +AP+        ++    +   S + + +++    V +G+++E  
Sbjct  129   FNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRQGSKLLM----VQLGSNLEEQ  184

Query  379   FMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
             +MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV AM+    
Sbjct  185   WMRSLNLAITNWII--EIKAFQHLKSPSPLF---SYAFSTQGLWKVHMYCPVVAMEMESV  239

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
                 N        +  L ++L +HQLE VIQF + +   + +  +   +DN+R  + RL 
Sbjct  240   NSALN--------DERLFFSLNYHQLEGVIQFNHRIYVREKWFNIAVNVDNVRCDIIRLV  291

Query  736   FNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
               K   D  +  +EKHFPSRI + + P V  S +  +S+ +S+ N   E E  K  + + 
Sbjct  292   NEKLLSDRGMGTEEKHFPSRISLQLTPTV-QSNILMVSVQKSSENPLTEFEVEKGIEAAI  350

Query  910   GD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-GD  1083
                +    +K  A   T   MK W++++   G +      L D   G EV+T KP     
Sbjct  351   EPPNTFFGLKVSANETTTKSMKPWKFEEWVHGYSANLTWFLHDLDDGREVSTSKPSKVSR  410

Query  1084  DGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEV  1263
               P A   N    RY  A R FTK+G +V AG+  G  V W++ K  +G V+++ + G V
Sbjct  411   MNPRAWFKN----RYSSAFRPFTKQGGVVFAGDSYGQSVLWKVDKTAIGKVMEFEVKGCV  466

Query  1264  WLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             WLTYWPN  +T Y +TR +E+ + + L L
Sbjct  467   WLTYWPNKHHTFYSDTRKLEFKEMLYLNL  495



>ref|NP_001042108.1| Os01g0165100 [Oryza sativa Japonica Group]
 dbj|BAD68290.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04022.1| Os01g0165100 [Oryza sativa Japonica Group]
 gb|EAY72666.1| hypothetical protein OsI_00532 [Oryza sativa Indica Group]
 gb|EAZ10670.1| hypothetical protein OsJ_00500 [Oryza sativa Japonica Group]
 dbj|BAG86963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=502

 Score =   152 bits (384),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 127/462 (27%), Positives = 201/462 (44%), Gaps = 47/462 (10%)
 Frame = +1

Query  1     VWVSDECHLSS-------DKPFLPLVLQLLQEVISRSPTAHDS-TCPRSQLQKLHPDRVS  156
             +W S   HL S       ++  L L + ++  V+   P    S   PR+Q+         
Sbjct  74    LWTSKPVHLKSYTQQSLDEQEMLELFVDIVDWVLRSGPNKKLSFQFPRAQIHG-------  126

Query  157   WMLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVL  336
                           FN+V LS  F +C  +AP         S+        +        
Sbjct  127   ---------NLKDVFNIVFLSLAFLVCIYEAPHALRCRCLESLRT----QLTGPKCKDAA  173

Query  337   RTFFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILK  516
             +TF   +G ++E  +M+T    +  W++ +          +P +   SY+  A GLW ++
Sbjct  174   KTFVRMLGANLEEQWMQTMNLAVTNWIVEQRSSHHSFGVPSPLF---SYALSASGLWKVQ  230

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              Y P+ AM            P +  ++  L ++L + QLE VIQ  Y     D +I V  
Sbjct  231   LYCPLIAMSME--------DPAVPTQDERLLFSLTYQQLEGVIQLAYKTIRRDNWIDVEI  282

Query  697   RLDNIRLHVARL--GFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
             ++DNIR  V  L      ++     +EKHFPSR+ + + P +  S V  +S+ +S++N  
Sbjct  283   KVDNIRCDVDSLVSEILMTERGHGSEEKHFPSRVMLQITP-MQQSDVLSVSVSKSSDNPT  341

Query  871   KEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGI  1050
              E    K  +GSF       +KA    +    MK W+++Q   GN    +  L D   G 
Sbjct  342   HEFGLEKGIEGSFDPPNTFGLKASVSESLTLTMKPWKFEQSVHGNTTTLNWFLHDGVNGR  401

Query  1051  EVATWKPDNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMV  1227
             EV + KP       P A   +    RY    R FTKKG ++ A +E G  V W++    +
Sbjct  402   EVYSSKPSKLSLLQPRAWFRD----RYSTVYRPFTKKGGVIFARDEYGDSVWWKICGAAL  457

Query  1228  GSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLI  1353
             G  + W I G +WLTYWPN   T + ETR +E+ + + LPL+
Sbjct  458   GKTMDWEIRGWIWLTYWPNKQKTFHSETRRLEFRECLQLPLM  499



>ref|NP_001059236.1| Os07g0231800 [Oryza sativa Japonica Group]
 dbj|BAC55853.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21150.1| Os07g0231800 [Oryza sativa Japonica Group]
 gb|EAZ39195.1| hypothetical protein OsJ_23621 [Oryza sativa Japonica Group]
 dbj|BAG99729.1| unnamed protein product [Oryza sativa Japonica Group]
Length=495

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 113/399 (28%), Positives = 186/399 (47%), Gaps = 34/399 (9%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNL--EMFSSKPAPVVLRTFFVT  354
             E     FNL  L+    +C  +APS        ++ A  +  +M+ +       +   + 
Sbjct  120   EDTGKIFNLAALTLALMVCIYEAPSTLRRDLIGTVSAQLIRGDMWGAA------KKLMLA  173

Query  355   VGTDVELCFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPV  531
             +G+D+E  +MR+    +  W+I  R  GG  +   T      SY+  A  LW ++ Y PV
Sbjct  174   MGSDMEEQWMRSLNLAVTNWIIETRRSGGTPVSPFTV----FSYAVSAIRLWKVELYCPV  229

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AM            P  + K+  L+++L +  LEAVIQF Y V + + +I V   +DNI
Sbjct  230   VAMIME--------HPAHQTKDEKLQFSLNYQHLEAVIQFIYRVTFRENWIDVTVNVDNI  281

Query  712   RLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             R  + +L      ++     DEKHFPSRI + + P V    +  L++ +ST+N  +EV+T
Sbjct  282   RCDLIQLVSETLMAKQGYGSDEKHFPSRISLQLTPLVQTDILS-LTVSRSTDNPAQEVDT  340

Query  886   HKIWKGSFGDSKVPKMKAVARMATKT---KMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
                   +   S  P    +   A +T    ++ W+++    GN    +  L     G EV
Sbjct  341   EMGLDATL--SAAPATIGITMSAHETVTRTLRPWKFEHSVHGNTAALNWFLHGGAEGREV  398

Query  1057  ATWKPDNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS  1233
              + +P   +   P +   N    RY    R FT+ G ++ AG+E G  V WR+     G 
Sbjct  399   FSSEPHKRELLQPRSWFRN----RYTNPGRPFTRGGGVIFAGDEYGESVCWRMPAAAAGK  454

Query  1234  VLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              ++W + G +W+TYWPN   T + ETR VE+ + + L +
Sbjct  455   TVEWEMKGRIWVTYWPNKKRTLHVETRRVEFRELLRLTI  493



>gb|KDP44690.1| hypothetical protein JCGZ_01190 [Jatropha curcas]
Length=370

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 110/392 (28%), Positives = 187/392 (48%), Gaps = 46/392 (12%)
 Frame = +1

Query  196   FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVEL  375
              FN   L+  F +C  +AP++      ++ L   L     +     L+     +G+++E 
Sbjct  1     MFNFAFLTLTFLICIYEAPADLRPECLNN-LKTQLTNCKLRDG---LKMLMKIIGSNLEE  56

Query  376   CFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
              +MR+    +  W+   +     L++ +P +   SYS   + LW ++ Y P+ A+     
Sbjct  57    QWMRSMNLAITNWISELQATNQTLKTPSPLF---SYSVSTFELWKVQLYCPIIAVD----  109

Query  556   RGERNPFPVIEAKESA-----LRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                      IE+  +A     L ++L HHQLE V+QF Y V   + ++ V   +DNIR  
Sbjct  110   ---------IESSSTASSDERLAFSLKHHQLEGVLQFNYRVMIQEKWVDVILSIDNIRCD  160

Query  721   VARLGFNKSQDDAYVD--EKHFPSRIRVWVGPEVGASYVGGLSLGQSTN-----NIEKEV  879
             + RL       +  V   EKHFPSRI + + P + ++ +       S N      +EK +
Sbjct  161   IVRLVNETLMAERGVGSGEKHFPSRISLQLTPILQSNIISVSVSKSSNNPTTEIELEKSI  220

Query  880   ETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVA  1059
             ET      SF   K+   + V+     T +K W++++   G + + +  L D+  G EV+
Sbjct  221   ETSFDPPNSFLGLKLSVGETVS-----TSLKPWKFEESVYGYSTILNWFLHDSIDGREVS  275

Query  1060  TWKPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVG  1230
             + KP          ++N       RY  A+R FTK+G ++ A +E G G+ W++ K  +G
Sbjct  276   SSKPSK------MALINPKSWFKDRYSSAHRPFTKQGGVIFARDEYGNGMRWKVDKSAIG  329

Query  1231  SVLKWRIGGEVWLTYWPNHVNTSYYETRCVEW  1326
               ++W I G++WLTYWPN   T Y ETR +E+
Sbjct  330   KTMEWEIKGKIWLTYWPNKYRTFYSETRRLEF  361



>gb|EAY84599.1| hypothetical protein OsI_05967 [Oryza sativa Indica Group]
Length=495

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 113/399 (28%), Positives = 186/399 (47%), Gaps = 34/399 (9%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNL--EMFSSKPAPVVLRTFFVT  354
             E     FNL  L+    +C  +APS        ++ A  +  +M+ +       +   + 
Sbjct  120   EDTGKIFNLAALTLALMVCIYEAPSTLRRDLIGTVSAQLIRGDMWGAA------KKLMLA  173

Query  355   VGTDVELCFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPV  531
             +G+D+E  +MR+    +  W+I  R  GG  +   T      SY+  A  LW ++ Y PV
Sbjct  174   MGSDMEEQWMRSLNLAVTNWIIETRRSGGTPVSPFTV----FSYAVSAIRLWKVELYCPV  229

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AM            P  + K+  L+++L +  LEAVIQF Y V + + +I V   +DNI
Sbjct  230   VAMIME--------HPAHQTKDEKLQFSLNYQHLEAVIQFIYRVTFRENWIDVTINVDNI  281

Query  712   RLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             R  + +L      ++     DEKHFPSRI + + P V    +  L++ +ST+N  +EV+T
Sbjct  282   RCDLIQLVSETLMAKQGYGSDEKHFPSRISLQLTPLVQTDILS-LTVSRSTDNPAQEVDT  340

Query  886   HKIWKGSFGDSKVPKMKAVARMATKT---KMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
                   +   S  P    +   A +T    ++ W+++    GN    +  L     G EV
Sbjct  341   EMGLDATL--SAAPATIGITMSAHETVTRTLRPWKFEHSVHGNTAALNWFLHGGAEGREV  398

Query  1057  ATWKPDNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS  1233
              + +P   +   P +   N    RY    R FT+ G ++ AG+E G  V WR+     G 
Sbjct  399   FSSEPHKRELLQPRSWFRN----RYTNPGRPFTRGGGVIFAGDEYGESVCWRMPAAAAGK  454

Query  1234  VLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              ++W + G +W+TYWPN   T + ETR VE+ + + L +
Sbjct  455   TVEWEMKGRIWVTYWPNKKRTLHVETRRVEFRELLRLTI  493



>ref|XP_007219049.1| hypothetical protein PRUPE_ppa004684mg [Prunus persica]
 gb|EMJ20248.1| hypothetical protein PRUPE_ppa004684mg [Prunus persica]
Length=496

 Score =   150 bits (379),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 116/402 (29%), Positives = 201/402 (50%), Gaps = 25/402 (6%)
 Frame = +1

Query  160   MLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLR  339
              L   S   F   FNL  ++ LF +C  +AP++  +   +S+       +S + +  +++
Sbjct  114   FLKLDSIANFGDVFNLSFVTLLFLVCIYEAPADLRSGCLNSLKNYLANCWSRQTSKSLMK  173

Query  340   TFFVTVGTDVELCFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILK  516
                  +G+++E  +MR+    +  W++ L+      +++ +P +   SY+   +GLW ++
Sbjct  174   V----LGSNLEEEWMRSINLAITNWIVELQATQRTLVKTPSPLF---SYAFSTFGLWKVQ  226

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              Y P+ AM         +  P ++ +   L+++L +HQLE V+QF   V   + +I V  
Sbjct  227   LYCPLIAMDIA-----NSSSPSVDER---LQFSLNYHQLEGVLQFNSKVIVQERWIDVML  278

Query  697   RLDNIRLHVARLGFNKSQDD--AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
              +DNIR  V  L   +  ++  A V EKHFPSRI + + P V  + V     G+S+ N  
Sbjct  279   NIDNIRCDVISLVNERLMNERGAGVAEKHFPSRISLQITPTVQTNVVSVSV-GKSSENPT  337

Query  871   KEVETHKIWKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTG  1047
             +E+   K  +GSF   +    +K  A       +K W++++   G +   +  L D+  G
Sbjct  338   REIGHEKGIEGSFEPPNPYLALKVSAGETITMSLKPWKFEESVYGYSAKLNWFLHDSVDG  397

Query  1048  IEVATWKPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEM  1224
              EV + KP       P A   +    RY  A R FT++G ++ AG+E G GV W++ K  
Sbjct  398   REVFSSKPSKFALINPKAWFKD----RYSSAYRPFTRQGGVIFAGDEYGEGVWWKVDKAA  453

Query  1225  VGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +G  + W I G +WLTYWPN   T Y ETR +E+ + + L +
Sbjct  454   MGRTMDWEIRGWIWLTYWPNKHKTFYTETRRLEFREILTLTI  495



>ref|XP_008233824.1| PREDICTED: uncharacterized protein LOC103332843 [Prunus mume]
Length=496

 Score =   149 bits (377),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 118/402 (29%), Positives = 199/402 (50%), Gaps = 25/402 (6%)
 Frame = +1

Query  160   MLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLR  339
              L   S   F   FNL  +S LF +C  +AP++  +    S+       +S + +  +++
Sbjct  114   FLKLDSIANFGDVFNLSFVSLLFLVCIYEAPADLRSGCLDSLKNYLANCWSRQASKSLMK  173

Query  340   TFFVTVGTDVELCFMRTFGYMLAKWLI-LREVGGVGLQSLTPQYLGISYSTEAYGLWILK  516
                  +G+++E  +MR+    +  W+  L+      +++ +P +   SY+   +GLW ++
Sbjct  174   V----LGSNLEEEWMRSINLAITNWIAELQATQRTLVKTPSPLF---SYAFSTFGLWKVQ  226

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              Y P+ AM         +  P ++ +   L+++L +HQLE V+QF   V   + +I V  
Sbjct  227   LYCPLIAMDIA-----NSSSPSVDER---LQFSLNYHQLEGVLQFNSKVIVQERWIDVML  278

Query  697   RLDNIRLHVARLGFNKSQDD--AYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
              +DNIR  V  L   +  ++  A V EKHFPSRI + + P V  + V     G+S+ N  
Sbjct  279   NIDNIRCDVISLVNERLMNERGAGVAEKHFPSRISLQITPTVQTNVVSVSV-GRSSENPA  337

Query  871   KEVETHKIWKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTG  1047
             +E+   K  +GSF   +    +K  A       +K W++++   G +   +  L D+  G
Sbjct  338   REIGHEKGIEGSFEPPNPYLALKVSAGETITMSLKPWKFEESVYGYSAKLNWFLHDSVDG  397

Query  1048  IEVATWKPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEM  1224
              EV + KP       P A   +    RY  A R FT++G ++ AG+E G GV W++ K  
Sbjct  398   REVFSSKPSKFALINPKAWFKD----RYSSAYRPFTRQGGVIFAGDEYGEGVWWKVDKAA  453

Query  1225  VGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +G  + W I G VWLTYWPN   T Y ETR +E+ + + L +
Sbjct  454   MGRTMDWEIRGWVWLTYWPNKHKTFYTETRKLEFREILSLTI  495



>ref|XP_010087031.1| hypothetical protein L484_012275 [Morus notabilis]
 gb|EXB25849.1| hypothetical protein L484_012275 [Morus notabilis]
Length=526

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 119/448 (27%), Positives = 203/448 (45%), Gaps = 37/448 (8%)
 Frame = +1

Query  46    LPLVLQLLQEVISRSPTAHDSTCPRSQLQKLHPDRVSWMLDSHSPETFSSFFNLVLLSRL  225
             LPL L  +++V+      +++    S ++ L  D        HS +     FN+  L+  
Sbjct  98    LPLFLNFIEDVLRYGSNNNNN----SMIKFLRVDY------DHSLQNVKETFNVAFLTLF  147

Query  226   FWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCFMRTFGYML  405
             F +C  +APS        +I    +   S K   ++++     +G+++E  +MR+    +
Sbjct  148   FLVCIYEAPSALRRDCLDTIKNHLMNCRSRKATKLLMKM----LGSNLEDRWMRSVNLAV  203

Query  406   AKWLILREVGGVGLQSL----TPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHRGERNP  573
               W+   +  G  + +     TP  L  SY+   +GLW ++ Y P+ AM           
Sbjct  204   TNWIAELQACGRRISTTAMIQTPSSL-FSYALSTFGLWKVQLYCPLIAMNMESSSSSSTI  262

Query  574   FPVIEAK-----ESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGF  738
                         +  L+++L +HQLE V+QF Y V     ++ V   +DNIR  V +L  
Sbjct  263   ITSTTPSGHHDDDQRLQFSLNYHQLEGVVQFNYRVVPQGSWVGVVVNIDNIRCDVIKLVN  322

Query  739   NKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF-  909
                  +  V   EKHFPSRI + + P +  + +       S N + +E+   K  +  F 
Sbjct  323   ETLMSERGVGSSEKHFPSRISLQLTPTLQTNVLSVSVSKSSQNPV-REIGLEKTIEAGFE  381

Query  910   GDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDG  1089
               +    +K  A       +K W++++   G +   +  L D+  G EV + KP      
Sbjct  382   PPNPYLGLKVSAGETVTMSLKPWKFEESVHGYSANLNWYLHDSVNGREVFSSKPSK----  437

Query  1090  PTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGE  1260
                 +MN       RY  A R FT++G +V AG+E G  V W++ K  +G+ ++W I G 
Sbjct  438   --IALMNPKAWFKHRYSSAYRPFTRQGGVVFAGDEYGESVVWKVDKAAMGTTMEWEIRGW  495

Query  1261  VWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
             +WLTYWPN   T Y ETR +E+ + ++L
Sbjct  496   IWLTYWPNKYRTCYTETRRLEFREILNL  523



>ref|XP_006411295.1| hypothetical protein EUTSA_v10016559mg [Eutrema salsugineum]
 gb|ESQ52748.1| hypothetical protein EUTSA_v10016559mg [Eutrema salsugineum]
Length=496

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 116/407 (29%), Positives = 193/407 (47%), Gaps = 63/407 (15%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             FNL   + +F +C  +AP+        ++    +   S + + +++    V +G+++E  
Sbjct  129   FNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRQGSKLLM----VQLGSNLEEQ  184

Query  379   FMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
             +MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV AM+    
Sbjct  185   WMRSLNLAITNWII--EIKAYQHLKSPSPLF---SYAFSTQGLWKVHIYCPVIAME----  235

Query  556   RGERNPFPVIEAKESALR-----YALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                      +E+ +SAL      ++L +HQLE VIQF + +   + +  +   +DN+R  
Sbjct  236   ---------MESVKSALSDERLFFSLNYHQLEGVIQFNHRIYVREKWFNIAVNIDNVRCD  286

Query  721   VARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
             + RL      S+     +EKHFPSRI + + P    S +  +S+ +S+ N  +E E  K 
Sbjct  287   IIRLVSETLLSERGMGTEEKHFPSRISLQLTP-TNQSNILMVSVQKSSENPLREFEVEK-  344

Query  895   WKGSFGDSKVPK----MKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
               G     + P     +K  A   T   MK W++++   G    Y A L          T
Sbjct  345   --GIEATIEPPNTFFGLKVSANETTTKSMKPWKFEESVHG----YSANL----------T  388

Query  1063  WKPDNGDDG--------PTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWR  1209
             W   + DDG            +MN       RY  A R FTK+G +V AG+  G  V W+
Sbjct  389   WFLHDADDGREVSSSKPSKVSMMNPRAWFKNRYSNAFRPFTKQGGVVFAGDSYGQSVLWK  448

Query  1210  LSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             + K  +G V+++ + G VWLTYWPN ++T Y +TR +E+ + + L L
Sbjct  449   VDKRALGKVMEFEVKGCVWLTYWPNKLHTFYSDTRKLEFKEMLYLNL  495



>ref|XP_002879866.1| hypothetical protein ARALYDRAFT_483093 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56125.1| hypothetical protein ARALYDRAFT_483093 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 116/404 (29%), Positives = 192/404 (48%), Gaps = 57/404 (14%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             FNL   + +F +C  +AP+        ++    +   S + + +++    V +G+++E  
Sbjct  129   FNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRQGSKLLM----VQLGSNLEEQ  184

Query  379   FMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
             +MR+    +  W+I  E+     L+S TP +   SY+    GLW +  Y PV AM+    
Sbjct  185   WMRSLNLAITNWII--EIKAFQHLKSPTPLF---SYAFSTQGLWKVHMYCPVVAME----  235

Query  556   RGERNPFPVIEAKESALR-----YALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                      +E+  SAL      ++L +HQLE VIQF + +   + +  +   +DN+R  
Sbjct  236   ---------MESVNSALHDERLFFSLNYHQLEGVIQFNHKIYVREKWFNIAVNIDNVRCD  286

Query  721   VARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
             + RL   K  S+     +EKHFPSRI + + P +  S +  +S+ +S+ N   E E  K 
Sbjct  287   IIRLVNEKLLSERGMGTEEKHFPSRISLLLTPTI-QSNILMVSVQKSSENPLTEFEVEKG  345

Query  895   WKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
              + +    +    +K  A   T   MK W++++   G    Y A L          TW  
Sbjct  346   IEATIDPPNTFFGLKVSANETTTKSMKPWKFEEWVHG----YSANL----------TWFL  391

Query  1072  DNGDDG--------PTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSK  1218
              + DDG            +MN       RY  A R FTK+G +V AG+  G  V W++ K
Sbjct  392   HDLDDGREVSSSKPSKVSMMNPRAWFKNRYSSAFRPFTKQGGVVFAGDSYGQSVLWKVDK  451

Query  1219  EMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
               +G V+++ + G VWLTYWPN  +T Y +TR +E+ + + L L
Sbjct  452   TAIGKVMEFEVKGCVWLTYWPNKHHTFYSDTRKLEFKEMLYLNL  495



>ref|XP_006643787.1| PREDICTED: uncharacterized protein LOC102702045 [Oryza brachyantha]
Length=538

 Score =   147 bits (371),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 126/461 (27%), Positives = 203/461 (44%), Gaps = 47/461 (10%)
 Frame = +1

Query  1     VWVSDECHLSS-------DKPFLPLVLQLLQEVISRSPTAHDS-TCPRSQLQKLHPDRVS  156
             +W S   HL S       ++  L L + ++  V+   P    S   P +Q+Q        
Sbjct  110   LWTSKPVHLKSKTQRALDEQEMLELFVDIVDRVLQYGPDKKPSFRFPGAQIQG-------  162

Query  157   WMLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVL  336
                           FN+V LS  F +C  +AP +   L +  + +   ++   K      
Sbjct  163   ---------NLKGVFNIVFLSLAFLVCIYEAPHD---LRYQCLESLRTQLTGPK-CKDAA  209

Query  337   RTFFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILK  516
             +T    +G ++E  +M+     +  W++          + +P +   SY+  A GLW ++
Sbjct  210   KTLVRMLGANLEDQWMQAMNLAVTNWIVELRSSHHSFGAPSPLF---SYALSASGLWKVQ  266

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              Y PV AM            P +  ++  L ++L + QLE VIQ  Y     + +I V  
Sbjct  267   LYCPVIAMGMEE--------PAVPTQDERLLFSLTYQQLEGVIQLAYKTIRKNNWIDVEL  318

Query  697   RLDNIRLHVARL--GFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
             ++DNIR  V  L      ++     +EKHFPSR+ + + P +  S V  +S+ +S++N  
Sbjct  319   KVDNIRCDVDSLVSEILMTERGLGSEEKHFPSRVMLQITP-MQQSEVLSVSVSKSSDNPT  377

Query  871   KEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGI  1050
              E    K  +GSF       +KA    +    MK W+++Q   GN    +  L D   G 
Sbjct  378   HEFGLEKGIEGSFDPPNSFGLKASVSESLTLAMKPWKFEQSVHGNTATLNWFLHDGVNGR  437

Query  1051  EVATWKPDNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMV  1227
             EV + KP       P A   +    RY    R FTKKG ++ A +E G  V W++    +
Sbjct  438   EVYSSKPSKLSLLQPRAWFRD----RYSTVYRPFTKKGGVIFARDEYGDSVWWKVCGAAL  493

Query  1228  GSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             G  + W I G +WLTYWPN   T + ETR +E+ + + LPL
Sbjct  494   GKTMDWEIKGWIWLTYWPNKQKTFHSETRRLEFRECLQLPL  534



>ref|XP_003557361.1| PREDICTED: uncharacterized protein LOC100822668 [Brachypodium 
distachyon]
Length=504

 Score =   146 bits (369),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 117/392 (30%), Positives = 196/392 (50%), Gaps = 21/392 (5%)
 Frame = +1

Query  196   FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVEL  375
               +L +L+    +C  +APS      F  +++P L     + A    RT  +++G+++E 
Sbjct  127   ILSLSVLTLALLVCVYEAPSPLRR-EFIGVISPQLARDEMRCAA---RTLMLSLGSNLEE  182

Query  376   CFMRTFGYMLAKWLI--LREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCT  549
              +MR+    +  W +  LR  GG G  +   ++   SY+  A  LW ++ Y PV AM   
Sbjct  183   QWMRSLNLGVTNWAMEALRSGGGGGPPAPA-RFAVFSYALSASRLWKVQVYCPVVAMAM-  240

Query  550   LHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVAR  729
                 +++   + +AK+  L ++L + QLE+VIQ  Y V + + +I V   +DNIR  V +
Sbjct  241   ----DQSSHHLQQAKDERLLFSLNYQQLESVIQLVYRVAFKENWIDVAVNVDNIRCDVIQ  296

Query  730   LGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKG  903
             L      ++     DEKHFPSRI + + P +  S +  LS+ +ST N  +EV T K    
Sbjct  297   LVSETLMAKQGYGSDEKHFPSRISLQLTP-LQQSDILSLSVSRSTENPVQEVATDKGIDT  355

Query  904   SFGDSKVPKMK-AVARMATKTK-MKNWRWDQDTEGNAVVYDATLCDNQTGI-EVATWKPD  1074
             + G +    +  +V+   T T+ ++ W+++   +GN       L     G  EV + +P 
Sbjct  356   TLGAAPAASIGISVSAHETVTRSVRPWKFEHSVQGNTASLSWFLHGGGGGGREVFSSEPP  415

Query  1075  NGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIG  1254
               +         N   RY   +R FT+ G ++ AG+E G GV WR++    G  L+W I 
Sbjct  416   KLELCQPRSWFRN---RYTSPSRPFTRSGGVIFAGDEYGEGVCWRMAAAAAGKTLEWEIK  472

Query  1255  GEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             G VW+TYWPN   T + ETR +++ + + L L
Sbjct  473   GRVWVTYWPNKKRTLHTETRRLQFRELLRLTL  504



>ref|XP_010508870.1| PREDICTED: uncharacterized protein LOC104785370 [Camelina sativa]
Length=495

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 118/400 (30%), Positives = 190/400 (48%), Gaps = 49/400 (12%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             FNL   + +F +C  +AP+        ++    +   S K + +++    V +G+++E  
Sbjct  128   FNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRKGSKLLM----VQLGSNLEEQ  183

Query  379   FMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
             +MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV AM+    
Sbjct  184   WMRSLNLAITNWII--EIKAFQHLKSPSPLF---SYAFSTQGLWKVHMYCPVVAMEMESV  238

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
                 N        +  L ++L +HQLE VIQF + +   + +  +   +DN+R  + RL 
Sbjct  239   NSALN--------DERLFFSLNYHQLEGVIQFNHRIYVREKWFNIAVNIDNVRCDIIRLV  290

Query  736   FNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNN--IEKEVETHKIWKG  903
               K   D  +  +EKHFPSRI + + P +  S +  +S+ +S+ N   E EVET  I   
Sbjct  291   NEKLLSDRGMGTEEKHFPSRISLQLTPTI-QSNILMVSVQKSSENPLTEFEVET-GIEAA  348

Query  904   SFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGD  1083
                 +    +K  A  AT   MK W++++   G    Y A L          TW   + D
Sbjct  349   IDPPNTFFGLKVSANEATTKSMKPWKFEEWVHG----YSANL----------TWFLHDLD  394

Query  1084  DGPTAVV--------MNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVG  1230
             DG             MN       RY  A R FTK+G +V AG+  G  V W++ K  +G
Sbjct  395   DGREVSSSKPSKVSRMNPRAWFKNRYSSAFRPFTKQGGVVFAGDSYGQSVLWKVDKTAIG  454

Query  1231  SVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              V+++ + G VWLTYWPN  +T Y +TR +E+ + + L L
Sbjct  455   KVMEFEVKGCVWLTYWPNKHHTFYSDTRKLEFKEMLYLNL  494



>ref|XP_008776289.1| PREDICTED: uncharacterized protein LOC103696439 [Phoenix dactylifera]
Length=497

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 113/394 (29%), Positives = 190/394 (48%), Gaps = 24/394 (6%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             + F   FN+  L+  F +C  +AP+        ++        S + + +++R     +G
Sbjct  122   DEFRDVFNIAFLTLAFLICIYEAPNNLRRGCLDTLRIQLASSRSREASKLLVRI----LG  177

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
             +++E  +MR+    +  W++  +      ++ +P +   S++  A GLW ++ Y P+ AM
Sbjct  178   SNLEEQWMRSLNLAVTNWILEFQASNHSFKTPSPLF---SHAFSASGLWKVQLYCPIIAM  234

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                         P    ++  L ++L + QLE VIQ  Y V + + +I V   +DNIR  
Sbjct  235   SIDD--------PGTTTQDERLLFSLKYQQLEGVIQLAYKVIFRESWIDVVVTVDNIRCD  286

Query  721   VARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
             V  L      ++      EKHFPSRI + + P +  S V  +SL +S++N   EV   K 
Sbjct  287   VNPLVSETLMAERGYGSKEKHFPSRIALQLTPML-QSDVLSVSLSKSSDNPTHEVSLEKA  345

Query  895   WKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
              +GSF   +     K  A       MK W+++Q   G++   +  L D   G EV + +P
Sbjct  346   LEGSFDPPNSYFGFKVSATETVTMSMKPWKFEQSAYGDSATLNWFLHDAVKGREVFSSRP  405

Query  1072  DNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWR  1248
                +   P A   +    R   A+R FTK+G ++ AG+E G  V W++    +G  ++W 
Sbjct  406   SKFELLQPRAWFRD----RDSSASRPFTKQGGVIFAGDEYGESVKWKVCGRALGKKMEWE  461

Query  1249  IGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             I G +WLTYWPN   T Y ETR +E+ + + LPL
Sbjct  462   IKGWIWLTYWPNKQRTFYSETRRLEFRELLYLPL  495



>ref|XP_004307695.1| PREDICTED: uncharacterized protein LOC101292549 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 115/378 (30%), Positives = 190/378 (50%), Gaps = 31/378 (8%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             FNL LL+ +F +C  +AP+   +   + IL   L    S+ A    ++    +G+++E  
Sbjct  130   FNLSLLALVFLVCIYEAPAALRSRCLN-ILKNYLADCWSRQAS---KSLMKLLGSNLEEE  185

Query  379   FMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHR  558
             +MR+    +  W++  +     L++ +P +   SY+   +GLW ++ Y PV AM      
Sbjct  186   WMRSMNLAITNWIVEHQAEQRTLKTPSPLF---SYAISTFGLWKVQLYCPVIAMDI----  238

Query  559   GERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGF  738
              E++  P   + +  L+++L +HQLE V+QF Y V        V  R D +RL    L  
Sbjct  239   -EKSSSP--SSGDERLQFSLNYHQLEGVLQFNYKV-------IVKERCDIVRLVNETL--  286

Query  739   NKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF-GD  915
                +  A   EKHFPSRI + V P   A+ V  +S+ +S+ N  +E+   K  +GSF   
Sbjct  287   -MRERGAGTGEKHFPSRISLQVTPTRQAN-VASVSVSKSSENPAREIGKEKGIEGSFEPP  344

Query  916   SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGD-DGP  1092
             +    ++  A       +K W++++   G +   +  L D+  G EV + KP       P
Sbjct  345   NPYLAIRVAANETITMSLKPWKFEESVYGYSANLNWFLHDSVDGREVFSSKPSKCKLINP  404

Query  1093  TAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLT  1272
              +   +    RY  A R FT++G ++ AG+E G GV W++ K  +G  ++W I G +WLT
Sbjct  405   KSWFRD----RYSSAYRPFTRQGGVIFAGDEYGEGVMWKVDKAAMGKTMEWEIRGWIWLT  460

Query  1273  YWPNHVNTSYYETRCVEW  1326
             YWPN   T Y ETR +E+
Sbjct  461   YWPNKHRTFYTETRRLEF  478



>ref|XP_010517460.1| PREDICTED: uncharacterized protein LOC104792899 [Camelina sativa]
Length=495

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 115/407 (28%), Positives = 189/407 (46%), Gaps = 47/407 (12%)
 Frame = +1

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
             S       FNL   + +F +C  +AP+        ++    +   S K + +++    V 
Sbjct  120   STSNLKDVFNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRKGSKLLM----VQ  175

Query  355   VGTDVELCFMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPV  531
             +G+++E  +MR+    +  W+I  EV     L+S +P +   SY+    GLW +  Y P+
Sbjct  176   LGSNLEEQWMRSLNLAITNWII--EVKAFQHLKSPSPLF---SYAFSTQGLWKVHMYCPL  230

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AM+        N        +  L ++L +HQLE VIQF + +   + +  +   +DN+
Sbjct  231   VAMEMESVNSALN--------DERLFFSLNYHQLEGVIQFNHKIYVREKWFNIAVNIDNV  282

Query  712   RLHVARLGFNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             R  + RL   K   D  +  +EKHFPSRI + + P +  S +  +S+ +S+ N   E E 
Sbjct  283   RCDIIRLVNEKLLSDRGMGTEEKHFPSRISLQLTPTI-QSNILMVSVQKSSENPLTEFEV  341

Query  886   HKIWKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
              K  + +    +    +K  A   T   MK W++++   G    Y A L          T
Sbjct  342   EKGIEAAIDPPNTFFGLKVSANETTTKSMKPWKFEEWVHG----YSANL----------T  387

Query  1063  WKPDNGDDGPTAVV--------MNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWR  1209
             W   + DDG             MN       RY  A R FTK+G +V AG+  G  V W+
Sbjct  388   WFLHDLDDGREVSSSKPSKVSRMNPRAWFKNRYSSAFRPFTKQGGVVFAGDSYGQSVLWK  447

Query  1210  LSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             + K  +G V+++ + G VWLTYWPN  +T Y +TR +E+ + + L L
Sbjct  448   VDKTAIGKVMEFEVKGCVWLTYWPNKHHTFYSDTRKLEFKEMLYLNL  494



>ref|XP_002278107.1| PREDICTED: uncharacterized protein LOC100263842 isoform X1 [Vitis 
vinifera]
 emb|CBI25414.3| unnamed protein product [Vitis vinifera]
Length=496

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 112/393 (28%), Positives = 192/393 (49%), Gaps = 26/393 (7%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   F L   +  F +   +AP++  +    + L   L +  S+ A  +L      +G++
Sbjct  124   FKDIFTLSFHTLTFLILIYEAPADLRSKCLTN-LKNQLAVSESREASKLLMRI---LGSN  179

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MR+    +  W++  +  G  L++ +P +   SY+    G+W ++ Y PV AM  
Sbjct  180   LEEQWMRSINLAITNWIVELQATGHALKTPSPLF---SYAISTVGMWKVQLYCPVIAMDV  236

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                       P   + +  + ++L +HQLE VIQF Y V   + +++V   +DNIR  V 
Sbjct  237   E--------NPSSSSPDERMLFSLNYHQLEGVIQFNYRVVVRERWVEVMVNIDNIRCDVV  288

Query  727   RLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWK  900
             RL      ++    V EKHFPSRI + + P +  + V  +S+ +S+ N  +E+   K  +
Sbjct  289   RLVSEALMTERGVGVAEKHFPSRISLQLTPAL-QTKVLSVSVSKSSENPTREIGLEKTIE  347

Query  901   GSF-GDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN  1077
             G F G S    +K  +       +K W++++   G +   +  L D+  G EV + KP  
Sbjct  348   GGFDGPSSYLGLKVSSAETMTMSLKPWKFEESVHGYSANLNWFLHDSVDGREVVSSKPSK  407

Query  1078  GDDGPTAVVMNN--LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRI  1251
                   A++        RY  A R FT++G +V AG+E G  V W++ +  +G  ++W I
Sbjct  408   -----IALIHPKAWFKDRYSSAYRPFTRQGGVVFAGDEYGENVRWKVDRTAMGKTMEWEI  462

Query  1252  GGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              G + LTYWPN   T Y ETR +E+ + + L L
Sbjct  463   KGSISLTYWPNKCRTFYNETRRLEFREILRLTL  495



>gb|AAD25673.1| hypothetical protein [Arabidopsis thaliana]
Length=401

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 114/407 (28%), Positives = 188/407 (46%), Gaps = 47/407 (12%)
 Frame = +1

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
             S       FNL   + +F +C  +AP+        ++    +   S + + +++    V 
Sbjct  26    STSNLKDVFNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRQGSKLLM----VQ  81

Query  355   VGTDVELCFMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPV  531
             +G+++E  +MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV
Sbjct  82    LGSNLEEQWMRSLNLAITNWII--EIKAFQHLKSPSPLF---SYAFSTQGLWKVHMYCPV  136

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AM+        N        +  L ++L +HQLE VIQ  + +   + +  V   +DN+
Sbjct  137   VAMEMESVNSSLN--------DERLFFSLNYHQLEGVIQLNHRIYVREKWFNVAVNIDNV  188

Query  712   RLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             R  + RL   K  S+     +EKHFPSRI + + P    S +  +S+ +S+ N   E E 
Sbjct  189   RCDIIRLVNEKLLSERGMGTEEKHFPSRISLQLTP-TNQSNILMVSVQKSSENPLTEFEV  247

Query  886   HKIWKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
              K  + +    +    +K  A   T   MK W++++   G    Y A L          T
Sbjct  248   EKGIEATIDPPNTFFGLKVSANETTTKSMKPWKFEEWVHG----YSANL----------T  293

Query  1063  WKPDNGDDG--------PTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWR  1209
             W   + DDG            +MN       RY  A R FTK+G +V AG+  G  V W+
Sbjct  294   WFLHDLDDGREVSSSKPSKVSMMNPRAWFKNRYSSAFRPFTKQGGVVFAGDSYGQSVLWK  353

Query  1210  LSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             + K  +G V+++ + G VWLTYWPN  +T Y +TR +E+ + + L L
Sbjct  354   VDKTAIGKVMEFEVKGCVWLTYWPNKHHTFYSDTRKLEFKEMLYLNL  400



>ref|NP_181570.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAT69214.1| hypothetical protein At2g40390 [Arabidopsis thaliana]
 gb|AEC09821.1| uncharacterized protein AT2G40390 [Arabidopsis thaliana]
Length=496

 Score =   143 bits (361),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 113/399 (28%), Positives = 187/399 (47%), Gaps = 47/399 (12%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             FNL   + +F +C  +AP+        ++    +   S + + +++    V +G+++E  
Sbjct  129   FNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRQGSKLLM----VQLGSNLEEQ  184

Query  379   FMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
             +MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV AM+    
Sbjct  185   WMRSLNLAITNWII--EIKAFQHLKSPSPLF---SYAFSTQGLWKVHMYCPVVAMEMESV  239

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
                 N        +  L ++L +HQLE VIQ  + +   + +  V   +DN+R  + RL 
Sbjct  240   NSSLN--------DERLFFSLNYHQLEGVIQLNHRIYVREKWFNVAVNIDNVRCDIIRLV  291

Query  736   FNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
               K  S+     +EKHFPSRI + + P    S +  +S+ +S+ N   E E  K  + + 
Sbjct  292   NEKLLSERGMGTEEKHFPSRISLQLTP-TNQSNILMVSVQKSSENPLTEFEVEKGIEATI  350

Query  910   GD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDD  1086
                +    +K  A   T   MK W++++   G    Y A L          TW   + DD
Sbjct  351   DPPNTFFGLKVSANETTTKSMKPWKFEEWVHG----YSANL----------TWFLHDLDD  396

Query  1087  G--------PTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS  1233
             G            +MN       RY  A R FTK+G +V AG+  G  V W++ K  +G 
Sbjct  397   GREVSSSKPSKVSMMNPRAWFKNRYSSAFRPFTKQGGVVFAGDSYGQSVLWKVDKTAIGK  456

Query  1234  VLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             V+++ + G VWLTYWPN  +T Y +TR +E+ + + L L
Sbjct  457   VMEFEVKGCVWLTYWPNKHHTFYSDTRKLEFKEMLYLNL  495



>ref|XP_010505767.1| PREDICTED: uncharacterized protein LOC104782517 [Camelina sativa]
Length=495

 Score =   143 bits (361),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 113/399 (28%), Positives = 188/399 (47%), Gaps = 47/399 (12%)
 Frame = +1

Query  199   FNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELC  378
             FNL   + +F +C  +AP+        ++    +   S K + +++    V +G+++E  
Sbjct  128   FNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRKGSKLLM----VQLGSNLEEQ  183

Query  379   FMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLH  555
             ++R+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV AM+    
Sbjct  184   WIRSLNLAITNWII--EIKAFQHLKSPSPLF---SYAFSTQGLWKVHMYCPVVAMEMESV  238

Query  556   RGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLG  735
                 N        +  L ++L +HQLE VIQF + +   + +  +   +DN+R  + RL 
Sbjct  239   NSALN--------DERLFFSLNYHQLEGVIQFNHRIYVREKWFNIAVNIDNVRCDIIRLV  290

Query  736   FNKSQDDAYV--DEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSF  909
               K   D  +  +EKHFPSRI + + P +  S +  +S+ +S+ N   E E  K  + + 
Sbjct  291   NEKLLSDRGMGTEEKHFPSRISLQLTPTI-QSNILMVSVQKSSENPLTEFEVEKGIEAAI  349

Query  910   GD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDD  1086
                +    +K  A   T   MK W++++   G    Y A L          TW   + DD
Sbjct  350   EPPNTFFGLKVSANETTTKSMKPWKFEEWVHG----YSANL----------TWFLHDLDD  395

Query  1087  GPTAVV--------MNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS  1233
             G             MN       RY  A R FTK+G +V AG+  G  V W++ K  +G 
Sbjct  396   GREVSSSKPSKVSRMNPRAWFKNRYSSAFRPFTKQGGVVFAGDSYGQSVLWKVDKTAIGK  455

Query  1234  VLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             V+++ + G VWLTYWPN  +T Y +TR +E+ + + L L
Sbjct  456   VMEFEVKGCVWLTYWPNKHHTFYSDTRKLEFKEMLYLNL  494



>ref|XP_010921044.1| PREDICTED: uncharacterized protein LOC105044746 [Elaeis guineensis]
Length=499

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 113/395 (29%), Positives = 183/395 (46%), Gaps = 26/395 (7%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             E F   FNL  L+  F +C  +AP+        ++          + + +++R     +G
Sbjct  122   EDFRDVFNLAFLTLAFLICIYEAPNNLRQGCLDTLRIQLTTSRCREASKLLVRV----LG  177

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
             +++E  +MR+    +   +   +      ++ +P +   SY+  A GLW ++ Y P+ AM
Sbjct  178   SNLEEQWMRSLNLAVTNLIQEFQTSNHSFKTPSPLF---SYAFSASGLWKVQLYCPIIAM  234

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                         P    ++  L ++L + QLE VIQ  Y V   + +I V   +DN+R  
Sbjct  235   SIE--------NPTATTQDERLLFSLKYQQLEGVIQLAYKVILRENWIDVVVTVDNVRCD  286

Query  721   VARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
             V  L      ++     +EKHFPSRI + + P + +  V  +S+ +S+ N   EV   K 
Sbjct  287   VNPLVSETLMAERGYGSEEKHFPSRISLQLTPTLQSD-VMSVSVSKSSENPHHEVGLEKA  345

Query  895   WKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
              +GSF   +    +K  A       MK W+++Q   G     +  L D   G EV + KP
Sbjct  346   LEGSFDPPNSYLGLKFSATETVTMSMKPWKFEQSAYGGGATLNWFLHDGVHGREVFSSKP  405

Query  1072  DNGDDGPTAVVMNN--LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKW  1245
                     A++        RY    R FTK+G ++ AG+E G  V W+L    +G  L+W
Sbjct  406   SK-----FALLQPRTWFRDRYSSVYRPFTKQGGVIFAGDEYGESVWWKLCGGALGKKLEW  460

Query  1246  RIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              I G +WLTYWPN   T Y ETR +E+ + + LPL
Sbjct  461   EIKGRIWLTYWPNRQRTFYSETRRLEFRESLYLPL  495



>gb|AAM76762.1| hypothetical protein [Arabidopsis thaliana]
Length=496

 Score =   141 bits (355),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 112/398 (28%), Positives = 186/398 (47%), Gaps = 47/398 (12%)
 Frame = +1

Query  202   NLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDVELCF  381
             NL   + +F +C  +AP+        ++    +   S + + +++    V +G+++E  +
Sbjct  130   NLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRQGSKLLM----VQLGSNLEEQW  185

Query  382   MRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKCTLHR  558
             MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV AM+     
Sbjct  186   MRSLNLAITNWII--EIKAFQHLKSPSPLF---SYAFSTQGLWKVHMYCPVVAMEMESVN  240

Query  559   GERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGF  738
                N        +  L ++L +HQLE VIQ  + +   + +  V   +DN+R  + RL  
Sbjct  241   SSLN--------DERLFFSLNYHQLEGVIQLNHRIYVREKWFNVAVNIDNVRCDIIRLVN  292

Query  739   NK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFG  912
              K  S+     +EKHFPSRI + + P    S +  +S+ +S+ N   E E  K  + +  
Sbjct  293   EKLLSERGMGTEEKHFPSRISLQLTP-TNQSNILMVSVQKSSENPLTEFEVEKGIEATID  351

Query  913   D-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDG  1089
               +    +K  A   T   MK W++++   G    Y A L          TW   + DDG
Sbjct  352   PPNTFFGLKVSANETTTKSMKPWKFEEWVHG----YSANL----------TWFLHDLDDG  397

Query  1090  --------PTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSV  1236
                         +MN       RY  A R FTK+G +V AG+  G  V W++ K  +G V
Sbjct  398   REVSSSKPSKVSMMNPRAWFKNRYSSAFRPFTKQGGVVFAGDSYGQSVLWKVDKTAIGKV  457

Query  1237  LKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +++ + G VWLTYWPN  +T Y +TR +E+ + + L L
Sbjct  458   MEFEVKGCVWLTYWPNKHHTFYSDTRKLEFKEMLYLNL  495



>ref|XP_010534631.1| PREDICTED: uncharacterized protein LOC104810129 isoform X1 [Tarenaya 
hassleriana]
Length=502

 Score =   140 bits (353),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 119/413 (29%), Positives = 194/413 (47%), Gaps = 51/413 (12%)
 Frame = +1

Query  169   SHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFF  348
             S SP   +  FNL   + +F +C  +AP     +  ++I    +   S + + +++    
Sbjct  120   SSSPN-LADVFNLGFHTFVFLVCIYEAPISLRTVCLNTIKNQLVTCRSRQGSKLLM----  174

Query  349   VTVGTDVELCFMRTFGYMLAKWLILREVGGVG----LQSLTPQYLGISYSTEAYGLWILK  516
             V +G+++E  +MR+    +  W++  E+        LQS +P +   SY     GLW + 
Sbjct  175   VQLGSNLEELWMRSLNLAITNWMV--EIRAAKQRPLLQSPSPLF---SYGFSTQGLWKVH  229

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              Y PV AM       E    P     +  L ++L +HQLE VIQF + +   D +I V  
Sbjct  230   LYCPVIAM-------EMENSPSSGLNDERLFFSLNYHQLEGVIQFNHRIFVHDKWINVAV  282

Query  697   RLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
              +DN+R  V RL      S+     +EKHFPSRI + + P V  S +  +S+ +S+ N  
Sbjct  283   NIDNVRCDVIRLVNETLLSERGYGAEEKHFPSRISLRLTPTV-QSNILMVSVTKSSENPT  341

Query  871   KEVETHKIWKGSFG-DSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTG  1047
             +E E  K ++ +    +    +K  A   T T +K W++++   G    Y A L      
Sbjct  342   REFEVEKGFEATVDPPNTFFGLKVSAGETTTTSLKPWKFEEWVNG----YSANL------  391

Query  1048  IEVATWKPDNGDDG--------PTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGT  1194
                 TW   + DDG            +MN       RY  A R F ++G +V AG+  G 
Sbjct  392   ----TWFLHDADDGREVSSSKPSKVSLMNPRAWFKNRYSSAFRPFNRQGGVVFAGDNYGQ  447

Query  1195  GVGWRLSK-EMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
              V W++ K    G V+++ + G +WLTYWPN  +T Y +TR +E+ + + L L
Sbjct  448   SVLWKVDKAAAAGKVMEFELRGCIWLTYWPNRHHTFYNDTRKLEFREMLYLNL  500



>emb|CDX74793.1| BnaA05g05390D [Brassica napus]
Length=487

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 114/404 (28%), Positives = 193/404 (48%), Gaps = 41/404 (10%)
 Frame = +1

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
             S       FNL   + +F +C  +APS        ++    +   S + + +++    V 
Sbjct  112   STSNLKDVFNLAFFTFVFLICIYEAPSSLRTTCLKTVKDQLVTCRSRQGSKLLM----VQ  167

Query  355   VGTDVELCFMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPV  531
             +G+++E  +MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV
Sbjct  168   LGSNLEEQWMRSLNLAMTNWII--EIRAYQHLKSPSPLF---SYAFSTQGLWKVHMYCPV  222

Query  532   RAMKCTLHRGERNPFPVIEAKESALR-----YALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              AM+             +E+  SAL      ++L +HQLE VIQF + +   + +  +  
Sbjct  223   IAME-------------MESVNSALTDERLFFSLNYHQLEGVIQFNHRIYVREMWFNIAV  269

Query  697   RLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
              +DN+R  + RL   K  S+    ++EKHFPS+I + + P V ++ +   S+ +S+ N  
Sbjct  270   NIDNVRCDIIRLVNEKLLSERGMGLEEKHFPSKISLQLTPTVQSNILMA-SVEKSSENPL  328

Query  871   KEVETHKIWKGSFGDSKVPKMKAVARMATKTK-MKNWRWDQDTEGNAVVYDATLCDNQTG  1047
             ++ E  K  + +           V+   TKTK MK W+++Q   G        L D   G
Sbjct  329   RQFEVEKGIEATIDPPNTFFGLKVSANETKTKSMKPWKFEQWVHGCTAYLTWFLHDFDDG  388

Query  1048  IEVATWKPDNGDDGPTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSK  1218
              EV++             +MN       RY  A R FTK+G +V AG+  G  V W++ K
Sbjct  389   REVSS------SKPSKVSMMNPRAWFKNRYTNAFRPFTKQGGVVFAGDSYGQSVLWKVDK  442

Query  1219  EMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
               +G V+++ + G V LTYWPN  +T Y +TR +E+ + + L L
Sbjct  443   RAIGKVMEFEVKGCVCLTYWPNKHHTFYSDTRRLEFKEMLYLNL  486



>ref|XP_008804150.1| PREDICTED: uncharacterized protein LOC103717503 [Phoenix dactylifera]
Length=499

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 116/396 (29%), Positives = 184/396 (46%), Gaps = 28/396 (7%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSK---PAPVVLRTFFV  351
             E F   FNL  L+  F +C  +AP+        ++    +++ SS+    + +++R    
Sbjct  122   EDFRDVFNLAFLTLAFLICIYEAPNNLRQGCLDTL---RIQLTSSRCREASKLLVRV---  175

Query  352   TVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPV  531
              +G+++E  +MR+    +  W+  +E         TP  L  SY+  A GLW ++ Y P+
Sbjct  176   -LGSNLEEQWMRSLNLAITNWI--QEFQPFNHSFKTPSPL-FSYAFSASGLWKVQLYCPI  231

Query  532   RAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNI  711
              AM            P    ++  L ++L + QLE VIQ  Y V   + +I V   +DN+
Sbjct  232   IAMSIE--------NPTAATQDERLLFSLKYQQLEGVIQLAYKVIIRENWIDVVVNVDNV  283

Query  712   RLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVET  885
             R  V  L      ++     +EKHFPSRI + + P + +  +       S N I  EV  
Sbjct  284   RCDVNPLVSETLMAERGYGTEEKHFPSRISLRLTPTLQSDVMSVSVSKSSDNPIH-EVGL  342

Query  886   HKIWKGSFGD-SKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVAT  1062
              K  +GSF   +     K  A       MK W+++Q   G + + +  L D   G EV +
Sbjct  343   EKTLEGSFDPPNSYLGFKVSATETVTMSMKPWKFEQSAHGGSAILNWFLRDGVHGREVFS  402

Query  1063  WKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
              KP             +   RY  A R FTK+G ++ AG+E G  V W++    +G  ++
Sbjct  403   SKPSKLSLLQPRTWFRD---RYSSAYRPFTKRGGVIFAGDEYGESVWWKVCGGALGKKME  459

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             W I G +WLTYWPN   T Y ETR +E+ + + LPL
Sbjct  460   WEIKGWIWLTYWPNRQRTFYSETRRLEFREMLYLPL  495



>ref|XP_010658215.1| PREDICTED: uncharacterized protein LOC100263842 isoform X2 [Vitis 
vinifera]
Length=484

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 111/390 (28%), Positives = 186/390 (48%), Gaps = 32/390 (8%)
 Frame = +1

Query  187   FSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTD  366
             F   F L   +  F +   +AP++  +    + L   L +  S+ A  +L      +G++
Sbjct  124   FKDIFTLSFHTLTFLILIYEAPADLRSKCLTN-LKNQLAVSESREASKLLMRI---LGSN  179

Query  367   VELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAMKC  546
             +E  +MR+    +  W++  +  G  L++ +P +   SY+    G+W ++ Y PV AM  
Sbjct  180   LEEQWMRSINLAITNWIVELQATGHALKTPSPLF---SYAISTVGMWKVQLYCPVIAMDV  236

Query  547   TLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVA  726
                       P   + +  + ++L +HQLE VIQF Y V        V  R D +RL   
Sbjct  237   E--------NPSSSSPDERMLFSLNYHQLEGVIQFNYRV-------VVRERCDVVRLVSE  281

Query  727   RLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGS  906
              L    ++    V EKHFPSRI + + P +  + V  +S+ +S+ N  +E+   K  +G 
Sbjct  282   AL---MTERGVGVAEKHFPSRISLQLTPAL-QTKVLSVSVSKSSENPTREIGLEKTIEGG  337

Query  907   F-GDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDN-G  1080
             F G S    +K  +       +K W++++   G +   +  L D+  G EV + KP    
Sbjct  338   FDGPSSYLGLKVSSAETMTMSLKPWKFEESVHGYSANLNWFLHDSVDGREVVSSKPSKIA  397

Query  1081  DDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGE  1260
                P A   +    RY  A R FT++G +V AG+E G  V W++ +  +G  ++W I G 
Sbjct  398   LIHPKAWFKD----RYSSAYRPFTRQGGVVFAGDEYGENVRWKVDRTAMGKTMEWEIKGS  453

Query  1261  VWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             + LTYWPN   T Y ETR +E+ + + L L
Sbjct  454   ISLTYWPNKCRTFYNETRRLEFREILRLTL  483



>ref|XP_009143218.1| PREDICTED: uncharacterized protein LOC103866952 [Brassica rapa]
Length=496

 Score =   137 bits (345),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 116/402 (29%), Positives = 194/402 (48%), Gaps = 37/402 (9%)
 Frame = +1

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
             S       FNL   + +F +C  +APS        ++    +   S + + +++    V 
Sbjct  121   STSNLKDVFNLAFFTFVFLICIYEAPSSLRTTCLKTVKDQLVTCRSRQGSKLLM----VQ  176

Query  355   VGTDVELCFMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYAPV  531
             +G+++E  +MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y PV
Sbjct  177   LGSNLEEQWMRSLNLAMTNWII--EIRAYQHLKSPSPLF---SYAFSTQGLWKVHMYCPV  231

Query  532   RAMKCTLHRGERNPFPVIEAKESALR-----YALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              AM+             +E+  SAL      ++L +HQLE VIQF + +   + +  +  
Sbjct  232   IAME-------------MESVNSALTDERLFFSLNYHQLEGVIQFNHRIYVREMWFNIAV  278

Query  697   RLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
              +DN+R  + RL      S+    ++EKHFPS+I + + P V ++ +   S+ +S+ N  
Sbjct  279   NIDNVRCDIIRLVNETLLSERGMGLEEKHFPSKISLQLTPTVQSNILMA-SVEKSSENPL  337

Query  871   KEVETHKIWKGSFGDSKVPKMKAVARMATKTK-MKNWRWDQDTEGNAVVYDATLCDNQTG  1047
             ++ E  K  + +           V+   TKTK MK W+++Q   G        L D   G
Sbjct  338   RQFEVEKGIEATIDPPNTFFGLKVSANETKTKSMKPWKFEQWVHGCTAYLTWFLHDFDDG  397

Query  1048  IEVATWKPDNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEM  1224
              EV++ KP       P A   N    RY  A R FTK+G +V AG+  G  V W++ K  
Sbjct  398   REVSSSKPSKVSMMNPRAWFKN----RYTNAFRPFTKQGGVVFAGDSYGQSVLWKVDKRA  453

Query  1225  VGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +G V+++ + G V LTYWPN  +T Y +TR +E+ + + L L
Sbjct  454   IGKVMEFEVKGCVCLTYWPNKHHTFYSDTRRLEFKEMLYLNL  495



>emb|CDY18872.1| BnaC04g04780D [Brassica napus]
Length=496

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 116/417 (28%), Positives = 194/417 (47%), Gaps = 57/417 (14%)
 Frame = +1

Query  160   MLDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLR  339
             M +  S       FNL   + +F +C  +AP+        ++    +   S + + +++ 
Sbjct  116   MQNIGSTSNLKDVFNLAFFTFVFLICIYEAPTSLRTTCLKTVKDQLVTCRSRQGSKLLM-  174

Query  340   TFFVTVGTDVELCFMRTFGYMLAKWLILREV-GGVGLQSLTPQYLGISYSTEAYGLWILK  516
                V +G+++E  +MR+    +  W+I  E+     L+S +P +   SY+    GLW + 
Sbjct  175   ---VQLGSNLEEQWMRSLNLAITNWII--EIRASQHLKSPSPLF---SYAFSTQGLWKVH  226

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALR-----YALAHHQLEAVIQFEYTVGYFDGF  681
              Y PV AM+             +E+  SAL      ++L +HQLE VIQF + +   + +
Sbjct  227   MYCPVIAME-------------MESVNSALTDERLFFSLNYHQLEGVIQFNHRIYVREKW  273

Query  682   IQVNARLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQS  855
               +   +DN+R  + RL      S+    ++EKHFPS+I + + P V ++ +   S  +S
Sbjct  274   FNIAVNIDNVRCDIIRLVNETLLSERGMGLEEKHFPSKISLQLTPTVQSNILMA-SAEKS  332

Query  856   TNNIEKEVETHKIWKGSFGDSKVPKMKAVARMATKTK-MKNWRWDQDTEGNAVVYDATLC  1032
             + N  ++ E  K  + +           V+   TKTK MK W ++Q   G    Y A L 
Sbjct  333   SENPLRQFEAEKGIEATIDPPNTFFGLKVSANETKTKSMKPWIFEQWVHG----YTAYL-  387

Query  1033  DNQTGIEVATWKPDNGDDG--------PTAVVMNN---LGRRYRGANRGFTKKGSLVIAG  1179
                      TW   + DDG            +MN       RY  A R FTK+G +V AG
Sbjct  388   ---------TWFLHDFDDGREVSSSKPSKVSMMNPRAWFKNRYTNAFRPFTKQGGVVFAG  438

Query  1180  EESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             +  G  V W++ K  +G V+++ + G V LTYWPN  +T Y +TR +E+ + + L L
Sbjct  439   DSYGQSVLWKVDKRAIGKVMEFEVKGCVCLTYWPNKHHTFYSDTRKLEFKEMLYLNL  495



>ref|XP_009406907.1| PREDICTED: uncharacterized protein LOC103989693 [Musa acuminata 
subsp. malaccensis]
Length=499

 Score =   132 bits (331),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 114/394 (29%), Positives = 186/394 (47%), Gaps = 24/394 (6%)
 Frame = +1

Query  181   ETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVG  360
             + F    NL  L+  F +C  +AP +   L    + A  L++ S+      L+     +G
Sbjct  122   KNFRDVLNLSFLTLTFLICIYEAPYD---LRCGCLDALRLQL-SNPTCRDALKLLVRMLG  177

Query  361   TDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
             +++E  +MR+    +  W++  +     +++++P +   SY+  A GLW ++ Y PV AM
Sbjct  178   SNLEEQWMRSLNLGMTNWMVELQSLNQSVRAISPLF---SYALSASGLWKVQVYCPVIAM  234

Query  541   KCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLH  720
                         P    ++  L ++L + QLEAVIQ  Y V     +I +   +DNIR  
Sbjct  235   SLE--------DPSATTQDERLLFSLRYQQLEAVIQLAYKVIVKQNWIDIVVAVDNIRCD  286

Query  721   VARLGFNKSQDD-AY-VDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKI  894
             V  L      D+  Y   EKHFPSRI + V P    S V  +S+ +S++N  +E+   K 
Sbjct  287   VISLVSETLMDERGYGSGEKHFPSRISLQVTP-THQSDVVSVSVSKSSDNPTQEIGLEKA  345

Query  895   WKGSFGDSKVPKMKAVARMATKT-KMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKP  1071
              +G+F          V+   T T  +K W+++Q   G +   +  L D   G EV + KP
Sbjct  346   LEGAFEPPGTYLGLRVSTTETVTVSVKPWKFEQSVHGASGKLNWFLHDGMNGREVFSSKP  405

Query  1072  DNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWR  1248
                    P A   +    RY    R FTK+G ++ AG+E G  V W++     G  + W 
Sbjct  406   SKFSLLQPKAWFRD----RYSSVYRPFTKEGGVIFAGDEYGESVWWKVGAGAFGKTMGWE  461

Query  1249  IGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             I G + +TYWPN   + Y ETR +++ + + L L
Sbjct  462   IKGTIGITYWPNKQRSFYSETRNLQFKELIYLNL  495



>gb|KFK29797.1| hypothetical protein AALP_AA7G180800 [Arabis alpina]
Length=323

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 168/347 (48%), Gaps = 39/347 (11%)
 Frame = +1

Query  349   VTVGTDVELCFMRTFGYMLAKWLILREVGGVG-LQSLTPQYLGISYSTEAYGLWILKGYA  525
             V +G+++E  +MR+    +  W+I  E+     L+S +P +   SY+    GLW +  Y 
Sbjct  2     VQLGSNLEEQWMRSLNLAITNWII--EIKAFQHLKSPSPLF---SYAFSTQGLWKVNMYC  56

Query  526   PVRAMKCTLHRGERNPFPVIEAKESALR-----YALAHHQLEAVIQFEYTVGYFDGFIQV  690
             PV AM+             IE   SAL      ++L +HQLE VIQF + +   + +  +
Sbjct  57    PVVAME-------------IENVNSALTDERLFFSLNYHQLEGVIQFNHRIYVREKWFNI  103

Query  691   NARLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNN  864
                +DN+R  + RL      S+     +EKHFPSRI + + P    S +  +S+ +S+ N
Sbjct  104   AVNVDNVRCDIIRLVNETLLSERGMGTEEKHFPSRISLQLTP-TNQSNILMVSVQKSSEN  162

Query  865   IEKEVETHKIWKGSFGDSKVPK----MKAVARMATKTKMKNWRWDQDTEGNAVVYDATLC  1032
               +E E  K   G     + P     +K  A   T   MK W++++   G +      L 
Sbjct  163   PLREFEVEK---GIEATIEPPNTFFGLKVSANETTTKSMKPWKFEEWVHGASANLTWFLH  219

Query  1033  DNQTGIEVATWKPDNGDD-GPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWR  1209
             D   G EV++ KP       P A   N    RY  A R FTK+G +V AG+  G  V  +
Sbjct  220   DLDDGREVSSSKPSKVSVMNPRAWFKN----RYSSAFRPFTKQGGVVFAGDSYGQSVLLK  275

Query  1210  LSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             + K   G V+++ I G VWLTYWPN  +T Y +TR +E+ + + L L
Sbjct  276   VDKTASGKVMEFEIKGCVWLTYWPNKHHTFYSDTRKLEFKEMLYLNL  322



>ref|XP_010485309.1| PREDICTED: uncharacterized protein LOC104763662 [Camelina sativa]
Length=265

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 136/276 (49%), Gaps = 20/276 (7%)
 Frame = +1

Query  544   CTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHV  723
             C   +   NP       +S L ++L  +QLE V+QF + V     +I V  ++DNIR  V
Sbjct  2     CGFTQRSSNPMA-----DSRLLFSLKFNQLEGVMQFNHKVIVRYKWIDVIVKIDNIRYDV  56

Query  724   ARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIW  897
              +L   K  S+  A   EKHFPSRI + + P +   ++       S N   +E E  +  
Sbjct  57    IKLVNEKLMSRRGAGEHEKHFPSRISLQLTPTLQTDFISVSVSKSSNNP-GREFEVERSI  115

Query  898   KGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEG-----NAVVYDATLCDNQTGIEVAT  1062
             +GSF       ++   R A+   M  W+++Q   G     N ++YD+++     G EV +
Sbjct  116   EGSFDPPNSLGLRVAGREASTMTMTPWKFEQSVLGYTANLNWILYDSSVG----GREVFS  171

Query  1063  WKPDNGDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLK  1242
              KP             +   RY  A R FT++G ++ AG+E G  V W++ K  +G  ++
Sbjct  172   TKPSRFSIMSPRSWFKD---RYARAYRSFTRRGGVIFAGDEYGETVVWKIGKGALGRRME  228

Query  1243  WRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPL  1350
             W I G +WLTYWPN   T Y+ETR +E+   ++L +
Sbjct  229   WEIKGFIWLTYWPNKYKTFYHETRRLEFTQLLNLTI  264



>gb|EMS47870.1| hypothetical protein TRIUR3_17972 [Triticum urartu]
Length=443

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 121/244 (50%), Gaps = 8/244 (3%)
 Frame = +1

Query  628   QLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVW  801
             QLE V+Q  Y     D +I +  ++DNIR  V  L      ++     +EKHFPSR+ + 
Sbjct  201   QLEGVVQLAYKTVRRDNWIDIEVKVDNIRCDVDPLVSETLMAERGYGSEEKHFPSRVMLQ  260

Query  802   VGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWR  981
             + P +  + V  +S+ +S++N   E    K ++GSF       +KA    +    MK W+
Sbjct  261   ITP-MQQTDVLSVSVSKSSDNPTHEFGIEKGFEGSFDPPNSFGLKASVTESLTLAMKPWK  319

Query  982   WDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDD-GPTAVVMNNLGRRYRGANRGFTKK  1158
             ++Q   GN    +  L D   G EV   KP       P A   +    RY  A R FTK+
Sbjct  320   FEQSVHGNTATLNWFLHDGMNGREVCASKPSKLSLLQPRAWFRD----RYSNAYRPFTKQ  375

Query  1159  GSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEV  1338
             G ++ A +E G  V W++    +G  + W I G +WLTYWPN   TS+ ETR  E+ + +
Sbjct  376   GGIIFARDEYGDSVNWKVCGAALGKTMDWEIRGWIWLTYWPNKQRTSHSETRWFEFRECL  435

Query  1339  DLPL  1350
              LPL
Sbjct  436   QLPL  439



>ref|XP_006657576.1| PREDICTED: uncharacterized protein LOC102720614 [Oryza brachyantha]
Length=502

 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 109/400 (27%), Positives = 178/400 (45%), Gaps = 30/400 (8%)
 Frame = +1

Query  175   SPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVT  354
             S E     F+L  L+    +C  +APS A      ++ A  +       A        + 
Sbjct  119   SEEDSGKIFSLAALTLGLMVCVYEAPSTARRELVGAVSAQLMHADMRGAA----EKLMLA  174

Query  355   VGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYG--LWILKGYAP  528
             +G  +E  +MR+       W++     G G+  + P +   SY+  A    LW ++ Y P
Sbjct  175   MGPGMEEQWMRSLNLAATNWVMEARRSG-GMSPVLP-FRVFSYAVLAASRRLWKVRLYCP  232

Query  529   VRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDN  708
             V AM       ER   P    K+  L ++L +  LEA IQF Y+V + + +I VN  +D+
Sbjct  233   VVAMVV-----ER---PAHRTKDEKLLFSLNYQHLEAAIQFVYSVTFREEWIDVNVNVDS  284

Query  709   IRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVE  882
             IR  + RL      ++     DEKHFPSRI + + P V  + V  L+L +ST +    V 
Sbjct  285   IRCELVRLVSETLMAKQGYGSDEKHFPSRISLQLRPLV-QTDVLSLTLRRSTED--SPVR  341

Query  883   THKIWKGSFGDSKVPKMKAVA--RMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
                +  G  G +  P   A++  R AT+T +  W  +    G+    + +L  +  G E 
Sbjct  342   EADMESGLDGAAPAPTGIAMSAHRTATRT-LGPWNSEHSVHGDTASLNWSL--HGGGAEG  398

Query  1057  ATWKPDNGDDGPTAVVMNNLGRRYRGANRG----FTKKGSLVIAGEESGTGVGWRLSKEM  1224
                +  +G+     ++      R R  N G      + G ++ AG+E G G  WR+    
Sbjct  399   REREAFSGEPPKLELLQPRSWFRNRCTNPGRPPATARGGGVMFAGDEHGEGACWRMGAAT  458

Query  1225  VGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
              G  ++W I G VW+TY P+     + ETR +E+ + + L
Sbjct  459   AGKTVEWEIKGSVWVTYCPSKRRAVHAETRRLEFREVMRL  498



>ref|XP_010534632.1| PREDICTED: uncharacterized protein LOC104810129 isoform X2 [Tarenaya 
hassleriana]
Length=465

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 101/365 (28%), Positives = 164/365 (45%), Gaps = 50/365 (14%)
 Frame = +1

Query  169   SHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFF  348
             S SP   +  FNL   + +F +C  +AP     +  ++I    +   S + + +++    
Sbjct  120   SSSPN-LADVFNLGFHTFVFLVCIYEAPISLRTVCLNTIKNQLVTCRSRQGSKLLM----  174

Query  349   VTVGTDVELCFMRTFGYMLAKWLILREVGGVG----LQSLTPQYLGISYSTEAYGLWILK  516
             V +G+++E  +MR+    +  W++  E+        LQS +P +   SY     GLW + 
Sbjct  175   VQLGSNLEELWMRSLNLAITNWMV--EIRAAKQRPLLQSPSPLF---SYGFSTQGLWKVH  229

Query  517   GYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNA  696
              Y PV AM       E    P     +  L ++L +HQLE VIQF + +   D +I V  
Sbjct  230   LYCPVIAM-------EMENSPSSGLNDERLFFSLNYHQLEGVIQFNHRIFVHDKWINVAV  282

Query  697   RLDNIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIE  870
              +DN+R  V RL      S+     +EKHFPSRI + + P V  S +  +S+ +S+ N  
Sbjct  283   NIDNVRCDVIRLVNETLLSERGYGAEEKHFPSRISLRLTPTV-QSNILMVSVTKSSENPT  341

Query  871   KEVETHKIWKGSFG-DSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTG  1047
             +E E  K ++ +    +    +K  A   T T +K W++++   G    Y A L      
Sbjct  342   REFEVEKGFEATVDPPNTFFGLKVSAGETTTTSLKPWKFEEWVNG----YSANL------  391

Query  1048  IEVATWKPDNGDDG--------PTAVVMNN---LGRRYRGANRGFTKKGSLVIAGEESGT  1194
                 TW   + DDG            +MN       RY  A R F ++G +V AG+  G 
Sbjct  392   ----TWFLHDADDGREVSSSKPSKVSLMNPRAWFKNRYSSAFRPFNRQGGVVFAGDNYGQ  447

Query  1195  GVGWR  1209
              V W+
Sbjct  448   SVLWK  452



>gb|KHN31316.1| hypothetical protein glysoja_022970 [Glycine soja]
Length=419

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 103/379 (27%), Positives = 164/379 (43%), Gaps = 66/379 (17%)
 Frame = +1

Query  163   LDSHSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRT  342
             LDS + +  S  FNL   + LF +   +AP+        S L  +L  F S+ A  ++  
Sbjct  99    LDSTASDNLSDVFNLSFFTLLFLVYIYEAPAADFRSGCISNLKDHLIGFQSRQASHMIMK  158

Query  343   FFVTVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGY  522
                 +G+++E  +MR+    L   L++ +V               S S+ A         
Sbjct  159   L---LGSNLEELWMRSLNLALYCHLMVMDVEN-------------SKSSPA---------  193

Query  523   APVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARL  702
                          ER            L+++L +H +E V+QF + V   D + ++   +
Sbjct  194   ------------SER------------LQFSLRYHHVEGVLQFNHKVLIKDEWAEIMVDI  229

Query  703   DNIRLHVARL--GFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKE  876
             DN+R  V +L   F   Q  A   EKHFPSRI + + P +    V  LS+G+S+ N  KE
Sbjct  230   DNVRCDVIKLVNEFLMKQRGAGAAEKHFPSRISLQLTPTI-QDQVLSLSVGKSSENPRKE  288

Query  877   VETHKIWKGSFGDSKVPKMKAVARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEV  1056
             +   K  + SF  S    +K  A  + +  +          G +   +  L D+  G EV
Sbjct  289   IGVDKSVEASFEASNPLALKVSAGESPQPLVY---------GYSANLNWFLHDSVDGKEV  339

Query  1057  ATWKPDN-GDDGPTAVVMNNLGRRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGS  1233
              + KP       P +   N    RY  A R F K+G ++ AG+E G  V W++ K  +G 
Sbjct  340   LSSKPSKFAMLNPKSWFKN----RYSSAYRPFNKEGWVIFAGDEYGKKVWWKVDKGAIGK  395

Query  1234  VLKWRIGGEVWLTYWPNHV  1290
               +W+I G +WLTYW N +
Sbjct  396   TTEWKIRGWIWLTYWSNKM  414



>gb|EMT01982.1| hypothetical protein F775_12130 [Aegilops tauschii]
Length=379

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 72/117 (62%), Gaps = 1/117 (1%)
 Frame = +1

Query  190  SSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTVGTDV  369
            S  F+L LL RLFWLCA +AP++ G L+F + L  ++E   +  AP  L    + VG DV
Sbjct  136  SPLFSLALLMRLFWLCALEAPADLGFLFFRA-LGTDIERALAGCAPAALGALLLAVGPDV  194

Query  370  ELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRAM  540
            E  FMR+ GYMLAKW +LRE+         P    +SY+   +GLW+L+GYAPV A+
Sbjct  195  EEQFMRSLGYMLAKWCLLREMQSAPKPPAKPDVACLSYAANVHGLWVLRGYAPVLAI  251



>ref|XP_008456896.1| PREDICTED: uncharacterized protein LOC103496710 isoform X2 [Cucumis 
melo]
Length=377

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 107/213 (50%), Gaps = 18/213 (8%)
 Frame = +1

Query  184  TFSS--FFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFVTV  357
            TF+S   FNL+ L+ +F +C  +AP+        ++       +S + + V    F   +
Sbjct  122  TFTSKEIFNLIFLTLIFLICIYEAPTSLRLDGLTTVKYHLANCWSRQTSKV----FMKLL  177

Query  358  GTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPVRA  537
            G+++E  +MR+    +  W++  +     L++ +P +   SYS   +GLW ++ Y PV A
Sbjct  178  GSNLEEQWMRSINLAITNWILELKANCCTLKTPSPLF---SYSYSTHGLWKVQLYCPVIA  234

Query  538  MKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRL  717
            M       E +  P  + +   L+++L +HQLE V+QF Y     + +I +   +DNIR 
Sbjct  235  MD----HIENSSSPSTDER---LQFSLNYHQLEGVLQFNYKAEVHEKWINLRVHVDNIRC  287

Query  718  HVARLGFNK--SQDDAYVDEKHFPSRIRVWVGP  810
             + +L  +   S+      EKHFPSRI + + P
Sbjct  288  SIIQLVNDTLMSKRGVGRSEKHFPSRISLQITP  320



>gb|EMS57742.1| hypothetical protein TRIUR3_24153 [Triticum urartu]
Length=447

 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 98/217 (45%), Gaps = 9/217 (4%)
 Frame = +1

Query  172  HSPETFSSFFNLVLLSRLFWLCACDAPSEAGALYFHSILAPNLEMFSSKPAPVVLRTFFV  351
            H  E      +L +L+  F +C  +APS     +  +I A      +        R   +
Sbjct  119  HVSEGSGKILSLSVLALAFLVCIYEAPSTPRREFIGAITA----RLTRDEMRHAARELML  174

Query  352  TVGTDVELCFMRTFGYMLAKWLILREVGGVGLQSLTPQYLGISYSTEAYGLWILKGYAPV  531
             +G+D+E  +MR+    +  W +     G G  S   ++   SY+  A  LW ++ Y PV
Sbjct  175  ALGSDLEEQWMRSLNLGVTNWAMEALRSGAGTSSPL-RFAVFSYALSASRLWKVQLYCPV  233

Query  532  RAMKCTLHRGERNPFPVIE--AKESALRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLD  705
             AM    H    +         K+  L ++L + QLE+VIQF Y V + + +I V   +D
Sbjct  234  VAMTMENHPSHHHHQQQQHQLVKDERLLFSLNYQQLESVIQFTYRVAFQENWIDVAVNVD  293

Query  706  NIRLHVARLGFNK--SQDDAYVDEKHFPSRIRVWVGP  810
            NIR  V +L      ++     DEKHFPSRI + + P
Sbjct  294  NIRCDVIQLVSETLMARQGHGSDEKHFPSRISLQLTP  330


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +1

Query  1123  RYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSY  1302
             RY   +R FT+ G ++ AG+E G GV WR+     G  ++W I G +W+TYWPN   T +
Sbjct  370   RYTSPSRPFTRSGGVIFAGDEYGEGVCWRMCAAAAGKTMEWEIKGRIWVTYWPNKKRTLH  429

Query  1303  YETRCVEWCDEVDLPL  1350
              ETR +E+ + + L +
Sbjct  430   TETRRLEFRELLHLTI  445



>gb|AFK40645.1| unknown [Lotus japonicus]
Length=201

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 67/129 (52%), Gaps = 11/129 (9%)
 Frame = +1

Query  970   KNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNN----LGRRYRGA  1137
             K W+++Q   G +   +  L D+  G EV + K        + + + N       RY  A
Sbjct  77    KPWKFEQSVYGYSANLNWFLHDSMDGKEVFSTKL-------SKIALVNPKSWFKDRYSSA  129

Query  1138  NRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRC  1317
              R FT++G ++ AG+E G  V W++ K  +G  ++W I G +WL Y PN   T Y+ETR 
Sbjct  130   YRPFTRQGGVIFAGDEYGESVCWKVDKSTIGKKMEWGIRGWIWLRYLPNKYKTFYHETRR  189

Query  1318  VEWCDEVDL  1344
             +E+ + V L
Sbjct  190   LEFREIVHL  198



>gb|AET79249.1| hypothetical protein [Glycine max]
Length=298

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 3/116 (3%)
 Frame = +1

Query  604  LRYALAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARL--GFNKSQDDAYVDEKH  777
            L+++L +H +E V+QF + V   D + ++   +DN+R  V  L   F   Q  A   EKH
Sbjct  131  LQFSLRYHHVEGVLQFNHKVLIKDEWAEIMVDIDNVRCDVIELVNEFLMKQRGAGAAEKH  190

Query  778  FPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEVETHKIWKGSFGDSKVPKMKAVA  945
            FPSRI + + P +    V  LS+G+S+ N  KE+   K  + SF  S    +K  A
Sbjct  191  FPSRISLQLTPTI-QDQVLSLSVGKSSENPRKEIGVDKSVEASFEASNPLALKVSA  245



>ref|XP_001775879.1| predicted protein [Physcomitrella patens]
 gb|EDQ59244.1| predicted protein [Physcomitrella patens]
Length=743

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 67/282 (24%), Positives = 114/282 (40%), Gaps = 45/282 (16%)
 Frame = +1

Query  580   VIEAKESALRYA----LAHHQLEAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNKS  747
              ++ +E   RY     L   + +  IQ   T+      +QV   + ++R  V    F   
Sbjct  360   ALQEEEPLRRYKQLTQLFSQRAKVNIQLTSTIESLPNCLQVVVGIKHVRFKVENARF---  416

Query  748   QDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQSTNNIEKEV-ETHKIWKGSFGDSKV  924
              D+  +   HFPS I + V P        G+++  S++NI  ++ +  +I  GS      
Sbjct  417   -DNECMG--HFPSMITLSVTPMTNEGT--GVTMTHSSSNIIVKIGKMERIQLGSNAGDGA  471

Query  925   PK-----MKAVARMATKTKMKN--WRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGD  1083
              +     + A A +   + MKN  WR++Q            L D + G  V T +   G 
Sbjct  472   NRGLSGGIGAAASVGVTSTMKNKPWRFEQ----------LPLKDERGGSFVWTLQSMKGV  521

Query  1084  --DGPTAVVMNNLGRRYRGANR---------GFTKKGSLVIAGEESGTGVGWRLSKEMVG  1230
               D    + M     ++R   R          FT +G ++    E    + WR  K M G
Sbjct  522   LFDRSNPMRMAERNSKWRFGRRMPSNPLDELPFTSEGGVIFTSAEFDDTMMWRFPKHMEG  581

Query  1231  SVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDLPLIP  1356
               ++W I G++  T+      T Y+ETR   +C +++ PL P
Sbjct  582   CKMRWSIEGQIHSTF----TTTRYFETRMATFCGDIEEPLKP  619



>ref|XP_001768066.1| predicted protein [Physcomitrella patens]
 gb|EDQ67138.1| predicted protein [Physcomitrella patens]
Length=1076

 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 98/258 (38%), Gaps = 81/258 (31%)
 Frame = +1

Query  634   EAVIQFEYTVGYFDGFIQVNARLDNIRLHVARLGFNKSQDDAYVDEK---HFPSRIRVWV  804
             E  IQ   TV     F+QV+  +  +R            D++  DE+   HFP+R+RV V
Sbjct  381   ELSIQLLATVVSHTDFLQVSVAVKQVRFKA---------DNSRWDEEAMGHFPTRVRVSV  431

Query  805   GPEVGASYVGGLSLGQSTNNIEKEVETHKIWKG---SFGDSKVPKMKA------------  939
              P         ++L  S++N E     + + KG   + G S     KA            
Sbjct  432   LPLTNEG--SSVTLTNSSSNNE-----YTVGKGESLTLGSSATNAGKAGLGAGFSVGAGQ  484

Query  940   VARMATKTKMKNWRWDQDTEGNAVVYDATLCDNQTGIEVATWKPDNGDDGPTAVVMNNLG  1119
             V+ +  K+K   WRW +    N +                       D  P         
Sbjct  485   VSSILMKSK--PWRWGRRVTSNPL-----------------------DGLP---------  510

Query  1120  RRYRGANRGFTKKGSLVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTS  1299
                      FT +G +     E    + WR  K+  G  L+WRI GEV +TY      + 
Sbjct  511   ---------FTSEGGVQFTSGEFSDTMMWRFPKKREGRKLRWRIEGEVCMTY----TTSR  557

Query  1300  YYETRCVEWCDEVDLPLI  1353
             Y+ETR  ++C E++ PL+
Sbjct  558   YFETRKAQFCGEIEEPLV  575



>ref|XP_001783656.1| predicted protein [Physcomitrella patens]
 gb|EDQ51551.1| predicted protein [Physcomitrella patens]
Length=888

 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 72/304 (24%), Positives = 113/304 (37%), Gaps = 44/304 (14%)
 Frame = +1

Query  499   GLWILKGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDG  678
             GLW ++   P+  M       E  PF     +       L   + +  IQ    V     
Sbjct  407   GLWEMQLEVPLLMMPVEHALQEEEPF-----RRYKQLTQLFSQRAKVNIQLTAIVEALPN  461

Query  679   FIQVNARLDNIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQST  858
              +QV   + ++R  V     N   D   +   HFPS + + V P +     G      S+
Sbjct  462   CLQVVVGIKHVRFKVE----NSRWDPDCMG--HFPSLVNLSVTP-ITKEGTGVTMTNSSS  514

Query  859   NNIEKEVETHKIWKGSFGDSKVPK-----MKAVARMATKTKMKN--WRWDQDTEGNAVVY  1017
             N I K  +   +  GS       +     M A A +   + MKN  WR++Q         
Sbjct  515   NIIVKIGKMENVQVGSNAGDGATRGISGGMTASASIGVTSTMKNRPWRFEQ---------  565

Query  1018  DATLCDNQTGIEVATWKPDNGD--DGPTAVVMNNLGRRYRGANR---------GFTKKGS  1164
                L D + G  V T +   G   +    + M +   ++R   R          FT +G 
Sbjct  566   -LPLKDERGGSFVCTLQSIKGIIFNRSNTMRMADRNSKWRFGRRMPSNPLDELPFTSEGG  624

Query  1165  LVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
             ++    E    + WR  K M G  L+W I G++  TY        Y+ETR   +C +++ 
Sbjct  625   VIFTSAEFDDTMMWRFPKHMEGKKLRWSIEGQIHSTY----TTARYFETRMATFCGDIEE  680

Query  1345  PLIP  1356
             PL P
Sbjct  681   PLKP  684



>ref|XP_001782680.1| predicted protein [Physcomitrella patens]
 gb|EDQ52511.1| predicted protein [Physcomitrella patens]
Length=952

 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 114/304 (38%), Gaps = 44/304 (14%)
 Frame = +1

Query  499   GLWILKGYAPVRAMKCTLHRGERNPFPVIEAKESALRYALAHHQLEAVIQFEYTVGYFDG  678
             GLW ++   P+  M       +  PF     +       L   + +  IQ    V     
Sbjct  343   GLWEMQLEVPLLMMPVEHALPDEEPF-----RRYKQLTQLFSQRAKVNIQLTAIVEALPN  397

Query  679   FIQVNARLDNIRLHVARLGFNKSQDDAYVDEKHFPSRIRVWVGPEVGASYVGGLSLGQST  858
              +QV   + ++R  V     N   D   +   HFP  + + V P V     G      S+
Sbjct  398   CLQVVVGIKHVRFKVE----NSRWDPECMG--HFPCLVTLSVTP-VTKEGTGVTMTNSSS  450

Query  859   NNIEKEVETHKIWKGS-FGDSKVPK----MKAVARMATKTKMKN--WRWDQDTEGNAVVY  1017
             N I K  +  ++  G+  GD         M A A +   + MKN  WR++Q         
Sbjct  451   NIIVKIGKMERVQIGTNAGDGSTRGISGGMGASATVGVTSTMKNKPWRFEQ---------  501

Query  1018  DATLCDNQTGIEVATWKPDNGD--DGPTAVVMNNLGRRYRGANR---------GFTKKGS  1164
                L D + G  V T +   G   D    + M     ++R   R          FT +G 
Sbjct  502   -LPLKDERGGSFVWTLQSMKGVMFDRTNPMRMAERNSKWRFGRRMPSNPLDELPFTSEGG  560

Query  1165  LVIAGEESGTGVGWRLSKEMVGSVLKWRIGGEVWLTYWPNHVNTSYYETRCVEWCDEVDL  1344
             ++    E    + WR  K M G  ++W I G++  TY      T Y+ETR   +C +++ 
Sbjct  561   VIFTNAEFDDTMMWRFPKHMDGKKMRWSIEGQIHSTY----TTTRYFETRMATFCGDIEE  616

Query  1345  PLIP  1356
             PL P
Sbjct  617   PLKP  620



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4365618994296