BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6750_g1_i1 len=1148 path=[1126:0-1147]

Length=1148
                                                                      Score     E

ref|XP_009625321.1|  PREDICTED: acid phosphatase 1-like                 317   3e-103   
ref|XP_009795136.1|  PREDICTED: acid phosphatase 1-like                 314   5e-102   
ref|XP_004235637.1|  PREDICTED: acid phosphatase 1-like                 307   3e-99    
ref|XP_009776612.1|  PREDICTED: acid phosphatase 1-like                 303   3e-97    
ref|XP_004241953.1|  PREDICTED: acid phosphatase 1                      301   8e-97    
ref|XP_009622654.1|  PREDICTED: acid phosphatase 1-like                 300   3e-96    
ref|XP_009787591.1|  PREDICTED: acid phosphatase 1-like                 300   4e-96    
ref|XP_010322861.1|  PREDICTED: acid phosphatase 1-like                 299   7e-96    
ref|XP_004241952.1|  PREDICTED: acid phosphatase 1-like                 298   1e-95    
emb|CDO97963.1|  unnamed protein product                                296   1e-94    
ref|XP_006356134.1|  PREDICTED: acid phosphatase 1-like                 293   1e-93    
gb|AFX66999.1|  putative acid phosphatase                               291   1e-92    
ref|XP_010033713.1|  PREDICTED: acid phosphatase 1-like                 276   5e-87    
ref|XP_007024338.1|  Stem 28 kDa glycoprotein, putative                 276   6e-87    
emb|CAN82027.1|  hypothetical protein VITISV_000612                     275   1e-86    Vitis vinifera
ref|XP_010033826.1|  PREDICTED: acid phosphatase 1-like                 272   1e-85    
ref|XP_010654601.1|  PREDICTED: acid phosphatase 1                      272   1e-85    
ref|XP_010033828.1|  PREDICTED: acid phosphatase 1-like                 272   2e-85    
ref|XP_010033712.1|  PREDICTED: acid phosphatase 1-like                 271   3e-85    
ref|XP_006465744.1|  PREDICTED: acid phosphatase 1-like                 269   3e-84    
ref|XP_004302846.1|  PREDICTED: stem 28 kDa glycoprotein-like           268   4e-84    
ref|XP_010690146.1|  PREDICTED: acid phosphatase 1-like                 268   8e-84    
ref|XP_007215831.1|  hypothetical protein PRUPE_ppa010152mg             267   2e-83    
ref|XP_002515949.1|  Stem 28 kDa glycoprotein precursor, putative       265   6e-83    Ricinus communis
ref|XP_010258709.1|  PREDICTED: acid phosphatase 1-like                 264   2e-82    
ref|XP_004302847.1|  PREDICTED: stem 28 kDa glycoprotein-like           264   2e-82    
ref|XP_008228404.1|  PREDICTED: acid phosphatase 1-like                 264   2e-82    
ref|XP_010088387.1|  Stem 28 kDa glycoprotein                           260   6e-81    
ref|XP_007045549.1|  Stem 28 kDa glycoprotein, putative                 260   9e-81    
gb|KDP40846.1|  hypothetical protein JCGZ_24845                         259   1e-80    
dbj|BAJ34931.1|  hypothetical protein                                   258   1e-80    
ref|XP_003632911.1|  PREDICTED: acid phosphatase 1-like                 258   2e-80    
ref|XP_002299744.2|  hypothetical protein POPTR_0001s19180g             258   6e-80    Populus trichocarpa [western balsam poplar]
ref|XP_006465710.1|  PREDICTED: acid phosphatase 1-like                 256   4e-79    
ref|XP_011000941.1|  PREDICTED: acid phosphatase 1-like                 255   8e-79    
ref|XP_010033825.1|  PREDICTED: acid phosphatase 1-like                 254   2e-78    
ref|XP_010033711.1|  PREDICTED: acid phosphatase 1-like                 254   2e-78    
gb|KDO51839.1|  hypothetical protein CISIN_1g036571mg                   252   9e-78    
ref|XP_006426853.1|  hypothetical protein CICLE_v10027566mg             252   1e-77    
ref|XP_006426852.1|  hypothetical protein CICLE_v10026223mg             251   4e-77    
ref|XP_010915365.1|  PREDICTED: acid phosphatase 1-like                 250   7e-77    
ref|XP_009797387.1|  PREDICTED: acid phosphatase 1-like                 248   3e-76    
ref|XP_008798588.1|  PREDICTED: acid phosphatase 1-like                 248   4e-76    
gb|EYU36713.1|  hypothetical protein MIMGU_mgv1a012835mg                246   7e-76    
ref|XP_009625320.1|  PREDICTED: acid phosphatase 1-like                 246   1e-75    
ref|XP_009338743.1|  PREDICTED: acid phosphatase 1-like                 244   1e-74    
ref|XP_004510320.1|  PREDICTED: stem 28 kDa glycoprotein-like           243   2e-74    
ref|XP_004305256.1|  PREDICTED: acid phosphatase 1-like                 243   3e-74    
ref|XP_009344485.1|  PREDICTED: acid phosphatase 1-like                 242   1e-73    
gb|AGG23547.1|  acid phosphatase-like protein 1                         241   2e-73    
ref|XP_008380842.1|  PREDICTED: acid phosphatase 1-like                 241   2e-73    
ref|XP_006654134.1|  PREDICTED: stem 28 kDa glycoprotein-like           240   3e-73    
ref|XP_010654600.1|  PREDICTED: acid phosphatase 1-like                 240   4e-73    
ref|XP_009381186.1|  PREDICTED: acid phosphatase 1-like                 239   1e-72    
ref|XP_003530059.1|  PREDICTED: stem 28 kDa glycoprotein-like           238   4e-72    
gb|KHN39260.1|  Stem 28 kDa glycoprotein                                236   8e-72    
ref|XP_008348489.1|  PREDICTED: acid phosphatase 1-like                 237   1e-71    
ref|XP_008358084.1|  PREDICTED: acid phosphatase 1-like                 236   1e-71    
ref|XP_006654133.1|  PREDICTED: acid phosphatase 1-like                 236   1e-71    
emb|CAB71336.2|  putative acid phosphatase                              236   2e-71    Hordeum vulgare [barley]
ref|XP_011101105.1|  PREDICTED: acid phosphatase 1-like                 236   2e-71    
gb|AFK40440.1|  unknown                                                 235   3e-71    
ref|XP_004960898.1|  PREDICTED: stem 31 kDa glycoprotein-like iso...    234   8e-71    
dbj|BAJ94870.1|  predicted protein                                      234   1e-70    
gb|EMT19717.1|  Acid phosphatase 1                                      234   1e-70    
ref|XP_010662272.1|  PREDICTED: acid phosphatase 1                      234   1e-70    
emb|CBI36038.3|  unnamed protein product                                240   2e-70    
ref|XP_002440748.1|  hypothetical protein SORBIDRAFT_09g006010          234   2e-70    Sorghum bicolor [broomcorn]
ref|XP_003627057.1|  Acid phosphatase                                   233   3e-70    
dbj|BAJ94050.1|  predicted protein                                      233   3e-70    
dbj|BAJ90845.1|  predicted protein                                      233   4e-70    
ref|NP_001148494.1|  stem 28 kDa glycoprotein precursor                 232   4e-70    Zea mays [maize]
ref|XP_011076425.1|  PREDICTED: acid phosphatase 1-like                 233   4e-70    
gb|EMS46715.1|  Stem 28 kDa glycoprotein                                232   6e-70    
gb|AFK46217.1|  unknown                                                 232   7e-70    
ref|XP_006853740.1|  hypothetical protein AMTR_s00056p00177520          232   1e-69    
gb|KHG01291.1|  Acid phosphatase 1                                      231   1e-69    
ref|XP_010941067.1|  PREDICTED: acid phosphatase 1-like                 231   3e-69    
ref|XP_004960901.1|  PREDICTED: stem 28 kDa glycoprotein-like           230   3e-69    
gb|EMS67586.1|  Acid phosphatase 1                                      231   4e-69    
ref|XP_008367296.1|  PREDICTED: acid phosphatase 1-like                 230   5e-69    
gb|EMS66285.1|  Stem 28 kDa glycoprotein                                229   8e-69    
ref|XP_003568779.1|  PREDICTED: stem 28 kDa glycoprotein                230   8e-69    
ref|XP_004963522.1|  PREDICTED: stem 28 kDa glycoprotein-like           229   1e-68    
emb|CDO98049.1|  unnamed protein product                                230   1e-68    
gb|EMS54507.1|  Acid phosphatase 1                                      229   2e-68    
ref|XP_004511128.1|  PREDICTED: acid phosphatase 1-like                 228   3e-68    
ref|XP_009372837.1|  PREDICTED: acid phosphatase 1-like                 228   3e-68    
ref|XP_007038298.1|  HAD superfamily, subfamily IIIB acid phospha...    227   4e-68    
ref|XP_008376378.1|  PREDICTED: acid phosphatase 1                      227   5e-68    
emb|CDP05370.1|  unnamed protein product                                227   5e-68    
ref|XP_006356133.1|  PREDICTED: acid phosphatase 1-like                 224   7e-68    
ref|XP_009362705.1|  PREDICTED: acid phosphatase 1                      227   8e-68    
ref|XP_010258799.1|  PREDICTED: acid phosphatase 1                      227   9e-68    
ref|XP_009800382.1|  PREDICTED: acid phosphatase 1-like                 226   1e-67    
ref|XP_009370433.1|  PREDICTED: acid phosphatase 1-like                 226   1e-67    
gb|KCW90870.1|  hypothetical protein EUGRSUZ_A02919                     225   3e-67    
ref|XP_002510996.1|  Acid phosphatase 1 precursor, putative             225   4e-67    Ricinus communis
ref|NP_001150932.1|  LOC100284565 precursor                             226   5e-67    Zea mays [maize]
ref|XP_008801792.1|  PREDICTED: acid phosphatase 1-like                 224   8e-67    
ref|XP_009588519.1|  PREDICTED: acid phosphatase 1-like                 224   9e-67    
gb|EMT03894.1|  Stem 28 kDa glycoprotein                                224   1e-66    
ref|XP_006357920.1|  PREDICTED: acid phosphatase 1-like                 223   2e-66    
ref|XP_010062554.1|  PREDICTED: acid phosphatase 1                      226   2e-66    
ref|XP_004960902.1|  PREDICTED: acid phosphatase 1-like                 224   2e-66    
gb|KHN05326.1|  Stem 28 kDa glycoprotein                                223   3e-66    
gb|EYU20188.1|  hypothetical protein MIMGU_mgv1a011800mg                223   3e-66    
ref|XP_007135625.1|  hypothetical protein PHAVU_010G144600g             222   4e-66    
ref|XP_004960903.1|  PREDICTED: acid phosphatase 1-like                 223   4e-66    
ref|XP_010693738.1|  PREDICTED: acid phosphatase 1                      221   6e-66    
ref|XP_010915367.1|  PREDICTED: acid phosphatase 1-like isoform X1      221   7e-66    
ref|XP_008234437.1|  PREDICTED: acid phosphatase 1                      221   8e-66    
gb|KDP22459.1|  hypothetical protein JCGZ_26290                         221   8e-66    
ref|XP_002439412.1|  hypothetical protein SORBIDRAFT_09g005960          221   1e-65    Sorghum bicolor [broomcorn]
ref|XP_007133483.1|  hypothetical protein PHAVU_011G182400g             221   1e-65    
gb|KDO45271.1|  hypothetical protein CISIN_1g023192mg                   221   1e-65    
ref|XP_002440742.1|  hypothetical protein SORBIDRAFT_09g005940          221   1e-65    Sorghum bicolor [broomcorn]
ref|XP_003627058.1|  Stem 28 kDa glycoprotein                           220   2e-65    
ref|XP_011028463.1|  PREDICTED: acid phosphatase 1                      220   2e-65    
gb|EAY96842.1|  hypothetical protein OsI_18762                          221   3e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_007218818.1|  hypothetical protein PRUPE_ppa010063mg             220   3e-65    
ref|NP_001236180.1|  acid phosphatase precursor                         219   5e-65    
ref|XP_006490172.1|  PREDICTED: acid phosphatase 1-like                 220   6e-65    
ref|NP_001242215.1|  uncharacterized protein LOC100795218 precursor     218   1e-64    
ref|XP_010098159.1|  Acid phosphatase 1                                 218   1e-64    
ref|XP_006837335.1|  hypothetical protein AMTR_s00111p00084650          219   1e-64    
ref|XP_003531798.1|  PREDICTED: acid phosphatase 1-like                 218   2e-64    
ref|XP_004235180.1|  PREDICTED: acid phosphatase 1                      218   2e-64    
ref|NP_001148296.1|  stem 28 kDa glycoprotein precursor                 218   2e-64    Zea mays [maize]
gb|AFW77368.1|  stem glycoprotein                                       218   2e-64    
ref|NP_001240054.1|  uncharacterized protein LOC100802126 precursor     218   2e-64    
gb|EYU31308.1|  hypothetical protein MIMGU_mgv1a011623mg                218   3e-64    
gb|AHC69831.1|  acid phosphatase                                        217   4e-64    
ref|XP_009797620.1|  PREDICTED: acid phosphatase 1-like                 217   4e-64    
ref|NP_001234071.1|  acid phosphatase 1 precursor                       216   5e-64    
ref|XP_004960899.1|  PREDICTED: stem 28 kDa glycoprotein-like iso...    217   6e-64    
ref|XP_010532228.1|  PREDICTED: acid phosphatase 1-like isoform X1      216   7e-64    
ref|XP_006358226.1|  PREDICTED: acid phosphatase 1-like                 216   7e-64    
ref|XP_006421584.1|  hypothetical protein CICLE_v10005566mg             217   8e-64    
ref|XP_007135620.1|  hypothetical protein PHAVU_010G144200g             216   8e-64    
ref|XP_011072446.1|  PREDICTED: acid phosphatase 1-like                 213   9e-64    
prf||1908418A  acid phosphatase 1                                       215   1e-63 
ref|XP_006284361.1|  hypothetical protein CARUB_v10005533mg             215   2e-63    
ref|XP_002867623.1|  hypothetical protein ARALYDRAFT_329150             215   2e-63    
gb|KFK26738.1|  acid phosphatase                                        214   3e-63    
ref|XP_010925513.1|  PREDICTED: acid phosphatase 1-like isoform X1      214   4e-63    
ref|XP_006385121.1|  acid phosphatase family protein                    214   4e-63    
emb|CBI25273.3|  unnamed protein product                                211   4e-63    
ref|NP_194245.1|  HAD superfamily, subfamily IIIB acid phosphatase      214   4e-63    Arabidopsis thaliana [mouse-ear cress]
gb|AFK42878.1|  unknown                                                 214   5e-63    
gb|AFW77369.1|  hypothetical protein ZEAMMB73_279889                    214   7e-63    
ref|XP_010536549.1|  PREDICTED: acid phosphatase 1-like                 213   7e-63    
gb|AGV54493.1|  acid phosphatase                                        213   8e-63    
ref|XP_010433681.1|  PREDICTED: acid phosphatase 1-like                 213   9e-63    
ref|XP_004960900.1|  PREDICTED: stem 28 kDa glycoprotein-like iso...    214   1e-62    
ref|XP_006280976.1|  hypothetical protein CARUB_v10026976mg             213   1e-62    
ref|XP_010442941.1|  PREDICTED: acid phosphatase 1-like                 213   2e-62    
gb|ACU24349.1|  unknown                                                 213   2e-62    Glycine max [soybeans]
ref|XP_010438922.1|  PREDICTED: acid phosphatase 1-like                 213   2e-62    
gb|ACJ84626.1|  unknown                                                 213   2e-62    Medicago truncatula
ref|XP_004143740.1|  PREDICTED: acid phosphatase 1-like                 213   2e-62    
ref|XP_009607238.1|  PREDICTED: acid phosphatase 1-like                 209   2e-62    
ref|XP_002865848.1|  hypothetical protein ARALYDRAFT_495196             212   2e-62    
ref|XP_004307784.1|  PREDICTED: acid phosphatase 1-like                 213   3e-62    
ref|XP_006656617.1|  PREDICTED: acid phosphatase 1-like                 211   3e-62    
ref|XP_010482458.1|  PREDICTED: acid phosphatase 1-like                 211   5e-62    
ref|NP_199939.1|  HAD superfamily, subfamily IIIB acid phosphatase      211   5e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437018.1|  PREDICTED: acid phosphatase 1                      211   5e-62    
ref|XP_007152955.1|  hypothetical protein PHAVU_004G174200g             211   6e-62    
ref|XP_006401998.1|  hypothetical protein EUTSA_v10014448mg             211   7e-62    
ref|XP_010925515.1|  PREDICTED: acid phosphatase 1-like isoform X2      211   7e-62    
ref|XP_004513069.1|  PREDICTED: acid phosphatase 1-like                 211   8e-62    
emb|CDY03376.1|  BnaC01g17060D                                          210   1e-61    
emb|CDY34346.1|  BnaA01g14490D                                          210   1e-61    
ref|XP_009138920.1|  PREDICTED: acid phosphatase 1                      210   2e-61    
ref|XP_008794092.1|  PREDICTED: acid phosphatase 1-like                 209   2e-61    
ref|XP_010110867.1|  Acid phosphatase 1                                 209   2e-61    
ref|NP_001056747.1|  Os06g0139800                                       210   4e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008798586.1|  PREDICTED: acid phosphatase 1-like                 209   4e-61    
ref|XP_010448471.1|  PREDICTED: acid phosphatase 1-like                 209   4e-61    
gb|EAZ35770.1|  hypothetical protein OsJ_20061                          210   5e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002867419.1|  acid phosphatase class B family protein            208   9e-61    
ref|XP_006413336.1|  hypothetical protein EUTSA_v10026026mg             207   1e-60    
gb|EMS60884.1|  Acid phosphatase 1                                      212   2e-60    
ref|XP_004158153.1|  PREDICTED: acid phosphatase 1-like                 207   2e-60    
ref|XP_010433112.1|  PREDICTED: acid phosphatase 1-like                 207   2e-60    
gb|EMT02057.1|  Stem 28 kDa glycoprotein                                207   2e-60    
gb|ADE76411.1|  unknown                                                 207   3e-60    
ref|XP_003620757.1|  Acid phosphatase-like protein                      206   3e-60    
emb|CDY47773.1|  BnaC07g41870D                                          207   3e-60    
ref|XP_009127318.1|  PREDICTED: acid phosphatase 1                      206   5e-60    
ref|XP_002514195.1|  Acid phosphatase 1 precursor, putative             206   5e-60    Ricinus communis
gb|ABK95709.1|  unknown                                                 204   5e-60    Populus trichocarpa [western balsam poplar]
ref|NP_194655.1|  HAD superfamily, subfamily IIIB acid phosphatase      206   5e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137842.1|  PREDICTED: acid phosphatase 1                      206   6e-60    
ref|XP_002309231.2|  hypothetical protein POPTR_0006s15760g             206   6e-60    Populus trichocarpa [western balsam poplar]
gb|AGV54632.1|  stem 28 kDa glycoprotein                                206   6e-60    
ref|XP_007215832.1|  hypothetical protein PRUPE_ppa010152mg             204   8e-60    
ref|NP_001151681.1|  acid phosphatase 1 precursor                       206   1e-59    Zea mays [maize]
gb|AFW85941.1|  acid phosphatase 1                                      207   1e-59    
ref|XP_010249468.1|  PREDICTED: acid phosphatase 1-like                 205   1e-59    
gb|ABK21277.1|  unknown                                                 204   2e-59    Picea sitchensis
ref|NP_001150931.1|  acid phosphatase 1 precursor                       206   2e-59    Zea mays [maize]
gb|ACN40876.1|  unknown                                                 204   2e-59    Picea sitchensis
gb|AFK34288.1|  unknown                                                 204   2e-59    
ref|XP_002436441.1|  hypothetical protein SORBIDRAFT_10g002690          206   2e-59    Sorghum bicolor [broomcorn]
gb|ABK21327.1|  unknown                                                 204   2e-59    Picea sitchensis
gb|AFW75455.1|  hypothetical protein ZEAMMB73_076415                    206   2e-59    
gb|ABK92831.1|  unknown                                                 204   3e-59    Populus trichocarpa [western balsam poplar]
ref|NP_194656.1|  HAD superfamily, subfamily IIIB acid phosphatase      204   4e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011091248.1|  PREDICTED: acid phosphatase 1-like                 203   5e-59    
ref|XP_007012979.1|  HAD superfamily isoform 2                          203   6e-59    
ref|XP_010541530.1|  PREDICTED: vegetative storage protein 2-like       203   7e-59    
ref|XP_002283385.2|  PREDICTED: acid phosphatase 1-like                 204   7e-59    Vitis vinifera
ref|XP_003529064.1|  PREDICTED: acid phosphatase 1-like                 202   9e-59    
gb|KFK29483.1|  hypothetical protein AALP_AA7G140100                    202   9e-59    
ref|XP_006284398.1|  hypothetical protein CARUB_v10005568mg             202   1e-58    
ref|XP_007226669.1|  hypothetical protein PRUPE_ppa021353mg             202   1e-58    
ref|XP_010438317.1|  PREDICTED: acid phosphatase 1-like                 202   1e-58    
ref|XP_010688366.1|  PREDICTED: acid phosphatase 1-like                 201   3e-58    
emb|CDO99288.1|  unnamed protein product                                201   3e-58    
ref|XP_006412859.1|  hypothetical protein EUTSA_v10026000mg             202   3e-58    
ref|XP_004964488.1|  PREDICTED: acid phosphatase 1-like isoform X1      205   3e-58    
ref|XP_010438316.1|  PREDICTED: acid phosphatase 1-like                 201   3e-58    
ref|XP_008224179.1|  PREDICTED: acid phosphatase 1-like                 202   3e-58    
ref|XP_007012978.1|  HAD superfamily isoform 1                          203   4e-58    
ref|XP_006284235.1|  hypothetical protein CARUB_v10005397mg             202   6e-58    
ref|XP_007202474.1|  hypothetical protein PRUPE_ppa010268mg             201   7e-58    
ref|XP_002867418.1|  predicted protein                                  200   9e-58    
ref|XP_008242463.1|  PREDICTED: acid phosphatase 1                      200   9e-58    
ref|XP_010688365.1|  PREDICTED: acid phosphatase 1-like                 200   1e-57    
ref|XP_009388590.1|  PREDICTED: acid phosphatase 1-like                 200   1e-57    
ref|XP_009773908.1|  PREDICTED: acid phosphatase 1-like                 200   1e-57    
ref|XP_006354440.1|  PREDICTED: acid phosphatase 1-like                 200   1e-57    
ref|XP_009795729.1|  PREDICTED: acid phosphatase 1-like                 200   2e-57    
ref|XP_008367917.1|  PREDICTED: acid phosphatase 1-like                 199   2e-57    
ref|XP_009109048.1|  PREDICTED: acid phosphatase 1-like isoform X2      199   2e-57    
emb|CDP03233.1|  unnamed protein product                                199   2e-57    
ref|XP_010447874.1|  PREDICTED: acid phosphatase 1-like                 199   2e-57    
ref|XP_010914845.1|  PREDICTED: acid phosphatase 1-like                 199   2e-57    
ref|XP_008387412.1|  PREDICTED: acid phosphatase 1-like                 199   2e-57    
ref|XP_009352576.1|  PREDICTED: acid phosphatase 1                      199   2e-57    
ref|XP_009109046.1|  PREDICTED: acid phosphatase 1-like isoform X1      199   3e-57    
ref|XP_011078233.1|  PREDICTED: acid phosphatase 1-like                 199   3e-57    
ref|XP_010258707.1|  PREDICTED: acid phosphatase 1-like                 200   3e-57    
ref|XP_009415369.1|  PREDICTED: acid phosphatase 1-like                 199   3e-57    
emb|CDY14217.1|  BnaA08g13480D                                          199   4e-57    
ref|XP_004247765.1|  PREDICTED: acid phosphatase 1-like                 198   4e-57    
ref|XP_010098162.1|  Stem 28 kDa glycoprotein                           198   5e-57    
ref|XP_006359744.1|  PREDICTED: acid phosphatase 1-like                 198   6e-57    
gb|ABK23358.1|  unknown                                                 198   1e-56    Picea sitchensis
ref|XP_009614482.1|  PREDICTED: acid phosphatase 1                      197   1e-56    
dbj|BAJ97988.1|  predicted protein                                      198   1e-56    
ref|XP_011007264.1|  PREDICTED: acid phosphatase 1                      197   1e-56    
ref|XP_003557220.2|  PREDICTED: acid phosphatase 1-like                 197   2e-56    
emb|CDO99292.1|  unnamed protein product                                197   2e-56    
ref|XP_004245159.1|  PREDICTED: acid phosphatase 1-like                 197   2e-56    
ref|XP_004964489.1|  PREDICTED: acid phosphatase 1-like isoform X2      200   3e-56    
ref|XP_010433115.1|  PREDICTED: acid phosphatase 1-like                 196   4e-56    
ref|XP_010047662.1|  PREDICTED: acid phosphatase 1-like                 196   6e-56    
ref|XP_002301854.1|  hypothetical protein POPTR_0002s25950g             195   6e-56    Populus trichocarpa [western balsam poplar]
ref|XP_010548683.1|  PREDICTED: acid phosphatase 1-like                 195   8e-56    
ref|XP_010267101.1|  PREDICTED: acid phosphatase 1-like                 195   1e-55    
ref|XP_009130001.1|  PREDICTED: vegetative storage protein 2-like       195   1e-55    
ref|XP_004287494.1|  PREDICTED: acid phosphatase 1-like                 194   2e-55    
ref|XP_006451342.1|  hypothetical protein CICLE_v10009222mg             194   2e-55    
gb|KDO55859.1|  hypothetical protein CISIN_1g024820mg                   194   3e-55    
ref|XP_010548682.1|  PREDICTED: acid phosphatase 1-like                 194   3e-55    
ref|XP_006857494.1|  hypothetical protein AMTR_s00067p00205850          193   3e-55    
emb|CDY05398.1|  BnaC02g41060D                                          194   4e-55    
ref|XP_008799767.1|  PREDICTED: acid phosphatase 1-like                 193   4e-55    
ref|XP_010098160.1|  Acid phosphatase 1                                 191   7e-55    
gb|KHN33255.1|  Stem 31 kDa glycoprotein                                191   1e-54    
gb|ABL85037.1|  acid phosphatase                                        192   1e-54    Brachypodium sylvaticum
prf||1609232A  31kD glycoprotein                                        192   1e-54 
ref|XP_010541004.1|  PREDICTED: acid phosphatase 1                      191   2e-54    
emb|CDY14216.1|  BnaA08g13470D                                          191   2e-54    
ref|NP_001238459.1|  stem 28 kDa glycoprotein precursor                 191   3e-54    
emb|CDY62035.1|  BnaC03g77680D                                          191   3e-54    
ref|XP_002867417.1|  predicted protein                                  191   3e-54    
ref|XP_011080101.1|  PREDICTED: acid phosphatase 1-like                 191   3e-54    
ref|XP_010482978.1|  PREDICTED: acid phosphatase 1-like                 191   3e-54    
ref|XP_011024457.1|  PREDICTED: acid phosphatase 1                      191   4e-54    
gb|ACU24345.1|  unknown                                                 190   5e-54    
ref|XP_006285610.1|  hypothetical protein CARUB_v10007060mg             189   5e-54    
ref|NP_001241536.1|  stem 31 kDa glycoprotein precursor                 190   5e-54    
ref|XP_009109045.1|  PREDICTED: acid phosphatase 1-like                 190   6e-54    
ref|XP_010447870.1|  PREDICTED: acid phosphatase 1-like                 191   6e-54    
gb|EPS70753.1|  hypothetical protein M569_04009                         189   7e-54    
gb|KFK39517.1|  hypothetical protein AALP_AA3G254300                    190   9e-54    
gb|AFK41939.1|  unknown                                                 187   1e-53    
gb|EMT19714.1|  Acid phosphatase 1                                      192   1e-53    
ref|XP_010023858.1|  PREDICTED: acid phosphatase 1-like isoform X1      188   3e-53    
ref|XP_009128910.1|  PREDICTED: acid phosphatase 1                      189   3e-53    
gb|ACU23829.1|  unknown                                                 188   3e-53    
gb|ACU23890.1|  unknown                                                 186   4e-53    
emb|CDO98048.1|  unnamed protein product                                186   4e-53    
ref|XP_004141163.1|  PREDICTED: acid phosphatase 1-like                 188   4e-53    
gb|ABK27105.1|  unknown                                                 188   5e-53    
dbj|BAA19152.1|  pod storage protein                                    187   5e-53    
ref|XP_007135621.1|  hypothetical protein PHAVU_010G144300g             187   6e-53    
ref|XP_008459056.1|  PREDICTED: acid phosphatase 1-like                 186   8e-53    
gb|ACN40193.1|  unknown                                                 188   1e-52    
ref|XP_002526558.1|  Acid phosphatase 1 precursor, putative             187   1e-52    
gb|AHA84282.1|  pod storage protein                                     187   1e-52    
ref|XP_010264908.1|  PREDICTED: acid phosphatase 1                      187   1e-52    
ref|XP_009357986.1|  PREDICTED: acid phosphatase 1-like                 187   1e-52    
ref|XP_006288447.1|  hypothetical protein CARUB_v10001708mg             187   1e-52    
ref|XP_008235609.1|  PREDICTED: acid phosphatase 1-like isoform X2      186   2e-52    
gb|EEE62606.1|  hypothetical protein OsJ_17409                          186   2e-52    
gb|AAS07026.1|  vegetative storage protein                              186   2e-52    
ref|XP_009419864.1|  PREDICTED: acid phosphatase 1-like                 185   2e-52    
gb|KFK27743.1|  hypothetical protein AALP_AA8G423400                    186   2e-52    
gb|ABK22580.1|  unknown                                                 187   3e-52    
ref|XP_010936027.1|  PREDICTED: acid phosphatase 1 isoform X2           186   3e-52    
gb|KDP33773.1|  hypothetical protein JCGZ_07344                         186   3e-52    
ref|XP_010936026.1|  PREDICTED: acid phosphatase 1 isoform X1           186   3e-52    
ref|XP_006465709.1|  PREDICTED: acid phosphatase 1-like                 186   4e-52    
ref|XP_006412858.1|  hypothetical protein EUTSA_v10025999mg             186   5e-52    
ref|XP_006304095.1|  hypothetical protein CARUB_v10010000mg             186   5e-52    
gb|EYU30686.1|  hypothetical protein MIMGU_mgv1a011950mg                186   5e-52    
gb|EMT02056.1|  Stem 31 kDa glycoprotein                                185   5e-52    
gb|KCW60246.1|  hypothetical protein EUGRSUZ_H02960                     185   6e-52    
gb|KEH42677.1|  plant acid phosphatase                                  184   7e-52    
emb|CDY48606.1|  BnaA01g07590D                                          185   8e-52    
emb|CDP03785.1|  unnamed protein product                                185   8e-52    
ref|XP_010023859.1|  PREDICTED: acid phosphatase 1-like isoform X2      184   9e-52    
ref|XP_004141030.1|  PREDICTED: acid phosphatase 1-like                 184   1e-51    
ref|XP_010457427.1|  PREDICTED: acid phosphatase 1-like                 185   1e-51    
gb|KCW53447.1|  hypothetical protein EUGRSUZ_J02693                     184   1e-51    
ref|XP_006418175.1|  hypothetical protein EUTSA_v10008462mg             184   1e-51    
gb|ADE77538.1|  unknown                                                 184   1e-51    
ref|XP_010493724.1|  PREDICTED: vegetative storage protein 2-like       184   1e-51    
ref|XP_010454803.1|  PREDICTED: vegetative storage protein 2            184   2e-51    
ref|XP_010421320.1|  PREDICTED: vegetative storage protein 2-like       184   2e-51    
ref|XP_010475042.1|  PREDICTED: acid phosphatase 1-like                 184   3e-51    
gb|KDP40845.1|  hypothetical protein JCGZ_24844                         183   3e-51    
ref|XP_006288459.1|  hypothetical protein CARUB_v10001720mg             183   3e-51    
ref|XP_010433111.1|  PREDICTED: acid phosphatase 1-like                 183   3e-51    
ref|XP_002273448.1|  PREDICTED: acid phosphatase 1                      183   3e-51    
ref|NP_199215.1|  HAD superfamily, subfamily IIIB acid phosphatase      183   4e-51    
sp|P10742.2|S25K_SOYBN  RecName: Full=Stem 31 kDa glycoprotein; A...    184   4e-51    
ref|XP_006443754.1|  hypothetical protein CICLE_v10021795mg             182   4e-51    
gb|EMT02058.1|  Stem 28 kDa glycoprotein                                180   5e-51    
ref|XP_006426854.1|  hypothetical protein CICLE_v10027612mg             182   5e-51    
ref|XP_010468739.1|  PREDICTED: vegetative storage protein 1-like       186   9e-51    
ref|XP_008796365.1|  PREDICTED: acid phosphatase 1                      182   9e-51    
ref|XP_008459051.1|  PREDICTED: acid phosphatase 1-like                 182   1e-50    
gb|KHG02415.1|  Acid phosphatase 1                                      181   1e-50    
emb|CBI27978.3|  unnamed protein product                                179   1e-50    
ref|XP_010438315.1|  PREDICTED: acid phosphatase 1-like                 182   1e-50    
gb|EYU42050.1|  hypothetical protein MIMGU_mgv1a013101mg                181   1e-50    
gb|AGV54742.1|  pod storage protein                                     181   1e-50    
ref|XP_007050188.1|  HAD superfamily, subfamily IIIB acid phospha...    181   2e-50    
ref|XP_006654132.1|  PREDICTED: stem 28 kDa glycoprotein-like           181   2e-50    
gb|KDP26481.1|  hypothetical protein JCGZ_17639                         181   2e-50    
ref|NP_563698.1|  HAD superfamily, subfamily IIIB acid phosphatase      181   2e-50    
ref|XP_009143372.1|  PREDICTED: acid phosphatase 1-like                 181   2e-50    
gb|AAM63804.1|  vegetative storage protein-like                         181   2e-50    
ref|XP_002315584.1|  acid phosphatase class B family protein            181   3e-50    
ref|XP_003590156.1|  Stem 28 kDa glycoprotein                           180   3e-50    
ref|XP_004134400.1|  PREDICTED: acid phosphatase 1-like                 180   3e-50    
gb|AAS07027.1|  vegetative storage protein                              180   4e-50    
ref|XP_006429635.1|  hypothetical protein CICLE_v10012544mg             180   4e-50    
ref|XP_003521307.1|  PREDICTED: acid phosphatase 1-like                 181   4e-50    
ref|XP_002874222.1|  vegetative storage protein Vsp2                    180   5e-50    
ref|XP_009602496.1|  PREDICTED: acid phosphatase 1-like isoform X2      180   5e-50    
ref|XP_003535883.1|  PREDICTED: acid phosphatase 1-like                 180   5e-50    
gb|AAB97863.1|  putative vegetative storage protein                     180   6e-50    
ref|NP_568455.1|  acid phosphatase VSP1                                 180   6e-50    
ref|XP_008235608.1|  PREDICTED: acid phosphatase 1-like isoform X1      180   6e-50    
ref|XP_002892194.1|  acid phosphatase class B family protein            180   6e-50    
pdb|4FYP|A  Chain A, Crystal Structure Of Plant Vegetative Storag...    180   6e-50    
gb|KHN24673.1|  Acid phosphatase 1                                      179   7e-50    
ref|XP_002865388.1|  hypothetical protein ARALYDRAFT_917224             180   7e-50    
ref|NP_001242155.1|  uncharacterized protein LOC100802885 precursor     179   7e-50    
gb|ACU19317.1|  unknown                                                 179   7e-50    
ref|XP_007201377.1|  hypothetical protein PRUPE_ppa010275mg             179   7e-50    
ref|XP_009118876.1|  PREDICTED: acid phosphatase 1                      180   8e-50    
ref|NP_001054848.1|  Os05g0190500                                       180   8e-50    
ref|NP_001042269.1|  Os01g0191200                                       181   8e-50    
ref|XP_011041430.1|  PREDICTED: acid phosphatase 1-like                 179   8e-50    
ref|XP_011013440.1|  PREDICTED: acid phosphatase 1-like                 179   9e-50    
gb|KFK42749.1|  hypothetical protein AALP_AA1G034500                    180   9e-50    
gb|KDO64169.1|  hypothetical protein CISIN_1g025360mg                   179   9e-50    
ref|XP_006654131.1|  PREDICTED: acid phosphatase 1-like                 179   1e-49    
emb|CDY60756.1|  BnaA05g34800D                                          179   1e-49    
emb|CDY32525.1|  BnaA09g50710D                                          179   1e-49    
ref|XP_010505497.1|  PREDICTED: acid phosphatase 1-like                 179   1e-49    
ref|XP_009602493.1|  PREDICTED: acid phosphatase 1-like isoform X1      179   1e-49    
emb|CDY10082.1|  BnaC08g43690D                                          179   2e-49    
ref|XP_004497819.1|  PREDICTED: acid phosphatase 1-like                 178   2e-49    
ref|XP_010227605.1|  PREDICTED: acid phosphatase 1-like isoform X2      179   2e-49    
ref|NP_001237136.1|  syringolide-induced protein B15-3-5                178   2e-49    
ref|XP_006426851.1|  hypothetical protein CICLE_v10026223mg             177   2e-49    
emb|CDX91480.1|  BnaC04g06700D                                          178   2e-49    
ref|XP_008463285.1|  PREDICTED: acid phosphatase 1                      178   3e-49    
gb|EAY72856.1|  hypothetical protein OsI_00725                          179   3e-49    
ref|XP_008438471.1|  PREDICTED: acid phosphatase 1-like                 178   3e-49    
ref|XP_002879756.1|  acid phosphatase class B family protein            177   3e-49    
ref|XP_010098158.1|  Acid phosphatase 1                                 176   3e-49    
ref|XP_010517161.1|  PREDICTED: acid phosphatase 1-like                 177   4e-49    
ref|XP_010509146.1|  PREDICTED: acid phosphatase 1-like                 177   4e-49    
gb|KFK31670.1|  hypothetical protein AALP_AA6G143700                    178   5e-49    
gb|KHN24883.1|  Acid phosphatase 1                                      177   6e-49    
ref|XP_006411076.1|  hypothetical protein EUTSA_v10017121mg             177   7e-49    
ref|XP_010542903.1|  PREDICTED: acid phosphatase 1-like                 177   8e-49    
gb|ACU23922.1|  unknown                                                 176   8e-49    
ref|XP_009783330.1|  PREDICTED: acid phosphatase 1 isoform X2           176   9e-49    
ref|XP_002960188.1|  hypothetical protein SELMODRAFT_139413             178   1e-48    
ref|XP_003555748.1|  PREDICTED: acid phosphatase 1-like                 177   1e-48    
emb|CDY36966.1|  BnaC09g17820D                                          177   1e-48    
emb|CAA56036.1|  vegetative storage product                             177   1e-48    
gb|EYU30687.1|  hypothetical protein MIMGU_mgv1a011950mg                176   1e-48    
gb|AAM61582.1|  vegetative storage protein Vsp2                         176   1e-48    
emb|CDY15485.1|  BnaA08g27690D                                          176   1e-48    
ref|NP_568454.1|  acid phosphatase VSP2                                 176   2e-48    
ref|XP_009783329.1|  PREDICTED: acid phosphatase 1 isoform X1           176   2e-48    
ref|XP_011095174.1|  PREDICTED: acid phosphatase 1                      176   2e-48    
ref|XP_009111130.1|  PREDICTED: acid phosphatase 1-like                 176   2e-48    
ref|XP_009113955.1|  PREDICTED: acid phosphatase 1-like                 176   2e-48    
ref|XP_002967517.1|  hypothetical protein SELMODRAFT_144839             177   2e-48    
gb|EAY82942.1|  hypothetical protein OsI_38160                          176   2e-48    
ref|XP_010091790.1|  Acid phosphatase 1                                 176   2e-48    
ref|NP_001174256.1|  Os05g0190300                                       175   2e-48    
ref|XP_004141031.1|  PREDICTED: acid phosphatase 1-like                 176   3e-48    
ref|XP_006341307.1|  PREDICTED: acid phosphatase 1-like                 176   3e-48    
gb|KHN02475.1|  Acid phosphatase 1                                      176   3e-48    
ref|XP_004157899.1|  PREDICTED: acid phosphatase 1-like                 176   3e-48    
ref|XP_004142728.1|  PREDICTED: acid phosphatase 1-like                 175   3e-48    
ref|XP_006645592.1|  PREDICTED: stem 28 kDa glycoprotein-like           176   3e-48    
ref|XP_007206281.1|  hypothetical protein PRUPE_ppa016173mg             175   3e-48    
gb|KGN54464.1|  Acid phosphatase 1                                      175   3e-48    
ref|XP_006603734.1|  PREDICTED: uncharacterized protein LOC100811...    176   4e-48    
ref|XP_010043623.1|  PREDICTED: acid phosphatase 1-like isoform X2      175   4e-48    
ref|XP_010043614.1|  PREDICTED: acid phosphatase 1-like isoform X1      175   7e-48    
emb|CDX86654.1|  BnaC08g00490D                                          174   9e-48    
ref|XP_007162590.1|  hypothetical protein PHAVU_001G164000g             174   1e-47    
ref|XP_010553191.1|  PREDICTED: acid phosphatase 1                      174   1e-47    
ref|XP_010494401.1|  PREDICTED: acid phosphatase 1-like                 174   1e-47    
ref|XP_010481786.1|  PREDICTED: acid phosphatase 1-like                 174   1e-47    
ref|XP_009123928.1|  PREDICTED: acid phosphatase 1-like                 174   1e-47    
ref|XP_010441940.1|  PREDICTED: acid phosphatase 1-like                 174   1e-47    
gb|AFW82018.1|  Stem glycoprotein                                       172   2e-47    
gb|ACU19087.1|  unknown                                                 174   2e-47    
emb|CDY22316.1|  BnaA06g36380D                                          173   2e-47    
dbj|BAA22096.1|  vegetative storage protein                             173   2e-47    
emb|CDX94751.1|  BnaC07g17600D                                          173   2e-47    
emb|CDY14447.1|  BnaC03g21480D                                          173   2e-47    
ref|NP_001130101.1|  acid phosphatase 1 precursor                       173   3e-47    
ref|XP_009101743.1|  PREDICTED: acid phosphatase 1                      173   3e-47    
ref|NP_181394.1|  HAD superfamily, subfamily IIIB acid phosphatase      172   3e-47    
ref|XP_006599745.1|  PREDICTED: acid phosphatase 1-like                 172   4e-47    
ref|XP_002438575.1|  hypothetical protein SORBIDRAFT_10g022110          172   4e-47    
ref|XP_008355740.1|  PREDICTED: acid phosphatase 1-like                 172   4e-47    
ref|XP_008363936.1|  PREDICTED: acid phosphatase 1-like                 172   4e-47    
ref|XP_006403150.1|  hypothetical protein EUTSA_v10003258mg             172   5e-47    
ref|XP_007145821.1|  hypothetical protein PHAVU_007G270800g             173   6e-47    
ref|XP_010653128.1|  PREDICTED: acid phosphatase 1 isoform X2           171   7e-47    
ref|XP_008244569.1|  PREDICTED: acid phosphatase 1                      171   8e-47    
gb|EMS54945.1|  Acid phosphatase 1                                      170   8e-47    
ref|XP_008370281.1|  PREDICTED: acid phosphatase 1                      171   9e-47    
ref|XP_003628249.1|  Acid phosphatase                                   171   9e-47    
ref|XP_011001652.1|  PREDICTED: acid phosphatase 1-like                 171   9e-47    
ref|XP_009133272.1|  PREDICTED: acid phosphatase 1                      171   9e-47    
ref|XP_010529940.1|  PREDICTED: acid phosphatase 1-like                 171   1e-46    
gb|EEE62601.1|  hypothetical protein OsJ_17404                          171   1e-46    
ref|XP_010653127.1|  PREDICTED: acid phosphatase 1 isoform X1           171   1e-46    
ref|NP_001054851.1|  Os05g0192100                                       169   1e-46    
ref|XP_006296330.1|  hypothetical protein CARUB_v10025510mg             171   1e-46    
ref|XP_007033479.1|  Acid phosphatase 1, putative isoform 1             171   2e-46    
ref|XP_007033481.1|  Acid phosphatase 1, putative isoform 3             171   2e-46    
ref|NP_001054846.1|  Os05g0189300                                       170   2e-46    
ref|NP_001054847.1|  Os05g0189900                                       170   2e-46    
gb|KCW88400.1|  hypothetical protein EUGRSUZ_A00788                     171   2e-46    
ref|XP_004302520.1|  PREDICTED: acid phosphatase 1-like                 170   2e-46    
ref|XP_010043653.1|  PREDICTED: acid phosphatase 1-like                 171   2e-46    
ref|XP_010043667.1|  PREDICTED: acid phosphatase 1-like isoform X2      170   2e-46    
gb|KCW88403.1|  hypothetical protein EUGRSUZ_A00791                     170   3e-46    
gb|EAY96836.1|  hypothetical protein OsI_18758                          169   3e-46    
ref|XP_010043643.1|  PREDICTED: acid phosphatase 1-like isoform X2      170   4e-46    
ref|XP_004960897.1|  PREDICTED: stem 31 kDa glycoprotein-like iso...    171   4e-46    
ref|XP_010043658.1|  PREDICTED: acid phosphatase 1-like isoform X1      170   4e-46    
ref|XP_009370888.1|  PREDICTED: acid phosphatase 1-like                 169   5e-46    
ref|XP_002323092.1|  hypothetical protein POPTR_0016s14650g             169   5e-46    
ref|XP_008388379.1|  PREDICTED: acid phosphatase 1-like                 169   6e-46    
ref|XP_010043635.1|  PREDICTED: acid phosphatase 1-like isoform X1      170   6e-46    
ref|XP_004984487.1|  PREDICTED: acid phosphatase 1-like isoform X1      169   6e-46    
ref|XP_004161712.1|  PREDICTED: acid phosphatase 1-like                 173   8e-46    
gb|AFX67034.1|  stem 28 kDa glycoprotein                                165   1e-45    
ref|XP_010244565.1|  PREDICTED: acid phosphatase 1                      169   1e-45    
ref|XP_009410837.1|  PREDICTED: acid phosphatase 1-like                 169   1e-45    
ref|XP_009337802.1|  PREDICTED: acid phosphatase 1-like                 168   1e-45    
ref|XP_004959893.1|  PREDICTED: acid phosphatase 1-like                 168   2e-45    
dbj|BAD53728.1|  putative Acid phosphatase precursor 1                  168   2e-45    
gb|EAZ01337.1|  hypothetical protein OsI_23372                          168   2e-45    
ref|XP_010683443.1|  PREDICTED: acid phosphatase 1                      168   3e-45    
gb|EPS59737.1|  hypothetical protein M569_15067                         167   3e-45    
ref|XP_002531803.1|  Acid phosphatase 1 precursor, putative             167   3e-45    
ref|XP_004516313.1|  PREDICTED: acid phosphatase 1-like                 167   4e-45    



>ref|XP_009625321.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=257

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 175/223 (78%), Gaps = 1/223 (0%)
 Frame = +1

Query  367   SRHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYAT  546
              RH+P +NCLSWRL VE NNI++W  VP  CE Y+GHYMLG+QYRDDC AV  +AI+YA 
Sbjct  36    GRHVPQINCLSWRLAVETNNIQNWKLVPLQCESYVGHYMLGKQYRDDCNAVIVAAIQYAK  95

Query  547   AVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETL  726
              +++  DGKDVWVFDIDET LSNLPYYAR +V FG  + N TKF+EW R+GKAPA+   L
Sbjct  96    TLKIAKDGKDVWVFDIDETTLSNLPYYARSDVAFGATKFNGTKFDEWTREGKAPAVPGAL  155

Query  727   RLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSE  906
              LY ++LA+G+KPVFI+ TKE+FR  RI+NL+K G+ +W  LIL+G NDT   +M YKS 
Sbjct  156   FLYRTLLAMGIKPVFITGTKEEFRQVRIANLKKVGYHSWVKLILKGVNDTGSSVM-YKSG  214

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             KR ELV  GYRIVGN+GDQWSDLLG+ VG RTFK+PDPMYY+ 
Sbjct  215   KRAELVKAGYRIVGNIGDQWSDLLGDFVGDRTFKLPDPMYYIG  257



>ref|XP_009795136.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=261

 Score =   314 bits (805),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 174/223 (78%), Gaps = 1/223 (0%)
 Frame = +1

Query  367   SRHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYAT  546
              RH+P +NCLSWRL VE NNI++W  VP  CE Y+GHYMLG+QYRDDC AV  +AI+YA 
Sbjct  40    GRHVPQINCLSWRLAVETNNIQNWKLVPLQCESYVGHYMLGKQYRDDCNAVVVAAIQYAK  99

Query  547   AVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETL  726
              +++  DGKDVWVFDIDET LSNLPYYAR +V FG  + N TKF+ W R+GKAPA+   L
Sbjct  100   TLKIAKDGKDVWVFDIDETTLSNLPYYARSDVAFGATKFNGTKFDGWTREGKAPAVPGAL  159

Query  727   RLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSE  906
              LY ++LA+G+KPVFI+ TKE+FR  RI+NL+K G+ +W  LIL+G NDT   +M YKS 
Sbjct  160   FLYRTLLAMGIKPVFITGTKEEFRQVRIANLKKVGYHSWVKLILKGVNDTGSSVM-YKSG  218

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             KR ELV  GYRIVGN+GDQWSDLLG+ VG RTFK+PDPMYY+ 
Sbjct  219   KRAELVKAGYRIVGNIGDQWSDLLGDFVGDRTFKLPDPMYYIG  261



>ref|XP_004235637.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=255

 Score =   307 bits (786),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = +1

Query  373   HIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAV  552
              +P +NCLSWRL VE NNI+DW  VP  CE Y+GHYMLG+QYRDDC  V A+AI+YA  +
Sbjct  36    QVPQINCLSWRLAVETNNIQDWTSVPLQCEDYVGHYMLGKQYRDDCYNVVAAAIQYAKTI  95

Query  553   ELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRL  732
             ++  +GKD+WVFDIDET LSNLPYYAR +V FG  + N TKF+EW R+GKAP +   L L
Sbjct  96    KIGKNGKDIWVFDIDETTLSNLPYYARSDVAFGSIKYNGTKFDEWTREGKAPPVPAALFL  155

Query  733   YNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKR  912
             YN++L++G+KPVFIS TKE+FR  RI+NL K G+ +W  LIL+G NDT    + YKS KR
Sbjct  156   YNTLLSMGIKPVFISGTKEEFRQIRITNLNKVGYHSWIRLILKGVNDTGSS-VKYKSGKR  214

Query  913   TELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              ELV  GYRIVGN+GDQWSDLLG+ VG RTFK+PDPMYY++
Sbjct  215   GELVKDGYRIVGNIGDQWSDLLGDYVGQRTFKLPDPMYYIA  255



>ref|XP_009776612.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=266

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE NN+++W  VP  CE YIGHYMLG+QYR DC AVA +AI YA +++
Sbjct  48    VPQLDCLSWRLAVETNNLQNWKLVPISCENYIGHYMLGKQYRHDCEAVANAAIEYAKSLK  107

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVWVFDIDET LSNLPYYAR +V FG    N+TKF  W+ +GKAPA+   L +Y
Sbjct  108   LSGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIPFNSTKFNAWVAEGKAPAIPSILGVY  167

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
              +VL+LG+KPVFI+ T+E F+  RI+NL+KAG+  W  L+L+G ND+    +++KS KRT
Sbjct  168   KTVLSLGIKPVFITGTRESFKQVRITNLKKAGYSNWAKLVLKGDNDSGT-AVEFKSSKRT  226

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             ELV  GYRIVGN+GDQWSD+LG+NVG RTFK+PDPMYY+
Sbjct  227   ELVKAGYRIVGNIGDQWSDILGDNVGSRTFKVPDPMYYI  265



>ref|XP_004241953.1| PREDICTED: acid phosphatase 1 [Solanum lycopersicum]
Length=278

 Score =   301 bits (772),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL +E NN+++W  VP+ C  Y+GHYM+G+QYR DC  VA  AI YA +++
Sbjct  60    VPQLDCLSWRLAIETNNLQNWRSVPKECTNYLGHYMMGKQYRHDCEYVAKQAIEYAKSLK  119

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVWVFDIDET LSN PYYAR +V FG +  NATKF+ WI +GKAPA+   L++Y
Sbjct  120   LSGDGKDVWVFDIDETTLSNSPYYARSDVAFGAKPYNATKFDAWIAEGKAPAIPSILKVY  179

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
             N+VL+LG+KP+FI+ TK+ F+  RI NL++AG+  W  LIL+GANDT    + +KS KRT
Sbjct  180   NTVLSLGIKPIFITGTKQNFKQVRIVNLKEAGYANWAALILKGANDTGS-AVKFKSSKRT  238

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
              LV  GYRI+GN+GDQWSDL+GENVG RTFK+PDPMYY+
Sbjct  239   ALVKAGYRIIGNIGDQWSDLIGENVGARTFKVPDPMYYI  277



>ref|XP_009622654.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=267

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 170/219 (78%), Gaps = 1/219 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE NN+++W  VP  CE YIGHY+LG+QYR DC AVA +AI YA +++
Sbjct  49    VPQLDCLSWRLAVETNNLQNWKLVPSACENYIGHYILGKQYRHDCEAVANAAIEYAKSLK  108

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVWVFDIDET LSNLPYYAR +V FG    N TKF  W+ +GKAPA+   L +Y
Sbjct  109   LGGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIPYNNTKFNAWVAEGKAPAIPSILGVY  168

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
              +VL+LG+KPVFI+ T+E F+  RI+NL+KAG+  W  L L+G ND+    +++KS KRT
Sbjct  169   KTVLSLGIKPVFITGTRESFKQVRIANLKKAGYSNWAKLALKGDNDSAT-AVEFKSSKRT  227

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             ELV  GYRIVGN+GDQWSDL+GENVG RTFK+PDPMYY+
Sbjct  228   ELVKAGYRIVGNIGDQWSDLIGENVGSRTFKVPDPMYYI  266



>ref|XP_009787591.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=268

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 170/219 (78%), Gaps = 1/219 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE NN+++W  VP  CE YIGHY+LG+QYR DC AVA +AI YA +V+
Sbjct  50    VPQLDCLSWRLAVETNNLQNWKLVPSACENYIGHYILGKQYRHDCEAVANAAIEYAKSVK  109

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVWVFDIDET LSNLPYYAR +V FG    N TKF  W+ +GKAPA+   L +Y
Sbjct  110   LGGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIPYNNTKFNAWVAEGKAPAIPSILGVY  169

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
              +VL+LG+K VFI+ T+E FR  RI+NL+KAG+  W  LIL+G NDT R  ++YKS KR 
Sbjct  170   KTVLSLGIKTVFITGTRESFRKVRITNLKKAGYTNWAKLILKGENDT-RSAVEYKSSKRR  228

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             ELV  GYRI+GN+GDQWSDL+G+N+G RTFK+PDP+YY+
Sbjct  229   ELVKAGYRIIGNIGDQWSDLIGDNLGARTFKVPDPLYYI  267



>ref|XP_010322861.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=266

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE NN+++W  VP+ CE Y+GHYMLG+QYR DC  VA  AI YA A++
Sbjct  48    VPQLDCLSWRLAVETNNLQNWRLVPKECENYVGHYMLGKQYRRDCEYVAKQAIEYAKALK  107

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVWVFDIDET LSNLPYYAR +V FG    N TKF  WI +GKAPA+   L +Y
Sbjct  108   LGGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIAYNNTKFNAWIAEGKAPAIPSILGVY  167

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
              +VL+LG+KPVFI+ T+E F+  RI NL+K G+  W  LIL+G ND+    + +KS KRT
Sbjct  168   KTVLSLGIKPVFITGTRENFKQVRIVNLKKVGYSNWAALILKGENDSGSA-VQFKSSKRT  226

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             ELV  GYRIVGN+GDQW+DL+GENVG RTFK+PDPMYY+S
Sbjct  227   ELVKAGYRIVGNIGDQWTDLIGENVGARTFKVPDPMYYIS  266



>ref|XP_004241952.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=266

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE NN+RDW  VP  C  Y+GHYMLG+QYR DC AVA +AI YA  ++
Sbjct  48    VPQLDCLSWRLAVETNNVRDWKLVPNECSNYVGHYMLGKQYRRDCEAVADAAIEYAKGLK  107

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVWVFD+DET LSNLPYYAR +V FG +  N+T+F  W+ +G APA+  TLRLY
Sbjct  108   LSGDGKDVWVFDVDETTLSNLPYYARSDVAFGAKAFNSTRFNAWVMEGTAPAIPATLRLY  167

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
              +VL+LG+KPV ++ T E  R  R++NL+KAG+ +W  LIL+G ND+ + ++ YKS KRT
Sbjct  168   KTVLSLGIKPVILTGTPEFTREGRVTNLKKAGYTSWLKLILKGENDSPKSVV-YKSNKRT  226

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             ELV  GYRIVGN GDQWSDL+G+N G RTFK+PDPMYY+
Sbjct  227   ELVIAGYRIVGNTGDQWSDLIGKNAGARTFKVPDPMYYI  265



>emb|CDO97963.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              ++P +NCLSWRL VE  N+R+W  VP  CE Y+GHYMLG+QYR+DC AVA  AI YA  
Sbjct  58    HNVPQINCLSWRLAVETYNLRNWKLVPESCENYVGHYMLGKQYREDCDAVADIAIAYAKN  117

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + L  DGK++WVFDIDET+LSN PYYAR +V FG    N TKF  W+ +G APA+   LR
Sbjct  118   LTLAGDGKEIWVFDIDETSLSNAPYYARSDVQFGAIPYNDTKFNAWVAEGAAPAVPGVLR  177

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY ++L+LG+KPVFIS TKE +R  RISNL+  G+R WE LIL+G NDT   ++ YKS K
Sbjct  178   LYKTLLSLGIKPVFISGTKEVYREVRISNLKNVGYRNWEKLILKGENDTGSAVV-YKSNK  236

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             RTELV  GYRIVGN+GDQWSDLLG NVG RTFK+PDPMY++
Sbjct  237   RTELVEAGYRIVGNIGDQWSDLLGTNVGDRTFKVPDPMYFI  277



>ref|XP_006356134.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=264

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 165/220 (75%), Gaps = 1/220 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE NN+++W  VP+ C  Y+GHYMLG+QYR DC  VA  AI YA  ++
Sbjct  46    VPQLDCLSWRLAVETNNLQNWKLVPKECTNYVGHYMLGKQYRRDCEYVAKQAIEYAKTLK  105

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVWVFDIDET LSN PYYAR +V FG    N TKF  W+ +GKAPA+   L +Y
Sbjct  106   LGGDGKDVWVFDIDETTLSNSPYYARSDVAFGAIAYNNTKFSAWLAEGKAPAIPSILGVY  165

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
              +VL+LG+KPVFI+ T+E F+  RI NL+K G+  W  LIL+G ND+    + +KS KRT
Sbjct  166   KTVLSLGIKPVFITGTRENFKQVRIVNLKKVGYSNWAALILKGENDSGSA-VQFKSSKRT  224

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             ELV  GYRIVGN+GDQW+DL+GENVG RTFK+PDPMYY+S
Sbjct  225   ELVKAGYRIVGNIGDQWTDLIGENVGARTFKVPDPMYYIS  264



>gb|AFX66999.1| putative acid phosphatase [Solanum tuberosum]
Length=284

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 164/219 (75%), Gaps = 1/219 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P+L+CLSWRL VE NN++ W  VP+ C  Y+GHYMLG+QYR DC  VA  AI YA +++
Sbjct  47    VPHLDCLSWRLAVETNNLQYWKLVPKECTNYVGHYMLGKQYRHDCEYVAKQAIEYAKSLK  106

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DG DVWVFDIDET LSNLPYYAR +V FG    N+TKF EWI +GKAPA+   L LY
Sbjct  107   LGGDGMDVWVFDIDETTLSNLPYYARSDVAFGAIAYNSTKFHEWIAEGKAPAIPSVLGLY  166

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               VL+LG+KPVFI+ T+E F   RI+NL+K G+  W  LIL+G N +    + +KS KRT
Sbjct  167   KIVLSLGIKPVFITGTRENFEQVRIANLKKVGYTNWAALILKGENYSGSA-VKFKSSKRT  225

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
              LV  GYRIVGN+GDQW+DL+GENVG RTFK+PDPMYYV
Sbjct  226   ALVKAGYRIVGNIGDQWTDLIGENVGARTFKLPDPMYYV  264



>ref|XP_010033713.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53450.1| hypothetical protein EUGRSUZ_J02696 [Eucalyptus grandis]
Length=257

 Score =   276 bits (705),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 164/217 (76%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L CLSWRLGVE +NI++W  VPR CEGY+GHYML  QYR+D   VA  A+ YA +++L  
Sbjct  44    LYCLSWRLGVETHNIKNWNTVPRECEGYVGHYML-HQYREDSKVVAREAVLYAKSLKLAG  102

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET+LSNLPYYA  E GFG+   NAT+F +WI  GKAPA+ ETL LY  +
Sbjct  103   DGKDVWVFDIDETSLSNLPYYA--EHGFGVEPLNATQFGQWILTGKAPALPETLELYREL  160

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG+KP+F++   E  R+   SNLR AGFR WEMLIL+G+  +E   + YKS +R ++ 
Sbjct  161   LKLGIKPIFLTGRPEDARNITSSNLRNAGFRTWEMLILKGSAYSETTAVVYKSSERRKVE  220

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRIVGN+GDQWSDLLG +VG RTFK+P+PMYY+S
Sbjct  221   ESGYRIVGNIGDQWSDLLGIHVGNRTFKLPNPMYYIS  257



>ref|XP_007024338.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
 gb|EOY26960.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
Length=259

 Score =   276 bits (705),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 162/221 (73%), Gaps = 2/221 (1%)
 Frame = +1

Query  373   HIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAV  552
             H+P L+CLSWRLGVE NN+  W  VP  CE Y+GHYMLG QYR D   VA  A+ YA ++
Sbjct  41    HVPGLSCLSWRLGVETNNVVGWITVPEECEEYVGHYMLGHQYRKDSRVVANQALLYAQSL  100

Query  553   ELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRL  732
              L  D KDVWVFDIDETALSNLPYYA  + GFG+ + N T F +W+ +GKAPA+ ETL L
Sbjct  101   SLARDCKDVWVFDIDETALSNLPYYA--QHGFGVEQYNPTLFNKWVMEGKAPALPETLNL  158

Query  733   YNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKR  912
             Y  +L+LG K VF++   E  RS   +NLRKAG++ WE LIL+G++ + +  + YKS +R
Sbjct  159   YKKLLSLGTKVVFLTGRPEYQRSVTANNLRKAGYQTWEKLILKGSSYSGKSAVVYKSSER  218

Query  913   TELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              +L   GY+I+GN+GDQWSDLLG +VG RTFKMPDPMYY+S
Sbjct  219   KKLAMSGYKIIGNMGDQWSDLLGTDVGNRTFKMPDPMYYIS  259



>emb|CAN82027.1| hypothetical protein VITISV_000612 [Vitis vinifera]
Length=255

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 166/222 (75%), Gaps = 3/222 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              H+P L+CLSWRLGVE +NI +W+ VP++CE Y+GHYMLG QYR D  AV   AI +A +
Sbjct  37    HHVPGLSCLSWRLGVETHNIIEWSTVPQVCESYVGHYMLGDQYRKDSGAVVYEAISHAQS  96

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             ++L  DGKD+WVFDIDET+LSNLPY+A+   GFG+   N+T+F  WI +GKAP + E+L+
Sbjct  97    LKLAGDGKDIWVFDIDETSLSNLPYFAK--HGFGVEAYNSTQFNNWIYEGKAPPLPESLK  154

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  + +LG+KPVFI+   E  R+   +NL+ AG+  WE LIL+G++ T   +  YKS +
Sbjct  155   LYKKLQSLGIKPVFITGRPEAQRNVTAANLQNAGYHTWEKLILKGSSVTGTAVA-YKSNE  213

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R +L   GYRIVGN+GDQWSD+LG NVG RTFK+PDPMYY+S
Sbjct  214   RKKLEQSGYRIVGNIGDQWSDILGTNVGNRTFKLPDPMYYIS  255



>ref|XP_010033826.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53661.1| hypothetical protein EUGRSUZ_J02928 [Eucalyptus grandis]
Length=258

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 159/217 (73%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+CLSWRLGVE NNI++W  VP  CEGY+GHYMLG QYR+D   VA  A+ YA +++L  
Sbjct  44    LSCLSWRLGVETNNIKNWTTVPLECEGYVGHYMLGHQYREDSKVVAREAVLYAKSLKLAG  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFD+DET LSNLPYYA+   GFG    N+T F +W+  GKAPA+ ETL LY  +
Sbjct  104   DGKDVWVFDVDETLLSNLPYYAKH--GFGAEPYNSTLFNQWVLTGKAPALPETLELYREL  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG+KP+F++   E  R    SNLR AGFR WEMLIL+G+  +    + YKS +R ++ 
Sbjct  162   LKLGIKPIFLTGRTEDQRKITSSNLRNAGFRNWEMLILKGSAYSGTTAVVYKSSERRKVE  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRIVGN+GDQWSDLLG + G RTFK+PDPMYY+S
Sbjct  222   ESGYRIVGNIGDQWSDLLGIHAGNRTFKLPDPMYYIS  258



>ref|XP_010654601.1| PREDICTED: acid phosphatase 1 [Vitis vinifera]
Length=255

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 164/222 (74%), Gaps = 3/222 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              H+P L+CLSWRLGVE +NI +W+ VP+ CE Y+GHYMLG QYR D   V   AI +A +
Sbjct  37    HHVPGLSCLSWRLGVETHNIIEWSTVPQACESYVGHYMLGDQYRKDSGVVVYEAITHAQS  96

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             ++L  DGKD+WVFDIDET+LSNLPY+A+   GFG+   N+T+F  WI +GKAP + E+L+
Sbjct  97    LKLAGDGKDIWVFDIDETSLSNLPYFAK--HGFGVEAYNSTQFNNWIYEGKAPPLPESLK  154

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  + +LG+KPVFI+   E  R+   +NL+ AG+  WE LIL+G++ T   +  YKS +
Sbjct  155   LYKKLQSLGIKPVFITGRPEAQRNVTAANLQNAGYHTWEKLILKGSSVTGTAVA-YKSNE  213

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R +L   GYRIVGN+GDQWSD+LG NVG RTFK+PDPMYY+S
Sbjct  214   RKKLEQSGYRIVGNIGDQWSDILGTNVGNRTFKLPDPMYYIS  255



>ref|XP_010033828.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53662.1| hypothetical protein EUGRSUZ_J02929 [Eucalyptus grandis]
Length=257

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L CLSWRLGVE +NI++W  VPR CEGY+GHYML  QYR+D   VA  A+ Y  +++L  
Sbjct  44    LYCLSWRLGVETHNIKNWNTVPRECEGYVGHYML-YQYREDSKVVAREAVLYVKSLKLAG  102

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET+LSNLPYYA  E GFG+   N T+F +WI  GKAPA+ ETL LY  +
Sbjct  103   DGKDVWVFDIDETSLSNLPYYA--EHGFGVEPLNPTQFGQWILTGKAPALPETLELYREL  160

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG+KP+F++   E  R+   SNLR AGFR WEMLIL+G+  +E   + YKS +R ++ 
Sbjct  161   LKLGIKPIFLTGRSEDARNITSSNLRNAGFRTWEMLILKGSAYSETTAVVYKSSERRKVE  220

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRIVGN+GDQWSDLLG +VG RTFK+P+PMYY+S
Sbjct  221   ESGYRIVGNIGDQWSDLLGIHVGNRTFKLPNPMYYIS  257



>ref|XP_010033712.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53448.1| hypothetical protein EUGRSUZ_J02694 [Eucalyptus grandis]
Length=258

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 158/217 (73%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+CLSWRLGVE NNI++W  VP  CEGY+GHYMLG QYR+D   VA  A+ YA +++L  
Sbjct  44    LSCLSWRLGVETNNIKNWTTVPLECEGYVGHYMLGHQYREDSKVVAREAVLYAKSLKLAG  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFD+DET LSNLPYYA+   GFG    N+T F +W+  GKAPA+ ETL LY  +
Sbjct  104   DGKDVWVFDVDETLLSNLPYYAKH--GFGAEPYNSTLFNQWVLTGKAPALPETLELYREL  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG+KP+F++   E  R    SNLR AGF  WEMLIL+G+  +    + YKS +R ++ 
Sbjct  162   LKLGIKPIFLTGRTEDQRKITSSNLRNAGFSNWEMLILKGSTYSGTTAVVYKSSERRKVE  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRIVGN+GDQWSDLLG + G RTFK+PDPMYY+S
Sbjct  222   ESGYRIVGNIGDQWSDLLGIHAGNRTFKLPDPMYYIS  258



>ref|XP_006465744.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
Length=264

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 162/223 (73%), Gaps = 2/223 (1%)
 Frame = +1

Query  367   SRHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYAT  546
             +  +P L+CLSWRL VE NNI  W  +P  CEGY+GHYMLG+QYR+D  AVA  AI YA 
Sbjct  44    TNDVPDLSCLSWRLAVETNNIIGWKTIPEKCEGYLGHYMLGQQYREDSEAVAYEAIVYAQ  103

Query  547   AVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETL  726
             ++EL  DG+++W+FDIDET+LSNLPYYA+   GFG+   N+T F EW+  G+AP++ E+L
Sbjct  104   SLELAGDGREIWIFDIDETSLSNLPYYAKH--GFGVEPFNSTLFNEWVNKGEAPSLPESL  161

Query  727   RLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSE  906
              LY  +L+LG+K VF++   E  RS   +NL+  GF  WE LIL+G++ +    + YKS 
Sbjct  162   NLYKKLLSLGIKIVFLTGRPEDQRSVTENNLKNVGFYTWENLILKGSSYSGETAVAYKSN  221

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R  L  +GYRI+GN+GDQWSDLLG N G RTFK+PDPMYY+S
Sbjct  222   ERKRLEKKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYIS  264



>ref|XP_004302846.1| PREDICTED: stem 28 kDa glycoprotein-like [Fragaria vesca subsp. 
vesca]
Length=265

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
             RHIP ++CLSWRLGVE  NI DW  VP  CEGY+GHYMLG QYR D  AV   A  YA +
Sbjct  46    RHIPGVSCLSWRLGVETRNIIDWTTVPAACEGYVGHYMLGHQYRKDSKAVTYEAYLYAKS  105

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + L  D K++W+FDIDET+LSNLPYY  V  GFG+   N+T F+ W+ +G APA+ E+L+
Sbjct  106   LNLTEDDKNLWIFDIDETSLSNLPYY--VHHGFGVEVYNSTTFDAWVLEGTAPALPESLK  163

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  +  LG+K  FI+   E  RS   +NL+K G+  WE L+L+ ++ + +  + YKS +
Sbjct  164   LYKKLSTLGVKVAFITGRGESQRSVTETNLKKVGYHTWEKLVLKDSSYSGKTAVVYKSTE  223

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R +L  +GYRI+GN+GDQWSDLLG NVG RTFKMPDPMYY+S
Sbjct  224   RKKLEEKGYRIIGNIGDQWSDLLGTNVGNRTFKMPDPMYYIS  265



>ref|XP_010690146.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=266

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 161/219 (74%), Gaps = 0/219 (0%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P LNCLSWRL VE  N+R+W  +P  CEGY+GHYM+G QYR DC AV ++A  Y  ++ 
Sbjct  47    VPGLNCLSWRLAVETYNLREWRTIPEECEGYVGHYMMGSQYRKDCLAVTSAAYDYIKSLS  106

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVWVFDIDET+LSNLPYYAR  VGFG    NAT F+EW ++ K+PA+   L  Y
Sbjct  107   LNKDGKDVWVFDIDETSLSNLPYYARPSVGFGANPYNATAFDEWQKEMKSPAIPSVLSFY  166

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               ++  G+K VF+S + E+FR  +  N++  G+  W+M+IL+ A++++   ++YKS  RT
Sbjct  167   KKLVRYGVKIVFLSGSHEEFRQFKERNMKNIGYTKWDMMILKQASESKLKAVEYKSAHRT  226

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             +L   GYRI+GN+GDQWSDL+G++ G+RTFK+PDPMYY+
Sbjct  227   KLEKMGYRIIGNMGDQWSDLIGDHPGMRTFKLPDPMYYI  265



>ref|XP_007215831.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
 gb|EMJ17030.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
Length=261

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 154/220 (70%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE NNI +W  VP  CEGY+GHYMLG QYR D   V   A  YA ++ 
Sbjct  44    VPGLSCLSWRLAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDSKVVTNGAWLYAKSLN  103

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK+VWVFDIDET LSNLPYYA    GFG    NAT F+EW+  G APA+ E+L+LY
Sbjct  104   LTKDGKNVWVFDIDETTLSNLPYYAVN--GFGTELYNATSFDEWVLKGTAPALPESLKLY  161

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VF++   E  R+   +NL+  G+  WE LIL+G+  T +    YKS +RT
Sbjct  162   QKLLTLGVKVVFLTGRGEDKRNVTTTNLKNVGYHTWEKLILKGSAYTGKTSYVYKSAERT  221

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +LV  G+RI+GN GDQWSD+LG NVG RTFK+PDPMYY+S
Sbjct  222   KLVKSGFRIIGNAGDQWSDILGTNVGNRTFKLPDPMYYIS  261



>ref|XP_002515949.1| Stem 28 kDa glycoprotein precursor, putative [Ricinus communis]
 gb|EEF46369.1| Stem 28 kDa glycoprotein precursor, putative [Ricinus communis]
Length=258

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 156/222 (70%), Gaps = 2/222 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              H+P ++CLSWRLGVE NNI  W  VP  CEGY+GHYMLG QYR D   +A  A  YA +
Sbjct  39    HHVPGVSCLSWRLGVETNNIIGWTTVPAECEGYVGHYMLGHQYRKDSKIIADEAFLYAKS  98

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             +EL  DGKD+WVFDIDET LSNLPYYA  E GFG    N+T F +W+   KAPA+ E+L 
Sbjct  99    LELSGDGKDIWVFDIDETTLSNLPYYA--EHGFGAEPYNSTLFNKWVVTSKAPALPESLS  156

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  +L+LG+K VFI+   E  R+   +NL+KAG+  W  L+L+ ++ + +  + YKS +
Sbjct  157   LYKRLLSLGIKIVFITGRTEDQRTVTTNNLKKAGYHTWMKLVLKTSSYSGKTAVFYKSSE  216

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R +LV  GYRI GN+GDQWSDLLG   G RTFK+PDPMYY+S
Sbjct  217   RGKLVKSGYRITGNIGDQWSDLLGTYTGNRTFKLPDPMYYIS  258



>ref|XP_010258709.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=260

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 153/217 (71%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             ++CLSWR GVE NNIR W  +P  CE Y+GHYMLG  YR DC  V   AI YA  ++L  
Sbjct  46    VSCLSWRFGVETNNIRGWKTIPSKCEDYVGHYMLGSLYRKDCKVVVDEAILYAENLKLTG  105

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET LSNLPYYAR   GFG+   N+T F EW+  G+AP + E+LRLY  +
Sbjct  106   DGKDVWIFDIDETILSNLPYYARH--GFGVEPFNSTLFNEWVNTGEAPPLPESLRLYRKL  163

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG+K VF++   E  R A  +NL+KAGF  WE LIL+ +++     + YKS +R  L 
Sbjct  164   LSLGLKIVFLTGRSEDQRKATSTNLKKAGFHTWEKLILKKSSNQGTTAVVYKSGERKTLE  223

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRIVGN+GDQWSD+LG N G RTFK+PDPMYY+S
Sbjct  224   ESGYRIVGNIGDQWSDILGNNTGNRTFKLPDPMYYLS  260



>ref|XP_004302847.1| PREDICTED: stem 28 kDa glycoprotein-like [Fragaria vesca subsp. 
vesca]
Length=262

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
             RH+P ++C+SWRLGVE +NI  W  +P  CE Y+G+YMLG QYR D  AV   A+ YA +
Sbjct  43    RHVPGISCMSWRLGVETHNIVGWTTIPAACERYVGNYMLGHQYRQDSRAVTNEALLYAKS  102

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + L  DGK++WVFDIDET+LSNLPYYA    GFG+   N+T F  W+ +GKAPA+ E+L+
Sbjct  103   LNLTKDGKNLWVFDIDETSLSNLPYYA--HHGFGVELYNSTAFNAWVLEGKAPALPESLK  160

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LYN +LALG+K  FI+   E  RS    NLR  G+  WE LIL+ ++ T    + YKS +
Sbjct  161   LYNKLLALGIKVAFITGRGESQRSVTEINLRYVGYLTWEKLILKNSSYTGNTSVVYKSSE  220

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             + +L   GYRI+GN+GDQWSDLLG NVG RTFK+PDPMYY+S
Sbjct  221   KKKLEESGYRIIGNIGDQWSDLLGTNVGDRTFKLPDPMYYIS  262



>ref|XP_008228404.1| PREDICTED: acid phosphatase 1-like [Prunus mume]
Length=265

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 153/220 (70%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE NNI +W  VP  CEGY+GHYMLG QYR D   V   A  YA ++ 
Sbjct  48    VPGLSCLSWRLAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDSKVVTNGAWLYAKSLN  107

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK+VWVFDIDET LSNLPYYA    GFG    N+T F EW+  G APA+ E+L+LY
Sbjct  108   LTKDGKNVWVFDIDETTLSNLPYYAVN--GFGTELYNSTSFNEWVLKGIAPALPESLKLY  165

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VF++   E  R+   +NL+  G+  WE LIL+G+  T +    YKS +RT
Sbjct  166   QKLLTLGVKVVFLTGRGEDQRNVTTTNLKNVGYHTWEKLILKGSAYTGKTSYVYKSAERT  225

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +LV  G+RI+GN GDQWSD+LG NVG RTFK+PDPMYY+S
Sbjct  226   KLVKSGFRIIGNAGDQWSDILGTNVGNRTFKVPDPMYYIS  265



>ref|XP_010088387.1| Stem 28 kDa glycoprotein [Morus notabilis]
 gb|EXB34861.1| Stem 28 kDa glycoprotein [Morus notabilis]
Length=259

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 154/217 (71%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             ++CLSWR GVE NNI DW+ +P  CE Y+G+YMLG QYR D   V   A  YAT++ L  
Sbjct  45    VSCLSWRFGVETNNIIDWSTIPEKCELYVGNYMLGEQYRKDSEVVIKEAYLYATSLNLSK  104

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET+LSNLPYYAR   GFG+   N T F EWI    APA+ ETL+LY S+
Sbjct  105   DGKDVWIFDIDETSLSNLPYYARH--GFGVEPFNLTSFTEWILTEDAPALPETLKLYKSL  162

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             ++LG K VF+S   E+ RSA   NL   G++AWE ++LR  +D     ++YKS +R +LV
Sbjct  163   ISLGFKIVFLSGRYEKTRSATERNLIYVGYKAWEKVLLRKDSDKSASSLEYKSAQRKQLV  222

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY IVGN+GDQWSDLLG + G RTFK+PDPMYY+S
Sbjct  223   KDGYSIVGNIGDQWSDLLGTDPGNRTFKLPDPMYYIS  259



>ref|XP_007045549.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
 gb|EOY01381.1| Stem 28 kDa glycoprotein, putative [Theobroma cacao]
Length=260

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 163/220 (74%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRLGVE NNI  W  +P+ CEGY+GHYMLG+QYR D  AVA  A  YA +++
Sbjct  43    VPGLSCLSWRLGVETNNIIGWKTIPQECEGYVGHYMLGKQYRKDSKAVADEAFLYAQSLK  102

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKDVW+FD+DET LSNLPYYA  E GFG+   NAT F +W+ +GKAPA+ E+L+LY
Sbjct  103   LPRDGKDVWIFDVDETTLSNLPYYA--EHGFGVEPYNATLFNKWVMEGKAPALPESLKLY  160

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L+LG+K VFI+   E  RS   +NL+K GF +WE LIL+ ++ + +  + YKS +R 
Sbjct  161   KKLLSLGIKAVFITGRAEDQRSITATNLKKVGFHSWEKLILKESSYSGKTSVGYKSNERK  220

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +L   GY+IVGN+GDQWSDLLG   G RTFK+PDPMYY+S
Sbjct  221   KLEKNGYKIVGNIGDQWSDLLGTYTGNRTFKLPDPMYYIS  260



>gb|KDP40846.1| hypothetical protein JCGZ_24845 [Jatropha curcas]
Length=262

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 152/217 (70%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L CLSWRLGVE NNI  W  VP  CEGY+GHYMLG QYR D  AV   A  YA +  L  
Sbjct  48    LTCLSWRLGVETNNIVGWKTVPEECEGYVGHYMLGHQYRLDSKAVTDEAFVYAKSHVLAG  107

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+WVFDIDET LSNLPYYA    GFG    N T F +W+   KAPA+ E+L+LY  +
Sbjct  108   DGKDLWVFDIDETTLSNLPYYA--SHGFGAEPYNFTLFNKWVLTSKAPALPESLQLYKRL  165

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             +ALG+K VFI+   E  R+A   NL+KAG+ AW  L+L+ ++ + +  + YKS +R +LV
Sbjct  166   IALGLKIVFITGRPEDQRAATTDNLKKAGYGAWLKLVLKASSYSGKTAVFYKSSERAKLV  225

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI+GN+GDQWSDLLG N G RTFK+PDPMYY+S
Sbjct  226   KSGYRIIGNIGDQWSDLLGTNTGNRTFKLPDPMYYIS  262



>dbj|BAJ34931.1| hypothetical protein [Vitis hybrid cultivar]
Length=237

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 156/217 (72%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWRL VE NNI +W  VP+ CE Y+GHYMLG QYR D   V   AI YA +++L  
Sbjct  24    LSCPSWRLAVETNNIINWETVPQACESYVGHYMLGHQYRQDSRVVVYEAIAYAESLKLGG  83

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET LSNLPYYA  E GFG    N T F EW+  G+APA+ E+L+LYN +
Sbjct  84    DGKDVWVFDIDETTLSNLPYYA--ENGFGAEVFNETSFNEWVMKGEAPALPESLKLYNKL  141

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             ++LG+K VF++   E  R+  ++NL+K G+  WE LILR ++D    ++ YKS +R ++ 
Sbjct  142   VSLGIKVVFLTGKGEDERNVTVANLKKVGYHTWEKLILRKSSDGSTALV-YKSNQRKKVE  200

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY+IVGN+GDQWSD+LG N G RTFK+PDPMYY++
Sbjct  201   ESGYKIVGNMGDQWSDILGTNTGNRTFKLPDPMYYIA  237



>ref|XP_003632911.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=255

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 156/217 (72%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWRL VE NNI +W  VP+ CE Y+GHYMLG QYR D   V   AI YA +++L  
Sbjct  42    LSCPSWRLAVETNNIINWETVPQACESYVGHYMLGHQYRQDSRVVVYEAIAYAESLKLGG  101

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET LSNLPYYA  E GFG    N T F EW+  G+APA+ E+L+LYN +
Sbjct  102   DGKDVWVFDIDETTLSNLPYYA--ENGFGAEVFNETSFNEWVMKGEAPALPESLKLYNKL  159

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             ++LG+K VF++   E  R+  ++NL+K G+  WE LILR ++D    ++ YKS +R ++ 
Sbjct  160   VSLGIKVVFLTGKGEDERNVTVANLKKVGYHTWEKLILRKSSDGSTALV-YKSNQRKKVE  218

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY+IVGN+GDQWSD+LG N G RTFK+PDPMYY++
Sbjct  219   ESGYKIVGNMGDQWSDILGTNTGNRTFKLPDPMYYIA  255



>ref|XP_002299744.2| hypothetical protein POPTR_0001s19180g [Populus trichocarpa]
 gb|EEE84549.2| hypothetical protein POPTR_0001s19180g [Populus trichocarpa]
Length=261

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              HIP ++CLSWRL VE NN+  W+ VP  CE Y+GHYMLG QYR+D   +   A  +A  
Sbjct  42    HHIPGMSCLSWRLAVETNNVIGWSTVPEECEDYVGHYMLGSQYREDSAVITDEAFAHAKT  101

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
              +L  DGKD+WVFD+DET LSNLPYYA+   GFG    N+T F +W+  GKA A+ E+L+
Sbjct  102   FKLAGDGKDIWVFDVDETTLSNLPYYAKH--GFGAEPYNSTAFNQWVFTGKALALPESLK  159

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY ++L++G+K VF++   E  R+   +NL+ AG+  WE LIL+ ++ + +  + YKS +
Sbjct  160   LYRNLLSIGIKVVFLTGRTEDQRAVTSNNLKNAGYHIWEKLILKSSSYSGKTAVFYKSSE  219

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R +L  +GYRI+GN+GDQWSDLLG +VG RTFK+PDPMYY+S
Sbjct  220   RAKLEKKGYRIIGNIGDQWSDLLGTSVGNRTFKLPDPMYYIS  261



>ref|XP_006465710.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
 gb|KDO51840.1| hypothetical protein CISIN_1g023352mg [Citrus sinensis]
Length=283

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRLGVE NN+  WA VP  C GY+GHYMLG+QYR D   VA  AI YA +++
Sbjct  66    VPGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLK  125

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK++WVFDIDET+LSNLPYYA+   GFG++  N T F EW+  GKAP + E+L+LY
Sbjct  126   LAGDGKNIWVFDIDETSLSNLPYYAKN--GFGVKPYNPTLFNEWVNTGKAPPLPESLKLY  183

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VF++   E  R+   +NL+ AGF  WE LIL+G++ +    + YKS +R 
Sbjct  184   KKLLLLGIKIVFLTGRPEDQRNVTEANLKHAGFDTWEKLILKGSSHSGETAVVYKSSERK  243

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             +L  +GYRI+GN+GDQWSDLLG N G RTFK+PDPMYY+
Sbjct  244   KLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI  282



>ref|XP_011000941.1| PREDICTED: acid phosphatase 1-like [Populus euphratica]
Length=271

 Score =   255 bits (652),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 157/222 (71%), Gaps = 2/222 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              HIP ++CLSWRL VE NN+  W+ VP  CE Y+GHYMLG QYR+D   +   A  +A  
Sbjct  52    HHIPGMSCLSWRLAVETNNVIGWSTVPEDCEDYVGHYMLGSQYREDSALITDEAFAHAKT  111

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
              +L  DGKD+WVFD+DET LSNLPYYA+   GFG    N+T F +W+  GKA A+ E+L+
Sbjct  112   FKLDGDGKDIWVFDVDETTLSNLPYYAKH--GFGAEPYNSTAFNQWVFTGKALALPESLK  169

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  +L++G+K VF++   E  R+   +NL+ AG+  WE LIL+ ++ + +  + YKS +
Sbjct  170   LYRRLLSIGIKVVFLTGRSEDQRAVTSTNLKNAGYHIWEKLILKSSSYSGKTAVFYKSSE  229

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R +L  +GYRI+GN+GDQWSDLLG +VG RTFK+PDPMYY+S
Sbjct  230   RAKLEKKGYRIIGNIGDQWSDLLGTSVGNRTFKLPDPMYYIS  271



>ref|XP_010033825.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53660.1| hypothetical protein EUGRSUZ_J02927 [Eucalyptus grandis]
Length=262

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 156/222 (70%), Gaps = 0/222 (0%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              HIP ++C SWRL VE +NI+DW  VP +CE Y+G+YMLG QYR DC A   +A  YA  
Sbjct  41    HHIPGVSCQSWRLAVETDNIKDWDVVPMVCENYVGNYMLGHQYRKDCNAAGWAAYDYAKG  100

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + L  DGKDVW+FDIDETALSNLPYYAR +  FG +  N T F+EW  +GKAPA+   L 
Sbjct  101   LTLKKDGKDVWIFDIDETALSNLPYYARPDNAFGAKEYNETTFKEWELEGKAPAVPAILY  160

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  +L LG K VFIS   E  RS  + N++K G+  WE LIL+  +++    M YKS+K
Sbjct  161   LYKRLLKLGFKIVFISGKSESLRSITVYNMKKVGYHTWEKLILKQTSESGTTAMVYKSKK  220

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R EL   GYRI+GN+GDQWSDL+G +VG RTFK+P+PM+Y++
Sbjct  221   RKELEEAGYRILGNMGDQWSDLMGSHVGNRTFKVPNPMFYIA  262



>ref|XP_010033711.1| PREDICTED: acid phosphatase 1-like [Eucalyptus grandis]
 gb|KCW53446.1| hypothetical protein EUGRSUZ_J02693 [Eucalyptus grandis]
Length=262

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 156/222 (70%), Gaps = 0/222 (0%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              HIP ++C SWRL VE +NI+DW  VP +CE Y+G+YMLG QYR DC A   +A  YA  
Sbjct  41    HHIPGVSCQSWRLAVETDNIKDWDVVPMVCENYVGNYMLGHQYRKDCNAAGWAAYDYAKG  100

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + L  DGKDVW+FDIDETALSNLPYYAR +  FG +  N T F+EW  +GKAPA+   L 
Sbjct  101   LTLKKDGKDVWIFDIDETALSNLPYYARPDNAFGAKEYNETTFKEWELEGKAPAVPAILY  160

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  +L LG K VFIS   E  RS  + N++K G+  WE LIL+  +++    M YKS+K
Sbjct  161   LYKRLLKLGFKIVFISGKSESLRSITVYNMKKVGYHTWEKLILKQTSESGTTAMVYKSKK  220

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R EL   GYRI+GN+GDQWSDL+G +VG RTFK+P+PM+Y++
Sbjct  221   RKELEEAGYRILGNMGDQWSDLMGSHVGNRTFKVPNPMFYIA  262



>gb|KDO51839.1| hypothetical protein CISIN_1g036571mg, partial [Citrus sinensis]
Length=251

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 161/223 (72%), Gaps = 2/223 (1%)
 Frame = +1

Query  367   SRHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYAT  546
             +   P L+CLSWRL VE NNI  W   P  CEGY+GHYMLG+QYR+D  AVA  AI YA 
Sbjct  31    TNDFPDLSCLSWRLAVETNNIIGWKTTPEKCEGYLGHYMLGQQYREDSEAVAYEAIVYAQ  90

Query  547   AVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETL  726
             ++EL  DG+++W+FDIDET+LSNLPYYA+   GFG+   N+T F EW+  G+AP++ E+L
Sbjct  91    SLELAGDGREIWIFDIDETSLSNLPYYAKH--GFGVEPFNSTLFNEWVNKGEAPSLPESL  148

Query  727   RLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSE  906
             +LY  +L+LG+K VF++   E  RS   +NL+  GF  WE LIL+G++ +    + YKS 
Sbjct  149   KLYKKLLSLGIKIVFLTGRPEDQRSVTENNLKNVGFYTWENLILKGSSYSGETAVVYKSS  208

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R  L  +GYRI+GN+GDQWSDLLG N G RTFK+PDPMYY+S
Sbjct  209   ERKRLEKKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYIS  251



>ref|XP_006426853.1| hypothetical protein CICLE_v10027566mg [Citrus clementina]
 gb|ESR40093.1| hypothetical protein CICLE_v10027566mg [Citrus clementina]
Length=264

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 161/223 (72%), Gaps = 2/223 (1%)
 Frame = +1

Query  367   SRHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYAT  546
             +   P L+CLSWRL VE NNI  W   P  CEGY+GHYMLG+QYR+D  AVA  AI YA 
Sbjct  44    TNDFPDLSCLSWRLAVETNNIIGWKTTPEKCEGYLGHYMLGQQYREDSEAVAYEAIVYAQ  103

Query  547   AVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETL  726
             ++EL  DG+++W+FDIDET+LSNLPYYA+   GFG+   N+T F EW+  G+AP++ E+L
Sbjct  104   SLELAGDGREIWIFDIDETSLSNLPYYAKH--GFGVEPFNSTLFNEWVNKGEAPSLPESL  161

Query  727   RLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSE  906
             +LY  +L+LG+K VF++   E  RS   +NL+  GF  WE LIL+G++ +    + YKS 
Sbjct  162   KLYKKLLSLGIKIVFLTGRPEDQRSVTENNLKNVGFYTWENLILKGSSYSGETAVVYKSS  221

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R  L  +GYRI+GN+GDQWSDLLG N G RTFK+PDPMYY+S
Sbjct  222   ERKRLEKKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYIS  264



>ref|XP_006426852.1| hypothetical protein CICLE_v10026223mg [Citrus clementina]
 gb|ESR40092.1| hypothetical protein CICLE_v10026223mg [Citrus clementina]
Length=283

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 157/219 (72%), Gaps = 2/219 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRLGVE NN+  WA VP  C  Y+GHYMLG+QYR D   VA  AI +A ++ 
Sbjct  66    VPGLSCLSWRLGVETNNVIGWATVPEKCADYVGHYMLGQQYRLDSEVVANEAILHAQSLT  125

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGKD+WVFDIDET+L NLPYYA+   GFG++  N T F EW+  GKAP + E+L+LY
Sbjct  126   LAGDGKDIWVFDIDETSLCNLPYYAKN--GFGVKPYNPTMFNEWVNTGKAPPLPESLKLY  183

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VF++   E  R+   +NL+ AGF  WE LIL+G++ +    + YKS +R 
Sbjct  184   KKLLLLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKGSSHSGETAVVYKSSERK  243

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             +L  +GYRI+GN+GDQWSDLLG N G RTFK+PDPMYY+
Sbjct  244   KLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI  282



>ref|XP_010915365.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=262

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             ++C+SWR+GVEANN+RDW  +P  CEGY+GHYMLG  YR D   V A A  YA  + L  
Sbjct  49    VSCVSWRVGVEANNVRDWKTIPSTCEGYVGHYMLGDLYRQDSALVTAEAANYAEGLNLQG  108

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET LSNLPYYA    GFG+   NAT F  W+  G+APA+ E+L LY  +
Sbjct  109   DGKDVWVFDIDETTLSNLPYYA--HHGFGVELYNATSFNAWVMKGEAPALPESLGLYKKL  166

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG+K VF++   E  R+    NLR  G+  WE L+L+  N      + YKS  R +L+
Sbjct  167   LSLGIKIVFLTGRTEDQRNITAHNLRMVGYHTWEKLLLKALN-VRGSSVAYKSGMRQKLI  225

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRIVGN+GDQWSD+LG+  G RTFK PDPMYY+S
Sbjct  226   DEGYRIVGNMGDQWSDILGQPKGDRTFKFPDPMYYIS  262



>ref|XP_009797387.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=239

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 163/221 (74%), Gaps = 5/221 (2%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P +NCLSWR+ VE NNIRDW  VP  C+ Y+  YM  +QYRDDC AV  +AI+YA  + 
Sbjct  20    VPQINCLSWRMAVETNNIRDWKTVPVQCKSYVSEYMTSQQYRDDCNAVVIAAIQYAKTLN  79

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             +  +GKD+WVF+IDET LSN+PYY+R EVGFG  + +  K+E WI++GK+PA+   L LY
Sbjct  80    VSKEGKDLWVFNIDETTLSNVPYYSRPEVGFGATKSSGKKYESWIKEGKSPAVPGALLLY  139

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE---RPMMDYKSE  906
              ++L LG+KP+FI++TKE+FR  RI+NL+KAG+ +W   I +G ND+E       ++K++
Sbjct  140   KTLLDLGIKPIFITDTKEEFRQLRIANLKKAGYHSWFKFICKGKNDSELYSEHKGNWKTQ  199

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
             KR ELV  GYR+VGN+G  W D++ + + LRTFKMP+PMYY
Sbjct  200   KRAELVKAGYRLVGNLGG-WDDIIVDFL-LRTFKMPNPMYY  238



>ref|XP_008798588.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=262

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 149/217 (69%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             + C SWR+ VEANN+R W  +PR CEGY+GHYMLG  YR D   VA  A +YA +++L  
Sbjct  49    VTCESWRVAVEANNMRGWKTIPRTCEGYVGHYMLGGLYRRDSAVVAGEAAKYAESLDLRA  108

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFD+DET LSNLPYYAR   GFG+   NAT F  W+  GKAPA+ E+L LY  +
Sbjct  109   DGKDVWVFDVDETTLSNLPYYAR--HGFGVELYNATSFNAWVMKGKAPALPESLELYKKL  166

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG+K VF++   E  R     NL+  G+  WE L+L+G N +   +  YKS  R +L 
Sbjct  167   LSLGIKIVFLTGRTEDQRDITAHNLKMVGYHTWEKLLLKGLNVSGSSVA-YKSGMRQKLE  225

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY +VGN+GDQWSD+LG+  G RTFK+PDPMYY+S
Sbjct  226   EEGYSVVGNIGDQWSDILGQPEGGRTFKVPDPMYYIS  262



>gb|EYU36713.1| hypothetical protein MIMGU_mgv1a012835mg [Erythranthe guttata]
Length=238

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 151/217 (70%), Gaps = 1/217 (0%)
 Frame = +1

Query  388   NCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHD  567
             NCLSWRL VE NN+R+W  VP  C  ++  YM   QYR DC  VA +A+ +A  V+L  D
Sbjct  22    NCLSWRLSVETNNLRNWKLVPNECATHVKVYMERGQYRQDCDIVADTAVEFAKTVKLAGD  81

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GK++WVFDIDETALSNLP+YAR +V +G +  N T   EWI++GKAPA    L+LY  ++
Sbjct  82    GKEIWVFDIDETALSNLPFYARPDVAYGAKSYNWTGLGEWIKEGKAPANPSMLKLYKELI  141

Query  748   ALGMKPVFIS-ETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             AL  K VF++   +E+F   RISNL+ AG+  WE LI +   +   P   +KS+KR EL 
Sbjct  142   ALKYKIVFLTGANEERFMKPRISNLKNAGYTTWEKLIFKPGAEKGTPTKIFKSKKRKELE  201

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRIVGNVGDQW DL+G+ VG+RTFK+P+PMYYV+
Sbjct  202   TAGYRIVGNVGDQWGDLVGDYVGMRTFKLPNPMYYVA  238



>ref|XP_009625320.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=237

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 160/218 (73%), Gaps = 5/218 (2%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             +NCLSWR+ VE NNIRDW  VP  C+ Y+  YM  +QYRDDC AV  +AI YA ++ +  
Sbjct  21    INCLSWRIAVETNNIRDWKTVPTQCKSYVSEYMTSQQYRDDCNAVVIAAIEYAKSLNISK  80

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             +GKD+WVF+IDET LSN+PYY+R +VGFG  + +  KFE WI++GK+PA+   L LY  +
Sbjct  81    EGKDLWVFNIDETTLSNVPYYSRPQVGFGATKSSGKKFESWIKEGKSPAVPGVLLLYKIL  140

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE---RPMMDYKSEKRT  915
             L LG+KP+FI++TKE+FR  RI+NL+KAG+ +W   I +G ND+E       ++K++KR 
Sbjct  141   LDLGIKPIFITDTKEEFRQLRIANLKKAGYHSWFKFICKGKNDSELYTEHKGNWKTQKRA  200

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
             ELV  GYR+VGN+G  W D++ + + LRTFKMP+PMYY
Sbjct  201   ELVKAGYRLVGNLGG-WDDIIVDFL-LRTFKMPNPMYY  236



>ref|XP_009338743.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=261

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 155/220 (70%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P ++CLSWRLGVE  NI +W  VP  CE Y+GHYMLG QYR D   VA  A  +A ++ 
Sbjct  44    VPGVSCLSWRLGVETRNIINWKTVPAECESYVGHYMLGHQYRKDSKVVADEAWLHAQSLN  103

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK+VWVFDIDET LSNLPYYAR   GFG    NAT F EW+ +G APA+ E+L+LY
Sbjct  104   LTKDGKNVWVFDIDETTLSNLPYYARH--GFGTEVYNATAFNEWVFEGTAPALPESLKLY  161

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VFI+   E  RS   +NL+ AG+  W+ L+L+G+N + +    YKS +R 
Sbjct  162   KKLLRLGVKVVFITGRGEDQRSVTTTNLKNAGYDTWKKLVLKGSNYSGKTSYVYKSAERE  221

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +L   G+RI+GN+GDQWSD+LG  VG RTFK+PDP+YY+S
Sbjct  222   KLEKNGFRIIGNMGDQWSDILGTTVGNRTFKLPDPLYYIS  261



>ref|XP_004510320.1| PREDICTED: stem 28 kDa glycoprotein-like [Cicer arietinum]
Length=262

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 153/223 (69%), Gaps = 3/223 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +IP L+C SWR+GVEA+NI +W  +P+ CE Y+G+YMLG QYR D   V      YA  
Sbjct  42    HYIPDLSCASWRVGVEAHNIINWKTIPKECEKYVGNYMLGAQYRADSKYVNREGYYYAKT  101

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + +  DGKD+WVFDIDET LSNLPYYA+   GFG+   N   F EW+  G APA+ E+ +
Sbjct  102   LNISGDGKDIWVFDIDETTLSNLPYYAK--HGFGVEPYNEVAFNEWVEVGAAPALPESQK  159

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE-RPMMDYKSE  906
             LYN +L+LG+K VF++    + +++  +NL+ AG+  WE LIL+       +  + YKS 
Sbjct  160   LYNKLLSLGIKIVFLTGRPLKQKNSTATNLKNAGYHTWEKLILKDTTKYHGKTAVTYKSS  219

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R +L   GYRIVGN+GDQWSD+LG N+G RTFK+PDP+YY+S
Sbjct  220   ERKKLEKEGYRIVGNIGDQWSDILGTNIGQRTFKLPDPLYYIS  262



>ref|XP_004305256.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=263

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 154/221 (70%), Gaps = 2/221 (1%)
 Frame = +1

Query  373   HIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAV  552
             H+  ++CLSWRLGVE +NI DW  +P  CEGY+GHYMLG QYR D   V   A  YA  +
Sbjct  45    HVGNISCLSWRLGVETHNIIDWTTIPAACEGYVGHYMLGDQYRKDSAVVTHEAYVYAEGL  104

Query  553   ELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRL  732
              L  DG  +WVFD+DET LSNLPYYA+   GFG+   N+T F  W+ +G APA+ E+L+L
Sbjct  105   NLTDDGNKLWVFDVDETTLSNLPYYAKH--GFGVEVYNSTAFNAWVLEGIAPALPESLKL  162

Query  733   YNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKR  912
             Y  +LALG+K  FI+   E  R+   +NL+ AG+  WE LIL+G++ +    + YKS +R
Sbjct  163   YKKLLALGIKVAFITGRGESQRNVTETNLKNAGYDTWETLILKGSSYSGNTSVVYKSAER  222

Query  913   TELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             T+L   GY I+GN+GDQWSDL+G +VG RTFK+PDPMYY+S
Sbjct  223   TKLEESGYTIIGNIGDQWSDLIGTSVGNRTFKLPDPMYYIS  263



>ref|XP_009344485.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=274

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 156/220 (71%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P ++CLSWRLGVE  NI +W  VP  CE Y+GHYMLG QYR D  AV   A  YA ++ 
Sbjct  57    VPGVSCLSWRLGVEVRNIINWKTVPAQCESYVGHYMLGHQYRKDSKAVTDVAWLYAKSLN  116

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK+VWVFDIDET LSNLPYYAR   GFG    N+T F+EW+ +G APA+ E+L+LY
Sbjct  117   LTKDGKNVWVFDIDETTLSNLPYYARH--GFGTEVYNSTSFDEWVLEGTAPALPESLQLY  174

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VFI+   E  RS   +NL+  G+R WE L+L+G+  + +    YKS +R 
Sbjct  175   KKLLKLGVKVVFITGRGEDRRSVTTTNLKNVGYRTWEKLVLKGSAYSGKTSYVYKSAERE  234

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +L   G+RI+GN+GDQWSD+LG +VG RTFK+PDP+YY+S
Sbjct  235   KLEKSGFRIIGNIGDQWSDILGTSVGNRTFKLPDPLYYIS  274



>gb|AGG23547.1| acid phosphatase-like protein 1 [Malus hupehensis]
Length=261

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 155/220 (70%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P ++CLSWRLGVE  NI +W  VP  CE Y+GHYMLG QYR D  AV   A  YA ++ 
Sbjct  44    VPGVSCLSWRLGVEVRNIINWKTVPAQCESYVGHYMLGHQYRKDSKAVTDVAWLYAKSLN  103

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK+VWVFDIDET LSNLPYYAR   GFG    N+T F EW+ +G APA+ E+L+LY
Sbjct  104   LTKDGKNVWVFDIDETTLSNLPYYARH--GFGTEVYNSTSFNEWVLEGTAPALPESLQLY  161

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VFI+   E  RS  I+NL+  G+  WE L+L+G+  + +    YKS +R 
Sbjct  162   KKLLKLGVKVVFITGRGEDQRSVTITNLKNVGYHTWEKLVLKGSAYSGKTSYVYKSAERE  221

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +L   G+RI+GN+GDQWSD+LG +VG RTFK+PDP+YY+S
Sbjct  222   KLEKSGFRIIGNIGDQWSDILGTSVGNRTFKLPDPLYYIS  261



>ref|XP_008380842.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=274

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 155/220 (70%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P ++CLSWRLGVE  NI +W  VP  CE Y+GHYMLG QYR D  AV   A  YA ++ 
Sbjct  57    VPGVSCLSWRLGVEVRNIINWKTVPAQCESYVGHYMLGHQYRKDSKAVTDVAWLYAKSLN  116

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK+VWVFDIDET LSNLPYYAR   GFG    N+T F EW+ +G APA+ E+L+LY
Sbjct  117   LTKDGKNVWVFDIDETTLSNLPYYARH--GFGTEVYNSTSFNEWVLEGTAPALPESLQLY  174

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VFI+   E  RS  I NL+  G+  WE L+L+G+  + +   +YKS +R 
Sbjct  175   KKLLKLGVKVVFITGRGEDQRSVTIXNLKNVGYHTWEKLVLKGSAYSGKTSYEYKSAERE  234

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +L   G+RI+GN+GDQWSD+LG +VG RTFK+PDP+YY+S
Sbjct  235   KLEKSGFRIIGNMGDQWSDILGTSVGNRTFKLPDPLYYIS  274



>ref|XP_006654134.1| PREDICTED: stem 28 kDa glycoprotein-like [Oryza brachyantha]
Length=245

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 150/220 (68%), Gaps = 7/220 (3%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA+N+ +W  VP  CEGY+GHY+LG  YR D   V   AI YA  ++L  +G
Sbjct  28    CDSWRLGVEAHNVINWKTVPAKCEGYVGHYLLGGHYRRDSAVVVDEAIAYAETLQLAGNG  87

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VW+FDIDET+LSNLPYYA+   GFG+   N T F E++ +G APA+ ET RLY  +L 
Sbjct  88    KEVWIFDIDETSLSNLPYYAK--HGFGVTPYNDTSFREYVAEGSAPALPETRRLYRRLLE  145

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILR-----GANDTERPMMDYKSEKRT  915
             +G+KPVF++   E  R+  ++NLRK G+  WE L+L+      A     P + YKS +R 
Sbjct  146   IGVKPVFLTGRTEDQRAVTVANLRKQGYSGWEKLLLKPAVHGAAGGLHAPAVAYKSGQRQ  205

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +L   G+ IVGN+GDQWSD+LGE  G RTFK+PDP+YY+ 
Sbjct  206   KLKDSGFIIVGNIGDQWSDILGEPEGARTFKLPDPLYYIG  245



>ref|XP_010654600.1| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=255

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 160/222 (72%), Gaps = 4/222 (2%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              H+P L+CLSWRLGVEA+NI +W+ VP+ CE Y+GHYMLG QYR D  AV   A+ YA +
Sbjct  38    HHVPGLSCLSWRLGVEAHNIIEWSTVPQACESYVGHYMLGHQYRKDSRAVVYEALTYAQS  97

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             ++L  DGKD+WVFD+DET+ SNLPYYA+   GF +   N+T+F  W+ +GKAPA+ E+L+
Sbjct  98    LKLAVDGKDIWVFDVDETSPSNLPYYAK--HGFRVEAYNSTQFNNWVYEGKAPALPESLK  155

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  +L+LG+K VFI+   E  R+   +NLR  G+  WE LIL+G+  +   ++ YKS +
Sbjct  156   LYKKLLSLGIKAVFITGRPEAQRNVTAANLRNVGYHTWEKLILKGS--SAGTIVVYKSNE  213

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R +L   GYRI+ N+GDQWSD+LG N   RTFK+ +PMYY+S
Sbjct  214   RKKLKKSGYRIIDNIGDQWSDILGTNTENRTFKLSNPMYYIS  255



>ref|XP_009381186.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=263

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 154/219 (70%), Gaps = 7/219 (3%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             + C SWR GVE NN+R W  VPR CEGY+GHYMLG +YR D   V A+A  Y   +++  
Sbjct  50    VTCASWRFGVETNNVRGWRTVPRSCEGYVGHYMLGDRYRQDSAVVTAAAAAYVEGLQIPG  109

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG D W+FDIDET LSNLPYYA    GFG+   NAT F  W+  G APA+ E+L+LY+ +
Sbjct  110   DGMDAWIFDIDETVLSNLPYYA--HHGFGVEPYNATSFNAWVDKGIAPALPESLKLYHKL  167

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILR--GANDTERPMMDYKSEKRTE  918
             L LG+K VF++   E+ R+  I+NL++AG+R WE L+L+  G N T    M +K+ +R +
Sbjct  168   LPLGIKIVFLTGRSEERRNVTITNLKRAGYRTWEKLLLKGEGVNGT---AMAFKTAEREK  224

Query  919   LVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             L  +GYRIVGN+GDQWSD+LG+  G RTFK+PDP+YY+S
Sbjct  225   LEEQGYRIVGNIGDQWSDILGKPEGARTFKLPDPLYYIS  263



>ref|XP_003530059.1| PREDICTED: stem 28 kDa glycoprotein-like [Glycine max]
Length=264

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 152/223 (68%), Gaps = 5/223 (2%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +IP ++C SWRLGVEA+N+ DW  +P+ CEGYIG+YMLG QYR D   V   A  YA  
Sbjct  46    HYIPEVSCKSWRLGVEAHNVIDWRTIPQDCEGYIGNYMLGHQYRSDSKTVCREAYFYAKT  105

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + +    K  WVFD+DET LSNLPY+A  + GFG+   NAT F EW+  G+APA+ E+L+
Sbjct  106   INIT--AKTTWVFDVDETTLSNLPYFA--DHGFGVELYNATAFNEWVDLGEAPALPESLK  161

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGAND-TERPMMDYKSE  906
             LYN +L+LG+K VFI+      ++   +NL+ AG+  WE LI +  +    +  + YKS 
Sbjct  162   LYNKLLSLGIKIVFITGRPLYQQAVTATNLKLAGYYKWEKLITKDTDKYNGKTAVTYKST  221

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R +L   GY I+GN+GDQWSD+LG N GLRTFK+PDPMYY+S
Sbjct  222   ERQKLEENGYNIIGNIGDQWSDILGTNTGLRTFKLPDPMYYIS  264



>gb|KHN39260.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=226

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 151/223 (68%), Gaps = 5/223 (2%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +IP ++C SWRLGVEA+N+ DW  +P+ CEGYIG+YMLG QYR D   V   A  YA  
Sbjct  8     HYIPEVSCKSWRLGVEAHNVIDWRTIPQDCEGYIGNYMLGHQYRSDSKTVCREAYFYAKT  67

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + +    K  WVFD+DET LSNLPY+A  + GFG+   NAT F EW+  G+APA+ E+L+
Sbjct  68    INIT--AKTTWVFDVDETTLSNLPYFA--DHGFGVELYNATAFNEWVDLGEAPALPESLK  123

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGAND-TERPMMDYKSE  906
             LYN +L+LG+K VFI+      ++   +NL+ AG+  WE LI +  +    +  + YKS 
Sbjct  124   LYNKLLSLGIKIVFITGRPLYQQAVTATNLKLAGYYKWEKLITKDTDKYNGKTAVTYKST  183

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R +L   GY I+GN+GDQWSD+LG N G RTFK+PDPMYY+S
Sbjct  184   ERQKLEENGYNIIGNIGDQWSDILGTNTGHRTFKLPDPMYYIS  226



>ref|XP_008348489.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=274

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 155/220 (70%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE  NI +W  VP  C  Y+GHYMLG QYR D   +   A  YA ++ 
Sbjct  57    VPGLSCLSWRLAVEVGNIINWKTVPAQCGSYVGHYMLGHQYRKDSKLITDVAWLYAKSLN  116

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK+VWVFDIDET LSNLPY+AR   GFG +  N T F EW+ +G+APA+ E+L+LY
Sbjct  117   LKKDGKNVWVFDIDETTLSNLPYFARQ--GFGTKAFNITAFNEWVLEGRAPALPESLQLY  174

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VFI+  +E  RS  I+NLR  G+R WE L+L+G+  + +   ++KS +R 
Sbjct  175   KKLLKLGVKVVFITGREEDQRSVTITNLRNVGYRTWEKLVLKGSAYSGKTSYEFKSAERA  234

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +L   G+RI+GN+GDQWSD+LG + G RTFK+PDP+YYVS
Sbjct  235   KLEKSGFRIIGNMGDQWSDILGASAGNRTFKLPDPLYYVS  274



>ref|XP_008358084.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=261

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 155/220 (70%), Gaps = 2/220 (1%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
             +P L+CLSWRL VE  NI +W  VP  C  Y+GHYMLG QYR D   +   A  YA ++ 
Sbjct  44    VPGLSCLSWRLAVEVGNIINWKTVPAQCGSYVGHYMLGHQYRKDSKLITDVAWLYAKSLN  103

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DGK+VWVFDIDET LSNLPY+AR   GFG +  N T F EW+ +G+APA+ E+L+LY
Sbjct  104   LKKDGKNVWVFDIDETTLSNLPYFARQ--GFGTKAFNITAFNEWVLEGRAPALPESLQLY  161

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
               +L LG+K VFI+  +E  RS  I+NLR  G+R WE L+L+G+  + +   ++KS +R 
Sbjct  162   KKLLKLGVKVVFITGREEDQRSVTITNLRNVGYRTWEKLVLKGSAYSGKTSYEFKSAERA  221

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +L   G+RI+GN+GDQWSD+LG + G RTFK+PDP+YYVS
Sbjct  222   KLEKSGFRIIGNMGDQWSDILGASAGNRTFKLPDPLYYVS  261



>ref|XP_006654133.1| PREDICTED: acid phosphatase 1-like [Oryza brachyantha]
Length=272

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 146/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRLGVEA+NI DW  VP  CEGY+GHYMLG  YR D   V   A+ YA  ++L  
Sbjct  59    LPCDSWRLGVEAHNIIDWETVPAKCEGYVGHYMLGGHYRRDSAVVVDEAVAYAETLQLAG  118

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             +GK+VW+FD+DET LSNLPYYA    GFG +  N T F  +  +G APA+ ETLRLY  +
Sbjct  119   NGKEVWIFDVDETTLSNLPYYAN--YGFGAKPFNHTSFINYAAEGTAPALPETLRLYQRL  176

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG+KPV ++  +E  R A   NLR+ G+  WE L+L+  +  +     +KS +R +LV
Sbjct  177   LELGIKPVILTGRREYLRDATEKNLRQQGYSMWEKLLLKPTSALQAGAA-FKSGERQKLV  235

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY IVGN+GDQWSD+LG   G RTFK+PDPMYYVS
Sbjct  236   DAGYAIVGNIGDQWSDILGAPEGSRTFKLPDPMYYVS  272



>emb|CAB71336.2| putative acid phosphatase [Hordeum vulgare subsp. vulgare]
 emb|CAF31501.1| putative acid phosphatase [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA N+RDW  VP  CEGY+GHYMLG  +R DC  V   AI Y   ++L  +G
Sbjct  61    CDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGNHFRRDCKVVIDQAIAYVDGLKLAGNG  120

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVWVFDIDET LSNLPYYA    GFG R  NAT F+ ++ +G AP + ET RLY  +L 
Sbjct  121   KDVWVFDIDETTLSNLPYYA--THGFGARPYNATSFDAYVMEGSAPVLPETKRLYYKLLK  178

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPVFI+   E  R+  + NLR  GF  W  L L+  +  +   + YKS +R +L   
Sbjct  179   VGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMSLTLK-QHGFKGSAISYKSAERKKLEDA  237

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSD+LG   G RTF  PDPMYY++
Sbjct  238   GYVIVGNIGDQWSDILGAPEGARTFSRPDPMYYIA  272



>ref|XP_011101105.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=267

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 149/217 (69%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR+ VEANN+  W ++P  C  Y+  YM+G+ Y  D   V+  A  +A +V L  
Sbjct  53    LQCTSWRVAVEANNLSPWEKIPEECADYVKEYMIGKGYELDLQRVSNEAKAFARSVYLSG  112

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGK  W+FD+DET LSNLPYYA  + GFG+   ++TKF +W+  G APA++ +L LY  V
Sbjct  113   DGKSAWIFDVDETLLSNLPYYA--DHGFGLEVFDSTKFGQWVEMGIAPAIESSLELYEEV  170

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K + ++   E+ RS  + NL +AGFR W+ L+LR + D E+    YKSEKR ELV
Sbjct  171   LSLGFKVILLTGRSERHRSITVENLFQAGFREWDKLLLRSSEDHEKTATIYKSEKRNELV  230

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              +GY+I+GN GDQWSDLLG ++ +R+FK+P+PMYY+S
Sbjct  231   EQGYQILGNSGDQWSDLLGSSMSIRSFKLPNPMYYIS  267



>gb|AFK40440.1| unknown [Lotus japonicus]
Length=261

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 150/223 (67%), Gaps = 3/223 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +IP ++C SW LGVEA+NI +W  +P  CEGY+G+YM+G+QYR D   V   A  YA +
Sbjct  41    HYIPDVSCASWTLGVEAHNIINWKTIPEECEGYVGNYMIGQQYRSDSKTVCKQAYFYARS  100

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + L  DGK++WVFDIDET+LSNLPYYA  E GFG+   N T F  W+    AP + E+L+
Sbjct  101   LNLPRDGKNIWVFDIDETSLSNLPYYA--EHGFGLELYNDTAFNLWVDRAAAPVLPESLK  158

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGAND-TERPMMDYKSE  906
             LYN +L+LG+K  F++      +     NL+ AGF  WE LIL+  +  + +  + YKS 
Sbjct  159   LYNKLLSLGIKIAFLTGRPLSQKDNTAKNLKLAGFYTWEKLILKEPSTYSGKTAVTYKSA  218

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R +L   GYRI+GN+GDQWSD+LG   G RTFK+PDPMYY+S
Sbjct  219   ERKKLEEEGYRIIGNIGDQWSDILGTTTGNRTFKLPDPMYYIS  261



>ref|XP_004960898.1| PREDICTED: stem 31 kDa glycoprotein-like isoform X2 [Setaria 
italica]
Length=262

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  388   NCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHD  567
             +C SWRLGVE NNIR W  +P  C GY+  YM G  +R DC  V   A  YA  +EL  D
Sbjct  50    SCPSWRLGVETNNIRGWYSIPAECRGYVRDYMFGDLFRQDCAVVVREAAAYAEGLELAGD  109

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             G+ VWVFDID+TALSNLPYYA  + GFG +  NAT FEE++    APA+ E L+LY  +L
Sbjct  110   GEAVWVFDIDDTALSNLPYYA--DTGFGAQPYNATYFEEYVAKATAPALPEVLKLYEKLL  167

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             ALG+K  FI+   E  R   + NLR AG+  WE L+L+  +     ++ YKS +R +LV 
Sbjct  168   ALGIKVAFITGRHEYEREPTVKNLRSAGYHTWEKLVLK-PSSLGSSVVPYKSGERQKLVD  226

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
              GYRIVGN+GDQWSDL+G   G RTFK+PDPMYYV
Sbjct  227   AGYRIVGNIGDQWSDLVGAPEGDRTFKVPDPMYYV  261



>dbj|BAJ94870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 144/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA N+RDW  VP  CEGY+GHYMLG  +R D   V   AI Y   ++L  +G
Sbjct  60    CDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGNHFRRDFKVVIDQAIAYVDGLKLNGNG  119

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVWVFDIDET LSNLPYYA    GFG R  NAT F+ ++ +G APA+ ET RLY  +L 
Sbjct  120   KDVWVFDIDETTLSNLPYYA--THGFGARPYNATSFDAYVLEGSAPALPETKRLYYKLLK  177

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPVFI+   E  R+  + NLR  GF  W  L L+  +  +   + YKS +R +L   
Sbjct  178   VGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMNLTLK-QHGFKGSAISYKSAERKKLQDA  236

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSD+LG   G RTFK+PDP+YY++
Sbjct  237   GYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYIA  271



>gb|EMT19717.1| Acid phosphatase 1 [Aegilops tauschii]
Length=278

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 150/214 (70%), Gaps = 3/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA+N+RDW  VP  CEGY+GHYMLG  YR D   V   AI Y  +++L  +G
Sbjct  67    CDSWRLGVEAHNVRDWKTVPASCEGYVGHYMLGGHYRRDSKLVIDQAISYVDSLKLAGNG  126

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFD+DET LSNLPYYA    GFG    N T F+E+ R   APA+ ET RL++ +L+
Sbjct  127   KEVWVFDVDETTLSNLPYYA--THGFGATPYNWTSFQEYARQASAPALPETKRLFDKLLS  184

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPV ++  +E  R+A ++NLR+ GF  W  ++L+ A + +   + +KS +R +L+  
Sbjct  185   VGIKPVILTGRREVQRTATVTNLRRQGFSGWMTVLLKPA-EFKGSGVTFKSGERQKLLDA  243

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GY IVGN+GDQWSD+LG   G RTFK+PDPMYY+
Sbjct  244   GYVIVGNIGDQWSDILGTPEGARTFKLPDPMYYI  277



>ref|XP_010662272.1| PREDICTED: acid phosphatase 1 [Vitis vinifera]
Length=259

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 140/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR GVEANN+  W  +P  C  Y+  YM GR Y  D   VA  A  YA  VEL  
Sbjct  45    LECTSWRFGVEANNLGPWKTIPVACAEYVKDYMTGRAYEIDLERVANEAAIYARTVELSA  104

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG DVWVFD+DET LSNLPYYA  E G+G+   +  +F +W+    APA+  +L+LY  V
Sbjct  105   DGNDVWVFDVDETLLSNLPYYA--EHGYGLEVFDEMEFAKWVEKATAPAIGSSLKLYEVV  162

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
              +LG K   ++   E  RS  + NL  AGF+ W+ LILRG+ND  +    YKSEKR+E+V
Sbjct  163   QSLGFKTFLLTGRSENQRSVTVENLINAGFQNWDKLILRGSNDHGKQATVYKSEKRSEMV  222

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRIVGN GDQWSDLLG  + LR+FK+P+PMYY+
Sbjct  223   KEGYRIVGNSGDQWSDLLGSEMSLRSFKLPNPMYYI  258



>emb|CBI36038.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 160/222 (72%), Gaps = 4/222 (2%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              H+P L+CLSWRLGVEA+NI +W+ VP+ CE Y+GHYMLG QYR D  AV   A+ YA +
Sbjct  284   HHVPGLSCLSWRLGVEAHNIIEWSTVPQACESYVGHYMLGHQYRKDSRAVVYEALTYAQS  343

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             ++L  DGKD+WVFD+DET+ SNLPYYA+   GF +   N+T+F  W+ +GKAPA+ E+L+
Sbjct  344   LKLAVDGKDIWVFDVDETSPSNLPYYAK--HGFRVEAYNSTQFNNWVYEGKAPALPESLK  401

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  +L+LG+K VFI+   E  R+   +NLR  G+  WE LIL+G+  +   ++ YKS +
Sbjct  402   LYKKLLSLGIKAVFITGRPEAQRNVTAANLRNVGYHTWEKLILKGS--SAGTIVVYKSNE  459

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R +L   GYRI+ N+GDQWSD+LG N   RTFK+ +PMYY+S
Sbjct  460   RKKLKKSGYRIIDNIGDQWSDILGTNTENRTFKLSNPMYYIS  501


 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 130/181 (72%), Gaps = 3/181 (2%)
 Frame = +1

Query  481   MLGRQYRDDCTAVAASAIRYATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRR  660
             MLG QYR D   V   AI +A +++L  DGKD+WVFDIDET+LSNLPY+A+   GFG+  
Sbjct  1     MLGDQYRKDSGVVVYEAITHAQSLKLAGDGKDIWVFDIDETSLSNLPYFAKH--GFGVEA  58

Query  661   CNATKFEEWIRDGKAPAMQETLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRA  840
              N+T+F  WI +GKAP + E+L+LY  + +LG+KPVFI+   E  R+   +NL+ AG+  
Sbjct  59    YNSTQFNNWIYEGKAPPLPESLKLYKKLQSLGIKPVFITGRPEAQRNVTAANLQNAGYHT  118

Query  841   WEMLILRGANDTERPMMDYKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDP  1020
             WE LIL+G++ T   +  YKS +R +L   GYRIVGN+GDQWSD+LG NVG RTFK+PDP
Sbjct  119   WEKLILKGSSVTGTAVA-YKSNERKKLEQSGYRIVGNIGDQWSDILGTNVGNRTFKLPDP  177

Query  1021  M  1023
             +
Sbjct  178   I  178



>ref|XP_002440748.1| hypothetical protein SORBIDRAFT_09g006010 [Sorghum bicolor]
 gb|EES19178.1| hypothetical protein SORBIDRAFT_09g006010 [Sorghum bicolor]
Length=285

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 148/217 (68%), Gaps = 7/217 (3%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VEA N RDW  VP  CE Y+GHYMLGRQYR D   VA  AI YA  ++L  +G
Sbjct  74    CDSWRLAVEAYNKRDWKTVPANCEHYVGHYMLGRQYRLDSRVVADEAIAYAEGLKLAGNG  133

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFDIDET+LSNLPYYA+   GFG +  NAT F E++ +G AP + ET RL+  +++
Sbjct  134   KEVWVFDIDETSLSNLPYYAK--HGFGTKPYNATSFNEYVLEGSAPVLPETQRLFKKLIS  191

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILR--GANDTERPMMDYKSEKRTELV  924
             LG+KPVF++   E  R+  ++NLR+ G+  W  L+L+  G   T    + YKS  R +L 
Sbjct  192   LGIKPVFLTGRTEDQRAITVTNLRRQGYSGWMHLLLKPIGFKGTA---IGYKSGARQKLQ  248

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY IVGN+GDQWSD+LG   G RTFK+PDP+YY+ 
Sbjct  249   NAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  285



>ref|XP_003627057.1| Acid phosphatase [Medicago truncatula]
 gb|AET01533.1| stem 28 kDa glycoprotein [Medicago truncatula]
Length=264

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 151/223 (68%), Gaps = 4/223 (2%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +I  ++C SWRLG+EA+NI +W  +P+ CE YIG+YMLG QYR D  AV      YA  
Sbjct  45    HYIEEVSCASWRLGIEAHNIINWKTIPKECEKYIGNYMLGDQYRADSKAVNREGYFYAKT  104

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + +   GKD+WVFDIDET+LSNLPYYA+   GFG+   N T F +W+  G APA+ E+ +
Sbjct  105   LNIT-TGKDIWVFDIDETSLSNLPYYAKH--GFGVEPYNDTLFNQWVDLGTAPALPESKK  161

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE-RPMMDYKSE  906
             LYN +L+LG+K  F++    + +     NLR+AGF+ WE LIL+       +  + YKS 
Sbjct  162   LYNKLLSLGIKIAFLTGRPLKQKEITAKNLRRAGFKKWEKLILKNTTIYHGKTAVTYKSS  221

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R +L   GYRIVGN+GDQWSD+LG N G RTFK+PDP+YY++
Sbjct  222   ERKKLEEEGYRIVGNIGDQWSDILGTNTGERTFKLPDPLYYIA  264



>dbj|BAJ94050.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 146/214 (68%), Gaps = 3/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA+N+RDW  VP  CE Y+GHYM+G  YR D   V   AI Y  +++L  +G
Sbjct  61    CDSWRLGVEAHNVRDWKTVPASCEDYVGHYMVGDHYRRDSKVVIDQAIAYVDSLKLAGNG  120

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFD+DET LSNLPYYA+   GFG    N+T F  + R+G APA+ ET RLYN +L+
Sbjct  121   KEVWVFDVDETTLSNLPYYAK--HGFGATPFNSTSFRAYAREGSAPALPETKRLYNKLLS  178

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPV ++  +E  R++  +NLR  G+  W  L+L+   D     + +KS +R +L   
Sbjct  179   VGIKPVILTGRRENLRASTTTNLRSQGYSRWMKLLLK-QQDFRGSSVTFKSGERQKLQNA  237

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GY IVGN+GDQWSD+LG   G RTFK+PDPMYY+
Sbjct  238   GYIIVGNIGDQWSDILGAPEGARTFKLPDPMYYI  271



>dbj|BAJ90845.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA N+RDW  VP  CEGY+GHYMLG  +R D   V    I Y   ++L  +G
Sbjct  60    CDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGNHFRRDFKVVIDQTIAYVDGLKLNGNG  119

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVWVFDIDET LSNLPYYA    GFG R  NAT F+ ++ +G APA+ ET RLY  +L 
Sbjct  120   KDVWVFDIDETTLSNLPYYA--THGFGARPYNATSFDAYVLEGSAPALPETKRLYYKLLK  177

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPVFI+   E  R+  + NLR  GF  W  L L+  +  +   + YKS +R +L   
Sbjct  178   VGIKPVFITGRTEDKRAVTVGNLRSQGFSGWMNLTLK-QHGFKGSAISYKSAERKKLQDA  236

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSD+LG   G RTFK+PDP+YY++
Sbjct  237   GYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYIA  271



>ref|NP_001148494.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACG31723.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACN31777.1| unknown [Zea mays]
Length=261

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 150/222 (68%), Gaps = 5/222 (2%)
 Frame = +1

Query  367   SRHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYAT  546
             +R +P  +C SWRLGVE NNIRDW  +P  C GY+  YM G  +R DC  VA  A  YA 
Sbjct  44    ARAVP--SCASWRLGVETNNIRDWYSIPAECRGYVRDYMYGDLFRQDCAVVAREAAAYAE  101

Query  547   AVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETL  726
              +EL  DGK+VWVFD+D+T LSNLPYYA  + GFG    NAT F+E++ +  AP + E L
Sbjct  102   GLELGGDGKEVWVFDVDDTTLSNLPYYA--DTGFGAEPYNATYFDEYVANATAPPLPEVL  159

Query  727   RLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSE  906
             +LY ++L+LG+K VFI+   +  +   I NLR AG+  W+ L+L+  +     ++ YKS 
Sbjct  160   QLYETLLSLGIKVVFITGRHDYEKEPTIKNLRSAGYHTWDKLVLK-PSSLGSSVVPYKSG  218

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             +R +LV  GYRIVGN+GDQWSDL+G   G RTFK+PDPMYYV
Sbjct  219   ERQKLVDAGYRIVGNMGDQWSDLIGAPEGDRTFKVPDPMYYV  260



>ref|XP_011076425.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=269

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 144/217 (66%), Gaps = 2/217 (1%)
 Frame = +1

Query  382   YLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV  561
             +L C SWR+ VEANN+  W  +P  C  Y+  YM G  Y  D   V   A  YA +V L 
Sbjct  54    HLQCTSWRVAVEANNLSPWKTIPEDCADYVKEYMTGNVYEFDLQRVYNEAGIYARSVNLN  113

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKD W+FD+DET LSNLPYYA  E G+G+   N+TKF++W+  G APA++ +L+LY  
Sbjct  114   GDGKDAWIFDVDETLLSNLPYYA--EHGYGLEMFNSTKFDQWVETGTAPAVESSLKLYEE  171

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             VL+LG K + ++   E+ R   + NL +AGFR W+ LILR + D  +    YKS+KR EL
Sbjct  172   VLSLGFKVILLTGRSERHRGITVENLLRAGFREWDKLILRSSEDHGKTATVYKSDKRNEL  231

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  GYRI+GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  232   VEEGYRILGNSGDQWSDLLGSSMSKRSFKLPNPMYYI  268



>gb|EMS46715.1| Stem 28 kDa glycoprotein [Triticum urartu]
Length=269

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 146/215 (68%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SW LGVEA+N+RDW  VP  CEGY+GHYMLG+ +R D   V   A+ Y   ++L  +G
Sbjct  58    CDSWVLGVEAHNVRDWKTVPASCEGYVGHYMLGKHFRRDSKIVIDQALAYVDNLKLAGNG  117

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFDIDET LSNLPYYA+   GFG    NAT F  ++ +G APA+ ET RLYN +L+
Sbjct  118   KEVWVFDIDETTLSNLPYYAK--HGFGATPFNATSFNAYVLEGSAPALPETKRLYNKLLS  175

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPVF++   E  R+  I+NLR+ G   W  L+L+     +   + YKS +R +L   
Sbjct  176   VGIKPVFLTGRTEDQRAVTITNLRRQGISGWMNLLLKQPG-FKGSAVTYKSGERQKLQDA  234

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             G+ IVGN+GDQWSD+LG   G RTFK+PDPMYY+ 
Sbjct  235   GFVIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  269



>gb|AFK46217.1| unknown [Medicago truncatula]
Length=264

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 151/223 (68%), Gaps = 4/223 (2%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +I  ++C SWRLG+EA+NI +W  +P+ CE YIG+YMLG QYR D  AV      YA  
Sbjct  45    HYIEEVSCASWRLGIEAHNIINWKTIPKECEKYIGNYMLGDQYRADSKAVNREGYFYAKT  104

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + +   GKD+WVFDIDET+LSNLPYYA+   GFG+   N T F +W+  G APA+ E+ +
Sbjct  105   LNIT-TGKDIWVFDIDETSLSNLPYYAKH--GFGVEPYNDTLFNQWVDLGTAPALPESKK  161

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE-RPMMDYKSE  906
             LYN +L+LG+K  F++    + +     NLR+AGF+ WE LIL+       +  + YKS 
Sbjct  162   LYNKLLSLGIKIAFLTGRPLKQKEITAKNLRRAGFKKWEKLILKNTTIYHGKTAVTYKSS  221

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R +L   GYRIVGN+GDQWSD+LG N G RTFK+PDP+YY++
Sbjct  222   ERKKLEEGGYRIVGNIGDQWSDILGTNTGERTFKLPDPLYYIA  264



>ref|XP_006853740.1| hypothetical protein AMTR_s00056p00177520 [Amborella trichopoda]
 gb|ERN15207.1| hypothetical protein AMTR_s00056p00177520 [Amborella trichopoda]
Length=287

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 144/215 (67%), Gaps = 2/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWR  VE NN+R+W +VP  C+ Y+G YM G +Y  D   V+  A  +A  + ++ DG
Sbjct  75    CDSWRFAVETNNLREWKKVPDKCQEYVGVYMTGDRYESDSEIVSGEAENFARNISILGDG  134

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVWVFDIDET LSNLPYYA  E GFG +  N   F EW+   +APA+  +L+LYN +  
Sbjct  135   KDVWVFDIDETLLSNLPYYA--ENGFGSKDFNEDSFNEWVVKAEAPALPYSLKLYNELKK  192

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG + + ++  +E  R+    NL  AG+ +WE LILRGA D+ +P + YKSEKR E+   
Sbjct  193   LGFRVILLTGREESQRTVTAENLIAAGYDSWERLILRGAKDSGKPAVVYKSEKRMEIEGE  252

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GYRI GN GDQWSDLLG  +G R+FK+P+PMYY+S
Sbjct  253   GYRIHGNSGDQWSDLLGFAIGNRSFKLPNPMYYIS  287



>gb|KHG01291.1| Acid phosphatase 1 [Gossypium arboreum]
Length=266

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 147/216 (68%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR  VEANN+  W  +P  C GY+  YM GR Y+ D   V++ A  YA  +EL  
Sbjct  52    LHCTSWRFSVEANNLSPWKTIPEECLGYVKEYMTGRGYKLDLERVSSEAGVYAKNLELSG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET LSNLPYY  +E G+G+   +  +F++W++ G APA++ +L+LY  +
Sbjct  112   DGKDVWIFDIDETLLSNLPYY--IEHGYGLEIFDPIEFDKWVQKGMAPAIEPSLKLYEKI  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  I NL KAGF+ W+ LILR +    +  + +KSEKR+E+V
Sbjct  170   LDLGFKVFLLTGRNEKHRSITIENLTKAGFQRWDKLILRDSEQHGKLAVVFKSEKRSEMV  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRIVGN GDQWSDLLG +   R+FK+P+PMYY+
Sbjct  230   EEGYRIVGNSGDQWSDLLGADPSRRSFKLPNPMYYI  265



>ref|XP_010941067.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=271

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 142/217 (65%), Gaps = 2/217 (1%)
 Frame = +1

Query  382   YLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV  561
             +L C SWR   EANN+  W  VP  C  Y+  YM G+ YR D   VA  A  YA ++ LV
Sbjct  56    HLRCASWRFAGEANNLAPWKTVPADCGAYVKDYMTGKAYRFDLEMVADEAAAYARSISLV  115

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DG D WVFD+DET LSNLPYYA  + G+G+   N+ +F++W+    APA+Q +L+LY  
Sbjct  116   GDGMDAWVFDVDETLLSNLPYYA--DHGYGLEVFNSHEFDKWVDKAMAPAIQSSLKLYEE  173

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             +L LG K   ++   E  +   + NL+K GF+ WE LILRG ND  +    YKSEKR+E+
Sbjct  174   ILRLGFKIFLLTGRSEGQKIVTVENLKKVGFQDWEKLILRGVNDHGKLATTYKSEKRSEI  233

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
              A GYRI+GN GDQWSDLLG + G R+FK+P+PMYY+
Sbjct  234   TAEGYRILGNSGDQWSDLLGSSTGNRSFKLPNPMYYI  270



>ref|XP_004960901.1| PREDICTED: stem 28 kDa glycoprotein-like [Setaria italica]
Length=268

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 145/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VEA N RDW  VP  CEGY+GHYMLG  YR D   V   A+ YA  ++L   G
Sbjct  57    CDSWRLAVEAYNKRDWRTVPADCEGYVGHYMLGGHYRRDSRVVVNEAVAYAEGLKLGGKG  116

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFDIDET+LSNLPYYA    GFG +  NAT F  ++ +G AP + ET RLYN ++A
Sbjct  117   KEVWVFDIDETSLSNLPYYA--THGFGTKPYNATSFNAYVLEGSAPVLPETQRLYNKLIA  174

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG+KPVF++   E  R+  ++NLR+ G+  W  L+L+     +   + +KS +R +LV  
Sbjct  175   LGIKPVFLTGRTEDQRAITVANLRRQGYSGWMKLLLKPVG-FKASAVGFKSGERKKLVDA  233

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSD+LG   G RTFK+PDP+YY+ 
Sbjct  234   GYVIVGNIGDQWSDILGAPEGARTFKLPDPIYYIG  268



>gb|EMS67586.1| Acid phosphatase 1 [Triticum urartu]
Length=280

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 145/214 (68%), Gaps = 3/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA+N+RDW  VP  CEGY+GHYMLG  YR D   V   AI Y  +++L  +G
Sbjct  69    CDSWRLGVEAHNVRDWKTVPTSCEGYVGHYMLGGHYRRDSKLVIDEAIFYVDSLKLAGNG  128

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFD+DET LSNLPYYA    GFG    N T F E+     APA+ ET RLYN +L+
Sbjct  129   KEVWVFDVDETTLSNLPYYA--THGFGATPYNWTSFHEYAAQASAPALPETKRLYNKLLS  186

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPV ++  +E  R+A I+NLR+ GF    M +L    + +   + +KS +R +L+  
Sbjct  187   VGIKPVILTGRREAQRTATITNLRRQGFSG-SMAVLLKPAEFKGSAVTFKSGERQKLLDA  245

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GY IVGN+GDQWSD+LG   G RTFK+PDPMYY+
Sbjct  246   GYVIVGNIGDQWSDILGTPEGARTFKLPDPMYYI  279



>ref|XP_008367296.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=266

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 144/216 (67%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR  VEANN+  W  +P  C GY+  Y+ GR Y  D   V+  A  YA +VEL  
Sbjct  52    LHCDSWRFSVEANNVNXWKTIPEECAGYVKDYLTGRAYAXDLERVSKEAGVYAKSVELNG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDID+T LSNLPYYA  + G+G+   +  +F++W+    APA++ +L+LY  V
Sbjct  112   DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDTVEFDKWVEKAMAPAIKSSLKLYEEV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K   ++   E  R   + NL  AGF  W  LILR A+D E+  + YKSEKR+E+ 
Sbjct  170   LSLGFKVFLLTGRTEGKRKVTVENLNNAGFXEWHKLILRSADDHEKLAIIYKSEKRSEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYR++GN GDQWSDLLG ++ LR+FK+P+PMYY+
Sbjct  230   KEGYRLLGNSGDQWSDLLGTSLALRSFKLPNPMYYI  265



>gb|EMS66285.1| Stem 28 kDa glycoprotein [Triticum urartu]
Length=275

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             + C SWRLGVEA N+RDW  VP  CEGY+GHYM+G  YR D   V   AI Y  +++L  
Sbjct  62    MACDSWRLGVEAYNVRDWKTVPASCEGYVGHYMVGDHYRRDSKVVVDQAIAYVDSLKLAG  121

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             +GK+VWVFD+DET LSNLPYYA+   GFG    N T+F  + ++G APA+ ET RLYN +
Sbjct  122   NGKEVWVFDVDETTLSNLPYYAK--HGFGATPFNVTRFNAYAQEGSAPALPETKRLYNKL  179

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L++G+KPV ++   E  R++  +NLR+ G+  W  L+L+ A   +   + +KS ++ +L 
Sbjct  180   LSVGIKPVILTGRAEYLRASTATNLRRQGYSGWMNLLLK-APGFKGSSVAFKSGEKQKLQ  238

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY IVGN+GDQWSD++G   G RTFK+PDPMYY+ 
Sbjct  239   DAGYIIVGNIGDQWSDIIGAPDGARTFKLPDPMYYIG  275



>ref|XP_003568779.1| PREDICTED: stem 28 kDa glycoprotein [Brachypodium distachyon]
Length=287

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 144/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SW LGVEA+N+R W  +P  CEGY+GHYMLG ++R D   V   AI YA  ++L  +G
Sbjct  76    CDSWLLGVEAHNVRGWKTIPAKCEGYVGHYMLGSRFRRDSKVVIDEAIAYAEGLKLAGNG  135

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVWVFDIDET LSNLPYYA    GFG +  NAT F  ++ +G APA+ ET RLYN +++
Sbjct  136   KDVWVFDIDETTLSNLPYYA--THGFGAKPFNATSFNAYVLEGSAPALPETKRLYNKLVS  193

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPVF++   E  R    +NLR+ G   W  L+L+     +   + YKS +R +L   
Sbjct  194   MGVKPVFLTGRTEDQRVITETNLRRQGITGWMNLLLK-QPGFKGSAVAYKSGERQKLQDA  252

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSDLLG   G RTFK+PDPMYY+ 
Sbjct  253   GYAIVGNIGDQWSDLLGAPEGSRTFKLPDPMYYIG  287



>ref|XP_004963522.1| PREDICTED: stem 28 kDa glycoprotein-like [Setaria italica]
Length=276

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 145/217 (67%), Gaps = 7/217 (3%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VEA N RDW  VP  CEGY+GHYMLG  YR D   V   A+ YA  ++L   G
Sbjct  65    CDSWRLAVEAYNKRDWRTVPVDCEGYVGHYMLGGHYRQDSGDVVDEAVAYAEGLKLGGKG  124

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFD DET LSNLPYYA    GFG +  NAT F E++ +G AP + ET RLYN +++
Sbjct  125   KEVWVFDTDETTLSNLPYYA--TDGFGTKPYNATSFNEYVMEGSAPVLPETQRLYNKLIS  182

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILR--GANDTERPMMDYKSEKRTELV  924
             LG+KPVF++   E  R+  ++NLR+ G+  W  L+L+  G N T    + +KS +R +L 
Sbjct  183   LGIKPVFVTGRTEDQRAITVANLRREGYSGWMKLMLKPVGYNGT---AIGFKSGERQKLQ  239

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY IVGN+GDQWSD+LG   G RTFK+PDP+YY+ 
Sbjct  240   DAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  276



>emb|CDO98049.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 148/217 (68%), Gaps = 4/217 (2%)
 Frame = +1

Query  388   NCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHD  567
             NCLSWRL VE NN R+W  VP +C  Y+ HYM G+QY  DC AV   AI Y  ++ +  D
Sbjct  85    NCLSWRLTVETNNKRNWNGVPEICGNYVAHYMTGKQYGYDCDAVVDIAIEYVKSLPIPRD  144

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNA---TKFEEWIRDGKAPAMQETLRLYN  738
             G+ +W+FDID+TALSNLP+++R +V FG++  NA    +F E++   + P ++ TLRLY 
Sbjct  145   GRSIWIFDIDDTALSNLPFFSRPDVFFGVKTDNAELEAEFYEFVLTAEVPVLEATLRLYQ  204

Query  739   SVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTE  918
             +V+  G+K VF++ + E+   AR  NL+  G+  WE LIL+  +     +  +KSE R +
Sbjct  205   AVVEAGIKAVFLTGSSERSADARDKNLKAVGYHTWEKLILK-PDSVTTSVQAFKSEVRDQ  263

Query  919   LVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
             LVA GYRI GN+GDQW+D++G NVG RTFK+P+PMYY
Sbjct  264   LVAEGYRIEGNIGDQWADIVGSNVGRRTFKLPNPMYY  300



>gb|EMS54507.1| Acid phosphatase 1 [Triticum urartu]
Length=280

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 142/214 (66%), Gaps = 3/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA N+RDW  VP  CEGY+GHYMLG  +R D   V   AI Y  +++L  +G
Sbjct  69    CDSWRLGVEAYNVRDWKTVPANCEGYVGHYMLGSHFRRDSKVVIDQAIAYVDSLKLDGNG  128

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFDIDET LSNLPYYA    GFG R  NAT F+ ++ +G APA+ E+ RLY  +L 
Sbjct  129   KEVWVFDIDETTLSNLPYYA--THGFGARPYNATSFDAYVLEGTAPALPESKRLYYKLLK  186

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPVFI+   E  R+  ++NLR  G   W  L L+         + YKS +R +L   
Sbjct  187   VGIKPVFITGRTEDKRAITVANLRSQGISGWMNLTLKQPG-FHGSAISYKSAQRKKLQDA  245

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GY IVGN+GDQWSDLLG   G RTFK+PDP+YY+
Sbjct  246   GYVIVGNIGDQWSDLLGAPEGARTFKLPDPLYYI  279



>ref|XP_004511128.1| PREDICTED: acid phosphatase 1-like [Cicer arietinum]
Length=264

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 145/217 (67%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR   EANN+  W  VP+ C  Y+  YM G+ Y  D   V+  A  YA +V+L  
Sbjct  50    LRCSSWRFAGEANNLSPWKTVPKECAEYVKEYMTGKGYVYDLEIVSKEAEEYAKSVQLNE  109

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG D W+FDIDET LSNLPYYA    GFG++  +  KF++W+  G APA++ +L+LY  V
Sbjct  110   DGLDAWIFDIDETLLSNLPYYAAH--GFGLQVFDHAKFDDWVVKGVAPAIEPSLKLYEDV  167

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K + ++   EQ R+  + NL  AGFR W  LILRG++D  +  + YKSEKR+E+ 
Sbjct  168   LNLGYKVILLTGRSEQHRAVTVDNLINAGFRDWHQLILRGSDDKGKRAVIYKSEKRSEME  227

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI+GN GDQWSDL+G ++ +++FK+P+PMYY+S
Sbjct  228   KDGYRILGNSGDQWSDLIGSSLSVKSFKLPNPMYYIS  264



>ref|XP_009372837.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=266

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR  VEANN+  W  +P  C  Y+  Y+ GR Y  D   V+  A  YA +VEL  
Sbjct  52    LHCASWRFSVEANNVNPWKTIPEECAEYVKDYLTGRAYGFDLERVSKEAGLYAKSVELNG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDID+T LSNLPYYA  + G+G+   +  +F++W+    APA++ +L+LY  V
Sbjct  112   DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDNVEFDKWVEKAMAPAVKSSLKLYEEV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K   ++   E  R   + NL  AGFR W  LILR A+D E+    YKSEKR E+ 
Sbjct  170   LSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDREKLATIYKSEKRGEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +V LR+FK+P+PMYY+
Sbjct  230   KEGYRILGNSGDQWSDLLGTSVSLRSFKLPNPMYYI  265



>ref|XP_007038298.1| HAD superfamily, subfamily IIIB acid phosphatase [Theobroma cacao]
 gb|EOY22799.1| HAD superfamily, subfamily IIIB acid phosphatase [Theobroma cacao]
Length=266

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 143/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE NN+  W  +P  C GY+  YM GR Y  D   VA  A  YA +VEL  
Sbjct  52    LQCTSWRFTVETNNLSPWKTIPEKCGGYVKDYMTGRGYTMDLERVANEAGVYAKSVELSG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET LSNLPYYA  E G+G+      +F++W++ G APA+  +L+LY  V
Sbjct  112   DGKDVWVFDIDETLLSNLPYYA--EHGYGLEIFYPVEFDKWVQRGMAPAIDPSLKLYEMV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  I NL KAGF++W+ LILR + D  +    +KSEKR+++V
Sbjct  170   LDLGFKVFLLTGRSEEQRSVTIENLTKAGFQSWDKLILRDSEDHGKLATVFKSEKRSKMV  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RI+GN GDQWSDLLG +   R+FK+P+PMYY+
Sbjct  230   EEGFRILGNSGDQWSDLLGSSPSSRSFKLPNPMYYI  265



>ref|XP_008376378.1| PREDICTED: acid phosphatase 1 [Malus domestica]
Length=266

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR  VEANN+  W  +P  C  Y+  Y+ GR Y  D   V+  A  YA +VEL  
Sbjct  52    LHCASWRFSVEANNVNPWETIPEECAEYVKDYLTGRAYGFDLERVSKEAGVYAKSVELNG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDID+T LSNLPYY   + G+G+   +  +F++W+    APA++ +L+LY  V
Sbjct  112   DGKDVWIFDIDDTLLSNLPYYT--DHGYGLEVFDNVEFDKWVEKAMAPAIKSSLKLYEEV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K   ++   E  R   + NL  AGFR W  LILR A+D E+    YKSEKR+E+ 
Sbjct  170   LSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDREKLATIYKSEKRSEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +V LR+FK+P+PMYY+
Sbjct  230   KEGYRILGNSGDQWSDLLGTSVSLRSFKLPNPMYYI  265



>emb|CDP05370.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 140/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W  +P  C  Y+  YM GR Y  D   V+ +A  +A +VEL  
Sbjct  54    LQCTSWRFAVEANNLSPWKTIPPECAAYVEDYMTGRAYSYDLQRVSRAAGAFAKSVELAE  113

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FD+DET LSNLPYYA  + G+G+   N TKF++W+ +G APA+  +L LY  V
Sbjct  114   DGKDVWIFDVDETLLSNLPYYA--QHGYGLEIFNHTKFDKWVEEGLAPAIHSSLELYRDV  171

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
              +LG K  F++   E+  +    NL K GF+ W+ LILR   D  +    YKSEKR E++
Sbjct  172   TSLGFKVFFLTGRSERHGNITADNLIKVGFQHWDKLILRSPEDHPKQATMYKSEKRDEMI  231

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRIVGN GDQWSDLLG +   R+FK+P+PMYY+
Sbjct  232   KEGYRIVGNSGDQWSDLLGSSPANRSFKLPNPMYYI  267



>ref|XP_006356133.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=185

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 137/186 (74%), Gaps = 2/186 (1%)
 Frame = +1

Query  481   MLGR-QYRDDCTAVAASAIRYATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIR  657
             MLG+ QYR DC  VA  AI YA  ++L  DGKDVWVFD+D+T LSNLPYYAR +V FG  
Sbjct  1     MLGKLQYRRDCEYVAKQAIEYAKGLKLNRDGKDVWVFDVDDTTLSNLPYYARSDVRFGTI  60

Query  658   RCNATKFEEWIRDGKAPAMQETLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFR  837
               N TKF EW+ +GK P +   L +Y ++L+LG+KPV I+   E FR +RI+NL+KAG+ 
Sbjct  61    ALNDTKFIEWLAEGKLPVIPSILGVYKTLLSLGIKPVIITGAPENFRQSRIANLKKAGYS  120

Query  838   AWEMLILRGANDTERPMMDYKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPD  1017
              W  L+LRG N++ +  ++YKS KR ELV  GYRIVGN+GDQW+DL+GE VG RTFK+P+
Sbjct  121   NWLKLVLRGGNNS-KSAVEYKSSKRMELVKAGYRIVGNIGDQWTDLIGEIVGARTFKVPN  179

Query  1018  PMYYVS  1035
             PMYYV 
Sbjct  180   PMYYVG  185



>ref|XP_009362705.1| PREDICTED: acid phosphatase 1 [Pyrus x bretschneideri]
Length=266

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR  VEANN+  W  +P  C  Y+  Y+ GR Y  D   V+  A  YA  VEL  
Sbjct  52    LHCDSWRFSVEANNVNPWKTIPEDCAEYVKDYLTGRAYEFDLERVSKEAGVYAKRVELNG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDID+T LSNLPYYA  + G+G+   +  +F +W+    APA++ +L+LY  V
Sbjct  112   DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDTVEFNKWVEKAMAPAIKSSLKLYEEV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K   ++   E  R   + NL  AGFR W  LILR A+D E+  + YKSEKR+E+ 
Sbjct  170   LSLGFKVFLLTGRTEGKRKVTVENLNNAGFREWHKLILRSADDHEKLAIIYKSEKRSEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYR++GN GDQWSDLLG +V LR+FK+P+PMYY+
Sbjct  230   REGYRLLGNSGDQWSDLLGTSVALRSFKLPNPMYYI  265



>ref|XP_010258799.1| PREDICTED: acid phosphatase 1 [Nelumbo nucifera]
Length=282

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 140/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR   E NN+  W  +P  C GY+  Y+ GR Y  D   V+  AI YA +V+LV 
Sbjct  68    LQCTSWRFAAETNNLNPWKTIPSECAGYVKDYVTGRGYLVDLERVSKEAIAYARSVQLVG  127

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD W+FDIDET LSNLPYYA  + G+G+   +  +F++W+    AP ++ +L+LY  V
Sbjct  128   DGKDAWIFDIDETLLSNLPYYA--DHGYGLEVFDGREFDKWVEKAMAPVIESSLKLYEEV  185

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  I NLR AGF+ W+ LILR   D  +    YKSE+R+E+V
Sbjct  186   LELGFKVFLLTGRSERHRSVTIENLRDAGFQNWDKLILRNLGDNGKSATLYKSERRSEMV  245

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +   R+FK+P+PMYY+
Sbjct  246   NEGYRILGNSGDQWSDLLGSSTSNRSFKLPNPMYYI  281



>ref|XP_009800382.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=257

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 144/216 (67%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W  +P+ C  Y+  Y+ G  Y+ D   V++ A  YA +++L  
Sbjct  43    LECTSWRFAVEANNLSPWKTIPKECADYVRQYINGGAYKLDIDRVSSEAGAYAESMKLGA  102

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FD+DET LSNLPYY+  + G+G+   ++ KF+EW+  G APA+  +L+LY  V
Sbjct  103   DGKDVWIFDVDETLLSNLPYYS--QHGYGLEVFDSVKFDEWVEKGVAPAIGSSLKLYQDV  160

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++   E+ R   + NL  AGF+ W+ LILRG+ D  +    YKSEKR E+V
Sbjct  161   MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRDEMV  220

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RIVGN GDQWSDLLG +  +R+FK+P+PMYY+
Sbjct  221   EEGFRIVGNSGDQWSDLLGSSTSIRSFKLPNPMYYI  256



>ref|XP_009370433.1| PREDICTED: acid phosphatase 1-like [Pyrus x bretschneideri]
Length=266

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR  VEANN+  W  +P  C  Y+  Y+ GR Y  D   V+  A  YA +VEL  
Sbjct  52    LHCASWRFSVEANNVNPWKTIPEECAEYVKDYLKGRAYGFDLERVSKEAGVYAKSVELNG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDID+T LSNLPYYA  + G+G+   +  +F++W+    APA++ +L+LY  V
Sbjct  112   DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDNVEFDKWVEKAMAPAIKSSLKLYEEV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K   ++   E  R   + NL  AGFR W  LILR A+D E+    YKSEKR+E+ 
Sbjct  170   LSLGFKVFLLTGRTEGKRKVTVENLNNAGFRDWHKLILRSADDLEKMATIYKSEKRSEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +V  R+FK+P+PMYY+
Sbjct  230   KEGYRILGNSGDQWSDLLGTSVSPRSFKLPNPMYYI  265



>gb|KCW90870.1| hypothetical protein EUGRSUZ_A02919 [Eucalyptus grandis]
Length=263

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 144/216 (67%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W  +P+ C  Y+  YM+G+ Y  D   V+  A  YA +VEL  
Sbjct  49    LQCDSWRFAVEANNVNPWKTIPQECADYVRDYMMGKGYGFDIDRVSKEAAVYAGSVELSG  108

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET LSNLPYYA  E GFG+   +  +F++W+   +A  +Q +L+LY  V
Sbjct  109   DGKDVWIFDIDETLLSNLPYYA--EHGFGLEVFDPVEFDKWVDKAEALGIQPSLKLYELV  166

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  I NL  AGF+ W+ LI+R + D  +  + YKSEKR E+V
Sbjct  167   LGLGFKVFLLTGRSEEQRSVTIENLINAGFQNWDKLIVRASEDHSKLAVVYKSEKRDEMV  226

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG ++ +R+FK+P+PMYY+
Sbjct  227   REGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  262



>ref|XP_002510996.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
 gb|EEF51598.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
Length=272

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 145/216 (67%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W  +P+ C GY+  Y++GR Y+ D   V+  A  YA +V+L  
Sbjct  58    LQCTSWRFAVEANNLNPWKTIPQECAGYVRDYVMGRGYQVDLERVSNEAGVYAKSVQLSE  117

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFD+DET LSNLPYYA  + G+G+   +  KF++W+ +  APA++ +L+LY  V
Sbjct  118   DGKDAWVFDVDETLLSNLPYYA--DHGYGLEVFDPMKFDKWVEEATAPAIESSLKLYKEV  175

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R     NL KAGF++W+ LILR + D  +    YKSEKR+E+V
Sbjct  176   RGLGFKVFLLTGRSEYQRGVTEENLIKAGFQSWDKLILRASGDHGKLASIYKSEKRSEMV  235

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             + GYRI+GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  236   SEGYRILGNSGDQWSDLLGISMSTRSFKLPNPMYYI  271



>ref|NP_001150932.1| LOC100284565 precursor [Zea mays]
 gb|ACG40988.1| stem 28 kDa glycoprotein precursor [Zea mays]
Length=293

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE  N RDW  VP  CE Y+GHYMLG  YR D   V   AI YA  ++L  +G
Sbjct  82    CDSWRLAVETYNKRDWTTVPASCERYVGHYMLGGHYRRDSRVVIDEAIAYAEGLKLGGNG  141

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFDIDET+LSNLPYYA    GFG +  NAT F E++ +G AP + ET RL+  +++
Sbjct  142   KEVWVFDIDETSLSNLPYYA--THGFGTKLYNATSFNEYVLEGSAPVLPETQRLFKKLVS  199

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG+KPVF++   E  R+  ++NLR+ G+  W  L+L+     +   + YKS +R +L   
Sbjct  200   LGIKPVFLTGRTEDQRAITVTNLRRQGYSGWMTLLLKPVG-LKATAIAYKSGERQKLQDA  258

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSD+LG   G RTFK+PDP+YY+ 
Sbjct  259   GYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  293



>ref|XP_008801792.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=270

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 141/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR   EANN+  W  VP  C  Y+  YM G+ YR D   VA  A  YA +V L  
Sbjct  56    LRCASWRFAGEANNLAPWKTVPADCGAYVKDYMTGKAYRFDLEMVADEAAAYARSVSLAG  115

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             D  D WVFD+DET LSNLPYYA  + G+G+   ++ +F++W+    APA+Q +L+LY  +
Sbjct  116   DCMDAWVFDVDETLLSNLPYYA--DHGYGLEVFSSHEFDKWVDKAMAPAIQSSLKLYEEI  173

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E  +   + NL+K GFR W+ LILRG ND  R    YKSEKR+E+V
Sbjct  174   LRLGFKIFLLTGRTEGQKIVTMENLKKVGFRDWKQLILRGVNDHGRTATMYKSEKRSEIV  233

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             A GYRI+GN GDQWSDLLG ++G R+FK+P+PM+Y+
Sbjct  234   ANGYRILGNSGDQWSDLLGSSMGNRSFKLPNPMFYI  269



>ref|XP_009588519.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=258

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE NN+  W  +P  C  Y+  Y+ G  Y+ D   V++ A  YA +++L  
Sbjct  44    LECTSWRFAVETNNLSPWKTIPEECADYVRQYINGGAYKLDIDRVSSEAGTYAESMKLGG  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFD+DET LSNLPYY+  + G+G+   ++ KF+EW+  G APA+  +L+LY  V
Sbjct  104   DGKDVWVFDVDETLLSNLPYYS--QHGYGLEVFDSVKFDEWVEKGVAPAIGSSLKLYQDV  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++   E+ R   + NL  AGF+ W+ LILRG+ D  +    YKSEKR E+V
Sbjct  162   MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATMYKSEKRDEMV  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RIVGN GDQWSDLLG +  +R+FK+P+PMYY+
Sbjct  222   KEGFRIVGNSGDQWSDLLGSSASIRSFKLPNPMYYI  257



>gb|EMT03894.1| Stem 28 kDa glycoprotein [Aegilops tauschii]
Length=273

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA N+RDW  VP  CE Y+GHYM+G  YR D   V   AI Y  +++L   G
Sbjct  62    CDSWRLGVEAYNVRDWKAVPASCEDYVGHYMVGDHYRRDSKVVVDQAIAYVDSLKLAGKG  121

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFD+DET LSNLPYYA+   GFG    N T F  +  +G APA+ ET RLYN + +
Sbjct  122   KEVWVFDVDETTLSNLPYYAK--HGFGATPFNVTSFNAYAHEGSAPALPETKRLYNKLFS  179

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPV ++   E  R++  +NLR+ G+  W  L+L+ A   +   + +KS +R +L   
Sbjct  180   VGIKPVILTGRAEYLRASTATNLRRQGYSRWMNLLLK-APGFKGSSVAFKSGERQKLQDA  238

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSD+LG   G RTFK+PDPMYY+ 
Sbjct  239   GYIIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  273



>ref|XP_006357920.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=251

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 144/216 (67%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE NN+  W  +P+ C  Y+  Y++G  Y+ D   V+  A  YA +V+L  
Sbjct  37    LKCTSWRFAVETNNLSPWKTIPQECADYVREYIVGPGYKMDIDRVSNEAGEYAKSVDLGD  96

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+DVWVFD+DET LSNLPYY+  + G+G+   ++ +F++W+  G APA+  +L+LY  V
Sbjct  97    DGRDVWVFDVDETLLSNLPYYS--DHGYGLEVFDSVEFDKWVEKGTAPALGSSLKLYQEV  154

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K   ++   E+ RS  + NL  AGF  W  LILRG++D  +    +KSE+R E+V
Sbjct  155   LSLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTFKSERRNEIV  214

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RIVGN GDQWSDLLG ++  R+FK+P+P+YY+
Sbjct  215   EEGFRIVGNSGDQWSDLLGSSMSNRSFKLPNPIYYI  250



>ref|XP_010062554.1| PREDICTED: acid phosphatase 1 [Eucalyptus grandis]
Length=365

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 144/216 (67%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W  +P+ C  Y+  YM+G+ Y  D   V+  A  YA +VEL  
Sbjct  151   LQCDSWRFAVEANNVNPWKTIPQECADYVRDYMMGKGYGFDIDRVSKEAAVYAGSVELSG  210

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET LSNLPYYA  E GFG+   +  +F++W+   +A  +Q +L+LY  V
Sbjct  211   DGKDVWIFDIDETLLSNLPYYA--EHGFGLEVFDPVEFDKWVDKAEALGIQPSLKLYELV  268

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  I NL  AGF+ W+ LI+R + D  +  + YKSEKR E+V
Sbjct  269   LGLGFKVFLLTGRSEEQRSVTIENLINAGFQNWDKLIVRASEDHSKLAVVYKSEKRDEMV  328

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG ++ +R+FK+P+PMYY+
Sbjct  329   REGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  364



>ref|XP_004960902.1| PREDICTED: acid phosphatase 1-like [Setaria italica]
Length=290

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 146/217 (67%), Gaps = 7/217 (3%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE NN RDW  VP  CE Y+G+YMLG  YR D   V   A+ YA  ++L  +G
Sbjct  79    CDSWRLAVETNNKRDWRTVPARCERYVGNYMLGGHYRRDSRVVIDEAVAYAEGLQLAGNG  138

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFDIDETALSNLPYYA    GFG +  +AT F  ++  G AP + ET RLYN +++
Sbjct  139   KEVWVFDIDETALSNLPYYA--SNGFGTKPYDATSFNAYVFAGSAPVLPETQRLYNKLIS  196

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILR--GANDTERPMMDYKSEKRTELV  924
             LG+ PVF++  +E  R+  ++NLR+ G+  W  L+L+  G N T    + +KS++R +L 
Sbjct  197   LGITPVFLTGRRENQRAITVANLRREGYSGWMKLLLKPVGYNGT---AIGFKSDERRKLQ  253

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY IVGN+GDQWSD+LG   G RTFK+PDP+YY+ 
Sbjct  254   DAGYVIVGNIGDQWSDILGAPEGARTFKLPDPLYYIG  290



>gb|KHN05326.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=271

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 152/223 (68%), Gaps = 5/223 (2%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +IP ++C SWRLGVEA+N+ DW  VP+ CEGYIG+YMLG QYR D   V   A  YA  
Sbjct  53    HYIPEVSCQSWRLGVEAHNVIDWKTVPQDCEGYIGNYMLGEQYRSDSKIVNQQAYFYAKT  112

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + +    K  WVFDIDET LSNLPYYA  + GFG+   N T F +W+  G+APA+ E+L+
Sbjct  113   LNIT--AKTAWVFDIDETTLSNLPYYA--DHGFGVELYNETSFNKWVDLGEAPALPESLK  168

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE-RPMMDYKSE  906
             LY  +L+LG+K VFI+      ++   +NL+ AG+  WE LI +  ++   +  + YKS 
Sbjct  169   LYKKLLSLGIKIVFITGRPLDQKAVTATNLKLAGYHTWEKLITKNTSEYHGKTAVTYKST  228

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R +L  +GY+I+GN+GDQWSDLLG N G RTFK+PDPMYY+S
Sbjct  229   ERKKLEEKGYKIIGNIGDQWSDLLGTNTGDRTFKLPDPMYYIS  271



>gb|EYU20188.1| hypothetical protein MIMGU_mgv1a011800mg [Erythranthe guttata]
Length=270

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 140/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR+  EANN+  W  +P  C  Y+  Y+ G+ Y  D   V+  A  +AT V L +
Sbjct  56    LQCTSWRVAGEANNLNPWRTIPEECIDYVKEYIKGKGYEFDLVRVSKIAGAFATTVNLSN  115

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+D W+FDIDET LSNLPYYA    G+G+   ++ KF++W+  G APA++ +L LY  V
Sbjct  116   DGRDAWIFDIDETLLSNLPYYA--AHGYGLEIFDSAKFDKWVETGNAPAIESSLNLYREV  173

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K + ++   E+ RS  + NL KAGF  WE LILR   D  +   +YKSEKR ELV
Sbjct  174   LRLGFKAILLTGRSERHRSITVENLSKAGFCDWEKLILRSTEDHGKTAKEYKSEKRNELV  233

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +V  R+FK+ +PMYY+
Sbjct  234   EEGYRILGNSGDQWSDLLGSSVSERSFKLSNPMYYI  269



>ref|XP_007135625.1| hypothetical protein PHAVU_010G144600g [Phaseolus vulgaris]
 gb|ESW07619.1| hypothetical protein PHAVU_010G144600g [Phaseolus vulgaris]
Length=260

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 154/223 (69%), Gaps = 5/223 (2%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +IP ++C SWR+GVEA+N+ +W  VP  CEGY+G+YMLG+QYR D   V   A  YA  
Sbjct  42    HYIPEVSCQSWRVGVEAHNVVEWKTVPADCEGYVGNYMLGKQYRSDSKTVCHEAFSYAKT  101

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + +    +D+WVFD+DET LSNLPYYA    GFG+   NAT  +EW+  G+APA+ E+L+
Sbjct  102   LNIT--SRDIWVFDVDETTLSNLPYYAHH--GFGVEPYNATTSDEWVEVGEAPALPESLK  157

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE-RPMMDYKSE  906
             LY  +L+LG+K VF++      ++  ++NL+ AG+  WE LIL+  +    +  + YKS 
Sbjct  158   LYKKLLSLGIKIVFLTGRPLNQKAVTVTNLKIAGYHKWEKLILKDTSIYHGKTAVTYKSS  217

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +R ++   GY+I+GN+GDQWSD+LG N G RTFK+PDPMYY+S
Sbjct  218   ERKKVEKEGYKIIGNIGDQWSDILGTNTGQRTFKLPDPMYYIS  260



>ref|XP_004960903.1| PREDICTED: acid phosphatase 1-like [Setaria italica]
Length=280

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 144/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VEA N RDW  VP  CEGY+GHYMLG  YR D   V   AI YA  ++L  +G
Sbjct  69    CDSWRLAVEAYNKRDWKTVPADCEGYVGHYMLGGHYRRDSRVVVDEAIAYAEGLKLAGNG  128

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             ++VWVFDIDET+LSNLPYYA+   GFG    NAT F  ++ +G A A+ ET RL++ +++
Sbjct  129   REVWVFDIDETSLSNLPYYAK--HGFGTEPFNATSFNAYVLEGSALALPETQRLFDKLIS  186

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG+KPVF++   E  R+  + NLR+ G+  W  L+L+     +   + +KS +R +L   
Sbjct  187   LGIKPVFLTGRTENQRAITVVNLRRQGYYGWMKLLLKPVG-FKGTAIGFKSGERRKLQDA  245

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSD+LG   G RTFK+PDPMYY+ 
Sbjct  246   GYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  280



>ref|XP_010693738.1| PREDICTED: acid phosphatase 1 [Beta vulgaris subsp. vulgaris]
Length=263

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 143/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR GVEANN+  W  +P+ C  Y+ +YM+G+ Y+ D   V+  +  +A +V L  
Sbjct  49    LQCTSWRFGVEANNLNPWKTIPQECGDYVKNYMMGKGYQLDLERVSYESSVFAKSVHLGD  108

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             D  DVWVFD+DET LSNLPYY  V+ G+G+   ++ +F++W+  G APA++ +LRLY  V
Sbjct  109   DSNDVWVFDVDETLLSNLPYY--VQHGYGLEVFDSVEFDKWVDKGMAPAIEPSLRLYEEV  166

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K   ++   E+ R     NL  AGF+ W+ LILR   D  +  M +KSEKR E+V
Sbjct  167   LSLGFKIFLLTGRSEKRRDVTAQNLMNAGFKNWDKLILRDTEDHGKLAMIFKSEKRIEMV  226

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RI+GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  227   KEGFRILGNSGDQWSDLLGSAMSTRSFKLPNPMYYI  262



>ref|XP_010915367.1| PREDICTED: acid phosphatase 1-like isoform X1 [Elaeis guineensis]
Length=255

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRL  E NN   W  +P  C  ++  YM G ++  D   VAA ++ +A AV++V 
Sbjct  41    LYCDSWRLSAETNNAGYWKTIPAGCLQFVAEYMNGDRFLSDSAVVAAESLAFAQAVQVVG  100

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+W+FD+DET LSNLPYY  V  G+G    N T F+EW+   KAPA+  +LRLY  +
Sbjct  101   DGKDIWIFDVDETLLSNLPYY--VVNGYGSEDFNETAFDEWVNLAKAPALPASLRLYEEL  158

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG + VF++   E  R+A + NL  AG+ +W  LILR A+D  +    YKSE+R EL 
Sbjct  159   LGLGFQVVFLTGRVEAQRNATVENLSFAGYHSWNRLILREASDIGKKAAAYKSERRAELE  218

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             A+GYRI GN GDQWSDLLG  + +R+FK+P+PMYY+
Sbjct  219   AQGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  254



>ref|XP_008234437.1| PREDICTED: acid phosphatase 1 [Prunus mume]
Length=266

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 141/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C+SWR  VEANNI  W  +P+ C  Y+  Y+ GR Y  D   V+  A  YA A+EL  
Sbjct  52    LHCISWRFSVEANNINPWKTIPQECAEYVKDYVTGRAYGFDLERVSKEAGVYAKAIELSG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD W+FDID+T LSNLPYYA  + G+G+   +  +FE W+    APA++ +L+LY  V
Sbjct  112   DGKDAWIFDIDDTLLSNLPYYA--DHGYGLEVFDHLEFERWVEKAMAPAIKSSLKLYEEV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG+K   ++   E  R A I NL  AGFR W  LILR  ++  +    YKSEKR E+ 
Sbjct  170   LGLGIKVFLLTGRGEGKRKATIENLVNAGFRDWHKLILRAPDEQGKLATVYKSEKRNEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSD+LG ++ +R+FK+P+PMYY+
Sbjct  230   KEGYRILGNSGDQWSDILGTSMSIRSFKLPNPMYYI  265



>gb|KDP22459.1| hypothetical protein JCGZ_26290 [Jatropha curcas]
Length=268

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 142/217 (65%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W  +P+ C  Y+ +YM+GR Y+ D   V+  A  YA +V+L  
Sbjct  54    LQCTSWRFAVEANNLNPWKTIPQDCAEYVRNYMMGRGYQVDLERVSNEAGVYAKSVQLNE  113

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFD+DET LSNLPYY     G+G+   +  +F++W+    APA++ +L+LY  +
Sbjct  114   DGKDAWVFDVDETLLSNLPYYTGH--GYGLEIFDPLEFDKWVEKAMAPAIEPSLKLYKEI  171

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS    NL  AGF+ W+ LILR ++D  +    YKSEKR E+V
Sbjct  172   LGLGFKVFLLTGRNEKQRSVTEENLINAGFQNWDKLILRASDDHGKLATTYKSEKRNEMV  231

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI GN GDQWSDLLG ++  R+FK+P+PMYY++
Sbjct  232   NEGYRIQGNSGDQWSDLLGSSMSTRSFKLPNPMYYIA  268



>ref|XP_002439412.1| hypothetical protein SORBIDRAFT_09g005960 [Sorghum bicolor]
 gb|EES17842.1| hypothetical protein SORBIDRAFT_09g005960 [Sorghum bicolor]
Length=268

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWR  VE + +RDW  VP  CE Y+G+YMLG QYR D  AV   A+ YA  ++L  DG
Sbjct  57    CDSWRFAVETDTLRDWETVPARCEKYVGNYMLGGQYRSDSQAVVDEAVAYAEGLKLSGDG  116

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFD+DET LSNLPYYA  E GFG    N+T F  + +   APA+ ET RLY  +  
Sbjct  117   KEVWVFDVDETTLSNLPYYA--EHGFGSEPYNSTAFGAYTKLANAPALPETQRLYKRLQE  174

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG+KPV ++  +E  R +   NL   G+  +E L+L+   D     +++KS +R +LV  
Sbjct  175   LGIKPVILTGRREDKRESTAKNLADVGYTGYEKLLLK-PQDARVTAVEFKSGERKKLVDA  233

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQW+DLLGE  G RTFK+PDPMYYV 
Sbjct  234   GYVIVGNIGDQWTDLLGEPEGDRTFKLPDPMYYVG  268



>ref|XP_007133483.1| hypothetical protein PHAVU_011G182400g [Phaseolus vulgaris]
 gb|ESW05477.1| hypothetical protein PHAVU_011G182400g [Phaseolus vulgaris]
Length=269

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 145/217 (67%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C +WR+  EANN+  W  VP  C  Y+  YM G+ Y  D   V+  A  +A +V+L  
Sbjct  55    LRCGAWRVAGEANNLGAWRTVPEECADYVKEYMTGKGYLVDLEMVSKEAEEFAKSVKLSD  114

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD W+FDIDET LSNLPYYA    G+G+   +  KF +W+ +G AP++Q +L+LY  V
Sbjct  115   DGKDAWIFDIDETLLSNLPYYA--AHGYGLEIFDHEKFNDWVEEGVAPSLQPSLKLYEDV  172

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K + ++   E+ RS  + NL  AGF+ W+ LILR ++D  +  + +KSEKR+E+ 
Sbjct  173   LKLGFKVILLTGRSERHRSVTVDNLINAGFKEWDHLILRSSDDQGKRAVVFKSEKRSEME  232

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI+GN GDQWSDL+G ++ +R+FK+P+PMYY+S
Sbjct  233   KDGYRILGNSGDQWSDLIGSSLSVRSFKLPNPMYYIS  269



>gb|KDO45271.1| hypothetical protein CISIN_1g023192mg [Citrus sinensis]
Length=286

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 141/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C +WR  VEANN+  W  +PR C  Y+  YM+GR Y  D   V+  A  YA +VEL  
Sbjct  72    LQCTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVYAKSVELRG  131

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD W+FDIDET LSNLPYY   E G+G+   N  +F++W+    +PA++ +L+LY  V
Sbjct  132   DGKDAWIFDIDETLLSNLPYYQ--EHGYGLEIFNPVEFDKWVEKAMSPAIEASLKLYEEV  189

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  + NL  AG R W+ LILR ++D  +  + YKSEKR E+V
Sbjct  190   LGLGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMV  249

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  250   QEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>ref|XP_002440742.1| hypothetical protein SORBIDRAFT_09g005940 [Sorghum bicolor]
 gb|EES19172.1| hypothetical protein SORBIDRAFT_09g005940 [Sorghum bicolor]
Length=260

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 144/215 (67%), Gaps = 3/215 (1%)
 Frame = +1

Query  388   NCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHD  567
             +C SWRLGVE NNIRDW  +P  C  Y+  YM G  +R DC  VA  A  YA  +EL  D
Sbjct  48    SCASWRLGVETNNIRDWYSIPAECRSYVRDYMYGDLFRQDCAVVAGEAAAYAEGLELAGD  107

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             G++VWVFD+D+T L+NLPYYA  + GFG    NAT F+E++ +  APA+ E L LY  +L
Sbjct  108   GEEVWVFDVDDTTLTNLPYYA--DTGFGAEPYNATYFDEYVANATAPALPEVLELYEKLL  165

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             +LG+K VFI+   +   +A + NLR AG+  WE L+L+  +     ++ YKS +R +LV 
Sbjct  166   SLGIKVVFITGRHDDEEAATVKNLRSAGYHTWEKLVLK-PSSLGSSVVPYKSGERQKLVD  224

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
              GYRIVGN+GDQWSDL G   G RTFK+PDPMYYV
Sbjct  225   AGYRIVGNMGDQWSDLTGAPEGDRTFKVPDPMYYV  259



>ref|XP_003627058.1| Stem 28 kDa glycoprotein [Medicago truncatula]
 gb|AET01534.1| stem 28 kDa glycoprotein [Medicago truncatula]
 gb|AFK40192.1| unknown [Medicago truncatula]
Length=261

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 149/227 (66%), Gaps = 10/227 (4%)
 Frame = +1

Query  367   SRHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYAT  546
              ++IP ++C SWR+ VEA NI +W  VP+ CE Y+G+YMLG QYR D   V      YA 
Sbjct  41    GKYIPEVSCASWRVAVEARNIINWKTVPQECEEYVGNYMLGDQYRADSKFVNREGFFYAR  100

Query  547   AVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETL  726
              + L  DG+D+WVFDIDET LSNLPYYA    GFG+   N T F  W+ +G APA+ ET 
Sbjct  101   TLNL-KDGRDLWVFDIDETTLSNLPYYATH--GFGVNPYNETLFNAWVDEGAAPALPETQ  157

Query  727   RLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE----RPMMD  894
             +LYN ++ LG+K  F++    + +     NL++AG+  +E LIL+   DTE    +  + 
Sbjct  158   KLYNKLVNLGVKIAFLTGRPLKQKDITAKNLKEAGYHTYEKLILK---DTELYHGKTAVQ  214

Query  895   YKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             YKS +R +L   G+RI+GN GDQWSD+LG N G RTFK+PDP+YY++
Sbjct  215   YKSSERKKLEEEGWRIIGNSGDQWSDILGTNTGERTFKLPDPLYYIA  261



>ref|XP_011028463.1| PREDICTED: acid phosphatase 1 [Populus euphratica]
Length=261

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR GVEANN+  W  VP  C  Y+  YMLGR Y  D   V+  A  YA +++L  
Sbjct  47    LQCTSWRFGVEANNLNPWKTVPLECGEYVKDYMLGRAYSLDLERVSNEAGVYAKSLKLSG  106

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+WVFD+DET LS+LPYYA  + G+G+ R +  +F +W+    APA++ +L+LY  V
Sbjct  107   DGKDIWVFDVDETLLSHLPYYA--DHGYGLERFDPAEFNKWVDKAIAPALEPSLKLYKEV  164

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++   E  RS    NL  AGF+ W+ LILRG+ D  +    +KS+KR+E+V
Sbjct  165   MGLGFKVFLLTGRSEMQRSVTEENLINAGFQNWDKLILRGSEDHGKLATIFKSDKRSEMV  224

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  225   KEGYRILGNSGDQWSDLLGSFMSNRSFKLPNPMYYI  260



>gb|EAY96842.1| hypothetical protein OsI_18762 [Oryza sativa Indica Group]
Length=280

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 147/219 (67%), Gaps = 6/219 (3%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA+N+  W  VP  CEGY+GHYMLG  YR D   V   AI YA +++L  +G
Sbjct  64    CDSWRLGVEAHNVIGWRTVPARCEGYVGHYMLGGHYRRDSAVVVDEAIAYAESLQLAGNG  123

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K++WVFDIDET+LSNLPYYA    GFG    N T F E++ +G APA+ ET RLY  +L 
Sbjct  124   KEIWVFDIDETSLSNLPYYAN--HGFGATLYNDTSFREYVAEGSAPALPETRRLYRRLLQ  181

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILR----GANDTERPMMDYKSEKRTE  918
             LG+KPVF++   E  R+  ++NLR+ G+  W  L+L+     A + +   + YKS +R +
Sbjct  182   LGVKPVFLTGRTEDQRNITVTNLRRQGYSGWMELLLKPVVHAAGELQGSAVAYKSGERQK  241

Query  919   LVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             L   G+ IVGN+GDQWSD+LG   G RTFK+PDPMYY+ 
Sbjct  242   LEDAGFTIVGNIGDQWSDILGTPEGARTFKLPDPMYYIG  280



>ref|XP_007218818.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica]
 gb|EMJ20017.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica]
Length=266

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 141/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR  VEANNI  W  +P+ C  Y+  Y+ GR Y  D   V+  A  YA AVEL  
Sbjct  52    LHCTSWRFSVEANNINPWKTIPQECAKYVKDYVTGRAYGFDLERVSKEAGVYAKAVELSG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDID+T LSNLPYYA  + G+G+   +  +F+ W+    APA++ +L+LY  V
Sbjct  112   DGKDVWIFDIDDTLLSNLPYYA--DHGYGLEVFDHLEFDRWVDKAMAPAIKSSLKLYEEV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG+K   ++   +  R A I NL  AGFR W  LILR  ++  +    YKSEKR E+ 
Sbjct  170   LGLGIKVFLLTGRSDGKRKATIENLINAGFRDWHKLILRAPDEQGKLATVYKSEKRNEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSD+LG ++ +R+FK+P+PMYY+
Sbjct  230   KEGYRILGNSGDQWSDILGTSMSIRSFKLPNPMYYI  265



>ref|NP_001236180.1| acid phosphatase precursor [Glycine max]
 emb|CAA11075.1| acid phosphatase [Glycine max]
Length=264

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 153/225 (68%), Gaps = 7/225 (3%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
              +IP ++C SWRLGVEA+N+ DW  VP+ CEGYIG+YMLG QYR D   V   A  YA  
Sbjct  44    HYIPEVSCQSWRLGVEAHNVIDWKTVPQDCEGYIGNYMLGEQYRSDSKIVNQQAYFYAKT  103

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             + +    K  WVFDIDET LSNLPYYA  + GFG+   N T F +W+  G+APA+ E+L+
Sbjct  104   LNIT--AKTAWVFDIDETTLSNLPYYA--DHGFGVELYNETSFNKWVDLGEAPALPESLK  159

Query  730   LYNSVLALGMKPVFIS--ETKEQFRSARISNLRKAGFRAWEMLILRGANDTE-RPMMDYK  900
             LY  +L+LG+K VFI+     ++  +A   NL+ AG+  WE LI +  ++   +  + YK
Sbjct  160   LYKKLLSLGIKIVFITGRPLDQKAVTATNLNLKLAGYHTWEKLITKNTSEYHGKTAVTYK  219

Query  901   SEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             S +R +L  +GY+I+GN+GDQWSDLLG N G RTFK+PDPMYY+S
Sbjct  220   STERKKLEEKGYKIIGNIGDQWSDLLGTNTGDRTFKLPDPMYYIS  264



>ref|XP_006490172.1| PREDICTED: acid phosphatase 1-like [Citrus sinensis]
Length=286

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 141/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C +WR  VEANN+  W  +PR C  Y+  YM+GR Y  D   V+  A  YA +VEL  
Sbjct  72    LQCTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVYAKSVELRG  131

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD W+FDIDET LSNLPYY   E G+G+   +  +F++W+    +PA++ +L+LY  V
Sbjct  132   DGKDAWIFDIDETLLSNLPYYQ--EHGYGLEIFDPVEFDKWVEKAMSPAIEASLKLYEEV  189

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  + NL  AG R W+ LILR ++D  +  + YKSEKR E+V
Sbjct  190   LGLGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMV  249

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  250   QEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>ref|NP_001242215.1| uncharacterized protein LOC100795218 precursor [Glycine max]
 gb|ACU20782.1| unknown [Glycine max]
 gb|ACU22719.1| unknown [Glycine max]
 gb|KHN05324.1| Stem 28 kDa glycoprotein [Glycine soja]
Length=255

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 141/214 (66%), Gaps = 5/214 (2%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEANN+  W  VP  C  YI  Y+LG QYR D   V   A  YA +++L +  
Sbjct  45    CASWRLGVEANNVVKWQTVPAACGEYIADYVLGDQYRSDSKTVNQQAYFYAKSLKLTN--  102

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDV+V D+D+T LSNL Y+A    GFG+   N T F+ W+ DG+A A+ ETL++YN +LA
Sbjct  103   KDVFVLDVDDTTLSNLQYFANH--GFGVEPHNTTAFKNWVLDGEAFALPETLKMYNKLLA  160

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGAND-TERPMMDYKSEKRTELVA  927
             LG+K VF+SE           NL++ GF  WE LILR  ++ + +   +YKS +R +L  
Sbjct  161   LGIKIVFLSERPLSLGDVTAKNLKEVGFNTWEKLILRDPSEYSGKLSFEYKSAEREKLEK  220

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
              GYRI+GNVGDQWSDLLG N G RTFK+P+P+YY
Sbjct  221   EGYRIIGNVGDQWSDLLGSNKGTRTFKLPNPLYY  254



>ref|XP_010098159.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXB74596.1| Acid phosphatase 1 [Morus notabilis]
Length=262

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SW+ GVE NNI  W  VP  CE Y+  YMLG +Y +D   V   A  YA +  L  DG
Sbjct  51    CSSWQYGVETNNIIGWKTVPEKCELYVARYMLGERYGEDSKVVTKEAYLYAQSHTLSDDG  110

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FD+D+TA+SNLPYYA    GFG++  +   F +WI    APA+ ++L+LY ++  
Sbjct  111   KDVWLFDVDDTAVSNLPYYAT--NGFGVKPYDPESFHQWILSEAAPALPKSLKLYKNLKT  168

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG K +F++  +E  RSA  SNL+ AG+  WE+++L+  +D      D+K+E+R  L   
Sbjct  169   LGFKIIFLTGRRENERSAIESNLKVAGYHTWELVLLKD-DDYSGTTADFKAEQRKNLEDA  227

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GYRIVGN+GDQW+DLLG N G RTFK+P+P+YY +
Sbjct  228   GYRIVGNIGDQWTDLLGTNAGHRTFKLPNPLYYAA  262



>ref|XP_006837335.1| hypothetical protein AMTR_s00111p00084650 [Amborella trichopoda]
 gb|ERN00189.1| hypothetical protein AMTR_s00111p00084650 [Amborella trichopoda]
Length=298

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 138/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE NN++ W  VP  C G++  YM  R YR D   VA  A  +A  VEL  
Sbjct  84    LYCESWRFAVETNNLQSWKVVPIECGGFVKKYMSERGYRSDLEMVAEVAGAFARNVELGQ  143

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG D W+FDIDET LSNL YY   E GFG+   N  KF+EW+   +APA+   L+LY  V
Sbjct  144   DGMDAWIFDIDETLLSNLVYYE--ENGFGLELFNGNKFDEWVDLAEAPAISPFLKLYEEV  201

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L +G K   ++   E  RS  I NL+ +GF+ W+ LI+RGA D  +  + YKSEKR E+ 
Sbjct  202   LEMGFKVFLLTGRSESQRSTTIHNLQNSGFQNWDRLIMRGAADQGKSAVFYKSEKRMEME  261

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RI+GN GDQWSDLLG ++ +R+FK+P+PMYY+
Sbjct  262   KEGFRILGNSGDQWSDLLGSSMAIRSFKLPNPMYYI  297



>ref|XP_003531798.1| PREDICTED: acid phosphatase 1-like [Glycine max]
 gb|KHN38151.1| Acid phosphatase 1 [Glycine soja]
Length=261

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C +WR+  EANN+  WA +P  C  Y+  YM G+ Y  D   V+  A  YA  V L +
Sbjct  47    LRCGAWRVAGEANNLGAWAIIPEECAEYVKDYMSGKGYALDLEMVSKEAEEYARTVPLGY  106

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET LSNLPYYA    G+G+   +  KF +W+  G A A++ +L+LY  V
Sbjct  107   DGKDAWVFDIDETLLSNLPYYAAH--GYGLEVFDHEKFNDWVEKGVATAIEPSLKLYEDV  164

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K + ++   E+ RS  + NL  AGF+ W+ LILR ++D  +P + YKSEKR E+ 
Sbjct  165   LNLGFKVILLTGRNERHRSVTVDNLINAGFKDWDQLILRTSDDQGKPAVLYKSEKRGEME  224

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG ++ +R+FK+P+P+YY+
Sbjct  225   KDGYRILGNSGDQWSDLLGSSISVRSFKLPNPVYYI  260



>ref|XP_004235180.1| PREDICTED: acid phosphatase 1 [Solanum lycopersicum]
Length=263

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 143/217 (66%), Gaps = 2/217 (1%)
 Frame = +1

Query  382   YLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV  561
             +L C SWR  VEANN+  W  +P+ C  Y+  Y+ G  Y+ +   V+  A  +A +++L 
Sbjct  48    HLECTSWRFAVEANNLSPWKIIPQECADYVRQYITGGAYKMEIDRVSTEAGAFAESMKLG  107

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKDVW+FD+DET LSNLPYY+  + G+G+   ++ +F++W+  G+APA+  +L+LY  
Sbjct  108   EDGKDVWIFDVDETLLSNLPYYS--QHGYGLEVFDSVEFDKWVEKGEAPAIGSSLKLYQD  165

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             V+ LG K   ++   E+ R   + NL  AGF+ W+ LILRG+ D  +    YKSEKR E+
Sbjct  166   VMRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRNEM  225

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  G RI GN GDQWSDLLG +  +R+FK+P+PMYY+
Sbjct  226   VEDGLRIAGNSGDQWSDLLGSSASIRSFKLPNPMYYI  262



>ref|NP_001148296.1| stem 28 kDa glycoprotein precursor [Zea mays]
 gb|ACG30436.1| stem 28 kDa glycoprotein precursor [Zea mays]
Length=272

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWR  VE N +RDW  VP  CE Y+G+YMLG  YR D  AVA  AI YA  + L   G
Sbjct  61    CDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSDSRAVANEAIAYAEGLNLTGQG  120

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFD+DET LSNLPYYA+   GFG+   N + F  ++++  AP + ET RLY  + A
Sbjct  121   KEVWVFDVDETTLSNLPYYAK--HGFGVEPYNWSTFGAYVKEANAPVLPETQRLYKRLQA  178

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG+KPV ++  +E  R A  +NL  AG+  +  L+L+  N  +   +++KS +R +L   
Sbjct  179   LGIKPVILTGRREDKREATANNLAAAGYTGYLKLLLKPQN-VKVSSIEFKSGERKKLQDA  237

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQW+DLLGE  G RTFK+PDPMYY+ 
Sbjct  238   GYVIVGNIGDQWTDLLGEPEGGRTFKLPDPMYYIG  272



>gb|AFW77368.1| stem glycoprotein [Zea mays]
Length=272

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWR  VE N +RDW  VP  CE Y+G+YMLG  YR D  AVA  AI YA  + L   G
Sbjct  61    CDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSDSRAVANEAIAYAEGLNLTGQG  120

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFD+DET LSNLPYYA+   GFG+   N + F  ++++  AP + ET RLY  + A
Sbjct  121   KEVWVFDVDETTLSNLPYYAK--HGFGVEPYNWSTFGAYVKEANAPVLPETQRLYKRLQA  178

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG+KPV ++  +E  R A  +NL  AG+  +  L+L+  N  +   +++KS +R +L   
Sbjct  179   LGIKPVILTGRREDKREATANNLAAAGYTGYLKLLLKPQN-VKVSSIEFKSGERKKLQDA  237

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQW+DLLGE  G RTFK+PDPMYY+ 
Sbjct  238   GYVIVGNIGDQWTDLLGEPEGGRTFKLPDPMYYIG  272



>ref|NP_001240054.1| uncharacterized protein LOC100802126 precursor [Glycine max]
 gb|ACU19722.1| unknown [Glycine max]
Length=271

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 141/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C +WR+  EANN+  W  +P  C  Y+  YM G+ Y  D   V+  A  +A +V L  
Sbjct  57    LRCGAWRVAGEANNLGAWRTIPEECTEYVKEYMTGKGYAVDLEMVSKEAEEFARSVPLGS  116

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD W+FDIDET LSNLPYYA    G+G+   +  KF  W+  G APA++ +L+LY  V
Sbjct  117   DGKDAWIFDIDETLLSNLPYYA--AHGYGLEVFDHEKFNNWVEKGVAPAIEPSLKLYEDV  174

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K + ++   E+ RS  + NL  AGF+ W+ LILR ++D  +  + YKSEKR+E+ 
Sbjct  175   LNLGFKVILLTGRSERHRSVTVDNLINAGFKEWDQLILRNSDDQGKRAVLYKSEKRSEME  234

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +V +R+FK+P+PMYY+
Sbjct  235   KDGYRILGNSGDQWSDLLGSSVSVRSFKLPNPMYYI  270



>gb|EYU31308.1| hypothetical protein MIMGU_mgv1a011623mg [Erythranthe guttata]
Length=276

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 141/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV-  561
             L C SWR+  EANN+  W ++P  C  Y+  YM  + Y  D   V+  ++ YA  + L  
Sbjct  61    LQCTSWRVAAEANNLSPWKKIPDECADYVKEYMEYKGYEIDLQRVSNESVLYARTLNLSG  120

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGK  WVFD+DET LSNLPYY  V+ G+G+   +  KF+EW+  G+APA++ +L++Y  
Sbjct  121   SDGKFSWVFDVDETLLSNLPYY--VDHGYGLEIFDGEKFDEWVEKGEAPALKSSLKVYEE  178

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             VLALG K   ++   E+FR+    NL +AGFR W+ LILR   D  +  + YKS KR EL
Sbjct  179   VLALGFKVFLLTGRSERFRNITARNLVRAGFRNWDKLILRSTEDNGKTAIKYKSGKRNEL  238

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  GY+I+GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  239   VQEGYKILGNSGDQWSDLLGTSISERSFKLPNPMYYI  275



>gb|AHC69831.1| acid phosphatase [Nicotiana tabacum]
Length=263

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE NN+  W  +P  C  Y+  Y+ G  Y+ D   V+  A  YA + +L  
Sbjct  49    LQCTSWRFAVETNNLGPWKTIPEECGNYVRQYIEGGAYKMDIDRVSDEAGAYAKSRDLGA  108

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFD+DET LSNLPYY+  + G G+   ++ +FE+W+  G APA+  +L+LY  V
Sbjct  109   DGKDVWVFDVDETLLSNLPYYS--DHGHGLEVFDSVEFEKWVEKGMAPAIGSSLKLYQDV  166

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++   E+ R   + NL  AGF+ W+ LILRG+ D  +    YKSEKR E+V
Sbjct  167   MRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRDEMV  226

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+R+VGN GDQWSDLLG +  +R+FK+P+PMYY+
Sbjct  227   EEGFRLVGNSGDQWSDLLGSSTSIRSFKLPNPMYYI  262



>ref|XP_009797620.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=263

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE NN+  W  +P  C  Y+  Y+ G  Y+ D   V+  A  YA + +L  
Sbjct  49    LQCTSWRFAVETNNLGPWKTIPEECGNYVRQYIEGGAYKMDIDRVSDEAGAYAKSRDLGA  108

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFD+DET LSNLPYY+  + G G+   ++ +FE+W+  G APA+  +L+LY  V
Sbjct  109   DGKDVWVFDVDETLLSNLPYYS--DHGHGLEVFDSVEFEKWVEKGMAPAIGSSLKLYQDV  166

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG K   ++   E+ R   + NL  AGFR W  LILRG++D  +    +KSE+R E+V
Sbjct  167   LSLGFKVFLLTGRGERHRGITVENLMNAGFRDWHKLILRGSDDHGKTATTFKSERRNEMV  226

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RI+GN GDQWSDLLG +   R+FK+P+PMYY+
Sbjct  227   EEGFRILGNSGDQWSDLLGSSASNRSFKLPNPMYYI  262



>ref|NP_001234071.1| acid phosphatase 1 precursor [Solanum lycopersicum]
 sp|P27061.1|PPA1_SOLLC RecName: Full=Acid phosphatase 1; AltName: Full=Apase-1(1); Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34134.1| acid phosphatase type 1 precursor [Solanum lycopersicum]
 gb|AAA34135.1| acid phosphatase type 5 [Solanum lycopersicum]
 emb|CAA39370.1| acid phosphatase [Solanum lycopersicum]
 prf||1908427A acid phosphatase 1
Length=255

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 140/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C +WR  VE NN+  W  +P  C  Y+  YM+G  Y+ +   V+  A  YA +V+L  
Sbjct  41    LKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGD  100

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+DVW+FD+DET LSNLPYY+  +  +G+   +  +F++W+ +G APA+  +L+LY  V
Sbjct  101   DGRDVWIFDVDETLLSNLPYYS--DHRYGLEVFDDVEFDKWVENGTAPALGSSLKLYQEV  158

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  + NL  AGF  W  LILRG++D  +    YKSE+R  +V
Sbjct  159   LKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMV  218

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RIVGN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  219   EEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI  254



>ref|XP_004960899.1| PREDICTED: stem 28 kDa glycoprotein-like isoform X1 [Setaria 
italica]
Length=274

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWR  VE NN R W  +P  CE Y+G+YM+G  YR D  AV   AI YA  +EL   G
Sbjct  63    CDSWRFAVETNNKRGWKTIPARCERYVGNYMMGGHYRSDSRAVVNEAIAYAEGLELSGKG  122

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
              +VWVFDIDETALSNLPYYA+   GFG    N T F  + +   APA+ ETLRLY  + A
Sbjct  123   NEVWVFDIDETALSNLPYYAK--HGFGAEPYNWTAFGAYAKQANAPALPETLRLYKRLQA  180

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG+KPV ++  +E  R A + NL  AG+  +  L+L+  N      +++KS +R +LV  
Sbjct  181   LGIKPVILTGRREDKREATVRNLASAGYTGYLKLLLKPQN-VRMHSLEFKSGERKKLVDA  239

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSDLLG   G RTFK+PDPMYY++
Sbjct  240   GYVIVGNIGDQWSDLLGAPEGDRTFKLPDPMYYIA  274



>ref|XP_010532228.1| PREDICTED: acid phosphatase 1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010532229.1| PREDICTED: acid phosphatase 1-like isoform X2 [Tarenaya hassleriana]
Length=266

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR   E NN+  W  VP  C  Y+  Y++GR Y  D   V+  A  YA++V+L  
Sbjct  52    LRCTSWRFAAETNNLAPWKTVPAECADYVKDYVMGRAYVIDLERVSDEAGFYASSVDLSG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+WVFDIDET LSNLPYY  +E G+G+   +  +F++W+  G APA+  +L+LY  V
Sbjct  112   DGKDIWVFDIDETLLSNLPYY--IEHGYGMEVFDHLEFDKWVEKGVAPAIAPSLKLYQKV  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++   E  R   + NL  AGF+ W+ LILR + +  +   +YKSEKR E+V
Sbjct  170   IDLGYKVFLLTGRSESHRLVTVENLINAGFQNWDKLILRSSEEKGKTATEYKSEKREEMV  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  230   KEGYRIRGNSGDQWSDLLGSSMSQRSFKLPNPMYYI  265



>ref|XP_006358226.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=263

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 142/217 (65%), Gaps = 2/217 (1%)
 Frame = +1

Query  382   YLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV  561
             +L C SWR  VEANN+  W  +P+ C  Y+  Y+ G  Y+ +   V++ A  +A +++L 
Sbjct  48    HLECTSWRFAVEANNLSPWKIIPQECTDYVRQYITGGAYKMEIDRVSSEAGAFAESMKLG  107

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKDVW+FD+DET LSNLPYY+  + G+G    ++ +F++W+  G APA+  +L+LY  
Sbjct  108   EDGKDVWIFDVDETLLSNLPYYS--QHGYGSEVFDSVEFDKWVEKGVAPAIGSSLKLYQD  165

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             V+ LG K   ++   E+ R   + NL  AGF+ W+ LILRG+ D  +    YKSEKR E+
Sbjct  166   VMRLGFKVFLLTGRSERHRIVTVENLMNAGFQDWDKLILRGSEDHGKSATIYKSEKRNEM  225

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  G RI GN GDQWSDLLG +  +R+FK+P+PMYY+
Sbjct  226   VEEGLRIAGNSGDQWSDLLGSSASIRSFKLPNPMYYI  262



>ref|XP_006421584.1| hypothetical protein CICLE_v10005566mg [Citrus clementina]
 gb|ESR34824.1| hypothetical protein CICLE_v10005566mg [Citrus clementina]
Length=286

 Score =   217 bits (552),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 140/214 (65%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C +WR  VEANN+  W  +PR C  Y+  YM+GR Y  D   V+  A  +A +VEL  DG
Sbjct  74    CTTWRFAVEANNLNPWKTIPRECLEYVRDYMMGRGYGLDLERVSNEAGVFAKSVELRGDG  133

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KD W+FDIDET LSNLPYY   E G+G+   +  +F++W+    +PA++ +L+LY  VL 
Sbjct  134   KDAWIFDIDETLLSNLPYYQ--EHGYGLEIFDPVEFDKWVEKAMSPAIEASLKLYEEVLG  191

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG K   ++   E+ RS  + NL  AG R W+ LILR ++D  +  + YKSEKR E+V  
Sbjct  192   LGFKIFLLTGRSEKQRSITVDNLINAGVRYWDKLILRSSDDHGKLAIIYKSEKRNEMVQE  251

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GYRI+GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  252   GYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI  285



>ref|XP_007135620.1| hypothetical protein PHAVU_010G144200g [Phaseolus vulgaris]
 gb|ESW07614.1| hypothetical protein PHAVU_010G144200g [Phaseolus vulgaris]
Length=270

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 142/216 (66%), Gaps = 5/216 (2%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             ++C SWRLGVEANN+  W  VP  C+ Y+  Y+LG QYR D   V   A  YA  + +  
Sbjct  58    VSCTSWRLGVEANNLIKWKTVPAACQEYVADYLLGDQYRSDSKTVCREAYFYAKRLNIT-  116

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
               KDV+VFDID+T LSNL Y+A    GFG+   NAT F+ W+  G+A A+ ETL LYN +
Sbjct  117   -AKDVFVFDIDDTTLSNLQYFANH--GFGVEAHNATAFKIWVSFGEAFALPETLVLYNKL  173

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMD-YKSEKRTEL  921
             ++LG+K VFI+E     +   ISNL++ GF  WE LI R        + + +K+ +R +L
Sbjct  174   VSLGIKVVFITERPVDLKDVTISNLKEVGFHTWEKLIARDPAIYSGKLSNAFKTSERKKL  233

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
             VA GYRIVGN+GDQWSD++GE  G RTFK+P+P+YY
Sbjct  234   VAEGYRIVGNIGDQWSDIVGEKKGFRTFKLPNPLYY  269



>ref|XP_011072446.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=184

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 132/185 (71%), Gaps = 1/185 (1%)
 Frame = +1

Query  481   MLGRQYRDDCTAVAASAIRYATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRR  660
             MLG++ R DC  VA +AI YA +++L  DGKDVWVFDIDET LSNLPYYAR +V FG   
Sbjct  1     MLGKRSRHDCEVVADAAIEYAKSLKLGGDGKDVWVFDIDETTLSNLPYYARSDVQFGALP  60

Query  661   CNATKFEEWIRDGKAPAMQETLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRA  840
              N TKF EW+ +GKAP +    RLY ++L+LG+K VF++   + FR  R +NL  AG+ +
Sbjct  61    YNGTKFNEWVTEGKAPPVPAVRRLYKTLLSLGIKAVFLTGGSDAFRRIRTANLYAAGYHS  120

Query  841   WEMLILRGANDTERPMMDYKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDP  1020
             W  LI +G  + E   + YKS+KR E+V  GYRIVGN+GDQWSDLLG + G RTFK+PDP
Sbjct  121   WLKLIFKGEAE-EGAALVYKSKKRREVVDEGYRIVGNIGDQWSDLLGADAGNRTFKVPDP  179

Query  1021  MYYVS  1035
             MYY+ 
Sbjct  180   MYYIG  184



>prf||1908418A acid phosphatase 1
Length=255

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 140/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C +WR  VE NN+  W  +P  C  Y+  YM+G  Y+ +   V+  A  YA +V+L  
Sbjct  41    LKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGD  100

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+DVW+FD+DET LSNLPYY+  +  +G+   +  +F++W+ +G APA+  +L+LY  V
Sbjct  101   DGRDVWIFDVDETLLSNLPYYS--DHRYGLEVFDDVEFDKWVENGIAPALGSSLKLYQEV  158

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E+ RS  + NL  AGF  W  LILRG++D  +    YKSE+R  +V
Sbjct  159   LKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMV  218

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RIVGN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  219   EEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI  254



>ref|XP_006284361.1| hypothetical protein CARUB_v10005533mg [Capsella rubella]
 gb|EOA17259.1| hypothetical protein CARUB_v10005533mg [Capsella rubella]
Length=260

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 137/216 (63%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR   E NN+  W  +P  C  Y+  Y++G+ Y  D   V+  A  YA+  E   
Sbjct  46    LHCTSWRFAAETNNLAPWKTIPAECADYVKDYLMGKGYVFDVERVSEEAKVYASTFESNG  105

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET LSNLPYY  +E G G+   + +KF++W+  G APA+  +L+LY  V
Sbjct  106   DGKDVWIFDIDETLLSNLPYY--LEHGCGLEVFDHSKFDKWVERGIAPAIAPSLKLYQMV  163

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               +G K + ++  +E  R   + NLR AGF  W+ LILR ++D  +    YKSEKR E+V
Sbjct  164   KEMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSSDDDHKTATTYKSEKRDEMV  223

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  224   KEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>ref|XP_002867623.1| hypothetical protein ARALYDRAFT_329150 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43882.1| hypothetical protein ARALYDRAFT_329150 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 137/216 (63%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR   E NN+  W  +P  C  Y+ HY++G  Y  D   V+  A  YA++ +   
Sbjct  46    LHCTSWRFAAETNNLAPWKTIPAECADYVYHYLMGEGYVVDVERVSEEAKLYASSFQSNA  105

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+W+FDIDET LSNLPYY  +E G G+   + +KF++W+  G APA+  + +LY  V
Sbjct  106   DGKDIWIFDIDETLLSNLPYY--MEHGCGLEVFDHSKFDKWVEKGIAPAIAPSFKLYQKV  163

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K + ++  +E  R   + NLR AGF  W+ LILR  +D  +    YKSEKR E+V
Sbjct  164   VDLGYKVILLTGRRENHRVITVENLRNAGFHNWDKLILRSLDDRNKTATMYKSEKREEMV  223

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  224   KEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>gb|KFK26738.1| acid phosphatase [Arabis alpina]
Length=264

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR   E NN+  W  +P  C  Y+  Y+LG+ Y  D   V+  A  +A++VE   
Sbjct  50    LHCTSWRFAAETNNLSPWKTIPEECADYVKDYVLGKGYVTDLERVSEEASMFASSVEFAG  109

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+W+FDIDET LSNLPYY  ++ GFG+   + ++F++W+  G APA+  +L+LY  V
Sbjct  110   DGKDIWIFDIDETLLSNLPYY--IDHGFGLEVFHHSEFDKWVERGVAPAIAPSLKLYQRV  167

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++  KE  R   + NL  AGF+ W+ LILR  ++  +    YKSEKR E+V
Sbjct  168   VDLGYKVFLLTGRKESHRLITVENLINAGFQNWDKLILRSPDEQHKMATLYKSEKRDEMV  227

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG ++  R+FK+ +PMYY+
Sbjct  228   KEGYRIRGNSGDQWSDLLGSSMSQRSFKLANPMYYI  263



>ref|XP_010925513.1| PREDICTED: acid phosphatase 1-like isoform X1 [Elaeis guineensis]
Length=256

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRL VE NN   W  +P  C  ++  YM G +Y  D   VAA ++ +A  V++  
Sbjct  42    LYCDSWRLSVETNNAGYWETIPARCLQFVAEYMNGERYASDSDVVAAESLAFAQTVQVAG  101

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FD+DET LSN+PYY     G+G    N T F+EW+   KAPA+Q +LRLY  +
Sbjct  102   DGKDVWIFDVDETLLSNVPYYDVH--GYGWEEFNETAFDEWVNLAKAPALQASLRLYEEL  159

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG + + ++   E  R+A   NL   G+ +W+  ILR A+D  +  + YKSE+R +L 
Sbjct  160   LGLGFQMILLTGRAEAQRNATEKNLSFVGYHSWKRFILREASDIGKKAVTYKSERRAQLE  219

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             A+GYRI GN GDQWSDLLG  + +R+FK+P+PMYY+
Sbjct  220   AQGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  255



>ref|XP_006385121.1| acid phosphatase family protein [Populus trichocarpa]
 gb|ERP62918.1| acid phosphatase family protein [Populus trichocarpa]
Length=261

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 141/216 (65%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR GVEANN+  W  VP  C  Y+  YMLGR Y  D   V+  +  YA +++L  
Sbjct  47    LQCTSWRFGVEANNLNPWKTVPLECGEYVKDYMLGRAYSLDLERVSNESGVYAKSLKLSG  106

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+WVFD+DET LS+LPYYA  + G+G+   +  +F +W+    APA++ +L+LY  V
Sbjct  107   DGKDIWVFDVDETLLSHLPYYA--DHGYGLEIFDPAEFNKWVDKAIAPALEPSLKLYKEV  164

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++   E  RS    NL  AGF+ W+ LILRG+ D  +    +KS+KR+E+V
Sbjct  165   MDLGFKVFLLTGRSETQRSVTEENLINAGFQNWDKLILRGSEDHGKLATIFKSDKRSEMV  224

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               G+RI+GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  225   KEGFRILGNSGDQWSDLLGSFMSNRSFKLPNPMYYI  260



>emb|CBI25273.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = +1

Query  481   MLGRQYRDDCTAVAASAIRYATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRR  660
             MLG QYR D   V   AI YA +++L  DGKDVWVFDIDET LSNLPYYA  E GFG   
Sbjct  1     MLGHQYRQDSRVVVYEAIAYAESLKLGGDGKDVWVFDIDETTLSNLPYYA--ENGFGAEV  58

Query  661   CNATKFEEWIRDGKAPAMQETLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRA  840
              N T F EW+  G+APA+ E+L+LYN +++LG+K VF++   E  R+  ++NL+K G+  
Sbjct  59    FNETSFNEWVMKGEAPALPESLKLYNKLVSLGIKVVFLTGKGEDERNVTVANLKKVGYHT  118

Query  841   WEMLILRGANDTERPMMDYKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDP  1020
             WE LILR ++D    ++ YKS +R ++   GY+IVGN+GDQWSD+LG N G RTFK+PDP
Sbjct  119   WEKLILRKSSDGSTALV-YKSNQRKKVEESGYKIVGNMGDQWSDILGTNTGNRTFKLPDP  177

Query  1021  MYYVS  1035
             MYY++
Sbjct  178   MYYIA  182



>ref|NP_194245.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB36757.1| acid phosphatase-like protein [Arabidopsis thaliana]
 emb|CAB79424.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAL67073.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14241.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AEE85017.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=260

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 136/216 (63%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR   E NN+  W  +P  C  Y+  Y++G  Y  D   V+  A  YA++ E   
Sbjct  46    LHCTSWRFAAETNNLAPWKTIPAECADYVKDYLMGEGYVVDVERVSEEAKVYASSFESNG  105

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+W+FDIDET LSNLPYY  +E G G+   + +KF+ W+  G APA+  +L+LY  V
Sbjct  106   DGKDIWIFDIDETLLSNLPYY--MEHGCGLEVFDHSKFDMWVEKGIAPAIAPSLKLYQKV  163

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K + ++  +E  R   + NLR AGF  W+ LILR  +D  +    YKSEKR E+V
Sbjct  164   IHLGYKVILLTGRRENHRVITVENLRNAGFHNWDKLILRSLDDRNKTATMYKSEKREEMV  223

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  224   KEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  259



>gb|AFK42878.1| unknown [Medicago truncatula]
 gb|AET02725.2| plant acid phosphatase [Medicago truncatula]
Length=259

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 139/217 (64%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR   EANN+  W  VP+ C  ++  YM G+ Y  D       A  +A +V+L  
Sbjct  45    LRCRSWRFAGEANNLSPWKTVPKECAEHVKEYMNGKGYVYDLEIANKEAGEFAKSVKLKE  104

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG D WVFDIDET LSNLPYYA    G+G    +  KF++W+  G APA++ +L+LY  +
Sbjct  105   DGLDAWVFDIDETLLSNLPYYA--AHGYGFEVFDHAKFDDWVEKGVAPAIEASLKLYEDI  162

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K + ++   E  R+  + NL  AGFR W  LILR ++D  +  + YKSEKR+E+ 
Sbjct  163   LNLGYKVILLTGRSESHRAVTVDNLINAGFRDWHQLILRSSDDKGKLAVIYKSEKRSEME  222

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               G+RI+GN GDQWSDLLG +V +R+FK+P+PMY+++
Sbjct  223   KEGFRILGNSGDQWSDLLGSSVSVRSFKLPNPMYFIA  259



>gb|AFW77369.1| hypothetical protein ZEAMMB73_279889 [Zea mays]
Length=276

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 142/219 (65%), Gaps = 7/219 (3%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWR  VE N +RDW  VP  CE Y+G+YMLG  YR D  AVA  AI YA  + L   G
Sbjct  61    CDSWRFAVETNTLRDWDTVPARCEKYVGNYMLGGHYRSDSRAVANEAIAYAEGLNLTGQG  120

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRR----CNATKFEEWIRDGKAPAMQETLRLYN  738
             K+VWVFD+DET LSNLPYYA+   GFG RR     N + F  ++++  AP + ET RLY 
Sbjct  121   KEVWVFDVDETTLSNLPYYAK--HGFGERRRVEPYNWSTFGAYVKEANAPVLPETQRLYK  178

Query  739   SVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTE  918
              + ALG+KPV ++  +E  R A  +NL  AG+  +  L+L+  N  +   +++KS +R +
Sbjct  179   RLQALGIKPVILTGRREDKREATANNLAAAGYTGYLKLLLKPQN-VKVSSIEFKSGERKK  237

Query  919   LVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             L   GY IVGN+GDQW+DLLGE  G RTFK+PDPMYY+ 
Sbjct  238   LQDAGYVIVGNIGDQWTDLLGEPEGGRTFKLPDPMYYIG  276



>ref|XP_010536549.1| PREDICTED: acid phosphatase 1-like [Tarenaya hassleriana]
Length=258

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 138/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR   E NN+  W  VP  C  Y+  YM+ R Y  D   V+  A  YA++VEL  
Sbjct  44    LHCTSWRFAAETNNLAPWKAVPAECADYVKDYMVERAYVIDLEKVSDEAEVYASSVELSG  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+WVFDIDET LSNLPYY  +E G+G    +  +F++W+  G+APA++ +L+LY  V
Sbjct  104   DGKDIWVFDIDETLLSNLPYY--IEHGYGAEVFDHLEFDKWVEKGRAPAIEASLKLYQKV  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R   + NL  AGF+ W+ LILR + D  +   +YKSEKR  +V
Sbjct  162   RDLGYKVFLLTGRSESHRLVTVENLINAGFQNWDKLILRSSEDKWKTATEYKSEKREGMV  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GY+I GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  222   DDGYKIRGNSGDQWSDLLGSSMSERSFKLPNPMYYI  257



>gb|AGV54493.1| acid phosphatase [Phaseolus vulgaris]
Length=256

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 140/216 (65%), Gaps = 5/216 (2%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             ++C SWRLGVEANN+  W  VP  C+ Y+  Y+LG QYR D   V   A  YA  + +  
Sbjct  44    VSCTSWRLGVEANNLIKWKTVPAACQEYVADYLLGDQYRSDSKTVCREAYFYAKTLNIT-  102

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
               +DV+VFDID+T LSNL Y+A    GFG+   NAT F+ W+  G+A A+ ETL LYN +
Sbjct  103   -ARDVFVFDIDDTTLSNLQYFANH--GFGVEAHNATAFKIWVSFGEAFALPETLVLYNKL  159

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMD-YKSEKRTEL  921
             + LG+K VFI+E     +   ISNL++ GF  WE  I R        + + +K+ +R +L
Sbjct  160   VGLGIKVVFITERPVDLKDVTISNLKEVGFHTWEKFIARDPAIYSGKLSNAFKTSERKKL  219

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
             VA GYRIVGN+GDQWSD++GE  G RTFK+P+P+YY
Sbjct  220   VAEGYRIVGNIGDQWSDIVGEKKGFRTFKLPNPLYY  255



>ref|XP_010433681.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 139/220 (63%), Gaps = 2/220 (1%)
 Frame = +1

Query  373   HIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAV  552
             ++  L+C SWR   E NN+  W  +P  C  Y+  Y++G+ Y  D   V+  A  YA++ 
Sbjct  49    NVNLLHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMGKGYVFDVERVSEEAKIYASSF  108

Query  553   ELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRL  732
             E   DGKDVW+FDIDET LSNLPYY  +E G G+   N +KF++W+  G APA+  +L+L
Sbjct  109   ESNGDGKDVWIFDIDETLLSNLPYY--LEHGCGLEVFNHSKFDKWVEKGIAPAIAPSLKL  166

Query  733   YNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKR  912
             Y  V  +G K + ++  +E  R   + NLR AGF  W+ LILR  +D  +    YKSEKR
Sbjct  167   YQMVQDMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIYKSEKR  226

Query  913   TELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
              E+V  GYRI GN GDQWSDLLG  +  R+FK+P+PMY++
Sbjct  227   DEMVNEGYRIRGNSGDQWSDLLGFAMSERSFKLPNPMYFI  266



>ref|XP_004960900.1| PREDICTED: stem 28 kDa glycoprotein-like isoform X2 [Setaria 
italica]
Length=279

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 140/219 (64%), Gaps = 6/219 (3%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWR  VE NN R W  +P  CE Y+G+YM+G  YR D  AV   AI YA  +EL   G
Sbjct  63    CDSWRFAVETNNKRGWKTIPARCERYVGNYMMGGHYRSDSRAVVNEAIAYAEGLELSGKG  122

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
              +VWVFDIDETALSNLPYYA+   GFG    N T F  + +   APA+ ETLRLY  + A
Sbjct  123   NEVWVFDIDETALSNLPYYAK--HGFGAEPYNWTAFGAYAKQANAPALPETLRLYKRLQA  180

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGA----NDTERPMMDYKSEKRTE  918
             LG+KPV ++  +E  R A + NL  AG+  +  L+L+ +     +     +++KS +R +
Sbjct  181   LGIKPVILTGRREDKREATVRNLASAGYTGYLKLLLKYSICLCTNVRMHSLEFKSGERKK  240

Query  919   LVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             LV  GY IVGN+GDQWSDLLG   G RTFK+PDPMYY++
Sbjct  241   LVDAGYVIVGNIGDQWSDLLGAPEGDRTFKLPDPMYYIA  279



>ref|XP_006280976.1| hypothetical protein CARUB_v10026976mg [Capsella rubella]
 gb|EOA13874.1| hypothetical protein CARUB_v10026976mg [Capsella rubella]
Length=258

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C +WR   E NN+  W  +P  C  Y+ +Y++G+ Y  D   V+  A  +A++VE   
Sbjct  44    LHCTTWRFAAEMNNLAPWKTIPVECADYVKNYVMGKGYATDLERVSEEAFIFASSVEFSG  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+WVFDIDET LSNLPYY  ++ GFG+   + ++F++W+  G APA+  +L+LY  V
Sbjct  104   DGKDIWVFDIDETLLSNLPYY--IDHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRV  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++  KE  R   + NL  AGF+ W+ LILR   +  +    YKSEKR E+V
Sbjct  162   IDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG ++  R+FK+ +PMYY+
Sbjct  222   KEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  257



>ref|XP_010442941.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=260

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C +WR   E NN+  W  +P  C  Y+ +Y++G+ Y  D   V+  A+ +A +VE   
Sbjct  46    LHCTTWRFAAEMNNLAPWKSIPAECADYVKNYVMGKGYATDLERVSEEALIFANSVEFSG  105

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+WVFDIDET LSNLPYY  ++ GFG+   + ++F++W+  G APA+  +L+LY  V
Sbjct  106   DGKDIWVFDIDETLLSNLPYY--IDHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRV  163

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++  KE  R   + NL  AGF+ W+ LILR   +  +    YKSEKR E+V
Sbjct  164   VDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  223

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG ++  R+FK+ +PMYY+
Sbjct  224   KEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  259



>gb|ACU24349.1| unknown [Glycine max]
Length=255

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 138/214 (64%), Gaps = 5/214 (2%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEANN+  W  VP  C  YI  Y+LG QYR D   V   A  YA +++L +  
Sbjct  45    CASWRLGVEANNVVKWQTVPAACGEYIADYVLGDQYRSDFKTVNQQAYFYAKSLKLTN--  102

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDV+V D+D+T LSNL Y+A    GFG+   N T F+ W+ DG+A A+ E L++YN +LA
Sbjct  103   KDVFVLDVDDTTLSNLQYFANH--GFGVEPHNTTAFKNWVLDGEAFALPEILKMYNKLLA  160

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGAND-TERPMMDYKSEKRTELVA  927
              G+K VF+SE           NL++ GF  WE LI R  ++ + +   +YKS +R +L  
Sbjct  161   FGIKIVFLSERPLSLGDVTAKNLKEVGFNTWEKLIFRDPSEYSGKLSFEYKSAEREKLEK  220

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
              GYRI+GNVGDQWSDLLG N G RTFK+P+P+YY
Sbjct  221   EGYRIIGNVGDQWSDLLGSNKGTRTFKLPNPLYY  254



>ref|XP_010438922.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=267

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 139/220 (63%), Gaps = 2/220 (1%)
 Frame = +1

Query  373   HIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAV  552
             ++  L+C SWR   E NN+  W  +P  C  Y+  Y++G+ Y  D   V+  A  YA++ 
Sbjct  49    NVNLLHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMGKGYVFDVERVSEEAKIYASSF  108

Query  553   ELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRL  732
             E   DGKDVW+FDIDET LSNLPYY  +E G G+   N +KF++W+  G APA+  +L+L
Sbjct  109   ESNGDGKDVWIFDIDETLLSNLPYY--LEHGCGLEVFNHSKFDKWVEKGIAPAIAPSLKL  166

Query  733   YNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKR  912
             Y  V  +G K + ++  +E  R   + NLR AGF  W+ LILR  +D  +    +KSEKR
Sbjct  167   YKLVQDMGYKVILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIFKSEKR  226

Query  913   TELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
              E+V  GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  227   DEMVNEGYRIRGNSGDQWSDLLGFAMSERSFKLPNPMYYI  266



>gb|ACJ84626.1| unknown [Medicago truncatula]
Length=259

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 138/217 (64%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR   EANN+  W  VP+ C  ++  YM G+ Y  D       A  +A +V+L  
Sbjct  45    LRCRSWRFAGEANNLSPWKTVPKECAEHVKEYMNGKGYVYDLEIANKEAGEFAKSVKLKE  104

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG D WVFDIDET LSNLPYYA    G+G    +  KF++W+  G  PA++ +L+LY  +
Sbjct  105   DGLDAWVFDIDETLLSNLPYYA--AHGYGFEVFDHAKFDDWVEKGVTPAIEASLKLYEDI  162

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K + ++   E  R+  + NL  AGFR W  LILR ++D  +  + YKSEKR+E+ 
Sbjct  163   LNLGYKVILLTGRSESHRAVTVDNLINAGFRDWHQLILRSSDDKGKLAVIYKSEKRSEME  222

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               G+RI+GN GDQWSDLLG +V +R+FK+P+PMY+++
Sbjct  223   KEGFRILGNSGDQWSDLLGSSVSVRSFKLPNPMYFIA  259



>ref|XP_004143740.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
 gb|KGN50316.1| hypothetical protein Csa_5G167080 [Cucumis sativus]
Length=266

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W R+P  C  Y+  Y+ GR Y+ +    +  A  +A  V+LV 
Sbjct  52    LRCDSWRFNVEANNLNPWKRIPESCSEYVKQYVTGRAYQLELEIASNEAQVFAKTVKLVG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET LSNLPYY   + G+G       +F+ W+    AP +Q +L  Y  +
Sbjct  112   DGKDVWVFDIDETLLSNLPYYT--DHGYGSENFKPDEFDNWVEKATAPPLQPSLEFYKEL  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K V ++   E+ R     NL  AGF  W+ LILR  +D  +  + YKSEKR+E+ 
Sbjct  170   LDLGFKLVLLTGRSEKQRECTTRNLINAGFYDWDRLILRRDDDQGKSAILYKSEKRSEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               G RI+GN GDQWSDLLG +V +R+FK+P+PMYY+S
Sbjct  230   NEGLRIIGNSGDQWSDLLGTSVSVRSFKLPNPMYYIS  266



>ref|XP_009607238.1| PREDICTED: acid phosphatase 1-like [Nicotiana tomentosiformis]
Length=169

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = +1

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDV VFDIDET L NLPYYAR +V FG    N  KF EW+ +GKAPA+  TLRLY  V
Sbjct  14    DGKDVCVFDIDETTLFNLPYYARSDVAFGAIPFNNAKFNEWVSEGKAPAIPATLRLYKMV  73

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L+LG+KPVFI+ T    R ARI+NL+KAG+ +W  L+L+G ND+ + ++ +KS KRTELV
Sbjct  74    LSLGIKPVFITGTPRFTRKARIANLKKAGYTSWLKLVLKGKNDSPKSVV-FKSSKRTELV  132

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRIVGN+GDQWSDL+G+NVG RTFK+PDPMYY+
Sbjct  133   KAGYRIVGNIGDQWSDLIGDNVGSRTFKVPDPMYYI  168



>ref|XP_002865848.1| hypothetical protein ARALYDRAFT_495196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42107.1| hypothetical protein ARALYDRAFT_495196 [Arabidopsis lyrata subsp. 
lyrata]
Length=257

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C +WR   E NN+  W  +P  C  Y+  Y++G+ Y  D   V+  A+ +A++VE   
Sbjct  43    LHCTTWRFAAEMNNLAPWKTIPVECADYVKDYVMGKGYVTDLERVSEEALIFASSVEFSG  102

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+W+FDIDET LSNLPYY  ++ GFG+   + ++F++W+  G APA+  +L+LY  V
Sbjct  103   DGKDIWIFDIDETLLSNLPYY--IDHGFGLELFDHSEFDKWVEKGVAPAIAPSLKLYQRV  160

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++  KE  R   + NL  AGF+ W+ LILR   +  +    YKSEKR E+V
Sbjct  161   IDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  220

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG ++  R+FK+ +PMYY+
Sbjct  221   KDGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  256



>ref|XP_004307784.1| PREDICTED: acid phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=267

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 137/216 (63%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W  +P  C  Y+  Y+ GR Y  D   V+  A  Y  +V L  
Sbjct  53    LRCTSWRFAVEANNVNPWKTIPEECVEYVKDYVTGRGYSVDLERVSNEAGIYVKSVVLGG  112

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FD+D+T LSN+PYYA  + G+G    +  +F++W+  G +PA++ +L+LY  V
Sbjct  113   DGKDVWIFDVDDTLLSNVPYYA--DHGYGSEVFDQVEFDKWVDKGMSPAIKSSLKLYEEV  170

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++   E  R     NL+  GF+ W  LILR A+D  +    YKSEKR+E+ 
Sbjct  171   LGLGFKVFLLTGRSEGKRGVTAENLKNVGFQDWHKLILRAADDHGKSATIYKSEKRSEME  230

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG ++ +R+FK+P+PMYY+
Sbjct  231   KEGYRILGNSGDQWSDLLGSSMSIRSFKLPNPMYYI  266



>ref|XP_006656617.1| PREDICTED: acid phosphatase 1-like, partial [Oryza brachyantha]
Length=226

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 135/216 (63%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             + C SWRL  EANN+  W+ VP  C  Y+  Y+ G  YR D   VA  A  YA A  +  
Sbjct  12    VRCASWRLAGEANNLAPWSAVPEECAAYVRGYVTGVAYRSDLEEVAREASTYARAARVAG  71

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+D WVFD+DET LSNLPYYA  E G+G+   +  +F++W+  G+APA+  +L+LY  V
Sbjct  72    DGRDAWVFDVDETLLSNLPYYA--EHGYGLELFDHREFDKWVERGEAPAIPSSLKLYKEV  129

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  +   + NL+K G+  W+ LILR   D ++    YKSEKR E+ 
Sbjct  130   RDLGFKTFLLTGRSEGHQGVTVDNLKKQGYHEWDKLILRAPADRKKTATIYKSEKRKEME  189

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +   R+FK+P+PMYY+
Sbjct  190   EEGYRILGNSGDQWSDLLGYSTSARSFKLPNPMYYI  225



>ref|XP_010482458.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=260

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 138/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C +WR   E NN+  W  +P  C  Y+ +Y++G+ Y  D   V+  A  +A +VE   
Sbjct  46    LHCTTWRFAAEMNNLAPWKTIPVECADYVKNYVMGKGYATDLERVSEEAFIFANSVEFSG  105

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+WVFDIDET LSNLPYY  ++ GFG+   + ++F++W+  G APA+  +L+LY  V
Sbjct  106   DGKDIWVFDIDETLLSNLPYY--IDHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRV  163

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG K   ++  KE  R   + NL  AGF+ W+ LILR   +  +    YKSEKR E+V
Sbjct  164   VDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  223

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG ++  R+FK+ +PMYY+
Sbjct  224   KEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  259



>ref|NP_199939.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 dbj|BAA97389.1| acid phosphatase [Arabidopsis thaliana]
 dbj|BAD95053.1| acid phosphatase [Arabidopsis thaliana]
 gb|ABD19661.1| At5g51260 [Arabidopsis thaliana]
 gb|AED96059.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=257

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 138/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C +WR   E NN+  W  +P  C  Y+  Y++G+ Y  D   V+  A+ +A ++E   
Sbjct  43    LHCTTWRFAAEMNNLAPWKTIPVECADYVKDYVMGKGYLTDLERVSEEALIFARSIEFSG  102

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD+W+FDIDET LSNLPYY  ++ GFG+   + ++F++W+  G APA+  +L+LY  V
Sbjct  103   DGKDIWIFDIDETLLSNLPYY--IDHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQRV  160

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K   ++  KE  R   + NL  AGF+ W+ LILR   +  +    YKSEKR E+V
Sbjct  161   LDLGYKVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPEEQHKMATLYKSEKRDEMV  220

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG ++  R+FK+ +PMYY+
Sbjct  221   KEGYRIRGNSGDQWSDLLGTSMSQRSFKLANPMYYI  256



>ref|XP_008437018.1| PREDICTED: acid phosphatase 1 [Cucumis melo]
Length=266

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 137/217 (63%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W  +P+ C  Y+  Y+ GR Y+ +    +  A  +A  V+LV 
Sbjct  52    LRCDSWRFNVEANNLNPWKTIPKNCSEYVKQYVTGRAYQLELEIASNEAEIFAKTVKLVG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET LSNLPYY   + G+G       +F+ W+    AP +Q +L LY  +
Sbjct  112   DGKDVWIFDIDETLLSNLPYYT--DHGYGSESFKPDEFDNWVEKATAPPLQPSLELYKEL  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K V ++   E+ R +   NL  AGF  W+ L+LR  +D  +  + YKSEKR+E+ 
Sbjct  170   LDLGFKLVLLTGRSEKQRESTTRNLINAGFYDWDRLVLRRDDDQGKSAILYKSEKRSEME  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               G RI+GN GDQWSDLLG +V +R+FK+P+PMYY+S
Sbjct  230   NEGLRIIGNSGDQWSDLLGTSVSVRSFKLPNPMYYIS  266



>ref|XP_007152955.1| hypothetical protein PHAVU_004G174200g [Phaseolus vulgaris]
 gb|ESW24949.1| hypothetical protein PHAVU_004G174200g [Phaseolus vulgaris]
Length=251

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 134/214 (63%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE NN   W RVP  C  ++  Y+ G +YR DC  V   ++ +A +V LV DG
Sbjct  39    CDSWRLAVETNNAGPWERVPANCVDFVAEYISGERYRRDCEVVGNLSLAFARSVRLVGDG  98

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             +D WVFDIDET LSN+PYY   ++GFG    N T F+ W+    APA+   L LYN +  
Sbjct  99    RDAWVFDIDETLLSNVPYYE--DIGFGFEIFNETSFDAWVNSAAAPALVPNLILYNELKE  156

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG +   ++   E  R+A  +NL  +G+R WE LILR + D  +P + YKSEKR EL   
Sbjct  157   LGFRIFLLTGRSEYQRNATEANLMLSGYRNWERLILRESYDKGKPAISYKSEKREELENE  216

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GYRI G+ GDQWSDL G  V  R+FK+P+PMYY+
Sbjct  217   GYRIHGSSGDQWSDLWGYAVAARSFKLPNPMYYI  250



>ref|XP_006401998.1| hypothetical protein EUTSA_v10014448mg [Eutrema salsugineum]
 gb|ESQ43451.1| hypothetical protein EUTSA_v10014448mg [Eutrema salsugineum]
Length=258

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 139/217 (64%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAV-ELV  561
             L+C SWR   E NN+  W  +P  C  YI  Y+LG+ Y  D   V+  A  +A++V E  
Sbjct  43    LHCTSWRFAAETNNLAPWQTIPVECADYIKDYVLGKGYVTDLERVSEEASNFASSVVESS  102

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKD+W+FDIDET LSNLPYY  ++ GFG+   + ++F++W+  G APA+  +L+LY  
Sbjct  103   GDGKDIWIFDIDETLLSNLPYY--IDHGFGLELFDHSEFDKWVERGVAPAIAPSLKLYQR  160

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             VL LG K   ++  KE  R   + NL  AGF+ W+ LILR  ++  +    YKSEKR E+
Sbjct  161   VLDLGYKVFLLTGRKESHRLVTVENLISAGFQNWDKLILRSPDEQHKTATLYKSEKRDEM  220

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  GYRI GN GDQWSDLLG ++  R+FK+ +PMYY+
Sbjct  221   VKEGYRIRGNSGDQWSDLLGSSMSQRSFKLANPMYYI  257



>ref|XP_010925515.1| PREDICTED: acid phosphatase 1-like isoform X2 [Elaeis guineensis]
Length=254

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 137/216 (63%), Gaps = 4/216 (2%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRL VE NN   W  +P  C  ++  YM G +Y  D   VAA ++ +A  V++  
Sbjct  42    LYCDSWRLSVETNNAGYWETIPARCLQFVAEYMNGERYASDSDVVAAESLAFAQTVQVAG  101

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FD+DET LSN+PYY       G    N T F+EW+   KAPA+Q +LRLY  +
Sbjct  102   DGKDVWIFDVDETLLSNVPYYDV----HGWEEFNETAFDEWVNLAKAPALQASLRLYEEL  157

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG + + ++   E  R+A   NL   G+ +W+  ILR A+D  +  + YKSE+R +L 
Sbjct  158   LGLGFQMILLTGRAEAQRNATEKNLSFVGYHSWKRFILREASDIGKKAVTYKSERRAQLE  217

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             A+GYRI GN GDQWSDLLG  + +R+FK+P+PMYY+
Sbjct  218   AQGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  253



>ref|XP_004513069.1| PREDICTED: acid phosphatase 1-like [Cicer arietinum]
Length=250

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 135/215 (63%), Gaps = 2/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE NN+  W ++P  C   +  YM+G QY+ DC  V   +  +A  V    DG
Sbjct  38    CDSWRLAVETNNVGAWKQIPASCVDSVAEYMIGEQYKRDCDVVGEYSYEFAKRVAFGGDG  97

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             +D WVFDIDET LSN+PYY    VGFG    N T F +W++   APA+  +L LY  +L 
Sbjct  98    RDAWVFDIDETLLSNVPYYK--TVGFGSEFFNETSFNDWVKLADAPALPSSLSLYKKLLE  155

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG +   ++   E  R+A  +NL  +G+R W+ LILRG  D  +P + +KSEKR ELV+ 
Sbjct  156   LGFRIFLLTGRSEYQRNATETNLLFSGYRNWDRLILRGPYDQGKPAIRFKSEKREELVSE  215

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GYRI G+ GDQWSDL G  V  R+FK+P+PMY+++
Sbjct  216   GYRIHGSSGDQWSDLWGFAVASRSFKLPNPMYFIA  250



>emb|CDY03376.1| BnaC01g17060D [Brassica napus]
Length=264

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV-  561
             +NC SWR   E NN+  W  +P  C GY+  Y++GR Y  D   V+  A  YA++     
Sbjct  49    VNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVVDLERVSEEANVYASSFGFSG  108

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKD W+FDIDET LSNLPYY  +E G G+   + TKF++W+  G APA+  +L+LY  
Sbjct  109   DDGKDTWIFDIDETLLSNLPYY--LEHGCGLEVFDHTKFDKWVEKGAAPAIAPSLKLYEK  166

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             V  LG K + ++  +E  R   I NL  AGF  W+ LILR  +D  +    +KSEKR E+
Sbjct  167   VKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILRSLDDDHKTATIFKSEKRDEM  226

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  227   VKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  263



>emb|CDY34346.1| BnaA01g14490D [Brassica napus]
Length=265

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV-  561
             +NC SWR   E NN+  W  +P  C GY+  Y++GR Y  D   V+  A  YA++     
Sbjct  50    VNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVVDLERVSEEANVYASSFGFSG  109

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKD W+FDIDET LSNLPYY  +E G G+   + TKF++W+  G APA+  +L+LY  
Sbjct  110   DDGKDTWIFDIDETLLSNLPYY--LEHGCGLEVFDHTKFDKWVEKGAAPAIAPSLKLYEK  167

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             V  LG K + ++  +E  R   I NL  AGF  W+ LILR  +D  +    +KSEKR E+
Sbjct  168   VKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILRSLDDDHKTATIFKSEKRDEM  227

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  228   VKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  264



>ref|XP_009138920.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=264

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV-  561
             +NC SWR   E NN+  W  +P  C GY+  Y++GR Y  D   V+  A  YA++     
Sbjct  49    VNCTSWRFAAETNNLAPWKTIPAECAGYVKDYLMGRGYVVDLERVSEEANVYASSFGFSG  108

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKD W+FDIDET LSNLPYY  +E G G+   + TKF++W+  G APA+  +L+LY  
Sbjct  109   DDGKDTWIFDIDETLLSNLPYY--LEHGCGLEVFDHTKFDKWVEKGAAPAIAPSLKLYEK  166

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             V  LG K + ++  +E  R   I NL  AGF  W+ LILR  +D  +    +KSEKR E+
Sbjct  167   VKDLGYKVILLTGRRENHRVITIENLINAGFNNWDELILRSLDDDHKTATIFKSEKRDEM  226

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  227   VKEGYRIRGNSGDQWSDLLGSAMSQRSFKLPNPMYYI  263



>ref|XP_008794092.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=258

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 137/216 (63%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRL  E NN   W  +P  C  ++  YM G +Y  D   VAA ++ +A  V++  
Sbjct  44    LYCDSWRLSEETNNAGYWGTIPARCLQFVAEYMNGDRYALDSDVVAAESLAFAQTVQVAG  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG DVW+FD+DET LSNLPYYA    G+G    N T F+EW+   KAPA+  +LRLY  +
Sbjct  104   DGNDVWIFDVDETLLSNLPYYAVN--GYGSEEFNETTFDEWLNLAKAPALPASLRLYEEL  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG + + ++   E  R+A   NL  AG+ +W  LILR A+D  +  + YKSEKR +L 
Sbjct  162   LGLGFQIILLTGRVEAERNATEKNLSFAGYHSWTRLILREASDIGKTAVAYKSEKRAQLE  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             A+G+RI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  222   AQGHRIHGNSGDQWSDLLGSPMATRSFKLPNPMYYI  257



>ref|XP_010110867.1| Acid phosphatase 1 [Morus notabilis]
 gb|EXC28686.1| Acid phosphatase 1 [Morus notabilis]
Length=259

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 139/217 (64%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE N+   W  +P+ CE Y+ +Y+ G +YR D   VA  ++ +  ++++  
Sbjct  45    LYCDSWRFSVETNDAGFWPTIPKRCENYVENYVTGDRYRSDSEFVAGDSLAFVRSLQMND  104

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD W+FDIDET LSNLPYY     GFG    + T F++W+   +APA+  +L LYN +
Sbjct  105   DGKDAWIFDIDETLLSNLPYYE--AHGFGAEVFDETPFDDWVDLAEAPALAASLSLYNEL  162

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R+A   NL  +G++ WE LILRG +D  +P + YKSEKR+ELV
Sbjct  163   EQLGFKIFLLTGRSEYQRNATEKNLLYSGYKNWERLILRGPSDQHKPAIVYKSEKRSELV  222

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GY I G+ GDQWSDL+G  V  R+FK+P+PMYY++
Sbjct  223   NEGYTIHGSSGDQWSDLMGFAVAQRSFKLPNPMYYIA  259



>ref|NP_001056747.1| Os06g0139800 [Oryza sativa Japonica Group]
 dbj|BAD68673.1| putative acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF18661.1| Os06g0139800 [Oryza sativa Japonica Group]
 gb|EAY99585.1| hypothetical protein OsI_21563 [Oryza sativa Indica Group]
 dbj|BAG86750.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 133/216 (62%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             + C SWRL  EANN+  W  +P  C  Y+  Y+ G  YR D   VA  A  YA    +  
Sbjct  79    VRCASWRLAGEANNLAPWKSLPEECAAYVREYLTGVAYRSDLEVVAREASAYARTARVGD  138

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+D WVFD+DET LSNLPYYA  + G+G+   +  +F++W+  G+APA+  +L+LYN V
Sbjct  139   DGRDAWVFDVDETLLSNLPYYA--DHGYGLELFDHREFDKWVERGEAPAIPSSLKLYNEV  196

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E      + NL+K GF  W+ LILR   D ++    YKSEKR E+ 
Sbjct  197   RDLGFKTFLLTGRSEGHHGVTVDNLKKQGFHDWDKLILRAPADRKKTATIYKSEKRKEME  256

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +   R+FK+P+PMYY+
Sbjct  257   EEGYRILGNSGDQWSDLLGFSTSARSFKLPNPMYYI  292



>ref|XP_008798586.1| PREDICTED: acid phosphatase 1-like [Phoenix dactylifera]
Length=255

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 137/216 (63%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRL  E NN   W  +P  C  ++  YM G ++  D   VAA ++ +A  V++V 
Sbjct  41    LYCDSWRLSEETNNAGYWKTIPARCLQFVAEYMNGDRFASDSAVVAAESLAFAQTVQVVG  100

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FD+DET LSNLPYYA    G+G    N T F+EW+   KAPA+  +LRLY  +
Sbjct  101   DGKDVWIFDVDETLLSNLPYYAVN--GYGSEDFNETTFDEWVNLAKAPALPASLRLYEEL  158

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG + V ++   E  R+    NL  AG+ +W  LILR  +D  +  + YKS +R EL 
Sbjct  159   LGLGFQVVLLTGRVEAQRNVTAENLSFAGYHSWNRLILREDSDIGKKAVRYKSGRRAELE  218

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             A+GYRI GN GDQWSDLLG  + +R+FK+P+PMYY+
Sbjct  219   AQGYRIHGNSGDQWSDLLGSPMAMRSFKLPNPMYYI  254



>ref|XP_010448471.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=270

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 136/216 (63%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L+C SWR   E NN+  W  +P  C  Y+  Y++ + Y  D   V+  A  YA++ E   
Sbjct  56    LHCTSWRFAAETNNLAPWKTIPVECADYVKDYLMDKGYVFDMERVSEEAEVYASSFESNG  115

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET LSNLPYY  +E G G+   N +KF++W+  G APA+  +L+LY  V
Sbjct  116   DGKDVWIFDIDETLLSNLPYY--LEHGCGLEVFNHSKFDKWVEKGIAPAIAPSLKLYQMV  173

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               +G K + ++  +E  R   + NLR AGF  W+ LILR  +D  +    +KSEKR E++
Sbjct  174   QDMGYKIILLTGRRENHRVVTVENLRNAGFHNWDKLILRSMDDDHKTATIFKSEKRDEMM  233

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  234   DEGYRIRGNSGDQWSDLLGYAMSERSFKLPNPMYYI  269



>gb|EAZ35770.1| hypothetical protein OsJ_20061 [Oryza sativa Japonica Group]
Length=293

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 133/216 (62%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             + C SWRL  EANN+  W  +P  C  Y+  Y+ G  YR D   VA  A  YA    +  
Sbjct  79    VRCASWRLAGEANNLAPWKSLPEECAAYVREYLTGVAYRSDLEVVAREASAYARTARVGD  138

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+D WVFD+DET LSNLPYYA  + G+G+   +  +F++W+  G+APA+  +L+LYN V
Sbjct  139   DGRDAWVFDVDETLLSNLPYYA--DHGYGLELFDHREFDKWVERGEAPAIPSSLKLYNEV  196

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E      + NL+K GF  W+ LILR   D ++    YKSEKR E+ 
Sbjct  197   RDLGFKTFLLTGRSEGHHGVTVDNLKKQGFHDWDKLILRAPADRKKTATIYKSEKRKEME  256

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG +   R+FK+P+PMYY+
Sbjct  257   EEGYRILGNSGDQWSDLLGFSTSARSFKLPNPMYYI  292



>ref|XP_002867419.1| acid phosphatase class B family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43678.1| acid phosphatase class B family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 134/214 (63%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN   W  +P +C   +  Y+ G Q+R D   +A  A+ +A +VE+  DG
Sbjct  41    CDSWRLAAETNNAGTWDVIPSICVDSVAEYLNGDQFRSDYDVIADYALAFAKSVEISGDG  100

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FDIDET L+N+ YY     G+G    +   F EW+  G APA   +LRLYN++  
Sbjct  101   KDVWIFDIDETLLTNIDYYK--AHGYGSEPYDNNSFSEWVEQGTAPAFDASLRLYNALKK  158

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
              G   + ++   E  RS+  +NLR AG+  WE L+LRG ND  +   +YKSE+R++L+  
Sbjct  159   FGFTIILLTGRDEDQRSSTETNLRDAGYSGWERLLLRGPNDQGKSATNYKSEQRSKLIQE  218

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             G++I GN GDQWSDLLG  V  R+FK+P+PMYY+
Sbjct  219   GFKIRGNSGDQWSDLLGFAVADRSFKVPNPMYYI  252



>ref|XP_006413336.1| hypothetical protein EUTSA_v10026026mg [Eutrema salsugineum]
 gb|ESQ54789.1| hypothetical protein EUTSA_v10026026mg [Eutrema salsugineum]
Length=258

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 134/216 (62%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             ++C SWR   E NN+  W  +P  C  Y+  Y++G+ Y  D   V+  A  YA+  E   
Sbjct  44    VHCTSWRFAAETNNLAPWKTIPPECADYVKDYLMGKGYVADLERVSEEAWVYASTFEFPG  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET LSNLPYY  +E G G+   N  +F++W+  G APA+  +L+LY  V
Sbjct  104   DGKDTWVFDIDETLLSNLPYY--LEHGCGLEVFNHVEFDKWVEKGVAPAIAPSLKLYQKV  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K + ++  +E+ +   + NL  AGF +W+ LILR  +   +    YKSE+R E+V
Sbjct  162   KDLGYKVILLTGRREKHKVVTVENLLNAGFHSWDELILRSLDGQNKTATIYKSEQRDEMV  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI GN GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  222   KEGYRIRGNSGDQWSDLLGSAMSERSFKLPNPMYYI  257



>gb|EMS60884.1| Acid phosphatase 1 [Triticum urartu]
Length=395

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 142/212 (67%), Gaps = 11/212 (5%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRLGVEA+N+RD  RVP  CEGY+GH MLG  Y  D   V   AI Y  +++L  +G
Sbjct  30    CDSWRLGVEAHNVRDRKRVPASCEGYVGHCMLGGHYHRDSKLVIDQAISYIDSIKLSGNG  89

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+V VFDIDET LSNLPYYA    GFG        F+E+ R   APA+ ET RLYN +L+
Sbjct  90    KEVLVFDIDETTLSNLPYYA--TQGFG--------FQEYARQASAPALPETKRLYNKLLS  139

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+K V ++  +E  R+A ++NLR+ GF  W  ++L+ A D +   + +KS +R +L+  
Sbjct  140   VGIKLVILTGRREVQRTATVTNLRRQGFSGWMTVLLKPA-DFKGSTVTFKSSERQKLLDA  198

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMY  1026
             GY IVGN+GDQWSD+LG   G RTFK+PDP+Y
Sbjct  199   GYIIVGNIGDQWSDILGTPEGARTFKLPDPIY  230


 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 117/189 (62%), Gaps = 24/189 (13%)
 Frame = +1

Query  466   YIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDGKDVWVFDIDETALSNLPYYARVEVG  645
             Y+GHYMLG  YR D   V   AI Y  +++L  +GK+VWVFD+DET LSNLPYYA    G
Sbjct  230   YVGHYMLGGHYRRDSKLVIDEAISYIDSLKLAGNGKEVWVFDVDETTLSNLPYYA--THG  287

Query  646   FGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLALGMKPVFISETKEQFRSARISNLRK  825
             FG    N T F+E+ R   APA+ ET RL++ +L++G+KPV ++  +E  R+A ++NLR+
Sbjct  288   FGATPYNWTSFQEYARQASAPALPETKRLFDKLLSVGIKPVILTGRREVQRTATVTNLRR  347

Query  826   AGFRAWEMLILRGANDTERPMMDYKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTF  1005
              GF  W                       T+L+  GY IVGN+GDQWSD+L    G RTF
Sbjct  348   QGFSGW----------------------MTKLLDAGYIIVGNIGDQWSDILSTPEGARTF  385

Query  1006  KMPDPMYYV  1032
             K+PDPMYY+
Sbjct  386   KLPDPMYYI  394



>ref|XP_004158153.1| PREDICTED: acid phosphatase 1-like [Cucumis sativus]
Length=264

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 4/217 (2%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VEANN+  W R+P  C  Y+  Y+ GR Y+ +    +  A  +A  V+LV 
Sbjct  52    LRCDSWRFNVEANNLNPWKRIPESCSEYVKQYVTGRAYQLELEIASNEAQVFAKTVKLVG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET LSNLPYY   + G+G       +F+ W+    AP +Q +L  Y  +
Sbjct  112   DGKDVWVFDIDETLLSNLPYYT--DHGYG--GLGPDEFDNWVEKATAPPLQPSLEFYKEL  167

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             L LG K V ++   E+ R     NL  AGF  W+ LILR  +D  +  + YKSEKR+E+ 
Sbjct  168   LDLGFKLVLLTGRSEKQRECTTRNLINAGFYDWDRLILRRDDDQGKSAILYKSEKRSEME  227

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               G RI+GN GDQWSDLLG +V +R+FK+P+PMYY+S
Sbjct  228   NEGLRIIGNSGDQWSDLLGTSVSVRSFKLPNPMYYIS  264



>ref|XP_010433112.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=259

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 132/216 (61%), Gaps = 2/216 (1%)
 Frame = +1

Query  388   NCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHD  567
             NC SWRL  E NN   W  VP  C   + +Y+ G Q+ +D   VA  AI YA  V+L  D
Sbjct  46    NCESWRLASETNNAGSWKVVPSRCVNSVKNYITGGQFENDYNIVARYAIAYAKRVKLGGD  105

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD WVFDIDET LSNL YY    +G+G    + TKF EW   GKAPA   +L+LY ++ 
Sbjct  106   GKDAWVFDIDETLLSNLEYYK--ALGYGSEPYDDTKFNEWAVQGKAPAFDASLKLYKALK  163

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
              LG   + ++   E  RS    NLR AG+  W  L+LRG ND  +    YKSE+R+++V 
Sbjct  164   RLGFTIILLTGRDESQRSVTAKNLRDAGYFGWNRLLLRGKNDQGKTATQYKSEQRSKVVK  223

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              GY+I G+ GDQWSDL G  V  R+FK+P+PMYY++
Sbjct  224   EGYKIHGSTGDQWSDLQGFAVAARSFKVPNPMYYIA  259



>gb|EMT02057.1| Stem 28 kDa glycoprotein [Aegilops tauschii]
Length=261

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 138/215 (64%), Gaps = 12/215 (6%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SW LGVEA+N+RDW  VP  CEG          +R D   V   A+ Y  +++L  +G
Sbjct  59    CDSWVLGVEAHNVRDWKTVPASCEG---------PFRRDSKVVVDQALAYVDSLKLTGNG  109

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             K+VWVFDIDET LSNLPYYA+   GFG    NAT F  ++R+G APA+ ET RLYN + +
Sbjct  110   KEVWVFDIDETTLSNLPYYAKH--GFGATPFNATSFNAYVREGSAPALPETKRLYNKLRS  167

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             +G+KPVF++   E  R+  ++NLR+ G   W  L+L+     +   + YKS +R +L   
Sbjct  168   VGIKPVFLTGRTEDQRAITVTNLRRQGISGWMNLLLKQPG-FKGSAVTYKSGERQKLQDA  226

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY IVGN+GDQWSD+LG   G RTFK+PDPMYY+ 
Sbjct  227   GYVIVGNIGDQWSDILGAPEGARTFKLPDPMYYIG  261



>gb|ADE76411.1| unknown [Picea sitchensis]
Length=254

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 136/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYML-GRQYRDDCTAVAASAIRYATAVELVHD  567
             C  WRL VE+ N+RDW  VP  C GY+  YM+   QY +D      + + Y   ++LV D
Sbjct  41    CEGWRLSVESGNLRDWDVVPSKCVGYVQKYMMTAGQYWEDSKVAVFTILEYVKTLKLVGD  100

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD WVFDIDET LSN+PYY + E  +G +  ++  FE W+ + K+PA+  +L LYN +L
Sbjct  101   GKDAWVFDIDETLLSNIPYYQQHE--YGGKAFDSKTFEAWVLEMKSPALPSSLLLYNRLL  158

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             A G K   ++   E  R+  + NL +AG++ W  LILRG N+       YK EKR ELV 
Sbjct  159   ARGFKIFLLTGRDESQRNGTVHNLFQAGYKGWAGLILRGVNEQGSQASAYKPEKRAELVK  218

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +GYR+ G+VGDQWSDL G     R+FK+P+PMYY+S
Sbjct  219   KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>ref|XP_003620757.1| Acid phosphatase-like protein [Medicago truncatula]
 gb|AES76975.1| plant acid phosphatase [Medicago truncatula]
Length=252

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 130/214 (61%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE NN+  W ++P  C   +  YM+G +Y  DC  V   +  +   V +  DG
Sbjct  40    CDSWRLAVETNNVGQWKQIPARCVESVAEYMIGEKYESDCEVVGKFSAEFVKGVTVGGDG  99

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             +D WVFDIDET LSN+PYY   +VGFG +  N T F +W+    APA+  +L  Y  +  
Sbjct  100   RDAWVFDIDETLLSNVPYYQ--DVGFGSKIFNETSFNDWVNLADAPALPASLSFYRKLQE  157

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG     ++   E  R+   +NL  AG+R WE LILRGA+D  +    YKSEKR EL++ 
Sbjct  158   LGFTIFLLTGRSEHQRNVTEANLLFAGYRNWERLILRGASDQGKSATSYKSEKRQELMSE  217

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GYRI G+ GDQWSDL G  V  R+FK+P+PMY++
Sbjct  218   GYRIHGSSGDQWSDLWGYAVSTRSFKLPNPMYFI  251



>emb|CDY47773.1| BnaC07g41870D [Brassica napus]
Length=261

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 134/214 (63%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN   W  +P +C   +  Y+ G QY  D   +A  A+ +A  V++  DG
Sbjct  49    CESWRLAAETNNAGTWDVIPSVCVDSVAGYLNGDQYGSDYGVIADYALAFAKTVQVSGDG  108

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FDIDET L+NL YY R   G+G     A  F EW+ +G APA + +LRLYN++  
Sbjct  109   KDVWIFDIDETLLTNLDYY-RAH-GYGSEPFEANSFNEWVVEGTAPAFEASLRLYNALKK  166

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   V ++   E  RS   +NLR AG+  WE L+LRG  D  +   +YKSE+R++L+  
Sbjct  167   LGFTIVLLTGRDEHQRSVTETNLRDAGYSGWERLLLRGPEDQGKSATNYKSEQRSKLIGE  226

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             G++I GN GDQWSDLLG  V  R+FK+P+PMYY+
Sbjct  227   GFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYI  260



>ref|XP_009127318.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
Length=261

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 138/217 (64%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVEL-V  561
             L+C SWR   E NN+  W+ +P  C  Y+  Y+LG+ Y  D   V+  A  +A+ V+   
Sbjct  46    LHCTSWRFAAETNNLAPWSTIPAECADYVKDYVLGKGYVADLERVSEEASVFASTVDFSA  105

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKD WVFDIDET LSNLPYY  ++ GFG+   + ++F++W+  G APA+  +L+LY  
Sbjct  106   GDGKDAWVFDIDETLLSNLPYY--IDHGFGLEVFDHSEFDKWVERGVAPAIAPSLKLYQR  163

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             V+ LG +   ++  KE  R   + NL  AGF+ W+ LILR  ++  +    YKSEKR E+
Sbjct  164   VIDLGYRVFLLTGRKESHRLVTVENLINAGFQNWDKLILRSPDEQHKMATLYKSEKRDEM  223

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  GYRI GN GDQWSDLLG ++  R+FK+ +PMYY+
Sbjct  224   VKEGYRIRGNSGDQWSDLLGSSMSQRSFKLANPMYYI  260



>ref|XP_002514195.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
 gb|EEF48149.1| Acid phosphatase 1 precursor, putative [Ricinus communis]
Length=251

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 132/217 (61%), Gaps = 4/217 (2%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRL VE NN   W  VP  CE Y+  YM   ++  D   VA+ ++ +A +V +  
Sbjct  37    LYCDSWRLSVETNNAGYWVNVPSRCESYVQQYMTSDRFLSDFEVVASDSLSFAKSVNITG  96

Query  565   DGKDVWVFDIDETALSNLPYYARVEV-GFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
             DGKD WVFDIDET LSNLPYY   EV GFG +  +   F++W+   +APA+Q +L LY  
Sbjct  97    DGKDAWVFDIDETLLSNLPYY---EVHGFGSQPFDENAFDQWVDLAEAPALQASLNLYKE  153

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             +  LG     ++   E  R A + +L  AG+  WE L LRG  D   P   YKS+KR EL
Sbjct  154   LKHLGFTIFLLTGRSENQRDATVKDLLFAGYSDWEGLFLRGVTDQGTPATVYKSQKRMEL  213

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             V  GYRI G+ GDQWSDL+G  V  R+FK+P+PMYY+
Sbjct  214   VNEGYRIHGSSGDQWSDLVGFAVAKRSFKLPNPMYYI  250



>gb|ABK95709.1| unknown [Populus trichocarpa]
Length=183

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 131/185 (71%), Gaps = 2/185 (1%)
 Frame = +1

Query  481   MLGRQYRDDCTAVAASAIRYATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRR  660
             MLG QYR+D   +   A  +A   +L  DGKD+WVFD+DET LSNLPYYA+   GFG   
Sbjct  1     MLGSQYREDSAVITDEAFAHAKTFKLAGDGKDIWVFDVDETTLSNLPYYAKH--GFGAEP  58

Query  661   CNATKFEEWIRDGKAPAMQETLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRA  840
              N+T F +W+  GKA A+ E+L+LY ++L++G+K VF++   E  R+   +NL+ AG+  
Sbjct  59    YNSTAFNQWVFTGKALALPESLKLYRNLLSIGIKVVFLTGRTEDQRAVTSNNLKNAGYHI  118

Query  841   WEMLILRGANDTERPMMDYKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDP  1020
             WE LIL+ ++ + +  + YKS +R +L  +GYRI+GN+GDQWSDLLG +VG RTFK+PDP
Sbjct  119   WEKLILKSSSYSGKTAVFYKSSERAKLEKKGYRIIGNIGDQWSDLLGTSVGNRTFKLPDP  178

Query  1021  MYYVS  1035
             MYY+S
Sbjct  179   MYYIS  183



>ref|NP_194655.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB79684.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAK93622.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14114.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AEE85608.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=255

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 135/214 (63%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN+  W  +P +C   +  Y+ G Q+  D + +   A+ +A +VE+  DG
Sbjct  43    CDSWRLAAETNNVGTWDLIPSICVDSVAEYLNGDQFLSDYSVIVDYALAFAKSVEISGDG  102

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FDIDET L+N+ YY     G+G    +  KF EW+  G APA   +LRLYN++  
Sbjct  103   KDVWIFDIDETLLTNIDYYK--AHGYGSEPYDDNKFSEWVEQGTAPAFDASLRLYNALKK  160

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   + ++   E  R++  +NLR AG+  WE L+LRG ND  +   +YKSE+R++L+  
Sbjct  161   LGFTIILLTGRDEHQRTSTETNLRDAGYSGWERLLLRGPNDQGKSATNYKSEQRSKLIEE  220

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             G++I GN GDQWSDL G  V  R+FK+P+PMYY+
Sbjct  221   GFKIRGNSGDQWSDLQGFAVADRSFKVPNPMYYI  254



>ref|XP_009137842.1| PREDICTED: acid phosphatase 1 [Brassica rapa]
 emb|CDY30222.1| BnaA03g49480D [Brassica napus]
Length=261

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 133/214 (62%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN   W  +P +C   +  Y+ G QY  D   +A  A+ +A  V++  DG
Sbjct  49    CESWRLAAETNNAGTWDVIPSVCVDSVAGYLNGDQYASDYGVIADYALAFAKTVQVSGDG  108

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FDIDET L+NL YY     G+G     +  F EW+ +G APA + +LRLYN++  
Sbjct  109   KDVWIFDIDETLLTNLDYYK--AHGYGSEPFESNSFNEWVVEGTAPAFEASLRLYNALKK  166

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   V ++   E  RS   +NLR AG+  WE L+LRG  D  +   +YKSE+R++L+  
Sbjct  167   LGFTIVLLTGRDEHQRSVTETNLRDAGYSGWERLLLRGPEDQGKSATNYKSEQRSKLIGE  226

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             G++I GN GDQWSDLLG  V  R+FK+P+PMYY+
Sbjct  227   GFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYI  260



>ref|XP_002309231.2| hypothetical protein POPTR_0006s15760g [Populus trichocarpa]
 gb|EEE92754.2| hypothetical protein POPTR_0006s15760g [Populus trichocarpa]
Length=247

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 129/214 (60%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C  WR  VE N++  W  VP  C  Y+  YM G  YR D    A+ A+ +A  VE+  DG
Sbjct  35    CNGWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVAASYALGFAKTVEIAGDG  94

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KD WVFD+DET LSNLPYYA    GFG    +   F+EW+   KAPA+Q +L LY  +  
Sbjct  95    KDAWVFDVDETLLSNLPYYAVH--GFGSEPFDELSFDEWVDLAKAPALQASLNLYKELKQ  152

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG     ++   E  R+A   NL+  G+  WE LILR ++D  +P   YKS++R ELV  
Sbjct  153   LGFTVFMLTGRSEHQRNATAKNLQLEGYSDWERLILRESSDQGKPATFYKSQRRLELVNE  212

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GYRI GN GDQWSDL G  V  R+FK+P+P+YY+
Sbjct  213   GYRIHGNSGDQWSDLFGFAVSERSFKLPNPLYYI  246



>gb|AGV54632.1| stem 28 kDa glycoprotein [Phaseolus vulgaris]
Length=255

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 137/216 (63%), Gaps = 5/216 (2%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             ++C S   GVEANN+  W  VP  C+ Y+  Y+LG QYR D   V   A  YA  ++   
Sbjct  43    VSCTSLGFGVEANNLSKWKTVPAACQEYVADYLLGDQYRSDSKTVCREAYFYAKTLKFT-  101

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
               +DV+VFDID+T LSNL Y+A    GFG+   NAT F+ W+  G+A A+ ETL LYN +
Sbjct  102   -ARDVFVFDIDDTTLSNLQYFANH--GFGVEAHNATAFKIWVSFGEAFALPETLVLYNKL  158

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMD-YKSEKRTEL  921
             + LG+K VFI+E     +   ISNL++ GF  WE  I R        + + +K+ +R +L
Sbjct  159   VGLGIKVVFITERPVDLKDVTISNLKEVGFHTWEKFIARDPAIYSGKLSNAFKTSERKKL  218

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
             VA GYRIVGN+GDQWSD++GE  G RTFK+P+P+YY
Sbjct  219   VAEGYRIVGNIGDQWSDIVGEKKGFRTFKLPNPLYY  254



>ref|XP_007215832.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
 gb|EMJ17031.1| hypothetical protein PRUPE_ppa010152mg [Prunus persica]
Length=228

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 123/185 (66%), Gaps = 2/185 (1%)
 Frame = +1

Query  376  IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE  555
            +P L+CLSWRL VE NNI +W  VP  CEGY+GHYMLG QYR D   V   A  YA ++ 
Sbjct  44   VPGLSCLSWRLAVETNNIINWKTVPAECEGYVGHYMLGHQYRKDSKVVTNGAWLYAKSLN  103

Query  556  LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
            L  DGK+VWVFDIDET LSNLPYYA    GFG    NAT F+EW+  G APA+ E+L+LY
Sbjct  104  LTKDGKNVWVFDIDETTLSNLPYYAV--NGFGTELYNATSFDEWVLKGTAPALPESLKLY  161

Query  736  NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
              +L LG+K VF++   E  R+   +NL+  G+  WE LIL+G+  T +    YKS +RT
Sbjct  162  QKLLTLGVKVVFLTGRGEDKRNVTTTNLKNVGYHTWEKLILKGSAYTGKTSYVYKSAERT  221

Query  916  ELVAR  930
            +LV +
Sbjct  222  KLVKK  226



>ref|NP_001151681.1| acid phosphatase 1 precursor [Zea mays]
 ref|XP_008658711.1| PREDICTED: acid phosphatase 1 isoform X1 [Zea mays]
 gb|ACG43863.1| acid phosphatase 1 precursor [Zea mays]
Length=295

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 133/216 (62%), Gaps = 4/216 (2%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH--  564
             C SWRL  EANN+  WA VP  C  ++  Y+ G  YR D   VA  +  YA A       
Sbjct  81    CASWRLAAEANNLAPWAAVPPECAPHVRDYVTGSAYRSDLDLVARESAAYARAAAPAGAA  140

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+D WVFD+DET LSNLPYYA  E G+G    +  KF+EW+  G+A A+  +L+LYN V
Sbjct  141   DGRDAWVFDVDETLLSNLPYYA--EHGYGAELFDHHKFDEWVERGEAAAIPSSLKLYNEV  198

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R   + NL K GF  WE LILR A D E+    YKSEKR E+ 
Sbjct  199   RGLGFKTFLLTGRSEAHRGVTVENLNKQGFHDWEKLILRAAGDREKTATVYKSEKRDEME  258

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  259   QEGYRILGNSGDQWSDLLGSSMSARSFKLPNPMYYI  294



>gb|AFW85941.1| acid phosphatase 1 [Zea mays]
Length=312

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 133/216 (62%), Gaps = 4/216 (2%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH--  564
             C SWRL  EANN+  WA VP  C  ++  Y+ G  YR D   VA  +  YA A       
Sbjct  98    CASWRLAAEANNLAPWAAVPPECAPHVRDYVTGSAYRSDLDLVARESAAYARAAAPAGAA  157

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+D WVFD+DET LSNLPYYA  E G+G    +  KF+EW+  G+A A+  +L+LYN V
Sbjct  158   DGRDAWVFDVDETLLSNLPYYA--EHGYGAELFDHHKFDEWVERGEAAAIPSSLKLYNEV  215

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R   + NL K GF  WE LILR A D E+    YKSEKR E+ 
Sbjct  216   RGLGFKTFLLTGRSEAHRGVTVENLNKQGFHDWEKLILRAAGDREKTATVYKSEKRDEME  275

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  276   QEGYRILGNSGDQWSDLLGSSMSARSFKLPNPMYYI  311



>ref|XP_010249468.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=266

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/217 (46%), Positives = 134/217 (62%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRL VE NN+  W ++P+ C  ++  Y+ G  Y  D   VA S++ +A  VEL  
Sbjct  52    LFCDSWRLSVETNNVGFWKKIPQRCASFMKEYISGDHYASDSDVVAQSSLAFAETVELSG  111

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD W+FDIDET LSN PYY   +  FG++  +   F  W+   +AP +  + RLY  +
Sbjct  112   DGKDAWIFDIDETLLSNFPYYELHD--FGLQEFDERTFNVWVDMAEAPPLPPSQRLYKQL  169

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG   + ++   E  R A   NL  AG+ +WE LILRG +D  +P + YKSEKR EL 
Sbjct  170   QQLGFTLILLTGRSEAQRDATEKNLLVAGYHSWEKLILRGPSDQGKPAIIYKSEKRMELE  229

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             A GYRI G+ GDQWSDLLG  +  R+FK+P+PMYY++
Sbjct  230   AEGYRIHGSSGDQWSDLLGFAMAKRSFKLPNPMYYIA  266



>gb|ABK21277.1| unknown [Picea sitchensis]
 gb|ABR17651.1| unknown [Picea sitchensis]
Length=254

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 137/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYM-LGRQYRDDCTAVAASAIRYATAVELVHD  567
             CL+WRL VE +N+++W+ VP  C GY+  YM    QY +D      + + YA  V+LV D
Sbjct  41    CLAWRLSVETSNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTILGYAKTVKLVGD  100

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD W+FDIDET LSNLPYY + E  +G    N+T FE W+ + KA  +  +L LYN +L
Sbjct  101   GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             A G K   ++   E  R+    NL +AG++ W+ LILRG N+       YK EKR ELV 
Sbjct  159   ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +GYR+ G+VGDQWSDL G     R+FK+P+PMYY+S
Sbjct  219   KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>ref|NP_001150931.1| acid phosphatase 1 precursor [Zea mays]
 gb|ACG40987.1| acid phosphatase 1 precursor [Zea mays]
Length=299

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 136/219 (62%), Gaps = 3/219 (1%)
 Frame = +1

Query  379   PYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAV-E  555
             P + C SWRL  EANN+  W  VP  C  ++  Y+ G  YR D   VA  +  YA A   
Sbjct  82    PDVRCASWRLAAEANNLAPWRAVPPECAPHVRDYVTGVAYRSDLDLVARESAAYARAAAP  141

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DG+D WVFD+DET LSNLPYYA  E G+G    +  KF+EW+  G+A A+  +L+LY
Sbjct  142   LGADGRDAWVFDVDETLLSNLPYYA--EHGYGAELFDHHKFDEWVERGEAAAIPSSLKLY  199

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
             N V  LG K   ++   E  R   + NL K GF  WE L+LR A D ++    YKSEKR 
Sbjct  200   NEVRELGFKTFLLTGRSEGHRGVTVDNLNKQGFHDWEKLVLRAAGDRKKTATVYKSEKRK  259

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             E+   GYRI+GN GDQWSDLLG ++G R+FK+P+PMYY+
Sbjct  260   EMEQEGYRILGNSGDQWSDLLGSSMGARSFKLPNPMYYI  298



>gb|ACN40876.1| unknown [Picea sitchensis]
Length=254

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 137/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYM-LGRQYRDDCTAVAASAIRYATAVELVHD  567
             CL+WRL VE +N+++W+ VP  C GY+  YM    QY +D      + + YA  V+LV D
Sbjct  41    CLAWRLSVETSNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTNLGYAKTVKLVGD  100

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD W+FDIDET LSNLPYY + E  +G    N+T FE W+ + KA  +  +L LYN +L
Sbjct  101   GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             A G K   ++   E  R+    NL +AG++ W+ LILRG N+       YK EKR ELV 
Sbjct  159   ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +GYR+ G+VGDQWSDL G     R+FK+P+PMYY+S
Sbjct  219   KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>gb|AFK34288.1| unknown [Medicago truncatula]
Length=252

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 130/214 (61%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE N++  W ++P  C   +  YM+G +Y  DC  V   +  +   V +  DG
Sbjct  40    CDSWRLAVETNSVGQWKQIPARCVESVAEYMIGEKYESDCEVVGKFSAEFVKGVTVGGDG  99

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             +D WVFDIDET LSN+PYY   +VGFG +  N T F +W+    APA+  +L  Y  +  
Sbjct  100   RDAWVFDIDETLLSNVPYYQ--DVGFGSKIFNETSFNDWVNLADAPALPASLSFYRKLQE  157

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG     ++   E  R+   +NL  AG+R WE LILRGA+D  +    YKSEKR EL++ 
Sbjct  158   LGFTIFLLTGRSEHQRNVTEANLLFAGYRNWERLILRGASDQGKSATSYKSEKRQELMSE  217

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GYRI G+ GDQWSDL G  V  R+FK+P+PMY++
Sbjct  218   GYRIHGSSGDQWSDLWGYAVSTRSFKLPNPMYFI  251



>ref|XP_002436441.1| hypothetical protein SORBIDRAFT_10g002690 [Sorghum bicolor]
 gb|EER87808.1| hypothetical protein SORBIDRAFT_10g002690 [Sorghum bicolor]
Length=303

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 134/217 (62%), Gaps = 3/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYA-TAVELV  561
             + C SW L  EANN+  W  VP  C  ++  Y+ G  YR D   VA  +  YA  A+ L 
Sbjct  88    VRCASWWLAAEANNLAPWKAVPPECVPHVRDYVTGAAYRSDLELVARESAAYARAALPLG  147

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DG+D WVFD+DET LSNLPYYA  + G+G    +  +F+EW+  G+A A+  +L+LYN 
Sbjct  148   DDGRDAWVFDVDETLLSNLPYYA--DHGYGAELFDHHRFDEWVERGEAAAIPSSLKLYNE  205

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             V  LG K   ++   E  R   + NL K GF  WE LILR A D ++    YKSEKR E+
Sbjct  206   VRELGFKTFLLTGRSEGHRGVTVENLNKQGFHDWEKLILRAAGDRKKTATVYKSEKRKEM  265

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
                GYRI+GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  266   EEEGYRILGNSGDQWSDLLGSSMSARSFKLPNPMYYI  302



>gb|ABK21327.1| unknown [Picea sitchensis]
 gb|ABR18337.1| unknown [Picea sitchensis]
Length=254

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 136/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYM-LGRQYRDDCTAVAASAIRYATAVELVHD  567
             CL+WRL VE  N+++W+ VP  C GY+  YM    QY +D      + + YA  V+LV D
Sbjct  41    CLAWRLSVETGNLKNWSVVPSKCVGYVEKYMRTPGQYWEDSKVAVLTILGYAKTVKLVGD  100

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD W+FDIDET LSNLPYY + E  +G    N+T FE W+ + KA  +  +L LYN +L
Sbjct  101   GKDAWIFDIDETLLSNLPYYQQHE--YGGEAYNSTTFEAWVSETKALVLPSSLLLYNVLL  158

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             A G K   ++   E  R+    NL +AG++ W+ LILRG N+       YK EKR ELV 
Sbjct  159   ARGFKIFLLTGRDEYQRNITTHNLFRAGYKGWDGLILRGVNEQGSAAGVYKPEKRGELVK  218

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +GYR+ G+VGDQWSDL G     R+FK+P+PMYY+S
Sbjct  219   KGYRLWGSVGDQWSDLSGPYEASRSFKLPNPMYYIS  254



>gb|AFW75455.1| hypothetical protein ZEAMMB73_076415 [Zea mays]
Length=299

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 136/219 (62%), Gaps = 3/219 (1%)
 Frame = +1

Query  379   PYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVE-  555
             P + C SWRL  EANN+  W  VP  C  ++  Y+ G  YR D   VA  +  YA A   
Sbjct  82    PDVRCASWRLAAEANNLAPWRAVPPECAPHVRDYVTGVAYRSDLDLVARESAAYARAAAP  141

Query  556   LVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLY  735
             L  DG+D WVFD+DET LSNLPYYA  E G+G    +  KF+EW+  G+A A+  +L+LY
Sbjct  142   LGADGRDAWVFDVDETLLSNLPYYA--EHGYGAELFDHHKFDEWVERGEAAAIPSSLKLY  199

Query  736   NSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRT  915
             N V  LG K   ++   E  R   + NL K GF  WE L+LR A D ++    YKSEKR 
Sbjct  200   NEVRELGFKTFLLTGRSEGHRGVTVDNLNKQGFHDWEKLVLRAAGDRKKTATVYKSEKRK  259

Query  916   ELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             E+   GYRI+GN GDQWSDLLG ++G R+FK+P+PMYY+
Sbjct  260   EMEQEGYRILGNSGDQWSDLLGSSMGARSFKLPNPMYYI  298



>gb|ABK92831.1| unknown [Populus trichocarpa]
Length=247

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 129/214 (60%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C  WR  VE N++  W  VP  C  Y+  YM G  YR D    A+ A+ +A  VE+  DG
Sbjct  35    CNGWRFSVETNDVGYWDHVPSRCVSYVQDYMTGDGYRSDSEVAASYALGFAKTVEIAGDG  94

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KD WVFD+DET LSNLPYYA    GFG    +   F+EW+   +APA+Q +L LY  +  
Sbjct  95    KDAWVFDVDETLLSNLPYYAVH--GFGSEPFDELSFDEWVDLAEAPALQASLNLYKELKQ  152

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG     ++   E  R+A   NL+  G+  WE LILR ++D  +P   YKS++R ELV  
Sbjct  153   LGFTVFMLTGRSEHQRNATAKNLQLEGYSDWERLILRESSDQGKPATFYKSQRRLELVNE  212

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GYRI GN GDQWSDL G  V  R+FK+P+P+YY+
Sbjct  213   GYRIHGNSGDQWSDLFGFAVSERSFKLPNPLYYI  246



>ref|NP_194656.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
 emb|CAB79685.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAM61010.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AAO44078.1| At4g29270 [Arabidopsis thaliana]
 dbj|BAE99747.1| acid phosphatase-like protein [Arabidopsis thaliana]
 gb|AEE85609.1| HAD superfamily, subfamily IIIB acid phosphatase [Arabidopsis 
thaliana]
Length=256

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 131/215 (61%), Gaps = 2/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN+  W  +P  CE YI +Y+ G Q+  D   VA+ AI YA  V++  DG
Sbjct  44    CESWRLAAETNNVGPWKVIPSQCENYIKNYINGGQFDKDYDVVASYAIDYAKTVKVGGDG  103

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KD WVFDIDET LSN+ YY     G+G    ++ K+ E +  GK P    +LRLY ++  
Sbjct  104   KDAWVFDIDETLLSNIEYYK--ANGYGSEPYDSIKYNEVVEKGKDPGYDASLRLYKALKK  161

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   + ++   E  RS    NLR AG+  W  L+LRG ND  +    YKSE+R+++V  
Sbjct  162   LGFTIILLTGRDEGHRSVTEKNLRDAGYFGWNRLLLRGQNDQGKTATQYKSEQRSQVVKE  221

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             GY I GN GDQWSDLLG  V  R+FK+P+PMYYV+
Sbjct  222   GYTIHGNTGDQWSDLLGFAVASRSFKVPNPMYYVA  256



>ref|XP_011091248.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=257

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 137/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCT-AVAASAIRYATAVELVHD  567
             C SWR+ VE +NIRD+  VP  C GYIG YM   QY+ D    +    +  +T   L  D
Sbjct  44    CESWRMNVELHNIRDFDVVPEECVGYIGKYMTSTQYKVDSERTIDECTVYLSTNCGLKKD  103

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             G D W+FDID+T LS +PYY +   GFG ++ N+T  EEW++  KAPA++ +LRL+N + 
Sbjct  104   GTDAWIFDIDDTLLSTVPYYKKN--GFGGKKLNSTCLEEWMQQAKAPALEHSLRLFNQLK  161

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
              LG++ + +S  +E  RSA I NL   G+  W  LILRG +D  + +  YK++ R +L++
Sbjct  162   GLGVQIILVSSRRECLRSATIDNLVDVGYHGWTSLILRGPDDENKDIQKYKADVRKQLIS  221

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              GYRI G +GDQWS + G     RTFK+P+P+YYV+
Sbjct  222   SGYRIWGILGDQWSSVEGLPTAKRTFKLPNPLYYVA  257



>ref|XP_007012979.1| HAD superfamily isoform 2 [Theobroma cacao]
 gb|EOY30598.1| HAD superfamily isoform 2 [Theobroma cacao]
Length=258

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SW L VE NN   W ++P  CE ++  YM G +Y  D   VA  ++ YA++VE+  
Sbjct  44    LYCASWHLSVETNNAGSWKQIPIRCESFVQDYMTGPRYMSDSEIVANYSLAYASSVEIGR  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET L+NLPYY     GFG    +   ++ W+   +APA+  +L+LYN +
Sbjct  104   DGKDAWVFDIDETLLTNLPYYQ--AHGFGSEPFDENSWDVWVDLAEAPAIPASLKLYNEL  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               +G K   ++   E  R+A   NL  AG+  WE LILRG +D       YKSEKR++LV
Sbjct  162   KQMGFKIFVLTGRSENQRNATGKNLLFAGYTDWERLILRGPSDDGTLATVYKSEKRSDLV  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI G+ GDQWSDLLG  V  R+FK+P+PMYY+S
Sbjct  222   NEGYRIHGSSGDQWSDLLGFAVAKRSFKLPNPMYYIS  258



>ref|XP_010541530.1| PREDICTED: vegetative storage protein 2-like [Tarenaya hassleriana]
Length=262

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 137/219 (63%), Gaps = 4/219 (2%)
 Frame = +1

Query  376   IPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYM-LGRQYRDDCTAVAASAIRYATAV  552
             I Y NC SW LGVE NNI ++  VP  CE Y+  Y+    QYR D   +   A  YA  +
Sbjct  45    ISYPNCRSWHLGVETNNIINFKTVPANCEEYVEDYLTFSDQYRADSKTICKEAYYYAKGL  104

Query  553   ELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRL  732
              L +D  +VW+FD+DET LSN+P+Y     GFG    ++  F +WI  G+AP + ETL L
Sbjct  105   ALKNDTVNVWIFDLDETLLSNIPFYQAN--GFGTESVDSEAFNKWISLGEAPVLGETLHL  162

Query  733   YNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKR  912
             YN++   G+KPV I+E  E+ R   +SNL KAG+  WE  I +      + +++YKS++R
Sbjct  163   YNNLQKKGIKPVLITERYEELREITLSNLEKAGYTFWEKAIFKPTGSNAK-IVNYKSKER  221

Query  913   TELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
              +L   GY I+GN+GDQWSDL  E+ G RTFK+P+P+YY
Sbjct  222   KKLERGGYTIIGNIGDQWSDLQKESAGRRTFKLPNPLYY  260



>ref|XP_002283385.2| PREDICTED: acid phosphatase 1-like [Vitis vinifera]
Length=307

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 133/216 (62%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE N+   W  VP  C  ++  YM G +YR D    A  ++ +A  V++  
Sbjct  93    LFCDSWRFTVETNDAGVWVSVPDRCVQWVKDYMTGDRYRSDSEFAADDSLSFAKTVQIAG  152

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVWVFDIDET LSNLPYYA    GFG    + + F+EW+   +APA+Q +LRLY  V
Sbjct  153   DGKDVWVFDIDETLLSNLPYYA--AHGFGSEAFDDSTFDEWVNLAEAPALQASLRLYREV  210

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K V I+   E  R+    NL  AG+  WE L LRG  D+ +  + YKSEKR EL 
Sbjct  211   EQLGFKIVLITGRIEPQRNVTEKNLVYAGYSNWERLFLRGRADSGKTALVYKSEKRRELE  270

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI G+ GDQWSDLLG  +  R+FK+P+PMYY+
Sbjct  271   DEGYRIHGSSGDQWSDLLGFAIARRSFKLPNPMYYI  306



>ref|XP_003529064.1| PREDICTED: acid phosphatase 1-like [Glycine max]
Length=253

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 132/214 (62%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SW L VE NN   W RVP  C  ++  Y+ G +YR DC  +   +  +A +V L  DG
Sbjct  41    CDSWMLAVETNNAGTWNRVPASCVDFVAEYITGDRYRRDCDVIRNLSAAFAKSVGLAGDG  100

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             +D WVFD+DET LSN+PYY  V  GFG    N T F+ W+    APA+   L LYN +  
Sbjct  101   RDAWVFDVDETLLSNVPYYQGV--GFGSEIFNETSFDNWVDLAAAPALPAILSLYNELKE  158

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG K  F++   E  R+A  +NL  +G+R WE LILRG++D  +P   YKSEKR EL   
Sbjct  159   LGFKIFFLTGRSEFQRNATETNLLLSGYRDWERLILRGSSDQGKPATTYKSEKRAELENE  218

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GYRI GN GDQWSDL G  V  R+FK+P+PMYY+
Sbjct  219   GYRIHGNSGDQWSDLWGYAVSARSFKLPNPMYYI  252



>gb|KFK29483.1| hypothetical protein AALP_AA7G140100 [Arabis alpina]
Length=257

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 133/214 (62%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN+  W  +P +C   +  Y+ G QY  D   +A  A+ +A  V++  DG
Sbjct  45    CESWRLAAETNNVGTWDVIPSICVDSVSEYLNGDQYGSDYGVIADYALAFAKTVQISGDG  104

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FDIDET L+N+ YY     G+G    ++  + EW+  G APA   +LRLYN++  
Sbjct  105   KDVWIFDIDETLLTNIDYYK--AHGYGSIPYDSNSYNEWVVQGTAPAFDASLRLYNALKK  162

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   V ++   E  RS    NLR AG+  WE L+LRG  D  +   +YKSE+R++L+  
Sbjct  163   LGFTIVLLTGRDEDQRSVTEKNLRDAGYLDWERLLLRGREDQGKSATNYKSEQRSKLIVE  222

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             G++I GN GDQWSDLLG  V +R+FK+P+PMYY+
Sbjct  223   GFKIHGNTGDQWSDLLGFAVAVRSFKVPNPMYYI  256



>ref|XP_006284398.1| hypothetical protein CARUB_v10005568mg [Capsella rubella]
 gb|EOA17296.1| hypothetical protein CARUB_v10005568mg [Capsella rubella]
Length=253

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 132/214 (62%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN   W  +P +C   +  Y+ G Q+  D   +A  A+ +A +V++  DG
Sbjct  41    CDSWRLAAETNNAGTWDVIPSVCVDPVADYLNGDQFLSDYNVIADYALSFAKSVDISGDG  100

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVWVFDIDET L+N+ YY     G+G    ++  F EW+  G APA   +L+LYN++  
Sbjct  101   KDVWVFDIDETLLTNIDYYK--AHGYGSEPYDSNSFSEWVLQGTAPAFDASLKLYNALQK  158

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   + ++   E  RS   +NLR AG+  WE L+LRG  D  +   DYKSE+R +L+  
Sbjct  159   LGFTIILLTGRDEDQRSFTETNLRDAGYSGWERLLLRGPEDQGKSATDYKSEQRAKLIEE  218

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             G++I GN GDQWSDLLG  V  R+FK+P+PMYY+
Sbjct  219   GFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYI  252



>ref|XP_007226669.1| hypothetical protein PRUPE_ppa021353mg, partial [Prunus persica]
 gb|EMJ27868.1| hypothetical protein PRUPE_ppa021353mg, partial [Prunus persica]
Length=238

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 136/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRY-ATAVELVHD  567
             C SWR+ VE +NIR++  VP  C GYIG Y+   QY+ D       AI Y +T+  L  D
Sbjct  25    CESWRMNVELHNIREFQVVPEECVGYIGKYVTSTQYKVDSERAIEEAIVYLSTSCNLEKD  84

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD W+FDID+T LS +PYY +    FG  + N T  EEW+  GKAPA++ +L+L+N + 
Sbjct  85    GKDAWIFDIDDTLLSTVPYYKKQH--FGGEKLNLTSLEEWMSQGKAPALENSLKLFNEMK  142

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             A G++ + +S  +E  RSA I NL   G+  W  LILRG +D    + +YK+E R +L+ 
Sbjct  143   ARGLQIILVSSRREHLRSATIDNLVDVGYYGWTSLILRGPDDELMGVQNYKTEVRKQLIG  202

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              GYRI G VGDQ+S + G     RTFK+P+P+YYVS
Sbjct  203   EGYRIWGIVGDQYSSIEGLPRAKRTFKLPNPLYYVS  238



>ref|XP_010438317.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=257

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 131/215 (61%), Gaps = 2/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN   W  +P +C   +  Y+ G Q+  D   +A  AI +A  VE+  DG
Sbjct  45    CDSWRLAAETNNAGTWDVIPSVCVDSVADYLNGEQFLSDYNVIADYAIAFAKTVEIPGDG  104

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FDIDET L+N+ YY     G+G     +  F EW+  G APA   +LRLYN++  
Sbjct  105   KDVWIFDIDETLLTNIDYYK--AHGYGSEPFESNTFNEWVVQGTAPAFDASLRLYNALKK  162

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   + ++   E  RS   +NLR AG+  WE L+LRG  D      +YKSE+R++L+  
Sbjct  163   LGFTIILLTGRDEDQRSFTETNLRDAGYSGWERLLLRGPKDQGTSATNYKSEQRSKLIEE  222

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             G++I GN GDQWSDLLG  V  R+FK+P+PMYY++
Sbjct  223   GFKIRGNTGDQWSDLLGFAVADRSFKVPNPMYYIA  257



>ref|XP_010688366.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=257

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 137/222 (62%), Gaps = 2/222 (1%)
 Frame = +1

Query  370   RHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATA  549
             R    L C SWR  VE N+   W  VP  C  ++ +YM+G +Y  D   VA +++ +A +
Sbjct  38    RQDDQLFCESWRFSVETNDAGLWYSVPSRCHNFVKNYMIGDRYLSDSNVVAGNSLEFAKS  97

Query  550   VELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLR  729
             V++  DGKD WVFD+DET L NLPYY   +  FG    N   F++++   ++P +  +L 
Sbjct  98    VKVSGDGKDAWVFDVDETLLFNLPYYEAHD--FGSEVFNEDSFDQYMLLAESPVLPASLS  155

Query  730   LYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEK  909
             LY  +  LG     ++   E FR+A  +NL+ AG+  WE LILRG +D  +  ++YKSEK
Sbjct  156   LYKELQRLGFTIFILTGRSEPFRNATEANLQSAGYSNWERLILRGPSDKSKKAVEYKSEK  215

Query  910   RTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             R EL   GYRI GN GDQWSDLLG  +G R+FK+P+PMYY++
Sbjct  216   RKELEDAGYRIRGNSGDQWSDLLGYAIGQRSFKLPNPMYYIA  257



>emb|CDO99288.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 136/214 (64%), Gaps = 3/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRY-ATAVELVHD  567
             C +WR+ VE +NIRD+  VP  C  Y+G YM   QY+ D       +I Y +T+  L  D
Sbjct  42    CEAWRMNVELHNIRDFDVVPDECVSYMGKYMTSTQYKVDSVRTIHESIVYLSTSCNLKKD  101

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             G D W+FDID+T LS +PYY +   GFG ++ N T  EEW+  GKAPA+Q +LRL+N + 
Sbjct  102   GTDAWIFDIDDTLLSTVPYYKKN--GFGGKKLNLTSLEEWMSKGKAPALQHSLRLFNELK  159

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             + G++ + +S   E  RSA + NL   GF  W  L+LRGA+D  + +  +KS+ R +L++
Sbjct  160   SRGVRIILVSSRMEHLRSATVDNLVNEGFFGWNSLLLRGADDACKDIQGFKSDARKQLIS  219

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYY  1029
             +GYRI G +GDQWS + G     RTFK+P+P+YY
Sbjct  220   KGYRIWGILGDQWSSIEGLPSANRTFKLPNPLYY  253



>ref|XP_006412859.1| hypothetical protein EUTSA_v10026000mg [Eutrema salsugineum]
 gb|ESQ54312.1| hypothetical protein EUTSA_v10026000mg [Eutrema salsugineum]
Length=263

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 132/214 (62%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN   W  +P +C   +  Y+ G QY  D   +A  A+ +A  V++  DG
Sbjct  51    CESWRLAAETNNAGTWDVIPSMCIDSVSEYVNGDQYGSDYGVIADYALAFAKTVQISGDG  110

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
              DVW+FDIDET L+N+ YY R   G+G     ++ F EW   G APA   +LRLYN++  
Sbjct  111   NDVWIFDIDETLLTNIDYY-RAH-GYGSEPFESSSFNEWAVQGTAPAFDASLRLYNALKK  168

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   + ++   E  RS   +NLR AG+  WE L+LRG  D  +   +YKSE+R++L+ +
Sbjct  169   LGFTIILLTGRDEDQRSVTETNLRDAGYSGWERLLLRGPGDQGKSATNYKSEQRSKLIEK  228

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             G+RI GN GDQWSDLLG  V  R+FK+P+PMYY+
Sbjct  229   GFRIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  262



>ref|XP_004964488.1| PREDICTED: acid phosphatase 1-like isoform X1 [Setaria italica]
Length=369

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 132/216 (61%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             + C SWRL  EANN+  W  VP  C  ++  Y+ G  YR D   +A  +  YA A  L  
Sbjct  155   VRCASWRLAAEANNLAPWKAVPAGCAAHVRDYIAGAAYRSDLDLIARESTTYARAAPLRG  214

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DG+D WVFDIDET LSNLPYYA  E G+G+   +  KF+ W+  G+A A+  +L+LYN V
Sbjct  215   DGRDAWVFDIDETLLSNLPYYA--EHGYGLELFDHQKFDRWVERGEALAIPSSLKLYNEV  272

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E        NL+K GF  W+ LILR A D ++    YKSEKR  + 
Sbjct  273   RELGFKTFLLTGRSEGHLDITAENLKKQGFHDWDKLILREACDRKKTATVYKSEKRKAME  332

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               GYRI+GN GDQWSDLLG ++  R+FK+P+PMYY+
Sbjct  333   EEGYRILGNSGDQWSDLLGWSMSARSFKLPNPMYYI  368



>ref|XP_010438316.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=259

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 129/216 (60%), Gaps = 2/216 (1%)
 Frame = +1

Query  388   NCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHD  567
             NC SWRL  E NN   W  VP  C   + +Y+ G Q+ +D   VA   I YA  V+L  D
Sbjct  46    NCESWRLASETNNAGSWKVVPSRCVNSVKNYITGGQFDNDYNIVARYVIAYAKRVKLGGD  105

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD WVFDIDET LSNL YY     G+G    + TKF EW   GKAPA   +L+LY ++ 
Sbjct  106   GKDAWVFDIDETLLSNLEYYK--AHGYGSEPYDDTKFNEWAVQGKAPAFDASLKLYKALK  163

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
              LG   + ++   E  RS    NLR AG+  W   +LRG ND  +    YKSE+R+++V 
Sbjct  164   RLGFTIILLTGRDESQRSITAKNLRDAGYFGWNRFLLRGKNDQGKTATQYKSEQRSKVVK  223

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              GY+I G+ GDQWSDL G  V  R+FK+P+PMYY++
Sbjct  224   EGYKIHGSTGDQWSDLQGFAVAARSFKVPNPMYYIA  259



>ref|XP_008224179.1| PREDICTED: acid phosphatase 1-like [Prunus mume]
Length=287

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 137/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCT-AVAASAIRYATAVELVHD  567
             C SWR+ VE +NIR++  VP  C GYIG Y+   QY+ D   A+  + +  +T+  L  D
Sbjct  74    CESWRMNVELHNIREFQVVPEECVGYIGKYVTSTQYKVDSERAIEEAIVHLSTSCNLEKD  133

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD W+FDID+T LS +PYY +    FG  + N T  EEW+  GKAPA++ +L+L+N + 
Sbjct  134   GKDAWIFDIDDTLLSTVPYYKKQH--FGGEKLNLTSLEEWMSQGKAPALENSLKLFNEMK  191

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
             A G++ + +S  +E  RSA I NL   G+  W  LILRG +D    + +YK+E R +L+ 
Sbjct  192   ARGLQIILVSSRREHLRSATIDNLVNVGYYGWTSLILRGPDDELMGVQNYKTEVRKQLIG  251

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              GYRI G VGDQ+S + G     RTFK+P+P+YYVS
Sbjct  252   EGYRIWGIVGDQYSSIEGLPRAKRTFKLPNPLYYVS  287



>ref|XP_007012978.1| HAD superfamily isoform 1 [Theobroma cacao]
 gb|EOY30597.1| HAD superfamily isoform 1 [Theobroma cacao]
Length=323

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SW L VE NN   W ++P  CE ++  YM G +Y  D   VA  ++ YA++VE+  
Sbjct  109   LYCASWHLSVETNNAGSWKQIPIRCESFVQDYMTGPRYMSDSEIVANYSLAYASSVEIGR  168

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET L+NLPYY     GFG    +   ++ W+   +APA+  +L+LYN +
Sbjct  169   DGKDAWVFDIDETLLTNLPYYQ--AHGFGSEPFDENSWDVWVDLAEAPAIPASLKLYNEL  226

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               +G K   ++   E  R+A   NL  AG+  WE LILRG +D       YKSEKR++LV
Sbjct  227   KQMGFKIFVLTGRSENQRNATGKNLLFAGYTDWERLILRGPSDDGTLATVYKSEKRSDLV  286

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI G+ GDQWSDLLG  V  R+FK+P+PMYY+S
Sbjct  287   NEGYRIHGSSGDQWSDLLGFAVAKRSFKLPNPMYYIS  323



>ref|XP_006284235.1| hypothetical protein CARUB_v10005397mg, partial [Capsella rubella]
 gb|EOA17133.1| hypothetical protein CARUB_v10005397mg, partial [Capsella rubella]
Length=290

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 131/216 (61%), Gaps = 2/216 (1%)
 Frame = +1

Query  388   NCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHD  567
             NC SWRL  E NN   W  VP  C   + +Y+ G Q+ +D   VA  AI YA  + L  D
Sbjct  77    NCESWRLASETNNAGSWNVVPSRCVNSVKNYINGGQFENDYNIVARYAIAYAKRINLGRD  136

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD WVFDIDET LSNL YY +V  G+G    +  KF EW   GKA +   +LRLY ++ 
Sbjct  137   GKDAWVFDIDETLLSNLDYY-KVH-GYGSEPYDNAKFNEWAVQGKASSFDGSLRLYKALK  194

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
              LG   + ++   E  RS    NLR AG+  W  LILRG ND  +  + YKSE+R+++V 
Sbjct  195   KLGFTIILLTGRDENQRSITEKNLRNAGYFGWNRLILRGKNDQGKTAIQYKSEQRSKVVK  254

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
              GY+I GN GDQWSDL G  V  R+FK+P+PMYY++
Sbjct  255   EGYKIHGNTGDQWSDLQGFAVATRSFKVPNPMYYIA  290



>ref|XP_007202474.1| hypothetical protein PRUPE_ppa010268mg [Prunus persica]
 gb|EMJ03673.1| hypothetical protein PRUPE_ppa010268mg [Prunus persica]
Length=256

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 130/217 (60%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE N+   W  +P  C  ++  YM G +Y  D  AVA  ++ +A  V++  
Sbjct  42    LYCDSWRFSVETNDAGTWTSIPSRCVAFVQDYMTGDRYLSDSAAVANYSLSFARGVQIGG  101

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET LSN PYY     GFG    +   F+EW+   KAPA+  +L+LY  +
Sbjct  102   DGKDAWVFDIDETLLSNFPYYQ--AHGFGSETFDEASFDEWVDLAKAPALPASLKLYKEL  159

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R+A   NL  A +  WE L+LRG +D       YKSEKR++L+
Sbjct  160   QELGFKIFLLTGRSEHQRNATAKNLLYARYNNWERLLLRGPSDQGTTATVYKSEKRSDLI  219

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI G+ GDQWSDLLG  V  R+FK+P+PMYY++
Sbjct  220   NEGYRIHGSSGDQWSDLLGFAVAQRSFKLPNPMYYIA  256



>ref|XP_002867418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43677.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 128/214 (60%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN   W  VP  CE Y+ +Y+   Q+  D   VA+ AI YA  V+L  DG
Sbjct  44    CESWRLAAETNNAGTWKVVPSQCENYVKNYISEGQFDKDYDLVASYAIAYAKTVKLGRDG  103

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KD WVFDIDET LSN+ YY     G+G +  + T F EW+  G AP    +LRLY ++  
Sbjct  104   KDAWVFDIDETLLSNIEYYK--AHGYGSQPYDNTLFNEWVVKGTAPGFDASLRLYKALKK  161

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   + ++   E  RS    NLR AG+  W  L+LRG ND  +    YKSE+R+++V  
Sbjct  162   LGFTIILLTGRDESQRSITEKNLRDAGYFGWNRLLLRGKNDQGKAATLYKSEQRSKVVKE  221

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GY I GN GDQWSDL G  V  R+FK+P+PMYY+
Sbjct  222   GYTIHGNTGDQWSDLQGFAVAARSFKVPNPMYYI  255



>ref|XP_008242463.1| PREDICTED: acid phosphatase 1 [Prunus mume]
Length=256

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 131/217 (60%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  +E N+   W  +P  C  ++  YM G +Y  D  AV+  ++ +A  V++  
Sbjct  42    LYCDSWRFSIETNDAGTWTSIPSRCVAFVQDYMTGDRYLSDSAAVSNYSLSFARGVQIGG  101

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET LSNLPYY     GFG    +   F+EW+   KAPA+  +L+LY  +
Sbjct  102   DGKDAWVFDIDETLLSNLPYYE--AHGFGSETFDEASFDEWVDLAKAPALPASLKLYKEL  159

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R+A   NL  A +  WE L+LRG +D       YKSEKR++L+
Sbjct  160   QQLGFKIFLLTGRSEHQRNATAKNLLYARYNNWERLLLRGPSDQGTTATVYKSEKRSDLI  219

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI G+ GDQWSDLLG  V  R+FK+P+PMYY++
Sbjct  220   NEGYRIHGSSGDQWSDLLGFAVAQRSFKLPNPMYYIA  256



>ref|XP_010688365.1| PREDICTED: acid phosphatase 1-like [Beta vulgaris subsp. vulgaris]
Length=245

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 136/219 (62%), Gaps = 7/219 (3%)
 Frame = +1

Query  382   YLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV  561
             +L C SWRL VE NN  +W+ +P  C  Y+  YM   ++  D   VAA+++++A +V + 
Sbjct  33    FLFCESWRLSVETNNAGNWSNIPDHCLEYVKEYMTSNRFVSDSKIVAANSLKFARSVNIS  92

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
              DGKD WVFDI ET ++ LPYY  +  GFG    ++  F EW R  KAPA+Q +L LY  
Sbjct  93    GDGKDAWVFDIAETLVTFLPYY--ITHGFG----SSKDFREWTRRNKAPALQASLSLYKE  146

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             +  LG   V ++   E  R   I  L+ AG+  WE LILRGA+D  +  +D+KS KR EL
Sbjct  147   LQQLGFSIVLLTGASEPDRKQTIEFLQYAGYSNWERLILRGASDEGKSALDFKSGKRKEL  206

Query  922   VARGYRIVGNVGDQWSDLLGE-NVGLRTFKMPDPMYYVS  1035
                GYRI GN GDQWSDLLG  ++  R+FK+P+PM+Y +
Sbjct  207   EDEGYRIHGNSGDQWSDLLGHYSIATRSFKLPNPMFYTA  245



>ref|XP_009388590.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=256

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 133/217 (61%), Gaps = 2/217 (1%)
 Frame = +1

Query  382   YLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELV  561
             +L C SWRL VE NN R W  VP  C  ++  YM G +Y  D   V   ++ +A +V++ 
Sbjct  41    HLYCDSWRLSVETNNARFWRTVPFRCSEFVQEYMSGARYASDTDIVVDESLAFARSVQIA  100

Query  562   HDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNS  741
             +DG D W+FD+DET LSN+PYYA    GFG +  N T F EW+   +APA+  +LRLY  
Sbjct  101   NDGNDAWIFDVDETLLSNVPYYAIN--GFGTKVFNETSFNEWVDKARAPALAASLRLYEE  158

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             +L  G + + ++   E  R   + NL  AG+ +W  LI R  +D  +P + +KS +R EL
Sbjct  159   LLVSGFQIILLTGRNEAQRKVTVENLLHAGYHSWRSLIFREDSDMGKPAVVFKSGRRAEL  218

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
               +G+RI+ + GDQWSDLLG  +  R+FK P+PMYY+
Sbjct  219   EGQGFRILASSGDQWSDLLGFPMAQRSFKHPNPMYYI  255



>ref|XP_009773908.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=256

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 131/216 (61%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRY-ATAVELVHD  567
             C SWR+ VE +NIRD+  VP+ C  YI  YM   QY+ D        I Y +T   L  D
Sbjct  43    CESWRMNVELHNIRDYVVVPQECVSYIAKYMTSTQYKVDSDRTIDECILYISTNCILEKD  102

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD W+FDID+T LS +PYY   + GFG  + N T  E+WI  GK  A+  +++L+N + 
Sbjct  103   GKDAWIFDIDDTLLSTVPYYK--QNGFGGNKLNVTSLEDWISQGKGTALDHSMKLFNHLK  160

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
              LG+K   +S  KE  RS  I NL   GF  W  LILRG  D  +    +K+E R++L++
Sbjct  161   ELGVKIFLVSSRKEHLRSPTIDNLVHVGFYGWTSLILRGQEDECKSAQGFKAEVRSKLIS  220

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +GYRI+G VGDQWS + G     RTFK+P+P+YYV+
Sbjct  221   KGYRILGIVGDQWSSIEGLPSAKRTFKLPNPLYYVA  256



>ref|XP_006354440.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=256

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 135/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRY-ATAVELVHD  567
             C SWR+ VE +NIRD+  VP+ C  YIG YM   QY+ D        I Y +T   L +D
Sbjct  43    CESWRMNVELHNIRDYVVVPQECVAYIGKYMTSTQYKVDSERTINECILYLSTNCILEND  102

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD W+FDID+T LS++PYY +   GFG  + N T  E+W+  GK  A++ +L+L+N + 
Sbjct  103   GKDAWIFDIDDTLLSSVPYYKKN--GFGGNKLNVTSLEDWMSQGKGTALEHSLKLFNHLK  160

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
              LG++   +S  +E  RSA + NL K  F  W  LILR   D  +    +K+E R++L++
Sbjct  161   GLGVQIFLVSSRREHLRSATVDNLVKVDFYGWNSLILRDQEDECKNAQSFKAEIRSKLIS  220

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +GYRIVG +GDQWS + G     R+FK+P+PMYYV+
Sbjct  221   QGYRIVGIIGDQWSSIEGLPSAKRSFKLPNPMYYVA  256



>ref|XP_009795729.1| PREDICTED: acid phosphatase 1-like [Nicotiana sylvestris]
Length=267

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 136/227 (60%), Gaps = 7/227 (3%)
 Frame = +1

Query  370   RHIPYLN-----CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAI  534
             R IP  N     C SWR  VE N+   WA +P  C  ++  YM G +Y  DC AVA  ++
Sbjct  43    RKIPKDNNNALYCESWRFTVETNDAGLWALIPERCASFVQDYMNGDRYSSDCGAVADLSL  102

Query  535   RYATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAM  714
              +A  V++ +DGKD WVFDIDET LSNLPYY  V  GFG    +   F++W+ + +APA+
Sbjct  103   AFANTVKVSNDGKDAWVFDIDETLLSNLPYY--VTHGFGSEIFDEIAFDKWVNEAEAPAI  160

Query  715   QETLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMD  894
               +L+LY  +   G K   ++   E  R+    NL  AG+  WE LILRG +D  +    
Sbjct  161   PASLKLYKELQQRGFKIFLLTGRSEFQRNYTEKNLVYAGYSNWERLILRGPSDKGKLATQ  220

Query  895   YKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             YKSEKR EL   GYRI G+ GDQWSDL G  V  R+FK+P+PMYY++
Sbjct  221   YKSEKRKELEDEGYRIHGSSGDQWSDLNGFAVATRSFKLPNPMYYIA  267



>ref|XP_008367917.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=259

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 134/217 (62%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE N+   W+ +P  C G++ +YM G +Y  D  AVA  ++ +A  V +  
Sbjct  45    LFCDSWRFSVETNDAGTWSNIPSRCVGFVQNYMTGARYPSDSAAVANFSLSFAKGVTIGG  104

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET LSNLPYY     GFG    +   F+EW+   +APA+  +L LY+ +
Sbjct  105   DGKDAWVFDIDETLLSNLPYYQ--AHGFGSETFDEASFDEWVELAEAPALPASLNLYSQL  162

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R+A   NL  AG+  WE L+LRG +D       +KS+KR++L+
Sbjct  163   ERLGFKIFLLTGRSEYQRNATAKNLLFAGYNNWERLLLRGPSDQGTLATVFKSQKRSDLI  222

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI G+ GDQWSDL+G  +  R+FK+P+PMYY++
Sbjct  223   NEGYRIHGSSGDQWSDLVGFAIAQRSFKLPNPMYYIA  259



>ref|XP_009109048.1| PREDICTED: acid phosphatase 1-like isoform X2 [Brassica rapa]
Length=262

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 131/214 (61%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE NN   W  +P  C   +  Y+ G QY  D   +   A+ +A  V++  DG
Sbjct  50    CESWRLAVETNNAGTWGVLPSSCVDSVARYLNGDQYGSDYDVIVDYALAFAKTVKISGDG  109

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FDIDET L+N+ YY     G+G    ++  F EW+  G APA   +LR+YN++  
Sbjct  110   KDVWIFDIDETLLTNIGYYK--NHGYGSEPFDSKSFNEWVVQGTAPAFAASLRMYNALKK  167

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   V ++   E  R+    NLR  G+  WE LILRG +D  +   +YKSE+R++L+ +
Sbjct  168   LGFTIVLLTGRDEDQRNVTEKNLRDVGYSGWERLILRGPDDQGKSATNYKSEQRSKLIDQ  227

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             G++I GN GDQWSDLLG  V  R+FK+P+PMYY+
Sbjct  228   GFKIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  261



>emb|CDP03233.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 138/225 (61%), Gaps = 5/225 (2%)
 Frame = +1

Query  370   RHIP---YLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRY  540
             R IP    L C SWR  VEAN++  WAR+P  C  ++  Y+   +YR D  AVA +++ +
Sbjct  45    RKIPRDDNLYCDSWRFVVEANDVGPWARIPSRCVAFVQDYVTNDRYRADSEAVADASLEF  104

Query  541   ATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQE  720
             A  V++  DGKD WVFDIDET LSN+PYYA    GFG    +   F+EW+   +APA+  
Sbjct  105   AKTVKVSGDGKDAWVFDIDETLLSNVPYYAVH--GFGSETFDENSFDEWVDLAEAPALPA  162

Query  721   TLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYK  900
             +LRL   +  LG K   ++   E  RSA   NL  AG+  WE LILRG +D  +P   YK
Sbjct  163   SLRLCKELEQLGFKIFLLTGRTEFQRSATSKNLDYAGYSDWERLILRGPSDDGKPATVYK  222

Query  901   SEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             SE+R EL   GY I G+ GDQWSDL G  V  R+FK+P+P+YY++
Sbjct  223   SERRKELEDEGYVIHGSSGDQWSDLNGFAVAERSFKLPNPLYYIA  267



>ref|XP_010447874.1| PREDICTED: acid phosphatase 1-like [Camelina sativa]
Length=256

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 2/215 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL  E NN   W  +P +C   +  Y+ G Q+  D   +A  AI +A  VE+  DG
Sbjct  44    CDSWRLAAETNNAGTWDVIPSVCVDSVADYLNGEQFLSDYNVIADYAIAFAKTVEISGDG  103

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FDIDET L+N+ YY      +G    +   F EW+  G APA   +LRLYN++  
Sbjct  104   KDVWIFDIDETLLTNIDYYKAHS--YGSEPFDVNSFNEWVVQGTAPAFDASLRLYNALKK  161

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG   + ++   E  RS   SNLR AG+  WE L+LRG  D      +YKSE+R++LV  
Sbjct  162   LGFTIILLTGRDEDQRSFTESNLRDAGYSGWERLLLRGPKDQGTSATNYKSEQRSKLVEE  221

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             G+++ GN GDQWSDL G  V  R+FK+P+PMYY++
Sbjct  222   GFKVRGNTGDQWSDLQGFAVADRSFKVPNPMYYIA  256



>ref|XP_010914845.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
 ref|XP_010914851.1| PREDICTED: acid phosphatase 1-like [Elaeis guineensis]
Length=255

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 133/214 (62%), Gaps = 2/214 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE NN  +W +VP  C   +  Y+ G QY  D   VA  +  YA  V+L  DG
Sbjct  43    CESWRLAVETNNAGEWKKVPSRCVDVVADYIKGPQYLTDSKMVARLSHAYAKTVQLAGDG  102

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVLA  750
             KDVW+FD+DET +SN  +Y     G+  R CN T +++W+  GKA A+  +L LY  + +
Sbjct  103   KDVWIFDVDETLISNFLHYTLH--GYESRMCNETAYDQWVYTGKATALPWSLWLYRKLQS  160

Query  751   LGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVAR  930
             LG + V ++  KE  R++   NL   G+R+W+ LILR + D  +  M YKSEKR EL A 
Sbjct  161   LGFQLVLLTGRKEHHRNSTEQNLMAVGYRSWKKLILRESLDATKTAMTYKSEKRAELEAE  220

Query  931   GYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             GY I G+ GDQWSDLLG  +  R+FK+P+PMY++
Sbjct  221   GYTIHGSSGDQWSDLLGPPMAKRSFKLPNPMYHI  254



>ref|XP_008387412.1| PREDICTED: acid phosphatase 1-like [Malus domestica]
Length=257

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 131/217 (60%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  +E N+   W+ +P  C  ++  YM G +YR D  +VA  ++ +A  V    
Sbjct  43    LYCDSWRFSIETNDAGTWSNIPSRCXRFVQDYMTGDRYRSDLASVANYSLSFAKGVTXGG  102

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET LSNL YY     GFG    N   F+EW+   +APA+  +L LY  +
Sbjct  103   DGKDAWVFDIDETLLSNLAYYQ--AHGFGSETFNEAFFDEWVDLAEAPALPASLNLYKEL  160

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R+A   NL  AG+  WE L+LRG +D   P   YKS+KR++L+
Sbjct  161   EXLGFKMFLLTGRSEHQRNATARNLLYAGYNNWERLLLRGPSDQGTPATVYKSQKRSDLI  220

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI G+ GDQWSDL+G  +  R+FK+P+PMYY++
Sbjct  221   NEGYRIHGSSGDQWSDLIGFAIAQRSFKLPNPMYYIA  257



>ref|XP_009352576.1| PREDICTED: acid phosphatase 1 [Pyrus x bretschneideri]
Length=258

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 133/217 (61%), Gaps = 2/217 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWR  VE N+   W+ +P  C G++ +YM G +Y  D  AVA  ++ +A  V +  
Sbjct  44    LFCDSWRFSVETNDAGTWSNIPSRCVGFVQNYMTGDRYLSDSAAVANFSLSFAKGVTIGG  103

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKD WVFDIDET LSNLPYY     GFG    +   F+EW+   +APA+  +L LY+ +
Sbjct  104   DGKDAWVFDIDETLLSNLPYYQ--AHGFGSETFDEASFDEWVELAEAPALPASLNLYSQL  161

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
               LG K   ++   E  R+A   NL  AG+  WE L+LRG +D       +KS+KR+ L+
Sbjct  162   ERLGFKIFLLTGRSEYQRNATAKNLLVAGYNNWERLLLRGPSDQGTLATVFKSQKRSNLI  221

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               GYRI G+ GDQWSDL+G  +  R+FK+P+PMYY++
Sbjct  222   NEGYRIHGSSGDQWSDLVGFAIAQRSFKLPNPMYYIA  258



>ref|XP_009109046.1| PREDICTED: acid phosphatase 1-like isoform X1 [Brassica rapa]
Length=265

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 133/217 (61%), Gaps = 5/217 (2%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE NN   W  +P  C   +  Y+ G QY  D   +   A+ +A  V++  DG
Sbjct  50    CESWRLAVETNNAGTWGVLPSSCVDSVARYLNGDQYGSDYDVIVDYALAFAKTVKISGDG  109

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRC---NATKFEEWIRDGKAPAMQETLRLYNS  741
             KDVW+FDIDET L+N+ YY     G+G+ R    ++  F EW+  G APA   +LR+YN+
Sbjct  110   KDVWIFDIDETLLTNIGYYK--NHGYGVSRSEPFDSKSFNEWVVQGTAPAFAASLRMYNA  167

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             +  LG   V ++   E  R+    NLR  G+  WE LILRG +D  +   +YKSE+R++L
Sbjct  168   LKKLGFTIVLLTGRDEDQRNVTEKNLRDVGYSGWERLILRGPDDQGKSATNYKSEQRSKL  227

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             + +G++I GN GDQWSDLLG  V  R+FK+P+PMYY+
Sbjct  228   IDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  264



>ref|XP_011078233.1| PREDICTED: acid phosphatase 1-like [Sesamum indicum]
Length=265

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 137/223 (61%), Gaps = 2/223 (1%)
 Frame = +1

Query  367   SRHIPYLNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYAT  546
             SR    L C SWR  VE N+   W R+PR C  ++  Y+ G +YR +  AVA +A+ +A 
Sbjct  45    SRRSLDLYCESWRFTVETNDAGIWTRIPRRCVDFVKDYITGERYRSESEAVADNALEHAK  104

Query  547   AVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETL  726
             AV +  +GKD WVFDIDET LSN+PYYA    GFG    +   F+ W+   +APA+  +L
Sbjct  105   AVGVSGNGKDAWVFDIDETLLSNVPYYA--AHGFGSEIFDEPSFDNWVNVAEAPALLASL  162

Query  727   RLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSE  906
             RLY ++   G     ++   E  R+A + NL+ AG+  WE LILRG  D  +P   YKSE
Sbjct  163   RLYKNLQECGFTIFLLTGRSEFQRNATVRNLQYAGYSNWERLILRGDADQGKPASIYKSE  222

Query  907   KRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             KR E+   GY I GN GDQWSDL+G  V  R+FK+P+P+YY++
Sbjct  223   KRKEIEDDGYIIRGNSGDQWSDLMGFAVAQRSFKLPNPLYYIA  265



>ref|XP_010258707.1| PREDICTED: acid phosphatase 1-like [Nelumbo nucifera]
Length=294

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +1

Query  520   AASAIRYATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDG  699
                AI YA  ++L  DGKDVW+FDIDET LSNLPYYAR   GFG+   N+T F EW+  G
Sbjct  125   GGEAILYAENLKLTRDGKDVWIFDIDETILSNLPYYARH--GFGVEPFNSTLFNEWVNTG  182

Query  700   KAPAMQETLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTE  879
             +AP + E+LRLY  +L+LG+K VF++   E  R A  +NL+KAGF  WE LIL+ +++  
Sbjct  183   EAPPLPESLRLYRKLLSLGLKIVFLTGRSEDQRKATSTNLKKAGFHTWEKLILKKSSNQG  242

Query  880   RPMMDYKSEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
                + YKS +R  L   GYRIVGN+GDQWSD+LG N G RTFK+PDPMYY+S
Sbjct  243   TTAVVYKSGERKTLEESGYRIVGNIGDQWSDILGNNTGNRTFKLPDPMYYLS  294



>ref|XP_009415369.1| PREDICTED: acid phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=264

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = +1

Query  385   LNCLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVH  564
             L C SWRL VE N+   W  +P+ C  ++  Y+ G +Y  D   +++ ++ +A  V +  
Sbjct  50    LFCDSWRLSVETNDAGYWRTIPQKCLKFVEDYVNGDRYASDFDVISSESLSFAETVPIAG  109

Query  565   DGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSV  744
             DGKDVW+FDIDET LSN+PYYA    G+G    N T F+EW+   +APA+  +LRLY  +
Sbjct  110   DGKDVWIFDIDETLLSNVPYYAIN--GYGSEVFNETSFDEWVDLARAPALPASLRLYEEL  167

Query  745   LALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELV  924
             + LG + V ++   E  R++  +NL  AG+ +W  LILR  +D  +P + YKSE+R  L 
Sbjct  168   IGLGFQMVLLTGRSENQRNSTENNLLYAGYHSWITLILRQTSDLGKPALVYKSERRAALE  227

Query  925   ARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             A+G+RI G+ GDQWSDLLG  +  R+FK+P+PMYYV
Sbjct  228   AQGFRIHGSSGDQWSDLLGLPLAKRSFKLPNPMYYV  263



>emb|CDY14217.1| BnaA08g13480D [Brassica napus]
Length=265

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 134/217 (62%), Gaps = 5/217 (2%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             C SWRL VE NN   W  +P  C   +  Y+ G QY  D   +   A+ +A  V++  DG
Sbjct  50    CESWRLAVETNNAGTWDVLPSSCVDSVARYLNGDQYGSDYDVIVDYALAFAKTVKIYGDG  109

Query  571   KDVWVFDIDETALSNLPYYARVEVGFGIRRC---NATKFEEWIRDGKAPAMQETLRLYNS  741
             KDVW+FDIDET L+N+ YY     G+G+ R    ++  F EW+  G APA   +LR+YN+
Sbjct  110   KDVWIFDIDETLLTNIGYYK--NHGYGVSRSEPFDSKSFNEWVVQGTAPAFAASLRMYNA  167

Query  742   VLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTEL  921
             +  LG   V ++   E  R+   +NLR  G+  WE LILRG +D  +   +YKSE+R++L
Sbjct  168   LKKLGFTIVLLTGRDEDQRNVTETNLRDVGYSGWERLILRGPDDQGKSATNYKSEQRSKL  227

Query  922   VARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYV  1032
             + +G++I GN GDQWSDLLG  V  R+FK+P+PMYY+
Sbjct  228   IDQGFKIHGNTGDQWSDLLGFAVADRSFKVPNPMYYI  264



>ref|XP_004247765.1| PREDICTED: acid phosphatase 1-like [Solanum lycopersicum]
Length=256

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 135/216 (63%), Gaps = 3/216 (1%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRY-ATAVELVHD  567
             C SWR+ VE +NIRD+  VP+ C  YIG YM   QY+ D        I Y +T   L +D
Sbjct  43    CESWRMNVELHNIRDYVVVPQECVAYIGKYMTSTQYKVDFERTINECILYISTNCILEND  102

Query  568   GKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             GKD W+FDID+T LS++PYY +   GFG  + N T  E+W+  GK  A++ +L+L+N + 
Sbjct  103   GKDAWIFDIDDTLLSSVPYYKKN--GFGGNKLNVTSLEDWMSQGKGTALEHSLKLFNHLK  160

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
              LG++   +S  +E  RSA + NL K  F  W  LILR   D  +    +K+E R++L++
Sbjct  161   ELGVQIFLVSSRREHLRSATVDNLVKVDFYGWNSLILRDQEDECKNAQTFKAEIRSKLIS  220

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             +GYRIVG +GDQWS + G     R+FK+P+PMYYV+
Sbjct  221   QGYRIVGIIGDQWSSINGLPSAKRSFKLPNPMYYVA  256



>ref|XP_010098162.1| Stem 28 kDa glycoprotein [Morus notabilis]
 gb|EXB74599.1| Stem 28 kDa glycoprotein [Morus notabilis]
Length=261

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 135/216 (63%), Gaps = 7/216 (3%)
 Frame = +1

Query  391   CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRYATAVELVHDG  570
             CLSWR G+E NN+ DWA  P  CEGYI  YMLG QY  D   V   A  YA  + L +DG
Sbjct  52    CLSWRFGIETNNLVDWAMYPEECEGYIWRYMLGCQYEKDSKVVTEEAYEYAKNLNLPYDG  111

Query  571   K-DVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQETLRLYNSVL  747
             K  VWVFDIDETAL+NL ++   + GF  +  N     E     ++PA+  TL LY  + 
Sbjct  112   KIHVWVFDIDETALTNLNHFIP-KHGFRAKPSNNEHALE-----ESPALPATLELYKKLG  165

Query  748   ALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYKSEKRTELVA  927
              LG+K VF+S   E  R+   +NLR  G+  WE +ILR  ++     +++KS +R +L  
Sbjct  166   TLGIKVVFLSLRTEDLRTDTENNLRNVGYETWEKVILRPDSNYAGTSLEFKSGQRKKLEE  225

Query  928   RGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
               YRIVGN+GDQWSDLLG N GLRTFK+P+P+Y+V+
Sbjct  226   SKYRIVGNIGDQWSDLLGTNSGLRTFKLPNPIYHVN  261



>ref|XP_006359744.1| PREDICTED: acid phosphatase 1-like [Solanum tuberosum]
Length=268

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 134/225 (60%), Gaps = 5/225 (2%)
 Frame = +1

Query  370   RHIPYLN---CLSWRLGVEANNIRDWARVPRLCEGYIGHYMLGRQYRDDCTAVAASAIRY  540
             R IP  N   C SWR  VE NN   W+ +P  C  ++  Y  G +Y  D  AVA  ++ +
Sbjct  46    RKIPKDNALYCDSWRFTVETNNAGLWSIIPERCISFVQEYTTGDRYSSDSAAVADLSLAF  105

Query  541   ATAVELVHDGKDVWVFDIDETALSNLPYYARVEVGFGIRRCNATKFEEWIRDGKAPAMQE  720
             A  V++ +DG D WVFDIDET LSNLPYY  VE GFG +  +   F++W+ +  APA+  
Sbjct  106   ANTVKVSNDGMDAWVFDIDETLLSNLPYY--VEHGFGSQIFDENAFDKWVNEANAPAIPA  163

Query  721   TLRLYNSVLALGMKPVFISETKEQFRSARISNLRKAGFRAWEMLILRGANDTERPMMDYK  900
             +L+LY  +   G     ++   E  R+    N+  AG+  WE LILRG +D  +    YK
Sbjct  164   SLKLYKELQQRGFTIFLLTGRSEYQRNNTEKNMVHAGYSNWERLILRGPSDKGKLATQYK  223

Query  901   SEKRTELVARGYRIVGNVGDQWSDLLGENVGLRTFKMPDPMYYVS  1035
             SEKR EL   GYRI GN GDQWSDL+G  V  R+FK+P+PMYY++
Sbjct  224   SEKRKELEDEGYRIRGNSGDQWSDLMGFAVAQRSFKLPNPMYYIA  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2838300354351