BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6671_g1_i1 len=929 path=[907:0-516 1424:517-928]

Length=929
                                                                      Score     E

emb|CDP18641.1|  unnamed protein product                                328   1e-107   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    329   1e-107   
ref|XP_006362426.1|  PREDICTED: vignain-like                            327   8e-107   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    326   1e-106   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    325   3e-106   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    325   4e-106   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             325   6e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006360707.1|  PREDICTED: vignain-like                            324   9e-106   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    323   3e-105   
ref|XP_006360708.1|  PREDICTED: vignain-like                            323   3e-105   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                322   5e-105   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        320   2e-104   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    320   3e-104   
ref|XP_002523447.1|  cysteine protease, putative                        320   4e-104   Ricinus communis
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    320   5e-104   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    319   1e-103   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             319   1e-103   
gb|AAR92154.1|  putative cysteine protease 1                            318   3e-103   Iris x hollandica [Dutch iris]
ref|XP_004975182.1|  PREDICTED: vignain-like                            317   5e-103   
ref|XP_004975183.1|  PREDICTED: vignain-like                            317   5e-103   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    316   9e-103   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        316   1e-102   
ref|XP_006362428.1|  PREDICTED: vignain-like                            316   1e-102   
emb|CDP18644.1|  unnamed protein product                                315   2e-102   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             314   3e-102   
ref|XP_002523448.1|  cysteine protease, putative                        315   3e-102   Ricinus communis
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        315   5e-102   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                315   6e-102   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                313   6e-102   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             313   8e-102   
dbj|BAF56428.1|  cysteine proteinase                                    314   8e-102   Lotus japonicus
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             313   2e-101   
ref|XP_007048796.1|  Senescence-associated gene 12                      313   2e-101   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        313   2e-101   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    312   5e-101   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          312   5e-101   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                311   6e-101   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    311   6e-101   
emb|CDP18645.1|  unnamed protein product                                311   1e-100   
ref|XP_008228922.1|  PREDICTED: vignain-like                            310   1e-100   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             311   1e-100   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        311   2e-100   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        310   2e-100   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        310   3e-100   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    310   3e-100   Vitis vinifera
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    310   3e-100   Vitis vinifera
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        310   3e-100   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             308   3e-100   Populus trichocarpa [western balsam poplar]
emb|CAN70559.1|  hypothetical protein VITISV_032465                     310   4e-100   Vitis vinifera
dbj|BAF56430.1|  cysteine proteinase                                    310   4e-100   Lotus japonicus
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        310   4e-100   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    310   5e-100   
ref|XP_009359967.1|  PREDICTED: vignain-like                            309   6e-100   
ref|XP_007025398.1|  Senescence-associated gene 12                      309   6e-100   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             309   7e-100   Populus trichocarpa [western balsam poplar]
ref|XP_009361500.1|  PREDICTED: vignain-like                            309   8e-100   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        309   9e-100   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                308   1e-99    
gb|AAL14199.1|  cysteine proteinase precursor                           308   1e-99    Ipomoea batatas [batate]
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             308   1e-99    
ref|XP_003605890.1|  Cysteine proteinase                                308   1e-99    
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    308   2e-99    Vitis vinifera
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        308   2e-99    
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        308   2e-99    
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        308   2e-99    
ref|XP_006469012.1|  PREDICTED: vignain-like                            308   2e-99    
dbj|BAF46311.1|  cysteine proteinase precursor                          307   3e-99    Ipomoea nil [qian niu]
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        307   3e-99    
ref|XP_009797968.1|  PREDICTED: vignain-like                            307   3e-99    
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             307   3e-99    
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             307   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             307   4e-99    
ref|XP_007048674.1|  Senescence-associated gene 12                      307   4e-99    
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             307   4e-99    
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    320   4e-99    
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        307   5e-99    
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        306   5e-99    
gb|AAT34987.1|  putative cysteine protease                              307   5e-99    Gossypium hirsutum [American cotton]
dbj|BAD29959.1|  cysteine protease                                      307   5e-99    Daucus carota [carrots]
ref|XP_006469011.1|  PREDICTED: vignain-like                            306   6e-99    
gb|ADV41672.1|  cysteine protease                                       307   6e-99    
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             306   6e-99    
emb|CDP05747.1|  unnamed protein product                                306   7e-99    
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    306   7e-99    
gb|KHN27806.1|  Vignain                                                 305   7e-99    
ref|XP_008246197.1|  PREDICTED: vignain-like                            304   8e-99    
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        306   8e-99    
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         306   9e-99    
ref|XP_007048792.1|  Senescence-associated gene 12                      306   1e-98    
ref|XP_003612210.1|  Cysteine proteinase                                306   1e-98    
emb|CAL64936.1|  putative cysteine protease 8                           306   1e-98    Trifolium pratense [peavine clover]
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    306   1e-98    
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             306   1e-98    
ref|XP_002522559.1|  cysteine protease, putative                        306   1e-98    Ricinus communis
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        305   2e-98    
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        305   2e-98    
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    305   2e-98    
gb|KHN13721.1|  Vignain                                                 305   2e-98    
ref|XP_003540013.1|  PREDICTED: vignain-like                            305   2e-98    
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        305   2e-98    
ref|XP_004308524.1|  PREDICTED: vignain-like                            305   2e-98    
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             305   3e-98    
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        305   3e-98    
gb|AAK27968.1|AF242372_1  cysteine protease                             305   3e-98    Ipomoea batatas [batate]
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    305   3e-98    
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    305   3e-98    Vitis vinifera
ref|XP_008340724.1|  PREDICTED: vignain-like                            305   4e-98    
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    305   4e-98    
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         304   4e-98    
emb|CAH66275.1|  OSIGBa0147O06.5                                        304   5e-98    Oryza sativa [red rice]
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        304   5e-98    
ref|XP_003557016.1|  PREDICTED: vignain-like                            304   5e-98    
emb|CAN64655.1|  hypothetical protein VITISV_005140                     304   5e-98    Vitis vinifera
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             304   6e-98    
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        304   8e-98    
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        304   1e-97    
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g             303   1e-97    
gb|AAW78661.2|  senescence-specific cysteine protease                   303   1e-97    Nicotiana tabacum [American tobacco]
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    303   1e-97    
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        303   1e-97    
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    303   2e-97    
ref|XP_004290089.1|  PREDICTED: vignain-like                            303   2e-97    
ref|XP_006467666.1|  PREDICTED: vignain-like                            303   2e-97    
ref|XP_004306597.1|  PREDICTED: vignain-like                            303   2e-97    
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    303   2e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_004306851.1|  PREDICTED: vignain-like                            302   2e-97    
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     302   3e-97    
ref|XP_002525124.1|  cysteine protease, putative                        302   3e-97    Ricinus communis
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             302   3e-97    
ref|XP_004306836.1|  PREDICTED: vignain-like                            302   3e-97    
ref|XP_004506025.1|  PREDICTED: vignain-like                            302   3e-97    
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410          302   3e-97    Sorghum bicolor [broomcorn]
gb|AAP32196.1|  cysteine protease 8                                     302   3e-97    Trifolium repens [creeping white clover]
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             302   4e-97    
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    302   4e-97    
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    302   4e-97    
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             302   4e-97    
ref|XP_004303175.1|  PREDICTED: vignain-like                            302   4e-97    
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    302   5e-97    
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    302   5e-97    
gb|KHN08187.1|  Thiol protease SEN102                                   301   5e-97    
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        302   5e-97    
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    301   5e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        301   5e-97    
emb|CAD40112.2|  OSJNBa0035O13.5                                        301   6e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        301   7e-97    
ref|XP_004306813.1|  PREDICTED: vignain-like                            301   7e-97    
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        301   8e-97    
ref|XP_006592465.1|  PREDICTED: vignain-like                            301   8e-97    
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                        301   9e-97    
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   300   9e-97    
dbj|BAD29955.1|  cysteine protease                                      301   1e-96    Daucus carota [carrots]
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             301   1e-96    
ref|XP_003609015.1|  Cysteine proteinase                                301   1e-96    
gb|EMT08019.1|  Vignain                                                 300   1e-96    
gb|EAY93078.1|  hypothetical protein OsI_14879                          300   1e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_009349242.1|  PREDICTED: vignain-like                            305   1e-96    
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         300   1e-96    
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        300   2e-96    
ref|XP_006469128.1|  PREDICTED: vignain-like                            300   2e-96    
ref|XP_006582264.1|  PREDICTED: vignain-like                            300   2e-96    
ref|XP_006582263.1|  PREDICTED: vignain-like                            300   2e-96    
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             300   2e-96    
gb|KHN08873.1|  Vignain                                                 300   2e-96    
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            300   2e-96    
gb|EEC84514.1|  hypothetical protein OsI_31214                          300   3e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    300   3e-96    
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        300   3e-96    
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        301   3e-96    
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                  299   4e-96    
ref|XP_002531152.1|  cysteine protease, putative                        299   4e-96    Ricinus communis
emb|CAH66233.1|  H0825G02.10                                            299   5e-96    Oryza sativa [red rice]
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        299   5e-96    
ref|XP_003527350.1|  PREDICTED: vignain-like                            299   5e-96    
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170          299   6e-96    Sorghum bicolor [broomcorn]
gb|KHN38752.1|  Vignain                                                 298   6e-96    
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             298   6e-96    
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like              299   6e-96    
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             298   1e-95    
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        298   1e-95    
ref|XP_004975184.1|  PREDICTED: vignain-like                            298   1e-95    
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                        298   1e-95    
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         298   2e-95    
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        298   2e-95    
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    298   2e-95    Vitis vinifera
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        297   2e-95    
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             297   2e-95    
ref|XP_006362420.1|  PREDICTED: vignain-like                            298   2e-95    
ref|XP_002525123.1|  cysteine protease, putative                        298   2e-95    Ricinus communis
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    298   2e-95    
gb|ADV74756.1|  cysteine protease                                       298   2e-95    
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                    300   2e-95    
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             298   2e-95    
ref|XP_004505498.1|  PREDICTED: vignain-like                            297   3e-95    
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        297   3e-95    
ref|XP_004294729.1|  PREDICTED: vignain-like                            297   3e-95    
gb|EMT08022.1|  Vignain                                                 297   3e-95    
ref|XP_004297571.1|  PREDICTED: vignain-like                            297   3e-95    
gb|AGT16936.1|  vignain-like protein                                    297   3e-95    
ref|XP_002531151.1|  cysteine protease, putative                        297   3e-95    Ricinus communis
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        297   4e-95    
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like              297   4e-95    
gb|EMT15489.1|  Thiol protease SEN102                                   297   4e-95    
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    297   4e-95    
gb|KHN33962.1|  Vignain                                                 295   4e-95    
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        296   5e-95    
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like              296   6e-95    
ref|NP_568651.1|  cysteine protease SAG12                               296   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             296   7e-95    
ref|XP_003538185.1|  PREDICTED: vignain-like                            296   8e-95    
ref|XP_006592475.1|  PREDICTED: vignain-like                            296   8e-95    
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             296   8e-95    
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     294   1e-94    
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        295   1e-94    
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        296   1e-94    
ref|XP_003607571.1|  Cysteine proteinase EP-B                           295   1e-94    
ref|XP_006592467.1|  PREDICTED: vignain-like                            295   2e-94    
ref|XP_004297572.1|  PREDICTED: vignain-like                            295   2e-94    
gb|KHN13720.1|  Vignain                                                 294   2e-94    
ref|XP_003526232.1|  PREDICTED: vignain-like                            295   2e-94    
ref|XP_003527349.1|  PREDICTED: vignain-like                            295   2e-94    
ref|XP_003556992.1|  PREDICTED: vignain-like                            295   2e-94    
ref|XP_003539970.1|  PREDICTED: vignain-like                            295   2e-94    
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like              295   2e-94    
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        295   2e-94    
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like              295   2e-94    
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                        295   2e-94    
ref|XP_009365508.1|  PREDICTED: vignain-like                            301   3e-94    
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             295   3e-94    
gb|AAP32195.1|  cysteine protease 5                                     295   3e-94    Trifolium repens [creeping white clover]
ref|XP_003539989.1|  PREDICTED: vignain-like                            295   3e-94    
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    293   3e-94    
gb|KHN32068.1|  Vignain                                                 293   4e-94    
gb|EMT29822.1|  Vignain                                                 294   4e-94    
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        295   4e-94    
ref|XP_003607548.1|  Cysteine protease                                  294   4e-94    
gb|AAP32198.1|  cysteine protease 12                                    294   4e-94    Trifolium repens [creeping white clover]
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             294   4e-94    
gb|EMT20796.1|  Vignain                                                 296   6e-94    
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             294   6e-94    
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             294   6e-94    
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    294   6e-94    
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        294   6e-94    
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            294   6e-94    
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    294   7e-94    
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    293   8e-94    
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                  296   8e-94    
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...    293   1e-93    
gb|AAA50755.1|  cysteine proteinase                                     293   1e-93    Alnus glutinosa
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             293   1e-93    Populus trichocarpa [western balsam poplar]
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like              293   1e-93    
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        293   1e-93    
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             293   1e-93    Populus trichocarpa [western balsam poplar]
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        293   1e-93    
gb|EMT09279.1|  Thiol protease SEN102                                   291   1e-93    
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     292   1e-93    
ref|XP_008780645.1|  PREDICTED: vignain-like                            291   2e-93    
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                        292   2e-93    
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        293   2e-93    
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    292   2e-93    
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    292   2e-93    Vitis vinifera
ref|XP_006652104.1|  PREDICTED: vignain-like                            292   2e-93    
ref|XP_007050065.1|  Senescence-associated gene 12                      292   3e-93    
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        292   3e-93    
gb|AAC49135.1|  SAG12 protein                                           292   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like              292   3e-93    
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                        292   3e-93    
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             292   4e-93    
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              291   5e-93    
ref|XP_004505502.1|  PREDICTED: vignain-like                            291   5e-93    
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          291   5e-93    
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                     291   5e-93    
gb|KHN28095.1|  Thiol protease                                          291   6e-93    
gb|EMT29821.1|  Thiol protease SEN102                                   291   7e-93    
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         290   8e-93    
gb|AFV30165.1|  cysteine proteinase                                     291   9e-93    
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        291   9e-93    
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160          290   1e-92    Sorghum bicolor [broomcorn]
ref|XP_003607574.1|  Cysteine protease                                  291   1e-92    
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 290   1e-92    
gb|AGT97048.1|  senescence-specific cysteine protease                   291   1e-92    
ref|XP_004489011.1|  PREDICTED: vignain-like                            290   1e-92    
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150          290   1e-92    
dbj|BAB13759.1|  cysteine proteinase                                    290   2e-92    
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             290   2e-92    
gb|EMT29823.1|  Vignain                                                 290   2e-92    
ref|XP_002865220.1|  senescence-associated gene 12                      290   2e-92    
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     290   2e-92    
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                     289   2e-92    
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                289   3e-92    
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        289   4e-92    
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    289   4e-92    
gb|KHN32069.1|  Vignain                                                 289   4e-92    
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                        289   4e-92    
ref|XP_003527388.1|  PREDICTED: vignain-like                            289   5e-92    
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                    291   8e-92    
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            288   1e-91    
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g             286   1e-91    
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        288   2e-91    
ref|XP_004505500.1|  PREDICTED: vignain-like                            288   2e-91    
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...    287   2e-91    
ref|XP_003558756.1|  PREDICTED: senescence-specific cysteine prot...    287   2e-91    
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             287   2e-91    
gb|KHN07749.1|  Vignain                                                 286   2e-91    
gb|EMT20795.1|  Vignain                                                 286   3e-91    
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    291   4e-91    
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             287   4e-91    
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         286   4e-91    
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    286   5e-91    
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                        289   5e-91    
emb|CBI21977.3|  unnamed protein product                                285   7e-91    
gb|EMT12294.1|  Vignain                                                 286   7e-91    
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         286   7e-91    
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             286   8e-91    
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          286   9e-91    
dbj|BAF56427.1|  cysteine proteinase                                    285   1e-90    
ref|XP_008811650.1|  PREDICTED: vignain-like                            284   1e-90    
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        285   1e-90    
gb|KHN27797.1|  Thiol protease SEN102                                   285   2e-90    
gb|KHN05669.1|  Vignain                                                 284   2e-90    
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    285   2e-90    
ref|XP_006468204.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    286   2e-90    
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...    285   3e-90    
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g             282   3e-90    
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     283   3e-90    
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             284   3e-90    
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...    284   4e-90    
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             284   4e-90    
ref|XP_008669672.1|  PREDICTED: ervatamin-B-like                        283   5e-90    
dbj|BAF56429.1|  cysteine proteinase                                    284   5e-90    
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...    283   6e-90    
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          283   9e-90    
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...    283   9e-90    
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg             283   1e-89    
gb|EMT33085.1|  Vignain                                                 283   1e-89    
emb|CDX87758.1|  BnaC02g31910D                                          283   1e-89    
ref|XP_007025415.1|  Senescence-associated gene 12, putative            282   2e-89    
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...    282   2e-89    
ref|XP_006421528.1|  hypothetical protein CICLE_v10006884mg             281   3e-89    
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...    282   3e-89    
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like        282   3e-89    
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    281   4e-89    
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    281   5e-89    
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg             281   5e-89    
emb|CDP18638.1|  unnamed protein product                                281   7e-89    
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1                 281   8e-89    
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    281   8e-89    
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g             280   9e-89    
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like              280   1e-88    
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg             280   1e-88    
gb|KHN34255.1|  KDEL-tailed cysteine endopeptidase CEP1                 279   2e-88    
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        280   2e-88    
emb|CBI21941.3|  unnamed protein product                                280   2e-88    
ref|XP_002275891.1|  PREDICTED: zingipain-2                             280   2e-88    
ref|XP_003540007.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    280   3e-88    
gb|AHA62783.1|  RCR3-like cysteine protease                             279   3e-88    
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                        279   3e-88    
ref|NP_001052232.2|  Os04g0203500                                       279   3e-88    
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    279   3e-88    
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    279   3e-88    
gb|EAY97106.1|  hypothetical protein OsI_19029                          279   4e-88    
ref|XP_010245279.1|  PREDICTED: vignain-like                            279   6e-88    
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        278   6e-88    
ref|XP_009774957.1|  PREDICTED: vignain-like                            279   7e-88    
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     278   7e-88    
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    290   9e-88    
gb|AHA62780.1|  RCR3-like cysteine protease                             278   1e-87    
dbj|BAG16376.1|  cysteine protease                                      277   1e-87    
ref|XP_003599736.1|  Cysteine proteinase                                278   1e-87    
emb|CDP15086.1|  unnamed protein product                                278   1e-87    
emb|CBI21976.3|  unnamed protein product                                277   1e-87    
emb|CDP18639.1|  unnamed protein product                                277   2e-87    
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                        277   2e-87    
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                        277   2e-87    
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg             277   2e-87    
gb|ABA97421.1|  Vignain precursor, putative                             277   2e-87    
dbj|BAG16370.1|  cysteine protease                                      276   3e-87    
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    276   3e-87    
ref|XP_003607647.1|  Cysteine proteinase                                276   3e-87    
gb|AAM73806.1|AF448505_1  cysteine proteinase                           276   4e-87    
ref|XP_003599735.1|  Cysteine proteinase                                276   4e-87    
gb|EAY93080.1|  hypothetical protein OsI_14881                          275   4e-87    
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like              276   4e-87    
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          276   5e-87    
emb|CAD40110.2|  OSJNBa0035O13.9                                        275   6e-87    
gb|AHA62779.1|  RCR3-like cysteine protease                             276   7e-87    
gb|AHA62782.1|  RCR3-like cysteine protease                             276   7e-87    
gb|AAX13273.1|  putative cysteine protease                              276   7e-87    
ref|XP_007025413.1|  Maternal effect embryo arrest 18                   292   7e-87    
ref|XP_009617207.1|  PREDICTED: vignain-like                            276   7e-87    
emb|CBI21972.3|  unnamed protein product                                275   9e-87    
gb|AHA62781.1|  RCR3-like cysteine protease                             275   1e-86    
emb|CDY58055.1|  BnaA06g40240D                                          275   1e-86    
emb|CBI21973.3|  unnamed protein product                                274   1e-86    
ref|XP_003596314.1|  Cysteine proteinase                                275   1e-86    
ref|XP_004487576.1|  PREDICTED: vignain-like                            275   2e-86    
ref|XP_008805113.1|  PREDICTED: vignain-like                            275   2e-86    
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                        274   3e-86    
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    274   3e-86    
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                     274   4e-86    
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830          273   4e-86    
ref|XP_004979206.1|  PREDICTED: vignain-like                            275   4e-86    
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g             274   4e-86    
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    273   5e-86    
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    273   5e-86    
ref|XP_010932269.1|  PREDICTED: LOW QUALITY PROTEIN: vignain-like       274   6e-86    
ref|XP_007037813.1|  Cysteine proteinases superfamily protein iso...    272   6e-86    
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             273   7e-86    
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    273   7e-86    
gb|KHG06908.1|  Vignain                                                 274   8e-86    
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                   273   8e-86    
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g             273   8e-86    
gb|KHN12137.1|  Thiol protease                                          273   9e-86    
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                        273   1e-85    
gb|AFK44139.1|  unknown                                                 273   1e-85    
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                        273   1e-85    
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...    273   1e-85    
ref|XP_003526229.1|  PREDICTED: vignain-like                            270   2e-85    
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like        272   2e-85    
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...    272   2e-85    
ref|XP_006421532.1|  hypothetical protein CICLE_v10005342mg             272   2e-85    
ref|XP_004236298.1|  PREDICTED: vignain-like                            272   3e-85    
ref|XP_010091035.1|  KDEL-tailed cysteine endopeptidase CEP1            272   3e-85    
ref|NP_001237379.1|  cysteine proteinase precursor                      272   3e-85    
ref|XP_007037812.1|  Cysteine proteinases superfamily protein iso...    272   3e-85    
gb|ABV22590.1|  KDEL-tailed cysteine endopeptidase                      272   3e-85    
ref|XP_009149742.1|  PREDICTED: zingipain-2-like                        271   3e-85    
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1                 271   3e-85    
ref|XP_009150151.1|  PREDICTED: macrodontain-1-like                     271   3e-85    
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like              271   4e-85    
emb|CDY08128.1|  BnaA06g15980D                                          271   4e-85    
gb|KHN33935.1|  KDEL-tailed cysteine endopeptidase CEP1                 270   4e-85    
ref|XP_010929952.1|  PREDICTED: vignain isoform X1                      271   5e-85    
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                        271   5e-85    
emb|CAA40073.1|  endopeptidase (EP-C1)                                  271   7e-85    
gb|KFK34125.1|  hypothetical protein AALP_AA5G104600                    271   8e-85    
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g             271   8e-85    
ref|NP_566920.1|  putative cysteine proteinase                          270   8e-85    
ref|XP_009384829.1|  PREDICTED: xylem cysteine proteinase 1-like        271   9e-85    
gb|EYU22236.1|  hypothetical protein MIMGU_mgv1a008784mg                271   9e-85    
ref|XP_006351440.1|  PREDICTED: vignain-like                            271   9e-85    
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like              270   9e-85    
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...    271   1e-84    
ref|XP_006291370.1|  hypothetical protein CARUB_v10017509mg             271   1e-84    
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg             270   1e-84    
ref|NP_001239703.1|  uncharacterized protein LOC100799247 precursor     270   1e-84    
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        270   1e-84    
ref|XP_004513101.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    270   2e-84    
gb|AAA92063.1|  cysteinyl endopeptidase                                 270   2e-84    
ref|XP_008799257.1|  PREDICTED: xylem cysteine proteinase 1-like        270   2e-84    
ref|XP_008229136.1|  PREDICTED: zingipain-2                             270   2e-84    
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                        269   2e-84    
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1                 269   2e-84    
ref|XP_004964022.1|  PREDICTED: cysteine proteinase EP-B 1-like         270   2e-84    
ref|XP_002877667.1|  hypothetical protein ARALYDRAFT_348033             269   2e-84    
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                        269   2e-84    
emb|CDY05926.1|  BnaC08g21030D                                          269   2e-84    
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg             269   3e-84    
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                        269   3e-84    
gb|ACU23531.1|  unknown                                                 270   3e-84    
ref|XP_006294508.1|  hypothetical protein CARUB_v10023540mg             269   3e-84    
ref|XP_002278323.2|  PREDICTED: vignain                                 271   3e-84    
ref|XP_008239373.1|  PREDICTED: vignain-like                            269   4e-84    
gb|AAP32194.1|  cysteine protease 1                                     267   4e-84    
gb|AAC35211.1|  cysteine proteinase                                     269   6e-84    
ref|XP_003596711.1|  Cysteine proteinase                                268   6e-84    
gb|ACG36128.1|  vignain precursor                                       269   6e-84    
ref|XP_007209277.1|  hypothetical protein PRUPE_ppa007566mg             269   7e-84    
ref|XP_007025397.1|  Senescence-associated gene 12, putative            267   7e-84    
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g             268   7e-84    
ref|XP_002446131.1|  hypothetical protein SORBIDRAFT_06g002140          267   7e-84    
ref|XP_006652103.1|  PREDICTED: cysteine protease 1-like                268   8e-84    
gb|KHN10462.1|  Vignain                                                 268   8e-84    
ref|XP_009149829.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    268   9e-84    
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...    268   1e-83    
ref|XP_003539770.1|  PREDICTED: vignain-like                            268   1e-83    
emb|CDY48168.1|  BnaA06g16650D                                          268   1e-83    
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg             268   1e-83    
ref|XP_006362436.1|  PREDICTED: vignain-like                            267   1e-83    
ref|XP_010510777.1|  PREDICTED: ervatamin-B-like                        268   1e-83    
ref|XP_007226517.1|  hypothetical protein PRUPE_ppa025615mg             268   1e-83    
ref|XP_003549830.2|  PREDICTED: vignain-like                            268   1e-83    
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like        267   1e-83    
emb|CDX73758.1|  BnaC08g22450D                                          267   2e-83    
ref|XP_011005599.1|  PREDICTED: vignain-like                            268   2e-83    
gb|KFK31525.1|  hypothetical protein AALP_AA6G123900                    267   2e-83    
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g             267   2e-83    
ref|XP_002515048.1|  cysteine protease, putative                        268   2e-83    
ref|XP_010054324.1|  PREDICTED: ervatamin-B-like                        267   2e-83    
ref|XP_008221945.1|  PREDICTED: vignain-like                            268   2e-83    
ref|XP_003635767.1|  Cysteine proteinase                                266   2e-83    
ref|XP_006292980.1|  hypothetical protein CARUB_v10019256mg             266   2e-83    
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                        266   2e-83    
ref|XP_006852216.1|  hypothetical protein AMTR_s00049p00133800          267   3e-83    
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                        266   3e-83    
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                        266   3e-83    
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                     268   3e-83    
emb|CBI30671.3|  unnamed protein product                                265   4e-83    
gb|ABF70145.1|  cysteine protease, putative                             267   4e-83    
gb|KDP30997.1|  hypothetical protein JCGZ_11373                         266   4e-83    



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/298 (54%), Positives = 208/298 (70%), Gaps = 7/298 (2%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++F A L L + A  +A  R   + NE   ++++E+W+ + GRVY N+ EK  R+ +FK+
Sbjct  9    LIFTAFLMLTVLAS-QAVCR---NLNEASMIEKHEQWMAQNGRVYKNEAEKGNRYKIFKE  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSHSEKTPFMYENVTVLPPTM  400
            NVE+I SFN  G  ++ LGINQFADLTN EFR       P   + T F YENV+ +P  M
Sbjct  65   NVEFIESFNKAGTKSYKLGINQFADLTNVEFRAARNGYKPKECKGTLFRYENVSAVPAAM  124

Query  401  NWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGC  574
            +W ++GAVT IK+QGQCGCCWAFSAV ATEGI Q++T KLISLSEQ+LVDC+T     GC
Sbjct  125  DWRKKGAVTGIKDQGQCGCCWAFSAVAATEGIHQLKTGKLISLSEQELVDCDTAGEDQGC  184

Query  575  NGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIM  754
            NGG M  AF ++  N+G+TT ANYPY    G CNT K ++ AA+I+G +++P N+EAA++
Sbjct  185  NGGLMDDAFTFIINNKGLTTEANYPYQAVDGTCNTNKEAKPAAKITGFEDVPANNEAALL  244

Query  755  QAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  245  KAVANQPVSVAIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGKSSDGTKYWLVKN  302



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 210/301 (70%), Gaps = 10/301 (3%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            +VFAA+L LEM    +ATAR   D      ++++E+W+ ++GRVY +  EK KRF +FK+
Sbjct  9    LVFAALLVLEMWGS-QATARTLPD---AAMIEKHEQWMAQFGRVYKDDAEKSKRFRIFKE  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTT----MACEMPSHSEKTPFMYENVTVL  388
            NVEYI SFN  G   +TL IN+FADLTN+EF+ +         P  S  + F Y NVT +
Sbjct  65   NVEYIESFNEAGARPYTLAINKFADLTNEEFQASRNGYKMGSYPKSSMFSSFRYANVTAV  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-S  565
            P +M+W ++GAVT +K+QGQCGCCWAFSAV ATEGI Q+ T KLISLSEQ+LVDC+T   
Sbjct  125  PASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSED  184

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GCNGG M  AF+++  N GITT +NYPY    G CNT K S +AA+I+G +++P NSE 
Sbjct  185  EGCNGGLMDNAFEFIISNGGITTESNYPYEGVDGTCNTKKESSSAAKITGYEDVPANSEP  244

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+K
Sbjct  245  ALLKAVANQPVSVAIDASGSDFQFYSSGVFTGDCGTELDHGVTAVGYGKTSDGTKYWLVK  304

Query  926  N  928
            N
Sbjct  305  N  305



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 208/300 (69%), Gaps = 11/300 (4%)
 Frame = +2

Query  47   VFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDN  226
             F A+L L M A  EAT+R   D NE   ++++E+W+  +GRVY + TEK KRF++FKDN
Sbjct  10   AFLALLVLGMWAN-EATSR---DLNEASMVQKHEKWMAHFGRVYRDDTEKAKRFNIFKDN  65

Query  227  VEYINSFN-LGNYTFTLGINQFADLTNDEFRTT---MACEMPSHSEKTPFM-YENVTVLP  391
             +YI S N  G   + L IN FADLTN+EFR T        P  S KT F  YENVT  P
Sbjct  66   FDYIESINKAGMRPYKLRINGFADLTNEEFRATHNGYKMSSPHMSSKTTFFRYENVTA-P  124

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH-  568
             TM+W ++GAVT +K+QGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S  
Sbjct  125  ATMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINEIKTGKLISLSEQELVDCDTSSDM  184

Query  569  GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAA  748
            GC GG M  AFK++ KN G+TT +NYPY    G C T K S  AA+I+G +++P NSE+A
Sbjct  185  GCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSESA  244

Query  749  IMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            ++ AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG+   G KYWL+KN
Sbjct  245  LLNAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGITSDGTKYWLIKN  304



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 201/286 (70%), Gaps = 10/286 (3%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYT  265
            +AT+R   D  E   +KR+E+W+  +GRVY +  EK KRF +FKDN EYI+S N+ G   
Sbjct  5    QATSR---DLYEASIVKRHEQWMARFGRVYKDDAEKAKRFKIFKDNTEYIDSVNMAGIKP  61

Query  266  FTLGINQFADLTNDEFRTTM-ACEMPSHS---EKTPFMYENVTVLPPTMNWLQRGAVTQI  433
            + L +N+FADLTNDEFR T     MPSH    E T F YENVT  P TM+W ++GAVT I
Sbjct  62   YKLDVNEFADLTNDEFRVTRNGYRMPSHKKSPEITSFKYENVTA-PATMDWRKKGAVTGI  120

Query  434  KNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH-GCNGGWMQTAFKYV  610
            K+QGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S  GC GG M  AFK++
Sbjct  121  KDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFI  180

Query  611  AKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAI  790
             KN G+TT +NYPY      C T K S  AA+I+  +++P NSE+A+++AVANQPVSVAI
Sbjct  181  IKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAI  240

Query  791  DAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            DA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  241  DASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKN  286



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/301 (54%), Positives = 212/301 (70%), Gaps = 10/301 (3%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +L LEM    +ATAR   D +    ++R+EEW+ ++GR Y +  EK KRF +FK+
Sbjct  9    LIFAVLLVLEMWTY-QATARSLPDAS---MIERHEEWMAQHGRAYKDDVEKAKRFKIFKE  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTVL  388
            NVEYI SFN  G   + L +N+FADLTN+EF+ +    +M S+   S+ + F Y NVT +
Sbjct  65   NVEYIQSFNEAGTRPYKLAVNKFADLTNEEFQASRNGYKMGSYGKASKVSSFRYANVTAV  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-S  565
            P +M+W Q+GAVT +K+QGQCGCCWAFSAV ATEGI Q+ T KLISLSEQ+LVDC+T   
Sbjct  125  PTSMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSED  184

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GCNGG M  AF+++  N GITT +NYPY    G CN+ K S  AA+I+G +++P NSE+
Sbjct  185  EGCNGGLMDNAFEFIISNGGITTESNYPYEAVDGTCNSKKESSHAAKITGYEDVPANSES  244

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+K
Sbjct  245  ALLKAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDHGVTAVGYGKTSDGTKYWLVK  304

Query  926  N  928
            N
Sbjct  305  N  305



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/302 (53%), Positives = 211/302 (70%), Gaps = 14/302 (5%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +L L +      +  W     E   M+R+E W+ +YGR Y ++ EK +R + FK+
Sbjct  32   LIFAVVLLLGLWT----SHVWSRSLYEASMMERHETWMAQYGRAYKDRVEKERRLNTFKN  87

Query  224  NVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTVL  388
            NVE+I SFN  G   + L +N+FADL N+EFR +    +MP+H   S   PF YEN++ +
Sbjct  88   NVEFIESFNKDGKKPYKLSVNEFADLMNEEFRASRNGYKMPAHLSSSSTNPFRYENISAV  147

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--  562
            P TM+W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T   
Sbjct  148  PSTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLSTGKLISLSEQELVDCDTSGE  207

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GCNGG+M  AF+++ +N+G+TT ANYPY    G CN+ K   AAA+I+G +++P NSE
Sbjct  208  DQGCNGGFMDDAFEFIIQNKGLTTEANYPYQGADGTCNSGK---AAAKITGYEDVPANSE  264

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG+   G KYWL+
Sbjct  265  AALLKAVANQPVSVAIDAGGSAFQFYSSGVFTGDCGTDLDHGVTAVGYGMSDDGTKYWLV  324

Query  923  KN  928
            KN
Sbjct  325  KN  326



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 210/303 (69%), Gaps = 16/303 (5%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +L L +      +  W     E   M+R+E W+ +YGR Y    EK +R ++FK+
Sbjct  32   LIFAVVLLLGLWT----SHVWSRSLYEASMMERHETWMAQYGRAYKGHVEKERRLNIFKN  87

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTT-----MACEMPSHSEKTPFMYENVTV  385
            NVE+I SFN +G   + L +N+FADLTN+EF+ +     M+  + S S K PF YENV+ 
Sbjct  88   NVEFIESFNKVGKKPYKLSVNEFADLTNEEFQASRNGYKMSAHLSSSSTK-PFRYENVSA  146

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
            +P TM+W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T  
Sbjct  147  VPSTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLSTGKLISLSEQELVDCDTSG  206

Query  563  -SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
               GCNGG M  AF ++ +N+G+TT ANYPY    G CN+ K   AAA+I+G +++P NS
Sbjct  207  EDQGCNGGLMDDAFDFIIQNKGLTTEANYPYQGADGACNSGK---AAAKITGYEDVPANS  263

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            EAA+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG+   G KYWL
Sbjct  264  EAALLKAVANQPVSVAIDAGGSAFQFYSSGVFTGDCGTDLDHGVTAVGYGMSDDGTKYWL  323

Query  920  LKN  928
            +KN
Sbjct  324  VKN  326



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   324 bits (830),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 208/301 (69%), Gaps = 11/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            + F A+L L M A  +AT+R      E   ++++E+W+  +GRVY +  EK KRF++FKD
Sbjct  9    LAFVALLVLGMQAS-QATSRGLY---ETSMVQKHEQWMTHFGRVYKDDVEKAKRFNIFKD  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSHS---EKTPFMYENVTVL  388
            N +YINS N  G   + L IN+FADLTN+EFR T    +MPS     E T F YENVT  
Sbjct  65   NTKYINSVNKAGIKPYKLDINEFADLTNEEFRATRNGYKMPSQKKSPEITSFKYENVTA-  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH  568
            P TM+W  +GAVT IKNQGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S 
Sbjct  124  PATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  569  -GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AFK++ KN G+TT +NYPY    G C T K S  AA+I+  +++P NSE+
Sbjct  184  MGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESSHAAKITSYEDVPANSES  243

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+K
Sbjct  244  ALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVK  303

Query  926  N  928
            N
Sbjct  304  N  304



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 206/302 (68%), Gaps = 11/302 (4%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            L   AA+L   M    +AT+R      E   ++++E+W+  +GRVY N  EK KRF +FK
Sbjct  9    LAFVAALLVFGM-QDFQATSRGLY---ETSMVQKHEQWMTRFGRVYKNDVEKAKRFKIFK  64

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMP---SHSEKTPFMYENVTV  385
            DN++YI+SFN  G  ++ L IN+FADLTNDEFR T    +MP      E T F YENVT 
Sbjct  65   DNIDYIDSFNKAGTKSYKLDINEFADLTNDEFRATHNGYKMPFQKKSPEITSFKYENVTA  124

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVS  565
             P TM+W  +GAVT IKNQGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S
Sbjct  125  -PATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS  183

Query  566  H-GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT +NYPY      C T K S  AA+I+  +++P NSE
Sbjct  184  DMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSE  243

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +++++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+
Sbjct  244  SSLLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLV  303

Query  923  KN  928
            KN
Sbjct  304  KN  305



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/301 (55%), Positives = 207/301 (69%), Gaps = 11/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            + F A+L L M A  +AT+R      E   +K++E+W+  +GRVY +  EK KRF +FKD
Sbjct  9    LAFVALLVLGMQAS-QATSRGLY---ETSIVKKHEQWMARFGRVYKDDVEKAKRFKIFKD  64

Query  224  NVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPS---HSEKTPFMYENVTVL  388
            N EYI+S N+ G   + L +N+F+DLTN+EFR T     MPS   + E T F YENVT  
Sbjct  65   NTEYIDSVNMAGIKPYKLDVNEFSDLTNEEFRATHNGYRMPSQKKYPEITSFKYENVTA-  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH  568
            P TM+W  +GAVT IKNQGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S 
Sbjct  124  PATMDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  569  -GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AFK++ KN G+TT +NYPY      C T K S  AA+I+  +++P NSE+
Sbjct  184  MGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDNTCKTGKESNHAAKITSYEDVPANSES  243

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+K
Sbjct  244  ALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVK  303

Query  926  N  928
            N
Sbjct  304  N  304



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/302 (53%), Positives = 211/302 (70%), Gaps = 11/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
             + A +L L+M A  +ATAR   +      ++R+E+W+V+YGR Y N  EK KR+++FKD
Sbjct  10   FILAVVLVLQMWAS-QATARTLPN---ASMVERHEQWMVQYGRTYKNDAEKAKRYNIFKD  65

Query  224  NVEYINSFNLGN-YTFTLGINQFADLTNDEFRTT-----MACEMPSHSEKTPFMYENVTV  385
            NVEYI S N     T+ L IN+FADLTN+EF+ +     M     S S+ + F Y NV+ 
Sbjct  66   NVEYIQSVNEAETRTYKLAINKFADLTNEEFQASRNGYKMRSLSKSSSKVSSFRYANVSA  125

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
            +PP+++W ++GAVT +K+QGQCGCCWAFSAV ATEGI Q+ T  L+SLSEQ+LVDC+T  
Sbjct  126  VPPSIDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSE  185

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GCNGG M  AF+++  N G+TT +NYPY    G CN+ K S  AARI+G +++P NSE
Sbjct  186  DQGCNGGLMDNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSE  245

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AVANQP+SVAIDA G  FQFY GG+F+  C T   H VTAVGYGV   G KYWL+
Sbjct  246  SALLKAVANQPISVAIDASGSDFQFYSGGVFTGQCGTELDHGVTAVGYGVTSDGTKYWLV  305

Query  923  KN  928
            KN
Sbjct  306  KN  307



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/301 (54%), Positives = 209/301 (69%), Gaps = 11/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            + F A+L LEM    +AT+R   D  E    +++++W+  +GRVY +  EK KRF +FKD
Sbjct  10   VAFGALLVLEMFVS-QATSR---DLYEASIFQKHKQWMSLFGRVYKDDIEKAKRFKIFKD  65

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTVL  388
            N EYI   N +G   + LGIN+FADL+N+EF+ +    +M SH   S+ T F YENVT  
Sbjct  66   NFEYIEFVNKVGTRPYILGINEFADLSNEEFKASRNGYKMYSHQQLSKSTSFKYENVTA-  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH  568
            P TM+W  +GAVT IK+QGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S 
Sbjct  125  PATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTRSD  184

Query  569  -GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AFK++ KN G+TT +NYPY      C T K S  AA+I+G +++P NSE+
Sbjct  185  MGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTDATCKTGKESNHAAKITGYEDVPDNSES  244

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYG +  G KYWL+K
Sbjct  245  ALLKAVANQPISVAIDASGSDFQFYSSGVFTGKCGTELDHGVTAVGYGKIGDGTKYWLVK  304

Query  926  N  928
            N
Sbjct  305  N  305



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 210/302 (70%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            +V AA+L LEM +  + TAR   D     T++ +E+W+ ++GRVY ++ EK KRF +FK+
Sbjct  9    LVIAALLVLEMWSS-QGTARTLPD---AATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKE  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTT-----MACEMPSHSEKTPFMYENVTV  385
            NVEYI SFN      + L IN+FADLTN+EF  +     M   M S ++ + F Y NV+ 
Sbjct  65   NVEYIRSFNEAAARPYRLAINKFADLTNEEFVASRNGYKMGSYMKS-TKVSSFRYANVSA  123

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
            +P +M+W Q+GAVT +K+QGQCGCCWAFSAV ATEGI Q+ T+KLISLSEQ+LVDC+T  
Sbjct  124  VPASMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTRKLISLSEQELVDCDTSE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GCNGG M  AF+++  N GITT +NYPY    G CN+ K S  AA+I+G +++P NSE
Sbjct  184  DEGCNGGLMDDAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHAAKITGYEDVPANSE  243

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
             A+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+
Sbjct  244  PALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLV  303

Query  923  KN  928
            KN
Sbjct  304  KN  305



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/302 (52%), Positives = 208/302 (69%), Gaps = 11/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++F A+L + + A    +  W    ++    +R+E W+ +YGRVY + +EK +RF +F++
Sbjct  9    LMFVALLVVGLWA----SQAWSRSLHDAAMNERHEMWMAKYGRVYKDNSEKERRFEIFRN  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH----SEKTPFMYENVTVL  388
            NVE+I SFN LGN  + L IN+FADLTN+EF+ +      S     +EK+ F Y NVT +
Sbjct  65   NVEFIESFNKLGNRPYKLDINEFADLTNEEFKVSKNGYKRSSGVGLTEKSSFRYANVTAV  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--  562
            P +M+W Q GAVT IK+QGQCGCCWAFSAV A EGIT++ T KLISLSEQ+LVDC+T   
Sbjct  125  PTSMDWRQNGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGE  184

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AF+++ +N G+TT ANYPY    G CNT KA   AA+I+G +++P NSE
Sbjct  185  DQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSE  244

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
             A+++AVA+QPVSVAIDA G  FQFY GG+F+  C T   H VTAVGYG    G KYWL+
Sbjct  245  DALLKAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTSDDGTKYWLV  304

Query  923  KN  928
            KN
Sbjct  305  KN  306



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 205/301 (68%), Gaps = 11/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            + F A+L L M A  +AT+R      E   ++++++W+  +GRVY +  EK KRF +FKD
Sbjct  9    LAFIALLVLVMQAS-QATSRGLY---ETSMVQKHDQWMTRFGRVYKDDVEKAKRFKIFKD  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSHS---EKTPFMYENVTVL  388
            N EYI+SFN  G   + L IN+FADLTN+EFR T     MPS     E T F YENVT  
Sbjct  65   NTEYIDSFNKAGTKPYKLDINEFADLTNEEFRATHNGYRMPSQKKSPEITSFKYENVTA-  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH  568
            P TM+W ++GAVT IK+QGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S 
Sbjct  124  PATMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  569  -GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AFK++ KN G+TT +NYPY      C T K S  AA+I+  +++P NSE+
Sbjct  184  MGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSES  243

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
             +++AVANQPVSVAIDA    FQFY  G+F+  C T   H VTAVGYG    G KYWL+K
Sbjct  244  DLLKAVANQPVSVAIDASASDFQFYSSGVFTGECGTELDHGVTAVGYGKASDGTKYWLVK  303

Query  926  N  928
            N
Sbjct  304  N  304



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 209/302 (69%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            +V AA+L LEM +  + TAR   D     T++ +E+W+ ++GRVY ++ EK KRF +FK+
Sbjct  9    LVIAALLVLEMWSS-QGTARTLPD---AATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKE  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTT-----MACEMPSHSEKTPFMYENVTV  385
            NVEYI SFN      + L IN+FADLTN+EF  +     M   M S ++ + F Y NV+ 
Sbjct  65   NVEYIRSFNEAAARPYRLAINKFADLTNEEFVASRNGYKMGSYMKS-TKVSSFRYANVSA  123

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
            +P +M+W Q+GAVT +K+QGQCGCCWAFSAV ATEGI Q+ T KLISLSEQ+LVDC+T  
Sbjct  124  VPASMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GCNGG M  AF+++  N GITT +NYPY    G CN+ K S  AA+I+G +++P NSE
Sbjct  184  DEGCNGGLMDDAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHAAKITGYEDVPANSE  243

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
             A+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+
Sbjct  244  PALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLV  303

Query  923  KN  928
            KN
Sbjct  304  KN  305



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/301 (53%), Positives = 204/301 (68%), Gaps = 10/301 (3%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            + FAA+L L M A   A++R      E   ++++ +W+  +GR Y +  EK KR  +FK+
Sbjct  9    LAFAALLVLGMHAS-RASSRGLY---EASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKE  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTVL  388
            N EYI+S N  G   + LGIN FADLTN+EFR T     MPSH   SE T F YENVT L
Sbjct  65   NAEYIDSVNKAGIRPYKLGINDFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTAL  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-S  565
              +M+W ++GAVT +KNQGQCGCCWAFSAV ATEGI +I+  KLISLSEQ+LVDC+T   
Sbjct  125  AASMDWRKKGAVTGVKNQGQCGCCWAFSAVAATEGINKIKNGKLISLSEQELVDCDTSWD  184

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AFKY+ KN G+TT +NYPY    G C T K S+ AA+I+G +++P NSE+
Sbjct  185  MGCQGGLMDYAFKYIIKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSES  244

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+ +AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTA+GYG    G  YWL+K
Sbjct  245  ALQKAVAHQPVSVAIDASGPDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVK  304

Query  926  N  928
            N
Sbjct  305  N  305



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 188/267 (70%), Gaps = 2/267 (1%)
 Frame = +2

Query  134  MKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEF  313
            ++R+E+W+ ++GRVY N  EK  RF +F+ NVE I SFN  N+ F LG+NQFADLTN+EF
Sbjct  38   LERHEQWMAQHGRVYKNAAEKAHRFEIFRANVERIESFNAENHKFKLGVNQFADLTNEEF  97

Query  314  RTTMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEG  493
            +T    +    +    F YENVT +P TM+W  +GAVT IK+QGQCG CWAFSAV ATEG
Sbjct  98   KTRNTLKPSKMASTKSFKYENVTAVPATMDWRTKGAVTPIKDQGQCGSCWAFSAVAATEG  157

Query  494  ITQIRTKKLISLSEQQLVDCETVS--HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKG  667
            IT++ T KLISLSEQ++VDC+  S   GCNGG M  AF+Y+ KN+GITT ANYPY    G
Sbjct  158  ITKLSTGKLISLSEQEVVDCDVTSDDQGCNGGEMDDAFEYIIKNKGITTEANYPYKAADG  217

Query  668  MCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGC  847
             CNT KA+  AA I+G +++  NSEAA+++A ANQP++VAIDA    FQ Y  G+F+  C
Sbjct  218  TCNTKKAASHAASITGYEDVTVNSEAALLKAAANQPIAVAIDAGDFAFQMYSSGVFTGDC  277

Query  848  TTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             T   H VT VGYG    G KYWL+KN
Sbjct  278  GTDLDHGVTLVGYGATSDGTKYWLVKN  304



>ref|XP_004975182.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score =   317 bits (812),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 205/304 (67%), Gaps = 10/304 (3%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVF  217
            ++   A L   +G  C  ++     +  +  M +R+E+W+VEYGRVY +  EK +RF VF
Sbjct  1    MVSSKAFLLAILGCACLCSSILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEVF  60

Query  218  KDNVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMA---CEMPSHSEKTPFMYENVTV-  385
            KDNV +I SFN GN  F L +NQFADLTNDEFR T A    +  S S  T F YEN++V 
Sbjct  61   KDNVAFIESFNAGNTKFWLAVNQFADLTNDEFRATKANKGFKPISTSVPTGFKYENLSVN  120

Query  386  -LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             LP T++W  +GAVT IKNQGQCGCCWAFSAV A EGI ++ T  LISLSEQ+LVDC+T 
Sbjct  121  ALPTTVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGSLISLSEQELVDCDTH  180

Query  563  S--HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPN  736
            S   GC GGWM +AF++V KN G+TT +NYPY    G C     S++AA I G +++P N
Sbjct  181  SMDEGCEGGWMDSAFEFVIKNGGLTTESNYPYKAVDGKCK--GGSKSAATIKGHEDVPVN  238

Query  737  SEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYW  916
            +EAA+M+AVANQPVSVA+DA  R F FY GG+ +  C T   H + A+GYGV   G KYW
Sbjct  239  NEAALMKAVANQPVSVAVDAGDRTFMFYSGGVMTGTCGTELDHGIAAIGYGVESDGTKYW  298

Query  917  LLKN  928
            LLKN
Sbjct  299  LLKN  302



>ref|XP_004975183.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score =   317 bits (812),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 205/304 (67%), Gaps = 10/304 (3%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVF  217
            ++   A L   +G  C  ++     +  +  M +R+E+W+VEYGRVY +  EK +RF VF
Sbjct  1    MVSSKAFLLAILGCACLCSSILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEVF  60

Query  218  KDNVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMA---CEMPSHSEKTPFMYENVTV-  385
            KDNV +I SFN GN  F L +NQFADLTNDEFR T A    +  S S  T F YEN++V 
Sbjct  61   KDNVAFIESFNAGNTKFWLAVNQFADLTNDEFRATKANKGFKPISTSVPTGFKYENLSVN  120

Query  386  -LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             LP T++W  +GAVT IKNQGQCGCCWAFSAV A EGI ++ T  LISLSEQ+LVDC+T 
Sbjct  121  ALPTTVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTGSLISLSEQELVDCDTH  180

Query  563  S--HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPN  736
            S   GC GGWM +AF++V KN G+TT +NYPY    G C     S++AA I G +++P N
Sbjct  181  SMDEGCEGGWMDSAFEFVIKNGGLTTESNYPYKAVDGKCK--GGSKSAATIKGHEDVPVN  238

Query  737  SEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYW  916
            +EAA+M+AVANQPVSVA+DA  R F FY GG+ +  C T   H + A+GYGV   G KYW
Sbjct  239  NEAALMKAVANQPVSVAVDAGDRTFMFYSGGVMTGTCGTELDHGIAAIGYGVESDGTKYW  298

Query  917  LLKN  928
            LLKN
Sbjct  299  LLKN  302



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   316 bits (810),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 158/302 (52%), Positives = 212/302 (70%), Gaps = 10/302 (3%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            ++  AA++ LE+    +ATAR   D +    ++++E+WI ++GRVY +  EK KRF++FK
Sbjct  8    ILFLAALVVLEIWGS-QATARTLPDAS---MVEKHEQWIAQFGRVYKDDAEKAKRFNIFK  63

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTV  385
            +NVEYI SFN  G   + L IN+FADLTN+EF+ +    +M S+   S+ + F Y NVT 
Sbjct  64   ENVEYIQSFNEAGARPYKLAINKFADLTNEEFQASRNGYKMGSYGKSSKVSSFRYANVTA  123

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
            +P +M+W ++GAVT +K+QGQCGCCWAFSAV ATEGI Q+ T  LISLSEQ+LVDC+T  
Sbjct  124  VPASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGNLISLSEQELVDCDTSE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GCNGG M  AF+++  N GITT +NYPY    G CN+ K S   A+I+G +++P NSE
Sbjct  184  DEGCNGGLMDNAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSE  243

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+
Sbjct  244  SALLKAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDHGVTAVGYGKTSDGTKYWLV  303

Query  923  KN  928
            KN
Sbjct  304  KN  305



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/301 (53%), Positives = 205/301 (68%), Gaps = 11/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            + F A+L L M A  + T+R   D NE   ++++E W+  +GRVY +  EK KR  +FK+
Sbjct  9    LAFVALLVLGMWAS-QTTSR---DLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKIFKN  64

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTVL  388
            NV+YI S N  G   + LGIN+FADLTN+EFR T    +M SH   S+   F YENVT  
Sbjct  65   NVDYIESVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMSSHQKSSKTISFRYENVTA-  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH  568
            P T++W  +GAVT +K+QGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S 
Sbjct  124  PATIDWRTKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSSD  183

Query  569  -GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AF ++ KN G+TT +NYPY    G C T K S   A+I+G +++P NSE+
Sbjct  184  MGCEGGLMDDAFTFIIKNHGLTTESNYPYEGTDGTCKTRKESNHVAKITGYEDVPANSES  243

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A++ AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTA+GYG    G KYWL+K
Sbjct  244  ALLSAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTKYWLVK  303

Query  926  N  928
            N
Sbjct  304  N  304



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/299 (55%), Positives = 207/299 (69%), Gaps = 10/299 (3%)
 Frame = +2

Query  50   FAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNV  229
            F A+L + +    EAT+R   D NE   +++ E+W+  +GRVY + TEK KRF++FKDN 
Sbjct  11   FLALLVIGILWANEATSR---DLNEASMVQKNEKWMARFGRVYRDDTEKAKRFNIFKDNF  67

Query  230  EYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTVLPP  394
            +YI S N  G   + L IN FADLTN+EFR T    +M SH   S+ T F YENVT  P 
Sbjct  68   DYIQSINKAGMRPYKLSINGFADLTNEEFRATHNGYKMSSHHTSSKTTFFRYENVTA-PA  126

Query  395  TMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH-G  571
            TM+W ++GAVT +K+Q QCGCCWAFSAV AT+GI +I+T KLISLSEQ+LVDC+T S  G
Sbjct  127  TMDWRKKGAVTGVKDQWQCGCCWAFSAVAATKGINEIKTGKLISLSEQELVDCDTSSDMG  186

Query  572  CNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAI  751
            C GG M  AFK++ KN G+TT +NYPY    G C T K S  AA+I+G +++P NSE+A+
Sbjct  187  CEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSESAL  246

Query  752  MQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            + AVANQPVSVAIDA G  FQFY  G+F+    T   H VTAVGYG+   G KYWL+KN
Sbjct  247  LNAVANQPVSVAIDASGSDFQFYSSGVFTGEYGTDLDHGVTAVGYGITSDGTKYWLVKN  305



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/277 (55%), Positives = 196/277 (71%), Gaps = 7/277 (3%)
 Frame = +2

Query  119  NEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFAD  295
            N+E  ++RYE+W+  +GRVY +  EK +RF +FKDNVE+I SFN  GN  + LGINQFAD
Sbjct  24   NDEAMVERYEQWMSLHGRVYKDSAEKERRFKIFKDNVEFIESFNRAGNRPYKLGINQFAD  83

Query  296  LTNDEFRTTMACEMPSHSEK----TPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCW  463
            LTN+EF  +      S S +    T F YENVT +P T++W  +GAVT IK+QGQCG CW
Sbjct  84   LTNEEFVASHNGLKMSSSPRLFMSTSFKYENVTAVPATVDWRTKGAVTPIKDQGQCGSCW  143

Query  464  AFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH--GCNGGWMQTAFKYVAKNRGITTG  637
            AFSA+ ATEGIT++ T KLISLSEQ++VDC+  S   GC+GG+M+ AF+++ KN+GI T 
Sbjct  144  AFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCSGGYMEDAFEFIVKNKGIATE  203

Query  638  ANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQF  817
              YPYT   G C+  K +  AA+I+  + +P NSEAA+++AVANQPVSV+IDA G  FQF
Sbjct  204  TTYPYTAADGTCSKTKEASHAAKIASYEKVPANSEAALLKAVANQPVSVSIDAGGMAFQF  263

Query  818  YKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            Y  G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  264  YSSGVFTGDCGTDLDHGVTAVGYGKTSNGTKYWLVKN  300



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 191/275 (69%), Gaps = 6/275 (2%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADL  298
            E   ++++ +W+  +GR Y +  EK KR  +FK+N EYI+S N  G   + LGIN FADL
Sbjct  13   EASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYKLGINDFADL  72

Query  299  TNDEFRTTM-ACEMPSH---SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWA  466
            TN+EFR T     MPSH   SE T F YENVT L  +M+W ++GAVT +KNQGQCGCCWA
Sbjct  73   TNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAASMDWRKKGAVTGVKNQGQCGCCWA  132

Query  467  FSAVGATEGITQIRTKKLISLSEQQLVDCETV-SHGCNGGWMQTAFKYVAKNRGITTGAN  643
            FSAV ATEGI +I+  KLISLSEQ+LVDC+T    GC GG M  AFKY+ KN G+TT +N
Sbjct  133  FSAVAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTESN  192

Query  644  YPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYK  823
            YPY    G C T K S+ AA+I+G +++P NSE+A+ +AVA+QPVSVAIDA G  FQFY 
Sbjct  193  YPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQFYS  252

Query  824  GGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             G+F+  C T   H VTA+GYG    G  YWL+KN
Sbjct  253  SGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVKN  287



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/302 (52%), Positives = 208/302 (69%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++F A+L + +      +  W    ++    +R+E W+V+YGRVY + +EK +RF +F++
Sbjct  9    LMFVALLVVGLWV----SQAWSRSLHDAAMNERHEMWMVKYGRVYKDNSEKERRFEIFRN  64

Query  224  NVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH----SEKTPFMYENVTVL  388
            NVE+I SFN  GN  + L IN+FADLTN+EF+ +      S     SEK+ F Y NVT +
Sbjct  65   NVEFIESFNKPGNRPYKLDINEFADLTNEEFKASRNGYKRSSNVGLSEKSSFRYGNVTAV  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--  562
            P +M+W Q+GAVT IK+QGQCGCCWAFSAV A EGIT++ T KLISLSEQ+LVDC+T   
Sbjct  125  PTSMDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGE  184

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AF+++ +N G+TT ANYPY    G CNT KA   AA+I+G +++P NSE
Sbjct  185  DQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSE  244

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
             A+++AVA+QPVSVAIDA G  FQFY GG+F+  C T   H VTAVGYG    G KYWL+
Sbjct  245  DALLKAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGT-SDGTKYWLV  303

Query  923  KN  928
            KN
Sbjct  304  KN  305



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 187/266 (70%), Gaps = 3/266 (1%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            R+E W+V+YGRVY +  EK  RF +FK NV+YI S N  G+  + L INQFADLT +EFR
Sbjct  37   RHERWMVQYGRVYKDAAEKEHRFQIFKANVDYIESTNQAGHRKYKLNINQFADLTTEEFR  96

Query  317  TTMACEMPSHSEKTP--FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATE  490
             +     P     T   F Y NVT +PP+++W  +GAVT IK+QGQCGCCWAFSAV ATE
Sbjct  97   ASYTGFKPKPMRATGQNFRYANVTDVPPSVDWRSKGAVTPIKDQGQCGCCWAFSAVVATE  156

Query  491  GITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGM  670
            GI QI T KL SLSEQQLVDC+ V+ GC GG M  AFKY+  N+GITT ANYPY  ++G 
Sbjct  157  GIAQISTGKLTSLSEQQLVDCDKVNGGCGGGIMDDAFKYIISNKGITTEANYPYVAKEGT  216

Query  671  CNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCT  850
            C+T K+S  AA ISG +++P NSE++++QAVA QPVSVAI+  G+ FQFY G +F   C 
Sbjct  217  CDTNKSSSVAATISGYEDVPRNSESSLLQAVAKQPVSVAIEGSGKDFQFYSGDVFMGNCG  276

Query  851  TRTTHAVTAVGYGVMPGGKKYWLLKN  928
            T   HAVT VGYG    G KYWLLKN
Sbjct  277  TDLDHAVTVVGYGTATDGTKYWLLKN  302



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   315 bits (806),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 207/302 (69%), Gaps = 11/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
             + AA+L L+M    +ATAR   D      ++R+E+W+V+YGR Y N  EK KRF++FKD
Sbjct  14   FILAAVLVLQMWVS-QATARTLPD---ASIVERHEQWMVQYGRTYKNDAEKAKRFNIFKD  69

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTT-----MACEMPSHSEKTPFMYENVTV  385
            NVEYI S N      + L IN+FADLTN+EF+ +     M  +  S S+ + +MY NV+ 
Sbjct  70   NVEYIQSVNETETRAYKLAINKFADLTNEEFQASRNGYKMRSQSKSSSKVSSYMYANVSA  129

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
            +PP+M+W ++GAVT +K+QGQCGCCWAFSAV ATEGI Q+ T  L+SLSEQ+LVDC+T  
Sbjct  130  VPPSMDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSE  189

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GCNGG M  AF+++  N G+TT +NYPY    G CN+ K S   A+I+G +++P NSE
Sbjct  190  DQGCNGGLMDYAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPSNSE  249

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AV NQP+SVAIDA G  FQFY  G+F+  C T   H VT VGYGV     KYWL+
Sbjct  250  SALLKAVVNQPISVAIDASGSDFQFYSSGVFTGQCGTELDHGVTVVGYGVTSDETKYWLV  309

Query  923  KN  928
            KN
Sbjct  310  KN  311



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   313 bits (803),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 197/273 (72%), Gaps = 8/273 (3%)
 Frame = +2

Query  134  MKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADLTNDE  310
            ++++E+W+++YGR Y +  EK  R+ +FK NVEYI S +   N T+ L IN+FADLT+DE
Sbjct  17   IEKHEQWMLQYGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAENRTYKLAINKFADLTSDE  76

Query  311  FRTTM-ACEMPSHS-----EKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFS  472
            F+ +    +M S S     E + F Y NV+ +PP+++W ++GAVT +K+QGQCGCCWAFS
Sbjct  77   FKASRNGFKMGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQGQCGCCWAFS  136

Query  473  AVGATEGITQIRTKKLISLSEQQLVDCETV-SHGCNGGWMQTAFKYVAKNRGITTGANYP  649
            AV ATEG+ Q++T KLISLSEQ+LVDC+T    GCNGG M  AF+++  N G+TT +NYP
Sbjct  137  AVAATEGLNQLKTGKLISLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTESNYP  196

Query  650  YTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGG  829
            Y    G CN+ K S   A+I+G +++P NSE+A+++AVANQP+SVAIDA G  FQFY GG
Sbjct  197  YEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFYSGG  256

Query  830  LFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +FS  C T   H VTAVGYGV   G KYWL+KN
Sbjct  257  VFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKN  289



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score =   313 bits (803),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 191/275 (69%), Gaps = 6/275 (2%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADL  298
            E   ++++ +W+  +GR Y +  EK KR  +FK+N EYI+S N  G   + LGIN FADL
Sbjct  21   EASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYKLGINDFADL  80

Query  299  TNDEFRTTM-ACEMPSH---SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWA  466
            TN+EFR T     MPSH   SE T F YENVT L  +M+W ++GAVT +KNQGQCGCCWA
Sbjct  81   TNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAASMDWRKKGAVTGVKNQGQCGCCWA  140

Query  467  FSAVGATEGITQIRTKKLISLSEQQLVDCETV-SHGCNGGWMQTAFKYVAKNRGITTGAN  643
            FSAV ATEGI +I+  KLISLSEQ+LVDC+T    GC GG M  AFKY+ KN G+TT +N
Sbjct  141  FSAVAATEGINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTESN  200

Query  644  YPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYK  823
            YPY    G C T K S+ AA+I+G +++P NSE+A+ +AVA+QPVSVAIDA G  FQFY 
Sbjct  201  YPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQFYS  260

Query  824  GGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             G+F+  C T   H VTA+GYG    G  YWL+KN
Sbjct  261  SGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVKN  295



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   314 bits (804),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/302 (52%), Positives = 204/302 (68%), Gaps = 16/302 (5%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            L+VF   LA E  AR       +         +R+E+W+ +YG+VY +  EK  R ++FK
Sbjct  15   LLVFG-FLAFEANARTLEDVSLK---------ERHEQWMTQYGKVYTDSYEKELRSNIFK  64

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEF--RTTMACEMPSHSEKTP-FMYENVTVL  388
            +NV+ I +FN  GN  + LGINQFADLTN+EF  R      M S+S +TP F YE+V+ +
Sbjct  65   ENVQRIEAFNNAGNKPYKLGINQFADLTNEEFKARNRFKGHMCSNSTRTPTFKYEDVSSV  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P +++W Q+GAVT IK+QGQCGCCWAFSAV ATEGIT++ T KLISLSEQ+LVDC+T  V
Sbjct  125  PASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGV  184

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ +N+G+ T A YPY      CN    ++ AA I G +++P NSE
Sbjct  185  DQGCEGGLMDDAFKFIMQNKGLNTEAKYPYQGVDATCNANAEAKDAASIKGFEDVPANSE  244

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AVANQP+SVAIDA G  FQFY  GLF+  C T   H VTAVGYGV   G KYWL+
Sbjct  245  SALLKAVANQPISVAIDASGSEFQFYSSGLFTGSCGTELDHGVTAVGYGVSDDGTKYWLV  304

Query  923  KN  928
            KN
Sbjct  305  KN  306



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/302 (52%), Positives = 204/302 (68%), Gaps = 15/302 (5%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            L++  A  ALE  AR    A  R         +R+E+W+V +G++Y + +EK +++ +FK
Sbjct  13   LVIVFAFCALEANARTLQDASMR---------ERHEQWMVTHGKLYLDSSEKEQKYQIFK  63

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEF--RTTMACEMPSHSEKTP-FMYENVTVL  388
            +NV+ I +FN  GN  + LGINQFADLTN+EF  R      + S   +TP F YE+VT L
Sbjct  64   ENVQRIEAFNNAGNKPYKLGINQFADLTNEEFKARNRFKGHICSTITRTPTFKYEHVTAL  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--  562
            P +++W Q+GAVT IK+QGQCG CWAFSAV ATEGIT++ T KLISLSEQ+L+DC+T   
Sbjct  124  PTSLDWRQKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQELIDCDTKGE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++  N+G+TT A YPY    G CN    S  AA I G +++P NSE
Sbjct  184  DQGCEGGLMDDAFKFILNNKGLTTEATYPYEGIDGTCNAKAESSHAASIKGYEDVPANSE  243

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AVANQPVSVAIDA G  FQFY GG+F+  C T   H VTAVGYGV   G KYWL+
Sbjct  244  SALLKAVANQPVSVAIDASGYEFQFYAGGVFNGSCDTNLDHGVTAVGYGVSDDGSKYWLV  303

Query  923  KN  928
            KN
Sbjct  304  KN  305



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 207/303 (68%), Gaps = 10/303 (3%)
 Frame = +2

Query  38   HLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVF  217
            H  +  A + +     CEAT+R   D       +R+E+W+  YGRVY +  E+ +RF++F
Sbjct  9    HQCICLAFIFIVGALVCEATSRTLQD---ASMYERHEQWMARYGRVYHDNNEREQRFNIF  65

Query  218  KDNVEYINSFNLG-NYTFTLGINQFADLTNDEF---RTTMACEMPSHSEKTPFMYENVTV  385
            K+NV +I+SFN   +  + LG+NQFADLTN+EF   R      M S+ + T F YEN+T 
Sbjct  66   KENVAHIDSFNRAKDKPYKLGVNQFADLTNEEFTASRNRFKGHMCSN-KATTFKYENLTA  124

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
            LP T++W ++GAVT IK+QGQCGCCWAFSAV A EG+T++ T KLISLSEQ+LVDC+T  
Sbjct  125  LPSTVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTKLTTGKLISLSEQELVDCDTKG  184

Query  563  -SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
               GC GG M  AF+++  N+G+TT ++YPY    G CNT K +  AA+I+G +++P NS
Sbjct  185  EDQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDGTCNTNKEANHAAKINGFEDVPANS  244

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            E A+ +AVANQPVSVAIDA G  FQFY GG+F+  C T   H VTAVGYGV   G KYWL
Sbjct  245  EDALQKAVANQPVSVAIDAGGFKFQFYSGGVFTGDCGTALDHGVTAVGYGVDDDGTKYWL  304

Query  920  LKN  928
            +KN
Sbjct  305  VKN  307



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 208/302 (69%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            + FAA+L L +    +AT+R   D  E  +M +++E+W+  +GRVY +  EK KRF +F+
Sbjct  10   LAFAALLVL-VSFASQATSR---DLYEAASMVQKHEQWMSHFGRVYKDDVEKAKRFKIFQ  65

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTV  385
             NVEYI   N  G   + LGIN+FADL+N+EFR T    +M SH   S+ T F Y NVT 
Sbjct  66   HNVEYIEFVNKAGTRPYKLGINEFADLSNEEFRDTRNGYKMTSHQQLSKTTSFKYANVTA  125

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVS  565
             P TM+W  +GAVT IK+QGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S
Sbjct  126  -PATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS  184

Query  566  H-GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT +NYPY      C T K S  AA+I+G +++P NSE
Sbjct  185  DMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTNATCKTGKESNHAAKITGYEDVPANSE  244

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTA+GYG    G +YWL+
Sbjct  245  SALLKAVANQPISVAIDASGSDFQFYSTGVFTGECGTELDHGVTAIGYGKTSDGTQYWLV  304

Query  923  KN  928
            KN
Sbjct  305  KN  306



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   312 bits (799),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 209/312 (67%), Gaps = 14/312 (4%)
 Frame = +2

Query  11   RMQGSRKNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQT  190
            R+QG    +  +  A IL +      EAT+R   D +  G   R+E+W+  YGR Y +  
Sbjct  6    RLQG----KACVCLALILIMLGACSSEATSRSLQDASMYG---RHEQWMARYGRTYNDIR  58

Query  191  EKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTP  361
            EK KRF++FK+NV   +S +  N  + L +NQFADLTNDEF+ +       H   ++ T 
Sbjct  59   EKEKRFNIFKENVXIESSNDDANKLYKLSVNQFADLTNDEFKASRN-RFKGHECSTKTTS  117

Query  362  FMYENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQ  538
            F YENVT  +P TM+W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ
Sbjct  118  FKYENVTASVPTTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQ  177

Query  539  QLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARIS  712
            +LVDC+T     GC GG M  AF+++ +N G++T ANYPY+   G CNT K +  AA+I+
Sbjct  178  ELVDCDTNGEDQGCEGGLMDDAFQFIQQNHGLSTEANYPYSGVDGTCNTKKEASIAAKIT  237

Query  713  GLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGV  892
            G +++P NSE A+++AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV
Sbjct  238  GYEDVPTNSEQALLKAVANQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGV  297

Query  893  MPGGKKYWLLKN  928
               G K+WL+KN
Sbjct  298  GDDGTKFWLVKN  309



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score =   312 bits (799),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 192/269 (71%), Gaps = 7/269 (3%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEFRT  319
            R+E+W+  +GR Y +  EK +R  +F++N+++I+S N G   + L  N+FADLTNDEFR 
Sbjct  44   RFEQWMALHGRQYMDAQEKEQRSQIFEENLKFIDSVNAGGRPYKLSANKFADLTNDEFRA  103

Query  320  TM----ACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGAT  487
                    E P+ +   PFMY NV+  P +M+W ++GAVTQ+K+QGQCGCCWAFSAV A 
Sbjct  104  MHMGFKGHECPTRASDAPFMYANVSA-PASMDWRKKGAVTQVKDQGQCGCCWAFSAVAAV  162

Query  488  EGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMR  661
            EGITQI+T KL+SLSEQ++VDC+T     GCNGG+M  AF+++  N G+TT A YPY   
Sbjct  163  EGITQIKTGKLVSLSEQEVVDCDTKGEDQGCNGGFMDDAFEFIINNHGLTTEAKYPYKAV  222

Query  662  KGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFST  841
             G CNT KAS  AA+I+G +++P N+E A+++AVANQPVSVAIDA G  FQFY GG+F+ 
Sbjct  223  DGTCNTKKASSGAAKITGYEDVPTNNEKALVKAVANQPVSVAIDASGYEFQFYSGGVFNG  282

Query  842  GCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             C T   H VTAVGYGV   G KYWL+KN
Sbjct  283  DCGTELDHGVTAVGYGVSSDGTKYWLVKN  311



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   311 bits (797),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 199/287 (69%), Gaps = 10/287 (3%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGN-YT  265
            +ATAR   D +    ++R+E+W+V+YGR Y N  EK  RF++FKDNVEYI S N     T
Sbjct  9    QATARTLPDTS---MVERHEQWMVQYGRTYKNDAEKANRFNIFKDNVEYIQSVNEAETRT  65

Query  266  FTLGINQFADLTNDEFRTT-----MACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQ  430
            + L IN+FADL ++EF+ +     M  +  S S+   F Y NV+ +PP+M+W ++GAVT 
Sbjct  66   YKLAINKFADLKHEEFQASRNGYKMRSQSKSSSKVLSFRYANVSGVPPSMDWTKKGAVTP  125

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-SHGCNGGWMQTAFKY  607
            +K+QGQCGCCWAFSAV ATEGI Q+ T  L+SLSEQ+LVDC+T    GCNGG M  AF++
Sbjct  126  VKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSEDQGCNGGLMDNAFEF  185

Query  608  VAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVA  787
            +  N G+TT +NYPY    G CN+ K S  AARI+G +++P NSE+A+++AVANQP+SVA
Sbjct  186  IISNNGLTTESNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVA  245

Query  788  IDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            IDA G   QFY  G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  246  IDASGPDIQFYSTGVFTGQCGTELDHGVTAVGYGATNDGTKYWLVKN  292



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   311 bits (798),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/301 (52%), Positives = 207/301 (69%), Gaps = 11/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
             V  A+L +      ++TAR  +D       +R+E+W+ +YGRVY +  E+  R+S+FK+
Sbjct  9    FVCLALLFISGAWPSKSTARTLLD---APMYERHEQWMTQYGRVYKDDNERATRYSIFKE  65

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEF---RTTMACEMPSHSEKTPFMYENVTVLP  391
            NV  I++FN     ++ LG+NQFADLTN+EF   R      M S  +  PF YENV+ +P
Sbjct  66   NVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFKGHMCS-PQAGPFRYENVSAVP  124

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--S  565
             TM+W + GAVT +K+QGQCGCCWAFSAV A EGI ++ T KLISLSEQ++VDC+T    
Sbjct  125  STMDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGED  184

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GCNGG M  AFK++ KN+G+TT ANYPY    G CNT KA+  AA+I+G +++P NSEA
Sbjct  185  QGCNGGLMDDAFKFIEKNKGLTTEANYPYKGTHGTCNTKKAANHAAKITGFEDVPANSEA  244

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+M+AVA QPVSVAIDA G  FQFY  G+F+  C T+  H VTAVGYGV   G KYWL+K
Sbjct  245  ALMKAVAKQPVSVAIDAGGYDFQFYSSGIFTGSCGTQLDHGVTAVGYGV-SDGSKYWLVK  303

Query  926  N  928
            N
Sbjct  304  N  304



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 194/277 (70%), Gaps = 7/277 (3%)
 Frame = +2

Query  119  NEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFAD  295
            N+E  ++R+E+W+  +GRVY +  EK +RF +FK NVE+I +FN  G   + LG+NQFAD
Sbjct  25   NDEAMVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGVNQFAD  84

Query  296  LTNDEFRTTMACEMPSHSEK----TPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCW  463
            LTN+EF+ +      S S K      F YENVT +P TM+W ++GAV  IK+QGQCG CW
Sbjct  85   LTNEEFKASRNGFKASSSLKLIRGASFKYENVTAVPATMDWRKKGAVAPIKDQGQCGSCW  144

Query  464  AFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH--GCNGGWMQTAFKYVAKNRGITTG  637
            AFSA+ ATEGIT++ T KLISLSEQ++VDC+  S   GCNGG M+ AF ++ KN+GI + 
Sbjct  145  AFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCNGGEMEDAFAFIVKNKGIASE  204

Query  638  ANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQF  817
            A YPYT   G C+  K +  AA+I+G + +P N+EAA+++AVANQPVSV+IDA G  FQF
Sbjct  205  ATYPYTAADGTCSKTKEASHAAKIAGYEKVPANNEAALLKAVANQPVSVSIDASGMAFQF  264

Query  818  YKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            Y  G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  265  YTSGVFTGDCGTDLDHGVTAVGYGKASNGTKYWLVKN  301



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/288 (55%), Positives = 199/288 (69%), Gaps = 11/288 (4%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NY  262
            CEAT+R   D +  G   RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N 
Sbjct  7    CEATSRSLQDASMYG---RYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVNK  63

Query  263  TFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQ  430
             + LG+NQFADLTN+EF+ +       H   ++ T F YENV   +P  M+W ++GAVT 
Sbjct  64   PYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYENVKAPVPAAMDWRKKGAVTP  122

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T  V  GC GG M  AF+
Sbjct  123  IKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQ  182

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ +N G++T ANYPY    G CNT KA+  AA+I+G +++P NSE A++ AVA+QPVSV
Sbjct  183  FIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSV  242

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  243  AIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKN  290



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 196/270 (73%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YGRVY + TE+  R+S+FK+NV  I++FN     ++ LG+NQFADLTN+EF
Sbjct  37   ERHEQWMTQYGRVYKDDTERATRYSIFKENVARIDAFNSQTGKSYKLGVNQFADLTNEEF  96

Query  314  ---RTTMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
               R      M S  +  PF YENV+ +P TM+W + GAVT +K+QGQCGCCWAFSAV A
Sbjct  97   KASRNRFKGHMCS-PQAGPFRYENVSAVPSTMDWRKEGAVTPVKDQGQCGCCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI ++ T KLISLSEQ++VDC+T     GCNGG M  AFK++ +N+G+TT ANYPY  
Sbjct  156  MEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT KA+  AA+I+G +++P NSEAA+M+AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  216  TDGTCNTNKAAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSSGIFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T+  H VTAVGYGV   G KYWL+KN
Sbjct  276  GSCDTQLDHGVTAVGYGV-SDGSKYWLVKN  304



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 182/271 (67%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEFR  316
            +++E+W+  YGRVY +  EK +RF +F+ NVE I SFN GN+ F LG NQFADLTN+EFR
Sbjct  36   EKHEQWMALYGRVYKDAAEKERRFKIFQANVELIESFNAGNHKFKLGANQFADLTNEEFR  95

Query  317  TTMACEMPSHSEKT-----PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
                         +      F YEN T +P +M+W  +GAVT IK+QGQCGCCWAFSAV 
Sbjct  96   AVHTXXXXXXXASSGMATKSFKYENATAVPVSMDWRAKGAVTPIKDQGQCGCCWAFSAVA  155

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            A EGIT++ T KLISLSEQ+LVDC+T     GC GG M  AFK++ KN G+TT ANYPY 
Sbjct  156  AMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTEANYPYE  215

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  K+   AA I G +++P NSEAA+++AVANQPVSVAIDA G  FQ Y  G+F
Sbjct  216  AADGTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQLYSSGVF  275

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGY     G KYWL+KN
Sbjct  276  TGDCGTELDHGVTAVGYDKTSDGTKYWLVKN  306



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 182/273 (67%), Gaps = 7/273 (3%)
 Frame = +2

Query  131  TMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDE  310
            T +++E+W+  YGR Y +  EK +RF +F+ NVE I SFN GN+ F LG NQFADLTN+E
Sbjct  34   TKEKHEQWMALYGRAYKDAAEKERRFKIFQANVELIESFNAGNHKFKLGANQFADLTNEE  93

Query  311  FRTTMACEMPSHSEKT-----PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSA  475
            FR             +      F YEN T +P +M+W  +GAVT IK+QGQCGCCWAFSA
Sbjct  94   FRAVHTXXXXXXXASSGMATKSFKYENATAVPVSMDWRAKGAVTPIKDQGQCGCCWAFSA  153

Query  476  VGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYP  649
            V A EGIT++ T KLISLSEQ+LVDC+T     GC GG M  AFK++ KN G+TT ANYP
Sbjct  154  VAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTEANYP  213

Query  650  YTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGG  829
            Y    G CN  K+   AA I G +++P NSEAA+++AVANQPVSVAIDA G  FQ Y  G
Sbjct  214  YEAADGTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSAFQLYSSG  273

Query  830  LFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +F+  C T   H VTAVGY     G KYWL+KN
Sbjct  274  VFTGDCGTDLDHGVTAVGYDKTSDGTKYWLVKN  306



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 193/274 (70%), Gaps = 6/274 (2%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADL  298
            E    +++E+W+ +YGRVY + T+K KR   FK N+EYI S N     T+ LGINQFAD+
Sbjct  31   EASITEKHEQWMSQYGRVYKDDTKKAKRLETFKQNLEYIESTNKDVTRTYKLGINQFADM  90

Query  299  TNDEFRTTMACEMPSHSEK---TPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAF  469
            TN+EF+        S  +K   T F YENVTV P +M+W ++GAVT+IK+QGQCGCCWAF
Sbjct  91   TNEEFKAIRNGYRISSQQKIKNTSFQYENVTV-PYSMDWRKKGAVTKIKDQGQCGCCWAF  149

Query  470  SAVGATEGITQIRTKKLISLSEQQLVDCETVSH-GCNGGWMQTAFKYVAKNRGITTGANY  646
            SAV ATEGI +I+T KLISLSEQ+LVDC+T S+ GC GG M  AFKY+ KN G+T+ +NY
Sbjct  150  SAVAATEGINKIKTGKLISLSEQELVDCDTNSNQGCEGGLMDDAFKYIIKNHGLTSESNY  209

Query  647  PYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKG  826
            PY    G C T K S   A+ISG +++P NSE+A+++AVANQPVSVAIDA G  FQFY  
Sbjct  210  PYKGIDGTCKTEKESNHIAKISGYKDVPENSESALLKAVANQPVSVAIDASGSDFQFYSS  269

Query  827  GLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            G+F+  C T   H V AVGYG    G KYW++KN
Sbjct  270  GIFTGKCGTELDHGVVAVGYGATKDGTKYWIVKN  303



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 208/305 (68%), Gaps = 10/305 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            N++  +  A+L +      +ATAR   + +E    +R+E+W+V+YGR Y +  EK KR+ 
Sbjct  5    NQYQYICLALLFVLAAWASQATAR---NLHEASMYERHEDWMVQYGREYKDADEKSKRYK  61

Query  212  VFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENV  379
            +FKDNV  I SFN   + ++ L IN+FADLTN+EFR +      +H   +E T F YENV
Sbjct  62   IFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN-RFKAHICSTEATSFKYENV  120

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            T +P T++W ++GAVT IK+QGQCG CWAFSAV A EGITQ+ T KLISLSEQ+LVDC+T
Sbjct  121  TAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDT  180

Query  560  V--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GC+GG M  AFK++ +N G+TT ANYPY    G CN  KA+  AA+I+G +++P 
Sbjct  181  SGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPA  240

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N+E A+ +AVA+QP++VAIDA G  FQFY  G+F+  C T   H V+AVGYG    G KY
Sbjct  241  NNEKALQKAVAHQPIAVAIDAGGSEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMKY  300

Query  914  WLLKN  928
            WL+KN
Sbjct  301  WLVKN  305



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 206/305 (68%), Gaps = 10/305 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            N++  +  A+L +      +ATAR     +E    +R+E+W+V+YGR Y +  EK KR+ 
Sbjct  5    NQYQYICLALLFVLAAWASQATAR---SLHEASMYERHEDWMVQYGREYKDADEKSKRYK  61

Query  212  VFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENV  379
            +FKDNV  I SFN   + ++ L IN+FADLTN+EFR +      +H   +E T F YENV
Sbjct  62   IFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN-RFKAHICSTEATSFKYENV  120

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            T +P T++W ++GAVT IK+QGQCG CWAFSAV A EGITQ+ T KLISLSEQ+LVDC+T
Sbjct  121  TAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDT  180

Query  560  V--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GC+GG M  AFK++ +N G+TT ANYPY    G CN  KA+  AA+I+G +++P 
Sbjct  181  SGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPA  240

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N+E A+ +AVA+QP++VAIDA G  FQFY  G+F+  C T   H V AVGYG    G KY
Sbjct  241  NNEKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKY  300

Query  914  WLLKN  928
            WL+KN
Sbjct  301  WLVKN  305



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 190/268 (71%), Gaps = 5/268 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFR  316
            RYE+W+  YGR+Y +  EK  RF +FK+NV +I S N   N  + L +NQFADLTN+EF+
Sbjct  40   RYEQWLTRYGRIYNDVNEKETRFKIFKENVAFIESSNKDANKPYRLSVNQFADLTNEEFK  99

Query  317  TTM-ACEMPSHSEKTPFMYENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATE  490
            T+    +    S KT F YEN+T  LP TM+W ++GAVT IK+QGQCGCCWAFSAV ATE
Sbjct  100  TSRNGFKGHECSTKTSFKYENLTASLPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATE  159

Query  491  GITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRK  664
            GITQ+ T KLISLSEQ+LVDC+T     GC GG M  AF+++ +NRGI+T ANYPY    
Sbjct  160  GITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGISTEANYPYDGVD  219

Query  665  GMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTG  844
            G CN  K +  AA+I+G +++P NSE A++ AVA+QPVSVAIDA G  FQFY  G+F+  
Sbjct  220  GTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGT  279

Query  845  CTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            C T   H VTAVGYGV   G KYWL+KN
Sbjct  280  CGTSLDHGVTAVGYGVSEDGTKYWLVKN  307



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   308 bits (790),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 193/270 (71%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YGRVY +  EK  R+++FK+NV  I++FN     ++ LG+NQFADLTN+EF
Sbjct  6    ERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYNLGVNQFADLTNEEF  65

Query  314  ---RTTMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
               R      M S  +  PF YENV+ +P TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  66   KASRNRFKGHMCS-PQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  124

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI Q+ T KLISLSEQ++VDC+T     GCNGG M  AFK++ +N+G+TT ANYPYT 
Sbjct  125  MEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTG  184

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K    AA+I+G Q++P NSEAA+M+AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  185  TDGTCNTQKEVSHAAKITGFQDVPANSEAALMKAVAKQPVSVAIDAGGFEFQFYSSGIFT  244

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  245  GSCGTELDHGVTAVGYG-GSDGTKYWLVKN  273



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 206/305 (68%), Gaps = 10/305 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            N++  +  A+L +      +ATAR     +E    +R+E+W+V+YGR Y +  EK KR+ 
Sbjct  5    NQYQYICLALLFVLAAWASQATARXL---HEASMYERHEDWMVQYGREYKDADEKSKRYK  61

Query  212  VFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENV  379
            +FKDNV  I SFN   + ++ L IN+FADLTN+EFR +      +H   +E T F YENV
Sbjct  62   IFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN-RFKAHICSTEATSFKYENV  120

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            T +P T++W ++GAVT IK+QGQCG CWAFSAV A EGITQ+ T KLISLSEQ+LVDC+T
Sbjct  121  TAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDT  180

Query  560  V--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GC+GG M  AFK++ +N G+TT ANYPY    G CN  KA+  AA+I+G +++P 
Sbjct  181  SGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPA  240

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N+E A+ +AVA+QP++VAIDA G  FQFY  G+F+  C T   H V AVGYG    G KY
Sbjct  241  NNEKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKY  300

Query  914  WLLKN  928
            WL+KN
Sbjct  301  WLVKN  305



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 207/303 (68%), Gaps = 19/303 (6%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVF  217
            L+VF   L+ E  AR            E+ +M +R+E+W+ +YG+VY +  EK  R  +F
Sbjct  15   LLVFG-FLSFEANARTL----------EDASMHERHEQWMAQYGKVYKDSYEKELRSKIF  63

Query  218  KDNVEYINSFN-LGNYTFTLGINQFADLTNDEF--RTTMACEMPSHSEKTP-FMYENVTV  385
            K+NV+ I +FN  GN ++ LGINQFADLTN+EF  R      M S+S +TP F YE+VT 
Sbjct  64   KENVQRIEAFNNAGNKSYKLGINQFADLTNEEFKARNRFKGHMCSNSTRTPTFKYEHVTS  123

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--  559
            +P +++W Q+GAVT IK+QGQCGCCWAFSAV ATEGIT++ T KLISLSEQ+LVDC+T  
Sbjct  124  VPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKG  183

Query  560  VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
            V  GC GG M  AFK++ +N+G+ T A YPY      CN    ++ AA I G +++P NS
Sbjct  184  VDQGCEGGLMDDAFKFIMQNKGLNTEAKYPYQGVDATCNANAEAKDAASIKGFEDVPANS  243

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            E+A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYG   GG KYWL
Sbjct  244  ESALLKAVANQPISVAIDASGSEFQFYSSGVFTGSCGTELDHGVTAVGYG-SDGGTKYWL  302

Query  920  LKN  928
            +KN
Sbjct  303  VKN  305



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 203/297 (68%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L  GA  CEAT+R   D +  G   +YE+W+  YGRVY +  EK  RF +FK+NV +I
Sbjct  11   LILMFGAWSCEATSRSLQDASMYG---KYEQWMTRYGRVYNDVNEKENRFKIFKENVAFI  67

Query  239  NSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
             S N   N  + LG+NQFADLTN+EF+ +       H   ++ T F YENV   +P  M+
Sbjct  68   ESSNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYENVKAPVPAAMD  126

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCN  577
            W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T  V  GC 
Sbjct  127  WRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCE  186

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N G++T ANYPY    G CNT KA+  AA+I+G +++P NSE A++ 
Sbjct  187  GGLMDDAFQFIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLT  246

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  247  AVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKN  303



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 187/270 (69%), Gaps = 6/270 (2%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEFR  316
            +R+E+W+ + GR Y +  EK +R+ +FK NVE I SFN GN  + LG+NQFADLTN+EF+
Sbjct  37   ERHEQWMAQQGRAYRDSAEKERRYQIFKANVELIESFNAGNSKYKLGVNQFADLTNEEFK  96

Query  317  TTMACEMPSHSEKTP----FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
              M    PS  +       F YENVT +P +M+W  +GAVT IK+QGQCGCCWAFSAV A
Sbjct  97   AMMNGFKPSTLKTLKATNVFSYENVTAVPSSMDWRAKGAVTPIKDQGQCGCCWAFSAVAA  156

Query  485  TEGITQIRTKKLISLSEQQLVDCETVS--HGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGIT+++T KL+SLSEQ+LVDC+  S   GC+GG M  AFK++  NRG+TT  NYPY  
Sbjct  157  MEGITKLKTGKLMSLSEQELVDCDVASDDQGCDGGLMDNAFKFIINNRGLTTETNYPYKG  216

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN+ K++   A I G +++P NSEAA+++AVANQPVSVAI+A    FQFY  G+F+
Sbjct  217  IDGTCNSKKSASHVASIKGYEDVPANSEAALLKAVANQPVSVAIEASSGSFQFYSSGIFT  276

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VT VGYG    G KYWL+KN
Sbjct  277  GSCGTDLDHGVTTVGYGTTKDGTKYWLVKN  306



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 160/301 (53%), Positives = 207/301 (69%), Gaps = 12/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            I+ A I  L  GA   +AT+R   D +  G   RYE+W+  YGRVY++  EK KRF++FK
Sbjct  12   IILALIFML--GALSSQATSRTLQDASMYG---RYEQWMARYGRVYSDINEKEKRFNIFK  66

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVTVLP  391
            +NV +I S N   N    L +NQFADLTN+EF+ +    M     ++ T F YENVT  P
Sbjct  67   ENVAFIESSNNDANKLHKLSVNQFADLTNEEFKASRNRFMGHECSAKTTSFKYENVTA-P  125

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VS  565
            PT++W ++GAVT +K+QGQCGCCWAFSAV A EGIT++ T KLISLSEQ+LVDC+T  V 
Sbjct  126  PTLDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVD  185

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AF+++ +N G++T  NYPYT   G CNT K +  AA+I+G +++P NSE 
Sbjct  186  QGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSEE  245

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+K
Sbjct  246  ALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVK  305

Query  926  N  928
            N
Sbjct  306  N  306



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 205/311 (66%), Gaps = 15/311 (5%)
 Frame = +2

Query  14   MQGSRKNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTE  193
            M  + ++  L+    I A      C+A++R      E     R+E+W+   GRVY + +E
Sbjct  1    MASTSRSLALLFIVGIWA------CQASSR---SVPEVSMSDRFEQWLASCGRVYQDASE  51

Query  194  KMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEF---RTTMACEMPSHSEKTP  361
            K KR  +FK+NVEYI S N   +  + LG+N+F DLTN+EF   R        + S+K+ 
Sbjct  52   KEKRLQIFKENVEYIESHNADTSKKYKLGVNEFTDLTNEEFKAMRNGYKLRPSTSSKKSS  111

Query  362  FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQ  541
            F YENV  +P +M+W ++GAVT IK+QGQCGCCWAFSAV A EGI Q++T KLISLSEQ+
Sbjct  112  FRYENVAAVPSSMDWRKKGAVTNIKDQGQCGCCWAFSAVAAMEGINQLKTGKLISLSEQE  171

Query  542  LVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISG  715
            LVDC+      GCNGG+M  AF+++  N+G+TT +NYPY    G CN  KA+  AA+I+ 
Sbjct  172  LVDCDINGEDQGCNGGFMDNAFEFIISNKGLTTESNYPYEGVDGSCNKKKAANHAAQITS  231

Query  716  LQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVM  895
             +++P NSEAA+++AVANQPVSVAIDA G  FQ YK G+F+  C+T   H VTAVGYG  
Sbjct  232  FEDVPSNSEAALLKAVANQPVSVAIDAGGSDFQHYKSGIFTGECSTFLDHGVTAVGYGTA  291

Query  896  PGGKKYWLLKN  928
              G KYWL+KN
Sbjct  292  DDGTKYWLVKN  302



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   309 bits (791),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 196/270 (73%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YGRVY +  EK  R+++FK+NV  I++FN     ++ LG+NQFADL+N+EF
Sbjct  37   ERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYKLGVNQFADLSNEEF  96

Query  314  RTTMACEMPSH---SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            + +       H    +  PF YENV+ +P TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  97   KASRN-RFKGHMCSPQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI Q+ T KLISLSEQ++VDC+T     GCNGG M  AFK++ +N+G+TT ANYPYT 
Sbjct  156  MEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K +  AA+I+G +++P NSEAA+M+AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  216  TDGTCNTQKEATHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGFEFQFYSSGIFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T+  H VTAVGYG+   G KYWL+KN
Sbjct  276  GSCGTQLDHGVTAVGYGI-SDGTKYWLVKN  304



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   309 bits (791),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 160/301 (53%), Positives = 207/301 (69%), Gaps = 12/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            I+ A I  L  GA   +AT+R   D +  G   RYE+W+  YGRVY++  EK KRF++FK
Sbjct  12   IILALIFML--GALSSQATSRTLQDASMYG---RYEQWMAHYGRVYSDINEKEKRFNIFK  66

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVTVLP  391
            +NV +I S N   N    L +NQFADLTN+EF+ +    M     ++ T F YENVT  P
Sbjct  67   ENVAFIESSNNDANKLHKLSVNQFADLTNEEFKASRNRFMGHECSAKTTSFKYENVTA-P  125

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VS  565
            PT++W ++GAVT +K+QGQCGCCWAFSAV A EGIT++ T KLISLSEQ+LVDC+T  V 
Sbjct  126  PTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVD  185

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AF+++ +N G++T  NYPYT   G CNT K +  AA+I+G +++P NSE 
Sbjct  186  QGCEGGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSEE  245

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+K
Sbjct  246  ALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVK  305

Query  926  N  928
            N
Sbjct  306  N  306



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   309 bits (791),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 161/295 (55%), Positives = 201/295 (68%), Gaps = 9/295 (3%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L +GA    AT+R   D +  G   RYE+W+  YGRVY +  EK  RF +FK+NV +I
Sbjct  16   LILMLGAWSSGATSRTLQDASMYG---RYEQWLTRYGRVYNDVNEKETRFKIFKENVAFI  72

Query  239  NSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEKTPFMYENVTV-LPPTMNWL  409
             S N   N  + L +NQFADLTN+EF+ +    +    S KT F YEN+T  LP TM+W 
Sbjct  73   ESSNKDANKPYRLSVNQFADLTNEEFKASRNGFKGHECSTKTSFKYENLTASLPATMDWR  132

Query  410  QRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGG  583
            ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T     GC GG
Sbjct  133  KKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCEGG  192

Query  584  WMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAV  763
             M  AF+++ +NRGI+T ANYPY    G CN  K +  AA+I+G +++P NSE A++ AV
Sbjct  193  LMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLTAV  252

Query  764  ANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  253  AHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  307



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 194/273 (71%), Gaps = 8/273 (3%)
 Frame = +2

Query  134  MKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADLTNDE  310
            ++++E+W+V+ GR Y +  EK  R+ +FK NVEYI S +   N+T+ L IN+FADLTN+E
Sbjct  17   IEKHEQWMVQCGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAQNWTYKLAINKFADLTNEE  76

Query  311  FRTTM------ACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFS  472
            F+ +       +  + S  E + F Y NV+ +PP+++W ++GAVT +K+QGQCGCCWAFS
Sbjct  77   FQASRNGFKKGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTPVKDQGQCGCCWAFS  136

Query  473  AVGATEGITQIRTKKLISLSEQQLVDCETV-SHGCNGGWMQTAFKYVAKNRGITTGANYP  649
            AV ATEG+ QI+T  LISLSEQ+LVDC+T    GCN G M  AF+++  N G+TT +NYP
Sbjct  137  AVAATEGLNQIKTGNLISLSEQELVDCDTSEDQGCNDGLMDNAFEFIISNNGLTTESNYP  196

Query  650  YTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGG  829
            Y    G CN+ K S   A+I+G +++P NSE+A+++AVANQP+SVAIDA G  FQFY GG
Sbjct  197  YEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFYSGG  256

Query  830  LFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +FS  C T   H VTAVGYGV   G KYWL+KN
Sbjct  257  VFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKN  289



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 194/268 (72%), Gaps = 5/268 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            R+E+W+ +YGRVY N+ EK KRF++FK+NVEYI SFN  G   + LGIN FADLTN EF+
Sbjct  38   RHEQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAGTKPYKLGINAFADLTNQEFK  97

Query  317  TTM-ACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATE  490
             +    ++P   S  TPF YENV+ +P T++W  +GAVT +K+QGQCGCCWAFSAV A E
Sbjct  98   ASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQGQCGCCWAFSAVAAME  157

Query  491  GITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRK  664
            GIT++ T  LISLSEQ+LVDC+   +  GC GG M  AF ++  N+G+TT +NYPY    
Sbjct  158  GITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFSFIINNKGLTTESNYPYQGTD  217

Query  665  GMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTG  844
            G C  +K+S +AA+ISG +++P NSE+A+ +AVANQPVSVAIDA G  FQFY  G+F+  
Sbjct  218  GSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGE  277

Query  845  CTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            C T   H VTAVGYG+   G KYWL+KN
Sbjct  278  CGTELDHGVTAVGYGIAEDGSKYWLVKN  305



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 198/288 (69%), Gaps = 11/288 (4%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NY  262
            CEAT+R   D +  G   RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N 
Sbjct  7    CEATSRSLQDASMYG---RYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVNK  63

Query  263  TFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQ  430
             + LG+NQFADLTN+EF+ +       H   ++ T F YEN+   +P TM+W ++GAVT 
Sbjct  64   PYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYENIKAPVPATMDWRKKGAVTP  122

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T     GC GG M  AF+
Sbjct  123  IKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQ  182

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ +N G++  ANYPY    G CNT KA+  AA+I+G +++P NSE A++ AVA+QPVSV
Sbjct  183  FIQQNHGLSAEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSV  242

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  243  AIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKN  290



>ref|XP_003605890.1| Cysteine proteinase [Medicago truncatula]
 gb|AES88087.1| papain family cysteine protease [Medicago truncatula]
Length=343

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/288 (53%), Positives = 195/288 (68%), Gaps = 12/288 (4%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG--NY  262
            + T+R   DD  E    R+ +W+ +YG+VY +  E+ KRF +F +NV YI +FN G  N 
Sbjct  24   QVTSRTLQDDMYE----RHRQWMSQYGKVYKDSQEREKRFKIFTENVNYIEAFNKGDNNK  79

Query  263  TFTLGINQFADLTNDEF---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQ  430
             +TLG+NQFADLTNDEF   R      M S   +T  F YEN + +P +++W ++GAVT 
Sbjct  80   LYTLGVNQFADLTNDEFTSSRNKFKGHMCSSITRTSTFKYENASAIPSSVDWRKKGAVTP  139

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            +KNQGQCGCCWAFSAV ATEGI ++ T KLISLSEQ+LVDC+T  V  GC GG M  AFK
Sbjct  140  VKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFK  199

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ +N G+ T ANYPY    G CN  K S  A  I+G +++P N+E A+ +AVANQP+SV
Sbjct  200  FIIQNHGLNTEANYPYQGVDGTCNANKGSINAVTITGYEDVPTNNEQALQKAVANQPISV  259

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AIDA G  FQFYK G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  260  AIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKN  307



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 206/305 (68%), Gaps = 10/305 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            N++  +  A+L +      +ATAR   + +E    +R+E+W+ +YGRVY +  EK KR+ 
Sbjct  5    NQYQYICLALLFVLAAWASQATAR---NLHEASMYERHEDWMAQYGRVYKDADEKSKRYK  61

Query  212  VFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENV  379
            +FKDNV  I SFN   + ++ L IN+FADLTN+EF T+      +H   +E T F YENV
Sbjct  62   IFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFGTSRN-RFKAHICSTEATSFKYENV  120

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            T +P T++W ++GAVT IK+QGQCG CWAFSAV A EGITQ+ T KLISLSEQ+LVDC+T
Sbjct  121  TAVPSTIDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDT  180

Query  560  V--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GCNGG M  AFK++ +N G+TT ANYPY    G CN  KA+  AA+I+G +++P 
Sbjct  181  SGEDQGCNGGLMDDAFKFIKQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPA  240

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N+E A+ +AV +QP++VAIDA G  FQFY  G+F+  C T   H V AVGYG    G KY
Sbjct  241  NNEKALQKAVVHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKY  300

Query  914  WLLKN  928
            WL+KN
Sbjct  301  WLVKN  305



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 199/297 (67%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L MGA    AT+R   D +  G   RYE+W+  YGRVY N  EK  RF +F +NV +I
Sbjct  16   LILMMGAWSSGATSRTLQDASMYG---RYEQWLTRYGRVYNNVNEKETRFKIFNENVAFI  72

Query  239  NSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
             S N   N  + L +NQFADLTN+EF+ +       H   +E T F YENVT  LP TM+
Sbjct  73   ESSNKYANKPYKLSVNQFADLTNEEFKASRN-GFKGHECSTETTSFKYENVTASLPATMD  131

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCN  577
            W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T     GC 
Sbjct  132  WRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCE  191

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N GI+T ANYPY    G CN  K +  AA+I+G +++P NSE A++ 
Sbjct  192  GGLMDDAFQFIQQNHGISTEANYPYDGVDGACNAKKEASHAAKITGFEDVPANSEKALLA  251

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  308



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 199/285 (70%), Gaps = 9/285 (3%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYT  265
            +AT+R   D +  G   +YE+W+  YGRVY    EK KRF++FK+NV +I S N   N  
Sbjct  26   QATSRALQDASMYG---KYEQWMARYGRVYTGINEKEKRFNIFKENVAFIESSNKDANKL  82

Query  266  FTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVTVLPPTMNWLQRGAVTQIKN  439
            + L +NQFADLTN++F+ +    M     + KT F YENVT  PPT++W ++GAVT IK+
Sbjct  83   YKLSVNQFADLTNEQFKASRNGFMGHECSAAKTSFKYENVTA-PPTVDWRKKGAVTPIKD  141

Query  440  QGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVA  613
            QGQCGCCWAFSAV A EGIT++ T KLISLSEQ+LVDC+T  V  GC GG M  AF+++ 
Sbjct  142  QGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCQGGLMDDAFQFIN  201

Query  614  KNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAID  793
            +N G++T ANYPYT   G CNT K +  AA+I+G +++P N E A+M+AVANQP+SVAID
Sbjct  202  QNHGLSTEANYPYTGVDGTCNTKKEANHAAKITGHEDVPANREDALMKAVANQPISVAID  261

Query  794  AMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  262  ASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKN  306



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 191/268 (71%), Gaps = 6/268 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            +YE+W+  YGR YA+  EK KRF++FK+NV +I S N   N  + L +NQFADLTN+EF+
Sbjct  40   KYEQWMASYGRAYADINEKEKRFNIFKENVAFIESSNNDANKLYKLSVNQFADLTNEEFK  99

Query  317  TTMACEMPSH--SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATE  490
             +    M     ++ T F YENVT  PPT++W  +GAVT IK+QGQCGCCWAFSAV A E
Sbjct  100  ASRNGFMGHECSTKTTAFKYENVTA-PPTVDWRNKGAVTPIKDQGQCGCCWAFSAVAAME  158

Query  491  GITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRK  664
            GIT++ T KLISLSEQ+LVDC+T  V  GC GG M  AF+++ KN G++T  NYPYT   
Sbjct  159  GITKLTTGKLISLSEQELVDCDTSGVDQGCGGGLMDDAFQFINKNHGLSTETNYPYTGVD  218

Query  665  GMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTG  844
            G CNT K +  AA+I+G +++P NSE A+++AVANQP+SVAIDA G  FQFY  G+F+  
Sbjct  219  GTCNTKKEASHAAKITGYEDVPANSEEALLKAVANQPISVAIDAGGSDFQFYSSGVFTGT  278

Query  845  CTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            C T   H VTAVGYG+   G KYWL+KN
Sbjct  279  CGTSLDHGVTAVGYGISADGTKYWLVKN  306



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 189/270 (70%), Gaps = 7/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT-FTLGINQFADLTNDEF  313
            +RYE+W   YGRVY +  EK KRF++FK NV +I +FN  +   + L +N+FADLTN+EF
Sbjct  37   ERYEQWTARYGRVYRDNVEKEKRFTIFKRNVAHIEAFNKASKKPYKLAVNEFADLTNEEF  96

Query  314  RTTMACEMPSH--SEKT-PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            + +       H  SE+T PF YENVT +P TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  97   KVSRN-RFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI Q+ T KL SLSEQ+LVDC+      GCNGG M  AF++V KN+GITT  NYPY  
Sbjct  156  IEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN  + +  AA+I+G +++P NSE A+M+AVANQPVSVAIDA G  FQFY  G+F+
Sbjct  216  VDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGSDFQFYSSGVFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  276  GDCGTELDHGVTAVGYGAADDGTKYWLVKN  305



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 193/268 (72%), Gaps = 5/268 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            R+E+W+ +YGRVY N+ EK KR+++FK+NVEYI SFN  G   + LGIN FADLTN EF 
Sbjct  36   RHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFI  95

Query  317  TTMACEMPSH--SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATE  490
             +    +  H  S  TPF YENV+ +P T++W ++GAVT +K+QGQCGCCWAFSAV A E
Sbjct  96   ASRNGYILPHECSSNTPFRYENVSAVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAME  155

Query  491  GITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRK  664
            GIT++ T  LISLSEQ+LVDC+   +  GC GG M  AF ++  N+G+TT +NYPY    
Sbjct  156  GITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTD  215

Query  665  GMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTG  844
            G C  +K+S +AA+ISG +++P NSE+A+ +AVANQPVSVAIDA G  FQFY  G+F+  
Sbjct  216  GSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGE  275

Query  845  CTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            C T   H VTAVGYG+   G KYWL+KN
Sbjct  276  CGTELDHGVTAVGYGIAEDGSKYWLVKN  303



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/304 (51%), Positives = 203/304 (67%), Gaps = 15/304 (5%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMK-RYEEWIVEYGRVYANQTEKMKRFSVF  217
            ++V  A+L L       + AR R  +  E TM+ R+++W+  +GRVY +  EK +RFS+F
Sbjct  10   VLVMVAVLGL-----WASQARSR--ELHEATMRERHDQWMARHGRVYQDDAEKERRFSIF  62

Query  218  KDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTT----MACEMPSHSEKTPFMYENVT  382
            K+NV+ + SFN  GN  +TL IN FADLT +EF+ +    M    P      PF YENVT
Sbjct  63   KNNVDLVESFNKNGNKPYTLAINAFADLTIEEFKASRNGYMRSSSPRQVSTKPFRYENVT  122

Query  383  VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             +P +M+W ++GAVT IKNQGQCG CWAFSAVGA EGI Q+ T KLISLSEQ+LVDC+T 
Sbjct  123  AVPSSMDWRKKGAVTPIKNQGQCGSCWAFSAVGAMEGIIQLTTGKLISLSEQELVDCDTS  182

Query  563  --SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPN  736
               HGC GG+M  AFK++    G+TT  NYPY    G CN  KA+ +AA+I+G  ++P N
Sbjct  183  GKDHGCEGGYMDDAFKFIIGRHGLTTETNYPYQAVDGTCNARKANSSAAKITGYADVPAN  242

Query  737  SEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYW  916
            +E+A+++AV +QPVSVAIDA    FQFY  G+F+  C T   H VTAVGYG    G KYW
Sbjct  243  NESALLKAVGHQPVSVAIDAGEWAFQFYSSGIFTGECGTNLDHGVTAVGYGTSENGTKYW  302

Query  917  LLKN  928
            L+KN
Sbjct  303  LVKN  306



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/302 (53%), Positives = 209/302 (69%), Gaps = 13/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            + FAA+L L M A   A++R       EG+M +++E+W+  + RVY +  EK KR  +FK
Sbjct  9    LAFAALLVLGMQA-SRASSRGFY----EGSMVQKHEQWMDRFRRVYKDDAEKEKRLKIFK  63

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSH---SEKTPFMYENVTV  385
            +N EYI+S N  G   + LGIN+FADLTN+EFR T    +M SH   SE T F YENVT 
Sbjct  64   ENAEYIDSVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMRSHQKSSETTSFKYENVTA  123

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
             P +++W ++GAVT +K+QGQCGCCWAFSAV ATEGI +I+  KLISLSEQ+LVDC+T  
Sbjct  124  -PTSIDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKKGKLISLSEQELVDCDTSW  182

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
            + GC GG M  AFK++ KN G+TT +NYPY    G C T K S  AA+I+G +++P NSE
Sbjct  183  NMGCQGGLMDYAFKFIIKNHGLTTESNYPYEGIDGTCKTGKKSNHAAKIAGYEDVPVNSE  242

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTA+GYG    G  YWL+
Sbjct  243  SALLKAVAHQPVSVAIDASGPDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTDYWLV  302

Query  923  KN  928
            KN
Sbjct  303  KN  304



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 188/270 (70%), Gaps = 7/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT-FTLGINQFADLTNDEF  313
            +RYE+W   YGRVY +  EK KRF++FK NV +I +FN  +   + L +N+FADLTN+EF
Sbjct  37   ERYEQWTARYGRVYRDNAEKEKRFTIFKQNVAHIEAFNKASKKPYKLAVNEFADLTNEEF  96

Query  314  RTTMACEMPSH--SEKT-PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            + +       H  SE+T PF YENVT +P TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  97   KVSRN-RFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI Q+ T KL SLSEQ+LVDC+      GCNGG M  AF++V KN+GITT  NYPY  
Sbjct  156  IEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN  + +  AA+I+G +++P NSE A+M AVANQPVSVAIDA G  FQFY  G+F+
Sbjct  216  VDGKCNAKEEANHAAKINGHEDVPANSETALMNAVANQPVSVAIDAGGSDFQFYSSGVFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  276  GDCGTELDHGVTAVGYGAADDGTKYWLVKN  305



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 195/270 (72%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YGRVY +  E+  R+S+FK+NV  I++FN     ++ LG+NQFADLTN+EF
Sbjct  37   ERHEQWMTQYGRVYKDDNERATRYSIFKENVARIDAFNSQTGKSYKLGVNQFADLTNEEF  96

Query  314  ---RTTMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
               R      M S  +  PF YENV+ +P T++W + GAVT +K+QGQCGCCWAFSAV A
Sbjct  97   KASRNRFKGHMCS-PQAGPFRYENVSAVPSTVDWRKEGAVTPVKDQGQCGCCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI ++ T KLISLSEQ++VDC+T     GCNGG M  AFK++ +N+G+TT ANYPY  
Sbjct  156  MEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT KA+  AA+I+G +++P NSEAA+M+AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  216  TDGTCNTNKAAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSSGIFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T+  H VTAVGYGV   G KYWL+KN
Sbjct  276  GSCDTQLDHGVTAVGYGV-SDGSKYWLVKN  304



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 202/297 (68%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L   +GA  CEAT+R   D +  G   RYE+W+  YGRVY +  EK  RF +FK+NV +I
Sbjct  11   LLFMLGAWSCEATSRSLQDASMYG---RYEQWMTRYGRVYNDVNEKENRFKIFKENVAFI  67

Query  239  NSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
             S N   N  + LG+NQFADLTN+EF+ +       H   ++ T F YENV   +P TM+
Sbjct  68   ESSNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYENVKAPVPATMD  126

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCN  577
            W ++GAVT +K+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T     GC 
Sbjct  127  WRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCE  186

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N G++  ANYPY    G CNT KA+  AA+I+G +++P NSE A++ 
Sbjct  187  GGLMDDAFQFIQQNHGLSAEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLT  246

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  247  AVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKN  303



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 204/306 (67%), Gaps = 9/306 (3%)
 Frame = +2

Query  32   NRH-LIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            N+H  +  A I         +AT+R  +   +    +R+E+W+ +YGRVY +  +K KRF
Sbjct  5    NQHGCLCLALIFIFGTNLVFQATSR-TLPIQDSAMYERHEQWMAQYGRVYKDSNDKEKRF  63

Query  209  SVFKDNVEYINSFNLGN-YTFTLGINQFADLTNDEF---RTTMACEMPSHSEKTPFMYEN  376
             +FK+NV  I++FN  N   + LGINQFADLTN+EF   R      M S++  + F YEN
Sbjct  64   KIFKENVARIDAFNTANGKPYKLGINQFADLTNEEFTASRNRFKGHMCSNTAAS-FKYEN  122

Query  377  VTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCE  556
            VT +P  M+W Q+GAVT +K+QGQCGCCWAFSAV A EGI  I T KLISLSEQ+LVDC+
Sbjct  123  VTAVPSAMDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGINMITTGKLISLSEQELVDCD  182

Query  557  TV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIP  730
            T     GC GG M  AFK++ K +G+TT  +YPY    G CNT K +  AA+I+G +++P
Sbjct  183  TKGEDQGCQGGLMDDAFKFIQKIQGLTTETDYPYRGVDGTCNTNKEANHAAKINGYEDVP  242

Query  731  PNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKK  910
             NSE  +++AVANQPVSVAIDA G  FQFY GG+F+  C T+  H VTAVGYGV   G K
Sbjct  243  ANSETVLLKAVANQPVSVAIDAGGFEFQFYSGGIFTGACETQLDHGVTAVGYGVGDDGTK  302

Query  911  YWLLKN  928
            YWL+KN
Sbjct  303  YWLVKN  308



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/297 (54%), Positives = 203/297 (68%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGARC-EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L  GA C EAT+R   D +  G   RYE+W+  YGR+Y +  EK  RF +FK+NV +I
Sbjct  11   LILMFGAWCCEATSRSLQDASMYG---RYEQWMTRYGRIYNDVNEKENRFKIFKENVAFI  67

Query  239  NSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
             S N   N  + LG+NQFADLTN+EF+ +       H   ++ T F YENV   +P TM+
Sbjct  68   ESSNNDVNKPYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYENVKAPVPATMD  126

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCN  577
            W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T     GC 
Sbjct  127  WRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCE  186

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N G++T ANYPY    G CNT KA+  AA+I+G +++P NSE A++ 
Sbjct  187  GGLMDDAFQFIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLT  246

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G K+WL+KN
Sbjct  247  AVAHQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKFWLVKN  303



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score =   320 bits (821),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/299 (54%), Positives = 206/299 (69%), Gaps = 11/299 (4%)
 Frame = +2

Query  50   FAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNV  229
            F A+  L M    E T+R   + NE   ++++E+W+  +GRVY +  EK KRF++FKDNV
Sbjct  473  FLALAVLTMWT-IEVTSR---ELNEASMVQKHEKWMARFGRVYRDDAEKAKRFNIFKDNV  528

Query  230  EYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSHSEKTP----FMYENVTVLPP  394
            +YI S N  G   + L IN FADLTN+EFR T     PS  +K+     F YE+VT  P 
Sbjct  529  DYIESINKSGMRPYKLSINGFADLTNEEFRATHNGYKPSSHQKSSKTVSFRYEDVTA-PA  587

Query  395  TMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH-G  571
            TM+W ++GAVT +K+QGQCGCCWAFSAV ATEGI +I+T KLISLSEQ+LVDC+T S  G
Sbjct  588  TMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINEIKTGKLISLSEQELVDCDTSSDMG  647

Query  572  CNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAI  751
            C GG M  AFK++ KN G+TT +NYPY    G C T K S  AA+I+G +++P NSE+++
Sbjct  648  CEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKKSNGAAKITGYEDVPANSESSL  707

Query  752  MQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            + AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG+   G KYWL+KN
Sbjct  708  LSAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGITSDGTKYWLVKN  766



>ref|XP_009759551.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=349

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 197/281 (70%), Gaps = 11/281 (4%)
 Frame = +2

Query  119  NEEGTMK-RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFA  292
            N E +M+ R+++WI  + +VY +  EK  RF +FK+NVE I +FN G +  + LG+N+F+
Sbjct  33   NYEASMRARHDQWIAHHDKVYKDLNEKEMRFKIFKENVERIEAFNAGEDKGYKLGVNKFS  92

Query  293  DLTNDEFRTTMACEMPSHSE-------KTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQC  451
            DLTN++FR        SH +       KT F Y NVT +PPTM+W ++GAVT IK+Q +C
Sbjct  93   DLTNEKFRVLHTGYKRSHPKVMSSSKPKTHFRYANVTDIPPTMDWRKKGAVTPIKDQKEC  152

Query  452  GCCWAFSAVGATEGITQIRTKKLISLSEQQLVDC--ETVSHGCNGGWMQTAFKYVAKNRG  625
            GCCWAFSAV ATEG+ Q++T KLI LSEQ+LVDC  E    GC+GG + TAF ++ KN+G
Sbjct  153  GCCWAFSAVAATEGLHQLKTGKLIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKG  212

Query  626  ITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGR  805
            +TT ANYPY    G+CN  K++ +AA+I+G +++P NSE A++QAVANQPVSVAID    
Sbjct  213  LTTEANYPYKGEDGVCNKKKSALSAAKIAGYEDVPANSEKALLQAVANQPVSVAIDGSSF  272

Query  806  PFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             FQFY  G+FS  C+T   HAVTAVGYG    G KYW++KN
Sbjct  273  DFQFYSSGVFSGSCSTWLNHAVTAVGYGATSDGTKYWIIKN  313



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   306 bits (785),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 189/270 (70%), Gaps = 8/270 (3%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N  + L +NQFADLTN+EF+
Sbjct  29   RYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNKYANKPYKLSVNQFADLTNEEFK  88

Query  317  TTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
             +       H   ++ T F YENVT  LP TM+W ++GAVT IK+QGQCGCCWAFSAV A
Sbjct  89   ASKN-GFKGHECSTKTTSFKYENVTASLPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAA  147

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
            TEGITQ+ T KL+SLSEQ+LVDC+T     GC GG M  AF+++ +N GI+T ANYPY  
Sbjct  148  TEGITQLTTGKLMSLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEANYPYEG  207

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K +  AA+I+G +++P NSE A++ AVA+QPVSVAIDA G  FQFY  G+F+
Sbjct  208  VDGTCNTKKETSHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDFQFYSSGVFT  267

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYGV   G KYWL+KN
Sbjct  268  GTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  297



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 159/307 (52%), Positives = 206/307 (67%), Gaps = 16/307 (5%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTE--KMKRFSV  214
             +  A +L+     +    +R  +D++      R+EEW+ ++GRVYA++ E  K KRF+V
Sbjct  7    FLFVALVLSFCFSIQLAGLSRPLLDEDS----MRHEEWMSQHGRVYADEQEDHKNKRFNV  62

Query  215  FKDNVEYINSFNLGNYTFTLGINQFADLTNDEFRTTM-----ACEMPSHSEK-TPFMYEN  376
            FK+NVE I  FN G  TF L INQFADLTN+EFR +         + S   K TPF YEN
Sbjct  63   FKENVERIEEFNDGK-TFKLAINQFADLTNEEFRASYNGFKGPMVLSSQITKPTPFRYEN  121

Query  377  VT-VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDC  553
            V+  LP +++W ++GAVT +KNQGQCGCCWAFSAV A EGITQI T KLISLSEQ+LVDC
Sbjct  122  VSSALPVSVDWRKKGAVTPVKNQGQCGCCWAFSAVAAIEGITQISTGKLISLSEQELVDC  181

Query  554  ET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNI  727
            +T  + HGC GG M TAF+++  N G+TT +NYPY    G CN  K +  A  I+G +++
Sbjct  182  DTKGIDHGCEGGLMDTAFEFIINNGGLTTESNYPYKGEDGTCNFNKTNPIAVSITGYEDV  241

Query  728  PPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGK  907
            P N E A+M+AVA+QPVSVAI+A G  FQFY  G+F+  C T   HAVTAVGYG    G 
Sbjct  242  PANDEQALMKAVAHQPVSVAIEAGGSDFQFYSSGVFTGECGTELDHAVTAVGYGESEDGS  301

Query  908  KYWLLKN  928
            KYW++KN
Sbjct  302  KYWIVKN  308



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 209/307 (68%), Gaps = 16/307 (5%)
 Frame = +2

Query  35   RHLIVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            +H ++ A IL   +GA  C+AT+R      E    +R+E+W+++YGRVY ++ EK  RF 
Sbjct  26   KHFMIAALIL---LGAWACQATSRTL---PEASMFERHEQWMIQYGRVYKDEAEKSVRFQ  79

Query  212  VFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTT-----MACEMPSHSEKTPFMYE  373
            +F DNV++I  FN  G  ++ L +N+FAD TN+EF+ +     MA      S+ T F YE
Sbjct  80   IFMDNVKFIEEFNKDGRQSYKLAVNEFADQTNEEFQASRNGYKMAVS-SRPSQTTLFRYE  138

Query  374  NVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDC  553
            NVT +P +M+W ++GAVT +K+QGQCG CWAFS + ATEGIT+++T KLISLSEQ+LVDC
Sbjct  139  NVTAVPSSMDWRKKGAVTPVKDQGQCGSCWAFSTIAATEGITKLKTGKLISLSEQELVDC  198

Query  554  ETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNI  727
            +      GC GG+M+  F+++ KN+GI   A+YPYT   G CN+ + +  AA+ISG + +
Sbjct  199  DKTGEDQGCEGGYMEDGFEFIVKNKGIALEASYPYTAADGTCNSKEEASRAAKISGYEKV  258

Query  728  PPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGK  907
            P NSE A+++AVANQPVSV+IDA G  FQFY  G+F+  C T   H VTAVGYG    G 
Sbjct  259  PANSETALLKAVANQPVSVSIDASGVAFQFYSSGVFTGECGTDLDHGVTAVGYGKTSDGT  318

Query  908  KYWLLKN  928
            KYWL+KN
Sbjct  319  KYWLVKN  325



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   306 bits (785),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 189/270 (70%), Gaps = 7/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT-FTLGINQFADLTNDEF  313
            +RYE+W   YGRVY +  EK KRF++FK NV +I +FN  +   + L +N+FADLTN+EF
Sbjct  37   ERYEQWTARYGRVYRDNVEKEKRFTIFKQNVAHIEAFNKASKKPYKLAVNEFADLTNEEF  96

Query  314  RTTMACEMPSH--SEKT-PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            + +       H  SE+T PF YENVT +P TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  97   KVSRN-RFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI Q+ T KL SLSEQ+LVDC+      GCNGG M  AF++V KN+GITT  NYPY  
Sbjct  156  IEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTETNYPYKG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN  + +  AA+I+G +++P NSE A+M+AVANQPVSVAIDA G  FQFY  G+F+
Sbjct  216  VDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQFYSSGVFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  276  GDCGTELDHGVTAVGYGAADDGTKYWLVKN  305



>gb|ADV41672.1| cysteine protease [Nicotiana tabacum]
Length=349

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 197/281 (70%), Gaps = 11/281 (4%)
 Frame = +2

Query  119  NEEGTMK-RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFA  292
            N E +M+ R+++WI  + +VY +  EK  RF +FK+NVE I +FN G +  + LG+N+F+
Sbjct  33   NYEASMRARHDQWIAHHDKVYKDLNEKEMRFKIFKENVERIEAFNAGEDKGYKLGVNKFS  92

Query  293  DLTNDEFRTTMACEMPSHSE-------KTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQC  451
            DLTN++FR        SH +       KT F Y NVT +PPTM+W ++GAVT IK+Q +C
Sbjct  93   DLTNEKFRVLHTGYKRSHPKVMSSSKPKTHFRYANVTDIPPTMDWRKKGAVTPIKDQKEC  152

Query  452  GCCWAFSAVGATEGITQIRTKKLISLSEQQLVDC--ETVSHGCNGGWMQTAFKYVAKNRG  625
            GCCWAFSAV ATEG+ Q++T KLI LSEQ+LVDC  E    GC+GG + TAF ++ KN+G
Sbjct  153  GCCWAFSAVAATEGLHQLKTGKLIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKG  212

Query  626  ITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGR  805
            +TT ANYPY    G+CN  K++ +AA+I+G +++P NSE A++QAVANQPVSVAID    
Sbjct  213  LTTEANYPYKGEDGVCNKKKSALSAAKIAGYEDVPANSEKALLQAVANQPVSVAIDGSSF  272

Query  806  PFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             FQFY  G+FS  C+T   HAVTAVGYG    G KYW++KN
Sbjct  273  DFQFYSSGVFSGSCSTWLNHAVTAVGYGATTDGTKYWIIKN  313



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   306 bits (785),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 195/270 (72%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YGRVY +  E+  R+S+FK+NV  I++FN     ++ LG+NQFADLTN+EF
Sbjct  37   ERHEQWMTQYGRVYKDDNERATRYSIFKENVARIDAFNSQTGKSYKLGVNQFADLTNEEF  96

Query  314  RTTMACEMPSH---SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            + +       H    +  PF YENV+ +P T++W + GAVT +K+QGQCGCCWAFSAV A
Sbjct  97   KASRN-RFKGHMCSPQAGPFRYENVSAVPSTVDWRKEGAVTPVKDQGQCGCCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI ++ T KLISLSEQ++VDC+T     GCNGG M  AFK++ +N+G+TT ANYPY  
Sbjct  156  MEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K++  AA+I+G +++P NSEAA+M+AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  216  TDGTCNTKKSAIHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGSDFQFYSSGIFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T+  H VTAVGYGV   G KYWL+KN
Sbjct  276  GSCDTQLDHGVTAVGYGV-SDGSKYWLVKN  304



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   306 bits (785),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/296 (49%), Positives = 201/296 (68%), Gaps = 3/296 (1%)
 Frame = +2

Query  47   VFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDN  226
            +  +   L +GA  +AT+R   +++E   ++ +E+W+  YGRVY +  EK KRF +FK N
Sbjct  10   ILVSFFVLVIGAS-QATSRLLHENDEAAMVEEHEKWMATYGRVYKDDAEKAKRFQIFKKN  68

Query  227  VEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSHSEKTPFMYENVTVLPPTMN  403
             EYI SFN  G  T++L IN+FAD+TN+EFR     +  + S+   F YENVT +P +++
Sbjct  69   FEYIESFNKAGTKTYSLSINRFADMTNEEFRARNGYKPFTSSKSASFRYENVTDVPSSLD  128

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET-VSHGCNG  580
            W + GAVT +KNQG CGCCWAFSAV ATEG+ Q++T +LISLSEQ+LVDC+T    GC G
Sbjct  129  WREEGAVTPVKNQGDCGCCWAFSAVAATEGVHQLKTGELISLSEQELVDCDTDEDRGCEG  188

Query  581  GWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQA  760
            G M +AF ++ KN G+TT ++YPY    G C+  +    AA I   +++P N+E+A+++A
Sbjct  189  GLMDSAFSFIIKNHGLTTESHYPYLGIDGSCSANEEHPPAATIKSYEDVPENNESALLKA  248

Query  761  VANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            VANQPVSVAIDA G+ F FY  G+F+  C T   H  TAVGYG+   G KYWL+KN
Sbjct  249  VANQPVSVAIDAGGQDFAFYSSGVFTGECGTHLDHGATAVGYGISEDGIKYWLVKN  304



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score =   306 bits (785),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 201/302 (67%), Gaps = 13/302 (4%)
 Frame = +2

Query  53   AAILA-LEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVFKDN  226
            A+ILA L     C A    R D NE+  M  R+E+W+ +Y RVY +  EK +RF VFK N
Sbjct  6    ASILAVLSFAFFCGAALAAR-DLNEDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKAN  64

Query  227  VEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--L  388
            V++I SFN G N  F LGINQFADLTNDEFRTT   +   PS  +  T F YENV+V  +
Sbjct  65   VKFIESFNTGGNRKFWLGINQFADLTNDEFRTTKTNKGFKPSLDKVSTGFRYENVSVDAI  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P T++W   GAVT IK+QGQCGCCWAFSAV ATEGI +I T KLISLSEQ+LVDC+    
Sbjct  125  PATIDWRTNGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGE  184

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT +NYPYT   G C +   S +AA I G +++P N E
Sbjct  185  DQGCEGGLMDDAFKFIIKNGGLTTESNYPYTAADGKCKSG--SNSAANIKGYEDVPTNDE  242

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFY GG+ +  C T   H + A+GYG    G KYWL+
Sbjct  243  AALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLM  302

Query  923  KN  928
            KN
Sbjct  303  KN  304



>gb|KHN27806.1| Vignain [Glycine soja]
Length=313

 Score =   305 bits (782),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 190/273 (70%), Gaps = 4/273 (1%)
 Frame = +2

Query  119  NEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFAD  295
            +E    +R+E+W+ +YG+VY +  EK KR  +FKDNVE+I SFN  GN  + LGIN  AD
Sbjct  6    HEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFIESFNAAGNKPYKLGINHLAD  65

Query  296  LTNDEFRTTMAC--EMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAF  469
             TN+EF  +        SHS+ TPF YENVT +P  ++W + GAVT +K+QGQCG CWAF
Sbjct  66   QTNEEFVASHNGYKHKASHSQ-TPFKYENVTGVPNAVDWRENGAVTAVKDQGQCGSCWAF  124

Query  470  SAVGATEGITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGANYP  649
            S V ATEGI QI T  L+SLSEQ+LVDC++V HGC+GG+M+  F+++ KN GI++ ANYP
Sbjct  125  STVAATEGIYQITTSMLMSLSEQELVDCDSVDHGCDGGYMEGGFEFIIKNGGISSEANYP  184

Query  650  YTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGG  829
            YT   G C+  K +  AA+I G + +P NSE A+ +AVANQPVSV IDA G  FQFY  G
Sbjct  185  YTAVDGTCDANKEASPAAQIKGYETVPANSEDALQKAVANQPVSVTIDAGGSAFQFYSSG  244

Query  830  LFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +F+  C T+  H VTAVGYG    G +YW++KN
Sbjct  245  VFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKN  277



>ref|XP_008246197.1| PREDICTED: vignain-like, partial [Prunus mume]
Length=286

 Score =   304 bits (779),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 195/284 (69%), Gaps = 11/284 (4%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NY  262
            CEAT+R   D +  G   RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N 
Sbjct  7    CEATSRSLQDASMYG---RYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVNK  63

Query  263  TFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQ  430
             + LG+NQFADLTN+EF+ +       H   ++ T F YENV   +P  M+W ++GAVT 
Sbjct  64   PYKLGVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYENVKAPVPAAMDWRKKGAVTP  122

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ+LVDC+T  V  GC GG M  AF+
Sbjct  123  IKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQ  182

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ +N G++T ANYPY    G CNT KA+  AA+I+G +++P NSE A++ AVA+QPVSV
Sbjct  183  FIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSV  242

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYW  916
            AIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYW
Sbjct  243  AIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYW  286



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score =   306 bits (784),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 191/274 (70%), Gaps = 6/274 (2%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADL  298
            E    +++E+W+ +YGRVY + TEK +R   FK N+EYI S N     T+ LGINQFAD+
Sbjct  31   EASITEKHEQWMTQYGRVYTDDTEKTERLETFKQNLEYIESINKDVTRTYKLGINQFADM  90

Query  299  TNDEFRTTMACEMPSHSEK---TPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAF  469
            TN+EF+ +      S  +K   T F YENVTV   +M+W ++GAVT+IK+QGQCGCCWAF
Sbjct  91   TNEEFKASRNGYRISSQQKIKTTFFQYENVTV-AYSMDWRKKGAVTKIKDQGQCGCCWAF  149

Query  470  SAVGATEGITQIRTKKLISLSEQQLVDCETVSH-GCNGGWMQTAFKYVAKNRGITTGANY  646
            SAV ATEGI +I+T KLISLSEQ+LVDC+T S+ GC GG M  AFKY+ KN G+T+ +NY
Sbjct  150  SAVAATEGINKIKTGKLISLSEQELVDCDTSSNQGCEGGLMDDAFKYIIKNHGLTSESNY  209

Query  647  PYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKG  826
            PY    G C T K S   A+I G +++P NSE A+++AVANQPVSVAIDA G  FQFY  
Sbjct  210  PYKGIDGTCKTEKESNHVAKIRGYKDVPENSELALLKAVANQPVSVAIDASGSDFQFYSS  269

Query  827  GLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            G+F+  C T   H VT VGYG    G KYW++KN
Sbjct  270  GIFTGKCGTELDHGVTTVGYGATKDGTKYWIVKN  303



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   306 bits (784),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/304 (51%), Positives = 203/304 (67%), Gaps = 11/304 (4%)
 Frame = +2

Query  35   RHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSV  214
            +H  +F A++ +      +A AR   D +     +R+E+W+ + GRVY +  EK  R+ +
Sbjct  6    QHQCIFLALIFILAALASQAIARSLQDAS---MYERHEDWMAQNGRVYKDANEKEIRYKI  62

Query  215  FKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTT---MACEMPSHSEKTPFMYENVT  382
            FK+NVE I SFN  G  ++ LGINQFADLTN+EF+T+       M S  E  PF YENVT
Sbjct  63   FKENVERIESFNKAGGKSYKLGINQFADLTNEEFKTSRNRFKGHMCSPQE-GPFRYENVT  121

Query  383  VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             +P +M+W ++GAVT IK+QGQCG CWAFSAV A EGITQ+ + KLISLSEQ+LVDC+T 
Sbjct  122  AVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTSHKLISLSEQELVDCDTK  181

Query  563  --SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPN  736
                GC GG M  AFK++  N+G+TT  NYPY    G CN  K +  AA+I+G +++P N
Sbjct  182  GEDQGCQGGLMDDAFKFIENNQGLTTETNYPYEGSDGTCNANKEANHAAKITGYEDVPAN  241

Query  737  SEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYW  916
             EAA+++AVA QPVSVAIDA G  FQFY  G+F+  C T   H V AVGYGV   G KYW
Sbjct  242  DEAALLKAVAQQPVSVAIDAGGFQFQFYSSGIFTGDCGTELDHGVAAVGYGV-SNGMKYW  300

Query  917  LLKN  928
            L+KN
Sbjct  301  LVKN  304



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 202/303 (67%), Gaps = 10/303 (3%)
 Frame = +2

Query  38   HLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVF  217
            H  +  A + +     CEAT+R   D       +R+E+W+  YGRVY +  E+ +RF++F
Sbjct  9    HQCICLAFIFIVGALVCEATSRTLQD---ASMYERHEQWMARYGRVYQDNNEREQRFNIF  65

Query  218  KDNVEYINSFNLG-NYTFTLGINQFADLTNDEF---RTTMACEMPSHSEKTPFMYENVTV  385
            K+NV  I+SFN   +  + LG+NQFADLTNDEF   R      M S+ + T F YENVT 
Sbjct  66   KENVARIDSFNRAKDKPYKLGVNQFADLTNDEFTASRNRFKGHMCSN-QATTFKYENVTA  124

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV-  562
            LP TM+W ++GAVT IK+QGQCG CWAFSAV A EG+T++ T KLISLSEQ+LVDC+T  
Sbjct  125  LPSTMDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGVTKLTTGKLISLSEQELVDCDTKG  184

Query  563  -SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
               GC GG M  AF+++  N+G+TT ++YPY    G CNT K +  AA I+G +++P N+
Sbjct  185  DDQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDGKCNTNKEANHAANINGHEDVPANN  244

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            E A+ +AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL
Sbjct  245  EEALHKAVANQPVSVAIDAGGYEFQFYSSGVFTGDCGTDLDHGVTAVGYGADDDGTKYWL  304

Query  920  LKN  928
            +KN
Sbjct  305  VKN  307



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 195/278 (70%), Gaps = 9/278 (3%)
 Frame = +2

Query  122  EEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG--NYTFTLGINQFA  292
            ++G+M +R+E W+  YG+VY +  E+ KRF +F +N++YI +FN G  N ++ LGINQFA
Sbjct  31   QDGSMHERHERWMNHYGKVYKDHQEREKRFKIFTENMKYIEAFNNGDNNESYKLGINQFA  90

Query  293  DLTNDEF---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCC  460
            DLTN+EF   R      M S   +T  F YENV+ +P T++W ++GAVT +KNQGQCGCC
Sbjct  91   DLTNEEFVASRNKFKGHMCSSIIRTTTFKYENVSAIPSTVDWRKKGAVTPVKNQGQCGCC  150

Query  461  WAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITT  634
            WAFSAV ATEGI ++ T KL+SLSEQ+LVDC+T  V  GC GG M  AFK++ +N G+ T
Sbjct  151  WAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLNT  210

Query  635  GANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQ  814
             A YPY    G CN  KAS  A  I+G +++P N+E A+ +AVANQP+SVAIDA G  FQ
Sbjct  211  EAQYPYQGVDGTCNANKASIQATTITGYEDVPANNEQALQKAVANQPISVAIDASGSDFQ  270

Query  815  FYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            FYK G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  271  FYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKN  308



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 203/303 (67%), Gaps = 12/303 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            I  A +  L + A  + T+R   DD+     +R+ +W+ +YG++Y +  E+  RF +FK+
Sbjct  10   ISLALLFCLGLFA-IQVTSRTLQDDS---MYERHGQWMSQYGKIYKDHQERETRFKIFKE  65

Query  224  NVEYINSFNLGNYT--FTLGINQFADLTNDEF---RTTMACEMPSHSEKT-PFMYENVTV  385
            NV YI +FN  + T  + LGINQFADLTN+EF   R      M S   +T  F YENV+ 
Sbjct  66   NVNYIETFNNADDTKSYKLGINQFADLTNEEFIASRNKFKGHMCSSIMRTTSFKYENVSG  125

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--  559
            +P T++W ++GAVT +KNQGQCGCCWAFSAV ATEGI ++ T KLISLSEQ+LVDC+T  
Sbjct  126  IPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKG  185

Query  560  VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
            V  GC GG M  AFK++ +N G++T A YPY    G CN  KAS  A  I+G +++P NS
Sbjct  186  VDQGCEGGLMDDAFKFIIQNHGLSTEAQYPYEGVDGTCNANKASVQAVTITGYEDVPANS  245

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            E A+ +AVANQP+SVAIDA G  FQFYK G+F+  C T   H VTAVGYGV   G KYWL
Sbjct  246  EQALQKAVANQPISVAIDASGSDFQFYKSGVFTGACGTELDHGVTAVGYGVSNDGTKYWL  305

Query  920  LKN  928
            +KN
Sbjct  306  VKN  308



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 190/270 (70%), Gaps = 5/270 (2%)
 Frame = +2

Query  134  MKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDE  310
            ++R+EEW+  YGRVY N+ EKM R+ +FKDNVE+I +FN  G   + LGIN FAD TN+E
Sbjct  35   LERHEEWMERYGRVYKNEEEKMMRYKIFKDNVEFIEAFNAAGTRPYKLGINAFADQTNEE  94

Query  311  FRTTM--ACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            F+       ++   S+ TPF YENV+ LP +M+W ++GAVT +K+QGQCG CWAFSA+ A
Sbjct  95   FKAARNGLFKVQKLSKATPFKYENVSALPSSMDWRKKGAVTPVKDQGQCGSCWAFSAIAA  154

Query  485  TEGITQIRTKKLISLSEQQLVDCETVSH--GCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
            TEGI QI T KLISLSEQ++VDC+  S   GC GG+M+ AF+++  N+GI + + YPY+ 
Sbjct  155  TEGINQISTGKLISLSEQEIVDCDKTSQDQGCEGGYMEDAFEFIIDNKGIASESTYPYSA  214

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN  + S  AA+I+  + +P N+E A+++AVA QPVSV+IDA G  FQFY  G+F+
Sbjct  215  TDGTCNKKEESPIAAKITSYEKVPENNEKALLKAVAKQPVSVSIDAGGMEFQFYSSGVFT  274

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  275  GDCGTDLDHGVTAVGYGKTSDGTKYWLVKN  304



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 205/309 (66%), Gaps = 14/309 (5%)
 Frame = +2

Query  32   NRHLIVFAAILAL--EMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMK  202
            N  L  F   LAL   +GA   EAT+R   D +  G   R+E+W+  YGRVY +  EK K
Sbjct  5    NLQLCKFCTCLALIIMLGAWSSEATSRSLQDASMYG---RHEQWMTRYGRVYTDNEEKEK  61

Query  203  RFSVFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMY  370
            RF +FK+NV YI S N   +  + L +NQF DLTN+EF  +       H   ++ T F Y
Sbjct  62   RFKIFKENVAYIESSNADTSKPYKLRVNQFTDLTNEEFIASRN-RFKGHECSTKTTSFKY  120

Query  371  ENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLV  547
            ENVT  +P TM+W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KL+SLSEQ+LV
Sbjct  121  ENVTTSVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELV  180

Query  548  DCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQ  721
            DC+T  V  GC GG M  AF+++ +N G++T ANYPY    G CNT K +  AA+I+G +
Sbjct  181  DCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITGHE  240

Query  722  NIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPG  901
            ++P N E A++ AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   
Sbjct  241  DVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDD  300

Query  902  GKKYWLLKN  928
            G KYWL+KN
Sbjct  301  GTKYWLVKN  309



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/289 (52%), Positives = 192/289 (66%), Gaps = 11/289 (4%)
 Frame = +2

Query  92   ATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTF  268
            A+  W    +E     R++ W+ +YGRVY    EK KRF +FK+NVE+I SFN  GN  +
Sbjct  21   ASQSWSRSLHEASMELRHKTWMTQYGRVYKGNVEKEKRFKIFKENVEFIESFNNNGNKPY  80

Query  269  TLGINQFADLTNDEFRTT-------MACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVT  427
             LGIN F DLTN+EFR +       M+    S+  K+ F YENVT +PP+++W  +GAVT
Sbjct  81   KLGINAFTDLTNEEFRASHNGYTMSMSSHQSSYRTKS-FRYENVTAVPPSLDWRTKGAVT  139

Query  428  QIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAF  601
             IK+QGQCGCCWAFSAV A EGIT++ T  LISLSEQ+LVDC+T  +  GC GG M  AF
Sbjct  140  HIKDQGQCGCCWAFSAVAAMEGITKLSTGTLISLSEQELVDCDTSGMDQGCEGGLMDDAF  199

Query  602  KYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVS  781
            +++ +N G+TT ANYPY    G CNT KA+  AA+I+G +N+P   E A+ +AVANQPVS
Sbjct  200  EFIIENNGLTTEANYPYEGVDGSCNTRKAANHAAKITGYENVPAYDEEALRKAVANQPVS  259

Query  782  VAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            VAIDA    FQ Y  G+F+  C T   H VT VGYG    G KYWL+KN
Sbjct  260  VAIDAGESAFQHYSSGIFTGDCGTELDHGVTVVGYGTSDDGTKYWLVKN  308



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 201/297 (68%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L +GA   EAT+R   D +  G   RY++W+  YGR+Y +  EK  RF +FK+NV +I
Sbjct  5    LILMLGAWSSEATSRSLQDASMYG---RYKQWLARYGRIYNDTNEKETRFKIFKENVAFI  61

Query  239  NSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
               N   N  + L +NQFADLTN+EF+ T       H   ++ + F YENVTV LP TM+
Sbjct  62   EFSNKDANKPYKLSVNQFADLTNEEFKATRN-GFKGHECSTKTSSFKYENVTVPLPATMD  120

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCN  577
            W ++GAVT +K+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ LVDC+T     GC 
Sbjct  121  WRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQXLVDCDTAGEDQGCE  180

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N GI+T ANYPY    G CNT K +  AA+I+G +++P NSE A++ 
Sbjct  181  GGLMDDAFQFIQQNHGISTEANYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLT  240

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  297



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 206/308 (67%), Gaps = 13/308 (4%)
 Frame = +2

Query  32   NRHLIVFAAI-LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKR  205
            NR L  +  + L L +GA   +AT+R   D +  G   RYE+W+  YGRVY +  EK  R
Sbjct  5    NRQLWKYMCLGLILMLGAWSSQATSRSLQDASMYG---RYEQWLARYGRVYNDVDEKETR  61

Query  206  FSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYE  373
            F +FK+NV +I S N   N  + L +NQFADLTN+EF+ +       H   ++ T F YE
Sbjct  62   FKIFKENVAFIESSNKDANTPYKLRVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYE  120

Query  374  NVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVD  550
            NVT  LP TM+W ++GAVT +K+QGQCGCCWAFSAV ATEG+TQ+ T KLISLSEQ+LVD
Sbjct  121  NVTAALPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVD  180

Query  551  CETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQN  724
            C+T     GC GG M  AF+++ +N GI+T  NYPY    G CNT K +  AA+I+G ++
Sbjct  181  CDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFED  240

Query  725  IPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGG  904
            +P NSE A++ AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G
Sbjct  241  VPANSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDG  300

Query  905  KKYWLLKN  928
             KYWL+KN
Sbjct  301  TKYWLVKN  308



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 198/300 (66%), Gaps = 11/300 (4%)
 Frame = +2

Query  50   FAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNV  229
            FA  L L   A C+ T R   +  E     R+E+W+  +G+VYA+  EK +RF +FKDNV
Sbjct  11   FAIFLILGTWA-CQVTPR---ELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDNV  66

Query  230  EYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEK---TPFMYENVTVLPP  394
            EYI SFN  GN  + L +N+FADLTN+E +        P  +     T F YENVT +P 
Sbjct  67   EYIESFNTAGNKPYKLSVNKFADLTNEELKIARNGYRRPLQTRPMKVTSFEYENVTAVPA  126

Query  395  TMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSH  568
            TM+W ++GAVT IK+QGQCG CWAFS V ATEGI Q+ T KL+SLSEQ+LVDC+T     
Sbjct  127  TMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQ  186

Query  569  GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAA  748
            GC GG M+  F+++ KN GIT+ ANYPY    G CN+ K +   A+I+G +++P NSEAA
Sbjct  187  GCEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGYESVPANSEAA  246

Query  749  IMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +++AVANQP+SV+IDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL KN
Sbjct  247  LLKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGTKYWLFKN  306



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 189/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  YG+VY +  E+ KRF +FK+NV YI +FN   N  + L INQFADLTN+EF
Sbjct  20   ERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEF  79

Query  314  ---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S   +T  F YENVT +P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  80   IAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  139

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ+LVDC+T  V  GC GG M  AFK+V +N G+ T ANYPY 
Sbjct  140  ATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANYPYK  199

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+  AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  200  GVDGKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKSGVF  259

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  260  TGSCGTELDHGVTAVGYGVSNDGTEYWLVKN  290



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 202/303 (67%), Gaps = 10/303 (3%)
 Frame = +2

Query  29   KNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            K +H++    +L++     C +    R + +E    +R+E+W+ +YG+VY +  EK KR 
Sbjct  6    KKQHILALVLLLSI-----CTSQVMSR-NLHEASMSERHEQWMKKYGKVYKDAAEKQKRL  59

Query  209  SVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTMAC--EMPSHSEKTPFMYENV  379
             +FKDNVE+I SFN  GN  + L IN  AD TN+EF  +        SHS+ TPF YENV
Sbjct  60   LIFKDNVEFIESFNAAGNRPYKLSINHLADQTNEEFVASHNGYKHKGSHSQ-TPFKYENV  118

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            T +P  ++W + GAVT +K+QGQCG CWAFS V ATEGI QI T  L+SLSEQ+LVDC++
Sbjct  119  TGVPNAVDWRENGAVTAVKDQGQCGSCWAFSTVAATEGIYQITTSMLMSLSEQELVDCDS  178

Query  560  VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
            V HGC+GG+M+  F+++ KN GI++ ANYPYT   G C+  K +  AA+I G + +P NS
Sbjct  179  VDHGCDGGYMEGGFEFIIKNGGISSEANYPYTAVDGTCDANKEASPAAQIKGYETVPANS  238

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            E A+ +AVANQPVSV IDA G  FQFY  G+F+  C T+  H VTAVGYG    G +YW+
Sbjct  239  EDALQKAVANQPVSVTIDAGGSAFQFYSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWI  298

Query  920  LKN  928
            +KN
Sbjct  299  VKN  301



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 189/274 (69%), Gaps = 5/274 (2%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADL  298
            +E   +R+E+W+V+YGRVY +  EK +RF +F+DN EYI S N  G+  + LG+NQFAD+
Sbjct  17   DEPMSRRHEQWMVQYGRVYMDAAEKERRFQIFRDNYEYIESVNRAGDRKYKLGLNQFADM  76

Query  299  TNDEFRTTMAC--EMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFS  472
            TN EF+ +      MP  S+   F Y N+T  P +M+W  RGAVT +KNQ  CGCCWAFS
Sbjct  77   TNGEFKASHLGFKPMPMESKTGSFQYANLTDAPHSMDWRTRGAVTAVKNQRSCGCCWAFS  136

Query  473  AVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANY  646
            +V A E ITQI+T  L+ LSEQQLVDC+    +HGC+GG+M  AF+YV  N GITT  NY
Sbjct  137  SVAAIEAITQIKTGNLVYLSEQQLVDCDANDGNHGCHGGFMTGAFQYVINNGGITTENNY  196

Query  647  PYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKG  826
            PY    G C+T +AS +AA I G +++P N E++++QAV NQPVSV ID  G+ F+ YKG
Sbjct  197  PYRANDGTCDTNRASSSAATIGGYESVPANDESSLLQAVTNQPVSVGIDGSGQDFRHYKG  256

Query  827  GLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            G+F+  C T   HAVTAVGYG    G KYWL+KN
Sbjct  257  GIFTGACETNMNHAVTAVGYGTAEDGTKYWLVKN  290



>ref|XP_004308524.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 201/298 (67%), Gaps = 12/298 (4%)
 Frame = +2

Query  56   AILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVE  232
            A + + +GA   EAT+R   D    G   RYE+WI  YGRVY +  EK  RF +FK+N  
Sbjct  13   AFVLIMLGAWSSEATSRSLQDALAYG---RYEQWIARYGRVYNDINEKEDRFKIFKENEA  69

Query  233  YINSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTVLPPTM  400
            Y+ S N  GN  + L +NQFADLTN+EF T        H   ++ T F YENVTV P TM
Sbjct  70   YVESSNKDGNKLYKLSLNQFADLTNEEF-TASRNRFLGHECSTKTTTFKYENVTV-PATM  127

Query  401  NWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGC  574
            +W ++GAVT +K+QGQCG CWAFSAVGA EGITQ+ T KLISLSEQ+LVDC+   V  GC
Sbjct  128  DWRKKGAVTPVKDQGQCGSCWAFSAVGAMEGITQLTTGKLISLSEQELVDCDVNGVDQGC  187

Query  575  NGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIM  754
            +GG M  AF++V +N GI T ANYPYT   G CN  KA+  AA I+G +++P NSE+A++
Sbjct  188  SGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKAAGHAATITGHEDVPANSESALL  247

Query  755  QAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +AVANQP+SVAIDA G  FQ Y  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  248  KAVANQPISVAIDASGYDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKN  305



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 188/270 (70%), Gaps = 7/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT-FTLGINQFADLTNDEF  313
            +RYE+W   YGRVY +  EK KRF++FK NV  I +FN  +   + L +N+FADLTN+EF
Sbjct  37   ERYEQWTARYGRVYRDNAEKEKRFTIFKQNVANIEAFNKASEKPYKLAVNEFADLTNEEF  96

Query  314  RTTMACEMPSH--SEKT-PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            + +       H  SE+T PF YENVT +P TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  97   KASRN-RFKGHMCSEQTGPFKYENVTAVPSTMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI Q+ T KL SLSEQ+LVDC+      GCNGG M  AF++V KN+GITT  NYPY  
Sbjct  156  IEGINQLTTGKLASLSEQELVDCDVKGEDEGCNGGLMDNAFQFVQKNKGITTEINYPYKG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN  + +  AA+I+G +++P NSE A+M+AVANQPVSVAIDA G  FQFY  G+F+
Sbjct  216  VDGKCNAKEEANHAAKINGHEDVPANSETALMKAVANQPVSVAIDAGGFDFQFYSSGVFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  276  GDCGTELDHGVTAVGYGAADDGTKYWLVKN  305



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 201/297 (68%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L +GA   EAT+R   D +  G   RY++W+  YGR+Y +  EK  RF +FK+NV +I
Sbjct  5    LILMLGAWSSEATSRSLQDASMYG---RYKQWLARYGRIYNDTNEKETRFKIFKENVAFI  61

Query  239  NSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
               N   N  + L +NQFADLTN+EF+ T       H   ++ + F YENVTV LP TM+
Sbjct  62   EFSNKDANKPYKLSVNQFADLTNEEFKATRN-GFKGHECSTKTSSFKYENVTVPLPATMD  120

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCN  577
            W ++GAVT +K+QGQCGCCWAFSAV ATEGITQ+ T KLISLSEQ LVDC+T     GC 
Sbjct  121  WRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQVLVDCDTAGEDQGCE  180

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N GI+T ANYPY    G CNT K +  AA+I+G +++P NSE A++ 
Sbjct  181  GGLMDBAFQFIQQNHGISTEANYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLT  240

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  297



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 192/268 (72%), Gaps = 5/268 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            R+E+W+ +YGRVY  + EK KRF++FK+NVEYI SFN  G   + LGIN FADLTN EF+
Sbjct  36   RHEQWMAQYGRVYKTEAEKTKRFNIFKENVEYIESFNKAGTKPYKLGINAFADLTNQEFK  95

Query  317  TTM-ACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATE  490
             +    ++P   S  TPF YENV+ +P T++W  +GAVT +K+QGQCGCCWAFSAV A E
Sbjct  96   ASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQGQCGCCWAFSAVAAME  155

Query  491  GITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRK  664
            GIT++ T  LISLSEQ+LVDC+      GC GG M  AF ++  N+G+TT +NYPY    
Sbjct  156  GITKLSTGNLISLSEQELVDCDVKGTDQGCEGGLMDDAFSFIINNKGLTTESNYPYQGTD  215

Query  665  GMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTG  844
            G C  +K+S +AA+ISG +++P NSE+A+ +AVANQPVSVAIDA G  FQFY  G+F+  
Sbjct  216  GSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGE  275

Query  845  CTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            C T   H VTAVGYG+   G KYWL+KN
Sbjct  276  CGTELDHGVTAVGYGIAEDGSKYWLVKN  303



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 194/270 (72%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YGRVY +  EK  R+++FK+NV  I++FN     ++ LG+NQFADL+N+EF
Sbjct  62   ERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYKLGVNQFADLSNEEF  121

Query  314  RTTMACEMPSH---SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            + +       H    +  PF YENV+ +P TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  122  KASRN-RFKGHMCSPQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  180

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI Q+ T KLISLSEQ++VDC+T     GCNGG M  AFK++ +N+G+TT ANYPYT 
Sbjct  181  MEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTG  240

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K +  AA+I+G +++P NSEAA+++AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  241  TDGTCNTQKEANHAAKITGFEDVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSSGIFT  300

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  301  GSCGTELDHGVTAVGYG-GSDGTKYWLVKN  329



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 203/305 (67%), Gaps = 10/305 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            N++  +  A+L        +ATAR  +   E    +R+E+W+ +YGRVY +  EK KR+ 
Sbjct  5    NQYQYICLALLFFLAAWASQATARNLL---EASMYERHEDWMAQYGRVYKDADEKSKRYK  61

Query  212  VFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENV  379
            +FKDNV  I SFN   + ++ L IN+FADLTN+EFR +      +H   +E T F YE+V
Sbjct  62   IFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRN-RFKAHICSTEATSFKYEHV  120

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
              +P T++W ++GAVT IK+QGQCG CWAFSAV A EGITQ+ T KLISLSEQ+LVDC+T
Sbjct  121  AAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDT  180

Query  560  V--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GCNGG M  AFK++ +N G+ T ANYPY    G CN  KA+  AA+I+G +++P 
Sbjct  181  SGEDQGCNGGLMDDAFKFIEQNHGLATEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPA  240

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N+E A+ +AVA+QP++VAIDA G  FQFY  G+F+  C T   H V AVGYG    G KY
Sbjct  241  NNEKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKY  300

Query  914  WLLKN  928
            WL+KN
Sbjct  301  WLVKN  305



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 160/301 (53%), Positives = 205/301 (68%), Gaps = 12/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            + FA I  L  GA    AT+R   D +  G   +YE+W+  YGRVY N  EK KRF++FK
Sbjct  8    MCFALIFML--GALSSHATSRTLQDPSMYG---KYEQWMAHYGRVYTNINEKEKRFNIFK  62

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVTVLP  391
             NV++I S N   N  + L +NQFADLTN+EF+ +    M     ++ T F YENVT  P
Sbjct  63   ANVDFIESSNNDANKPYKLKVNQFADLTNEEFKASRNRFMGHECSTKTTSFKYENVTA-P  121

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VS  565
             T++W ++GAVT IK+QGQCGCCWAFSAV A EGIT++ T KLISLSEQ+LVDC+T  V 
Sbjct  122  ATVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVD  181

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AF+++ +N G++T  NYPYT   G CNT K +  AA I+G +++P NSEA
Sbjct  182  QGCEGGLMDDAFQFITQNHGLSTETNYPYTGVDGTCNTKKEASHAATITGHEDVPANSEA  241

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVG+GV   G KYWL+K
Sbjct  242  ALLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVK  301

Query  926  N  928
            N
Sbjct  302  N  302



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 194/270 (72%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YGRVY +  EK  R+++FK NV  I+ FN     ++ LG+NQFADL+N+EF
Sbjct  36   ERHEQWMAQYGRVYKDNAEKETRYNIFKANVARIDEFNSQTGKSYKLGVNQFADLSNEEF  95

Query  314  ---RTTMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
               R      M S  +  PF YENV+ +P +M+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  96   KASRNRFKGHMCS-PQAGPFRYENVSAVPDSMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  154

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI Q+ T KLISLSEQ++VDC+T     GCNGG M  AFK++ +N+G+TT ANYPYT 
Sbjct  155  MEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYTG  214

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K +  AA+I+G +++P NSEAA+++AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  215  TDGTCNTQKEANHAAKITGFEDVPANSEAALIKAVAKQPVSVAIDAGGFEFQFYSSGIFT  274

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T+  H VTAVGYG+   G KYWL+KN
Sbjct  275  GSCGTQLDHGVTAVGYGI-SDGTKYWLVKN  303



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 190/270 (70%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YG+VY +  EK+ R  +FK NVE I SFN  G   + LGINQFADLTN+EF
Sbjct  37   ERHEKWMAQYGKVYKDANEKVIRRKIFKRNVERIESFNKAGGKPYKLGINQFADLTNEEF  96

Query  314  RTTMACEMPSH---SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            +T+       H    +  PF YENVT +P +M+W ++GAVT IK+QGQCG CWAFS V A
Sbjct  97   KTSRN-RFKGHMCSPQAGPFRYENVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSTVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGITQ+ TKKLISLSEQ+LVDC+T     GC GG M  AFK++  N+G+TT ANYPY  
Sbjct  156  VEGITQLTTKKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIENNQGLTTEANYPYVG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K +  AA+I+G +++P N+EAA+++AV NQPVSVAIDA G  FQFY  G+F+
Sbjct  216  SDGTCNTKKEANHAAKITGYEDVPANNEAALLKAVTNQPVSVAIDAGGFAFQFYSSGIFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H V AVGYGV   G KYWL+KN
Sbjct  276  GDCGTELDHGVAAVGYGV-SNGTKYWLVKN  304



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 197/302 (65%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +  L +   C A    R   ++     R+E W+ +YGR+Y +  EK +RF VFK 
Sbjct  7    LLFAILGCLCL---CSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKA  63

Query  224  NVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--L  388
            NV +I SFN GN+ F LG+NQFADLTNDEFR+T   +  +PS +   T F YENV +  L
Sbjct  64   NVAFIESFNAGNHKFWLGVNQFADLTNDEFRSTKTNKGFIPSTTRVPTGFRYENVNIDAL  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P TM+W  +G VT IK+QGQCGCCWAFSAV A EGI ++ T KLISLSEQ+LVDC+    
Sbjct  124  PATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT +NYPY      C +   S + A I G +++P N+E
Sbjct  184  DQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCKSV--SNSVASIKGYEDVPANNE  241

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFYKGG+ +  C T   H + A+GYG    G KYWLL
Sbjct  242  AALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  923  KN  928
            KN
Sbjct  302  KN  303



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 208/316 (66%), Gaps = 15/316 (5%)
 Frame = +2

Query  2    ENIRMQGSRKNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYA  181
            E+I +Q  R    L    A++ +      +AT+R   D +  G   R+E+W+V YGRVY 
Sbjct  2    ESINLQLCR----LCTCLALIIMLGAWSSKATSRSLQDASMYG---RHEQWMVRYGRVYT  54

Query  182  NQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---S  349
            +  EK KRF +FK+NV YI S N   +  + L +NQF DLTN+EF  +       H   +
Sbjct  55   DNEEKEKRFKIFKENVAYIESSNADASKPYKLRVNQFTDLTNEEFIASRN-RFKGHECST  113

Query  350  EKTPFMYENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLIS  526
            + T F YENVT  +P TM+W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KL+S
Sbjct  114  KTTSFKYENVTASVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVS  173

Query  527  LSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAA  700
            LSEQ+LVDC+T  V  GC GG M  AF+++ +N G++T ANYPY    G CNT K +  A
Sbjct  174  LSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIA  233

Query  701  ARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAV  880
            A+I+G +++P N E A++ AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAV
Sbjct  234  AKITGHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAV  293

Query  881  GYGVMPGGKKYWLLKN  928
            GYGV   G KYWL+KN
Sbjct  294  GYGVSDDGTKYWLVKN  309



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 189/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  YG+VY +  E+ KRF +FK+NV YI +FN   N  + L INQFADLTN+EF
Sbjct  37   ERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEF  96

Query  314  ---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S   +T  F YENVT +P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ+LVDC+T  V  GC GG M  AFK+V +N G+ T ANYPY 
Sbjct  157  ATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+  AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  217  GVDGKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKSGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSNDGTEYWLVKN  307



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 205/305 (67%), Gaps = 10/305 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            N++  +  A+L +       A AR   + +E    +R+E+W+ +YGRVY +  EK KR+ 
Sbjct  5    NQYRYICLALLFVLAAWASHAKAR---NLHEASMYERHEDWMAQYGRVYKDAGEKSKRYK  61

Query  212  VFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENV  379
            +FKDNV  I SFN   N ++ L IN+FADLTN+EFR +      +H   +E T F YE+V
Sbjct  62   IFKDNVARIESFNKAMNKSYKLSINEFADLTNEEFRASRN-RFKAHICSTEATSFKYEHV  120

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
              +P T++W ++GAVT IK+QGQCG CWAFSAV A EGITQ+ T KLISLSEQ+LVDC+T
Sbjct  121  XAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDT  180

Query  560  V--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GC+GG M  AFK++ +N G+TT ANYPY    G CN  KA+  AA+I+G +++P 
Sbjct  181  SGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVPA  240

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N+E A+ +AVA+QP++VAIDA G  FQFY  G+F+  C T   H V+AVGYG    G KY
Sbjct  241  NNEKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMKY  300

Query  914  WLLKN  928
            WL+KN
Sbjct  301  WLVKN  305



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   304 bits (778),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 188/270 (70%), Gaps = 7/270 (3%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFR  316
            R+E+W+  YG+VYA+  EK +RF +FKDNVEYI SFN  GN  + L +N+FADLTN+E +
Sbjct  37   RHEQWMETYGKVYADAAEKERRFEIFKDNVEYIESFNTAGNKPYKLSVNKFADLTNEELK  96

Query  317  TTM-ACEMPSHSEK---TPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
                    P  +     T F YENVT +P TM+W ++GAVT IK+QGQCG CWAFS V A
Sbjct  97   VARNGYRRPLQTRPMKVTSFKYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAA  156

Query  485  TEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
            TEGI Q+ T KL+SLSEQ+LVDC+T     GC GG M+  F+++ KN GITT ANYPY  
Sbjct  157  TEGINQLTTGKLVSLSEQELVDCDTQGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQA  216

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN+ K +   A+I+G +++P NSEAA+++AVA+QP+SV+IDA G  FQFY  G+F+
Sbjct  217  ADGTCNSRKEASRIAKITGYESVPANSEAALLKAVASQPISVSIDAGGSDFQFYSSGVFT  276

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  277  GQCGTELDHGVTAVGYGETSDGTKYWLVKN  306



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 199/305 (65%), Gaps = 13/305 (4%)
 Frame = +2

Query  35   RHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSV  214
            + ++V A +L L       A+  W  +  E    +R+E+W+  +GRVY    EK +RF +
Sbjct  8    KFILVAAMVLGLY------ASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMI  61

Query  215  FKDNVEYINSFNLGN-YTFTLGINQFADLTNDEFRTT----MACEMPSHSEKTPFMYENV  379
            FK+NVE+I SFN  N   + LGIN FADLTNDEF+ T          S S    F YENV
Sbjct  62   FKNNVEFIESFNENNTRPYKLGINGFADLTNDEFKATRNGYKRSSSVSSSGPKSFRYENV  121

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            T +P T++W Q+GAVT +K QGQCGCCWAFSAV ATEGI Q+ T  L+SLS QQLVDC+T
Sbjct  122  TAVPSTVDWRQKGAVTPVKEQGQCGCCWAFSAVAATEGIHQLTTGNLVSLSVQQLVDCDT  181

Query  560  V--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
               + GC GG++  AFK++  N G+TT  NYPY   KG C+  +A   AA+I+G +++P 
Sbjct  182  KGDNRGCAGGFVNAAFKFIIDNDGLTTEDNYPYEAVKGTCDAGQAESPAAKITGYEDVPS  241

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            NSE+A+ QAVANQPVSVAIDA G  FQFY GG+F+  C T   H VT VGYG    G KY
Sbjct  242  NSESALSQAVANQPVSVAIDADGSHFQFYSGGVFTGDCQTDLDHGVTVVGYGTSDDGTKY  301

Query  914  WLLKN  928
            WL+KN
Sbjct  302  WLVKN  306



>ref|XP_009608954.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=349

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 195/281 (69%), Gaps = 11/281 (4%)
 Frame = +2

Query  119  NEEGTMK-RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFA  292
            N E TM+ R+++WIV + +VY +  EK  RF +FK+NVE I +FN G +  + LG N+F+
Sbjct  33   NYEATMRARHDQWIVHHEKVYKDLNEKEVRFQIFKENVERIEAFNAGEDKGYKLGFNKFS  92

Query  293  DLTNDEFRTTMACEMPSHSE-------KTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQC  451
            DLTN+EFR        SH +       KT F Y NVT +PPTM+W ++GAVT IK+Q +C
Sbjct  93   DLTNEEFRVLHTGYKRSHPKVMTSSKGKTHFRYTNVTDIPPTMDWRKKGAVTPIKDQKEC  152

Query  452  GCCWAFSAVGATEGITQIRTKKLISLSEQQLVDC--ETVSHGCNGGWMQTAFKYVAKNRG  625
            GCCWAFSAV A EG+ Q++T +LI LSEQ+LVDC  E    GC+GG + TAF ++ KN+G
Sbjct  153  GCCWAFSAVAAMEGLHQLKTGELIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKG  212

Query  626  ITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGR  805
            +TT  NYPY    G+CN  K++ +AA+I+G +++P NSE A++QAVANQPVSVAID    
Sbjct  213  LTTEVNYPYKGEDGVCNKKKSALSAAKITGYEDVPANSEKALLQAVANQPVSVAIDGSSF  272

Query  806  PFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             FQFY  G+FS  C+T   HAVTAVGYG    G KYW++KN
Sbjct  273  DFQFYSSGVFSGSCSTWLNHAVTAVGYGATTDGTKYWIIKN  313



>ref|XP_007132817.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
 gb|ESW04811.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
Length=340

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 189/275 (69%), Gaps = 5/275 (2%)
 Frame = +2

Query  119  NEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFAD  295
            +E    +R+E+W+ +YGR Y +  EK KRF +FKDNV++I  FN  GN  + LGIN  AD
Sbjct  30   HEASISQRHEQWMKQYGRTYKDAAEKQKRFLIFKDNVQFIEFFNTAGNKPYKLGINHLAD  89

Query  296  LTNDEFRTTMACEMPSH----SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCW  463
             TN+EF  +      SH    + +TPF YENVT +P  ++W + GAVT IK+QG+CG CW
Sbjct  90   QTNEEFIASHTGYKGSHELRITAQTPFKYENVTRIPTAVDWRENGAVTPIKDQGRCGSCW  149

Query  464  AFSAVGATEGITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGAN  643
            AFS V ATEGI QI T KL+SLSEQ+LVDC++V  GC+GG M+  F+++ KN GIT+  N
Sbjct  150  AFSTVAATEGIYQITTGKLVSLSEQELVDCDSVDQGCDGGLMEDGFEFIIKNGGITSEVN  209

Query  644  YPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYK  823
            YPYT     C+T K +   A+I G + +PPNSE A+ +AVANQPVSV+IDA G  FQFY 
Sbjct  210  YPYTGVNETCDTKKEASPEAQIKGYETVPPNSEEALQKAVANQPVSVSIDAGGSAFQFYS  269

Query  824  GGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             G+F+  C T+  H VTAVGYG+   G +YW++KN
Sbjct  270  SGVFTGQCGTQLDHGVTAVGYGITDNGTEYWIVKN  304



>gb|AAW78661.2| senescence-specific cysteine protease [Nicotiana tabacum]
Length=349

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 195/281 (69%), Gaps = 11/281 (4%)
 Frame = +2

Query  119  NEEGTMK-RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFA  292
            N E TM+ R+++WIV + +VY +  EK  RF +FK+NVE I +FN G +  + LG N+F+
Sbjct  33   NYEATMRARHDQWIVHHEKVYKDLNEKEVRFQIFKENVERIEAFNAGEDKGYKLGFNKFS  92

Query  293  DLTNDEFRTTMACEMPSHSE-------KTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQC  451
            DLTN+EFR        SH +       KT F Y NVT +PPTM+W ++GAVT IK+Q +C
Sbjct  93   DLTNEEFRVLHTGYKRSHPKVMTSSKGKTHFRYTNVTDIPPTMDWRKKGAVTPIKDQKEC  152

Query  452  GCCWAFSAVGATEGITQIRTKKLISLSEQQLVDC--ETVSHGCNGGWMQTAFKYVAKNRG  625
            GCCWAFSAV A EG+ Q++T +LI LSEQ+LVDC  E    GC+GG + TAF ++ KN+G
Sbjct  153  GCCWAFSAVAAMEGLHQLKTGELIPLSEQELVDCDVEGEDEGCSGGLLDTAFDFILKNKG  212

Query  626  ITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGR  805
            +TT  NYPY    G+CN  K++ +AA+I+G +++P NSE A++QAVANQPVSVAID    
Sbjct  213  LTTEVNYPYKGEDGVCNKKKSALSAAKITGYEDVPANSEKALLQAVANQPVSVAIDGSSF  272

Query  806  PFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             FQFY  G+FS  C+T   HAVTAVGYG    G KYW++KN
Sbjct  273  DFQFYSSGVFSGSCSTWLNHAVTAVGYGATTDGTKYWIIKN  313



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 195/276 (71%), Gaps = 8/276 (3%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADL  298
            E   ++R+E+W+  +G +Y +  EK KRF++FKDNVE I +FN+ GN  + L +N+FAD 
Sbjct  35   EASMLERHEQWMASHGVLYEDAVEKEKRFTIFKDNVERIEAFNMAGNKPYKLSVNRFADQ  94

Query  299  TNDEFRTT----MACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWA  466
            TN+EF+ +         PS S KT F YEN+T + P+M+W  +GAVT IK+QG CGCCWA
Sbjct  95   TNEEFKASRNGYKRSTQPS-SSKTSFRYENMTSVLPSMDWRSKGAVTPIKDQGDCGCCWA  153

Query  467  FSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGA  640
            FSAV A EGIT+++  KLISLSEQ+LVDC+T    +GC GG+M  AF+++  N G+TT A
Sbjct  154  FSAVAAMEGITKLKAGKLISLSEQELVDCDTAGGDYGCEGGFMDNAFQFIQHNGGLTTEA  213

Query  641  NYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFY  820
            NYPY    G C+  K++ +AA+ISG +++P N+E A+++AV+NQPVSVAIDA G  FQFY
Sbjct  214  NYPYKQTDGTCDKRKSALSAAKISGYEDVPANNEVALLKAVSNQPVSVAIDAGGFDFQFY  273

Query  821  KGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  274  SSGIFTGECGTNLDHGVTAVGYGTSSDGTKYWLVKN  309



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/297 (53%), Positives = 199/297 (67%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L +GA   +AT+R   D +      RYE+W+  YGRVY +  EK  RF +FK+NV +I
Sbjct  5    LILMLGAWSSQATSRSLQDAS---IYARYEQWLARYGRVYNDVDEKEIRFKIFKENVAFI  61

Query  239  NSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
             S N   N    L +NQFADLTN+EF+ +       H   ++ T F YENVT  LP TM+
Sbjct  62   ESSNKDANKPHKLSVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYENVTAALPATMD  120

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCN  577
            W ++GAVT +K+QGQCGCCWAFSAV ATEG+TQ+ T KLISLSEQ+LVDC+T     GC 
Sbjct  121  WRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCE  180

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N GI+T  NYPY    G CNT K +  AA+I+G +++P NSE A++ 
Sbjct  181  GGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLT  240

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  241  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  297



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 201/310 (65%), Gaps = 19/310 (6%)
 Frame = +2

Query  29   KNRHLIVFAAIL---ALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKM  199
            K + +I F  IL   A E+ +R         +  E     R+E+W+  +G+VYA+  EK 
Sbjct  6    KRQCIIAFILILGTWAYEVASR---------ELQEPSMSARHEQWMATFGKVYADAAEKE  56

Query  200  KRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEK---TPF  364
            +RF +FKDNVEYI SFN  GN  + L +N+FADLT +E +        P  +     T F
Sbjct  57   RRFEIFKDNVEYIESFNTAGNKPYKLSVNKFADLTTEELKVARNGYRRPLQTRPMKVTSF  116

Query  365  MYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQL  544
             YENVT +P TM+W ++GAVT IK+QGQCG CWAFS V ATEGI Q+ T KL+SLSEQ+L
Sbjct  117  EYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQEL  176

Query  545  VDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGL  718
            VDC+T     GC GG M+  F+++ KN GIT+ ANYPY    G CN+ K +   A+I+G 
Sbjct  177  VDCDTQGEDQGCEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGY  236

Query  719  QNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMP  898
            +++P NSEAA+++AVANQP+SV+IDA G  FQFY  G+F+  C T   H VTAVGYG   
Sbjct  237  ESVPANSEAALLKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETS  296

Query  899  GGKKYWLLKN  928
             G KYWL+KN
Sbjct  297  DGTKYWLVKN  306



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 201/303 (66%), Gaps = 14/303 (5%)
 Frame = +2

Query  41   LIVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVF  217
             I  A IL L  GA   EAT+R   D    G   RYE+W++ YGR+Y++  EK KRF +F
Sbjct  9    FICLALILIL--GAWSSEATSRSLQDALMYG---RYEQWMIRYGRIYSDTDEKEKRFKIF  63

Query  218  KDNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV  385
            K+NV +I S N   N  + L +N FADLTN+EF T        H   ++ T F YEN TV
Sbjct  64   KENVAFIESSNDEANKPYKLSVNGFADLTNEEF-TASRNRFKGHECSTKTTSFKYENATV  122

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--  559
             P  M+W Q+GAVT IK+QGQCGCCWAFSAV A EGITQ+ T KLISLSEQ+LVDC+   
Sbjct  123  -PTKMDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNG  181

Query  560  VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
               GC GG M  AF+++ +N G++T ANYPYT   G CN  K +  AA I+G +++P NS
Sbjct  182  EDQGCEGGLMDDAFEFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPANS  241

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            E+A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL
Sbjct  242  ESALLKAVANQPISVAIDASGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVGDDGTKYWL  301

Query  920  LKN  928
            +KN
Sbjct  302  VKN  304



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 198/306 (65%), Gaps = 16/306 (5%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            +V AAIL L + A       W    N+    +R+E W+ +YGRVY +  EK  RF +FK+
Sbjct  10   LVLAAILVLGVWA----PQSWSRTLNDATMNERHEMWMAQYGRVYRDNAEKEMRFKIFKE  65

Query  224  NVEYINSFN--LGNYTFTLGINQFADLTNDEFRTT-------MACEMPSHSEKTPFMYEN  376
            NVEYI SFN    N  + LGIN+FAD TN+EFR         +     S +    F YEN
Sbjct  66   NVEYIASFNNKARNKPYKLGINEFADQTNEEFRAPRNGYKRRLPSVRSSETTDVSFRYEN  125

Query  377  VTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCE  556
             +V P +++W ++GAVT +K+QGQCGCCWAFSAV A EGI  I T+KL SLSEQ+LVDC+
Sbjct  126  ASV-PASIDWRKKGAVTGVKDQGQCGCCWAFSAVAAMEGINHITTRKLTSLSEQELVDCD  184

Query  557  TV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIP  730
            T     GC GG M  AF+++  N+G+ T A YPY    G CN  +A+ +AA+ISG +++P
Sbjct  185  TSGEDQGCEGGLMDDAFEFIISNKGLATEAKYPYKASDGSCNKKEANPSAAKISGYEDVP  244

Query  731  PNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKK  910
             N+EAA+M+AVANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYG    G K
Sbjct  245  SNNEAALMKAVANQPVSVAIDASGSDFQFYSSGVFTGQCGTELDHGVTAVGYGTADDGTK  304

Query  911  YWLLKN  928
            YWL+KN
Sbjct  305  YWLVKN  310



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 200/296 (68%), Gaps = 12/296 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L +GA   EAT+R   D    G   RYE+W+  +GRV+++  EK  RF +FK+N+ YI
Sbjct  14   LILMLGAWSSEATSRTLQDVTMYG---RYEQWMARHGRVFSSIDEKESRFKIFKENLAYI  70

Query  239  NSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSHSEKT---PFMYENVTVLPPTMNW  406
             S N   + TF LG+NQFA LTN+EF T+++     H   T    F YENVTV P TM+W
Sbjct  71   ESSNNDASKTFRLGVNQFAHLTNEEF-TSLSNGFKGHESSTKTSSFRYENVTV-PATMDW  128

Query  407  LQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNG  580
              +GAVT IKNQGQCGCCWAFSAV A EGITQ+   KLISLSEQ+LVDC+      GC G
Sbjct  129  RSKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLTMGKLISLSEQELVDCDKSGEDQGCEG  188

Query  581  GWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQA  760
            G M  AF+++ +N G++T ANYPYT   G CN  K +  AA I+G +++P NSE+A+++A
Sbjct  189  GLMDDAFEFINQNHGLSTEANYPYTGVDGKCNARKEASHAASITGHEDVPANSESALLKA  248

Query  761  VANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            VA+QP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  249  VASQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKN  304



>sp|A2XQE8.1|SAG39_ORYSI RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EAY93058.1| hypothetical protein OsI_14861 [Oryza sativa Indica Group]
Length=339

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 197/302 (65%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +  L +   C A    R   ++     R+E W+ +YGRVY +  EK +RF VFK 
Sbjct  7    LLFAILGCLCL---CSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKA  63

Query  224  NVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--L  388
            NV +I SFN GN+ F LG+NQFADLTNDEFR T   +  +PS +   T F YENV +  L
Sbjct  64   NVAFIESFNAGNHNFWLGVNQFADLTNDEFRWTKTNKGFIPSTTRVPTGFRYENVNIDAL  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P T++W  +GAVT IK+QGQCGCCWAFSAV A EGI ++ T KLISLSEQ+LVDC+    
Sbjct  124  PATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT +NYPY      C +   S + A I G +++P N+E
Sbjct  184  DQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCKSV--SNSVASIKGYEDVPANNE  241

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFYKGG+ +  C T   H + A+GYG    G KYWLL
Sbjct  242  AALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  923  KN  928
            KN
Sbjct  302  KN  303



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 202/307 (66%), Gaps = 14/307 (5%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            N    V    L L +GA   EAT+R   D    G   RYE+W+  YGRVY + TEK +RF
Sbjct  4    NNQSKVLCLALVLMLGAWSSEATSRSLQDALAYG---RYEQWMARYGRVYNDATEKEERF  60

Query  209  SVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTT----MACEMPSHSEKTPFMYE  373
             +FK N  +I S N  GN  + LG+NQFADLTN+EF  +    +  E  + S  T F YE
Sbjct  61   KIFKANEAFIESSNNEGNKPYKLGLNQFADLTNEEFIASRNRFLGHECSTKS--TTFKYE  118

Query  374  NVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDC  553
            N TV P T++W Q+GAVT +K+QGQCGCCWAFSAV A EGITQ+ T KLISLSEQ+LVDC
Sbjct  119  NSTV-PATIDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDC  177

Query  554  ET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNI  727
            +      GC GG M  AF+++ +N G++T ANYPYT   G CN  K +  AA I+G +++
Sbjct  178  DVNGEDQGCEGGLMDNAFEFINQNHGLSTEANYPYTGVDGTCNAKKEANHAASITGHEDV  237

Query  728  PPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGK  907
            PPN E+A+ +AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G 
Sbjct  238  PPNDESALQKAVANQPISVAIDASGSGFQFYSSGVFTGPCGTSLDHGVTAVGYGVSDDGT  297

Query  908  KYWLLKN  928
            K+WL+KN
Sbjct  298  KFWLVKN  304



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 191/286 (67%), Gaps = 7/286 (2%)
 Frame = +2

Query  92   ATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGN-YTF  268
            A+  W  +  E    +R+E+W+  +GRVY    EK +RF +FK+NVE+I SFN  N   +
Sbjct  7    ASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNENNTRPY  66

Query  269  TLGINQFADLTNDEFRTT----MACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIK  436
             LGIN FADLTNDEF+ T          S S    F YENVT +P T++W Q+GAVT +K
Sbjct  67   KLGINGFADLTNDEFKATRNGYKRSSSVSSSGPKSFRYENVTAVPSTVDWRQKGAVTPVK  126

Query  437  NQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYV  610
             QGQCGCCWAFSAV ATEGI Q+ T  L+SLS QQLVDC+T   + GC GG++  AFK++
Sbjct  127  EQGQCGCCWAFSAVAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNRGCAGGFVNAAFKFI  186

Query  611  AKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAI  790
              N G+TT  NYPY   KG C+  +A   AA+I+G +++P NSE+A+ QAVANQPVSVAI
Sbjct  187  IDNDGLTTEDNYPYEAVKGTCDAGQAESPAAKITGYEDVPSNSESALSQAVANQPVSVAI  246

Query  791  DAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            DA G  FQFY GG+F+  C T   H VT VGYG    G KYWL+KN
Sbjct  247  DADGSHFQFYSGGVFTGDCQTDLDHGVTVVGYGTSDDGTKYWLVKN  292



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/303 (49%), Positives = 209/303 (69%), Gaps = 10/303 (3%)
 Frame = +2

Query  38   HLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVF  217
              ++ A    L M A  +A+ R   + +E   ++R+E+W+ ++G+VY +  EK++RF +F
Sbjct  8    QFLLIALFFVLAMWAD-QASTR---ELHESTMVERHEKWMAKHGKVYKDDEEKLRRFQIF  63

Query  218  KDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEK--TPFMYENVTV  385
            K+NVE+I S N  GN ++ LGIN+FADLTN+EFR +    + P  + +  TPF YENVT 
Sbjct  64   KNNVEFIESSNAAGNNSYMLGINRFADLTNEEFRASWNGYKRPLDASRIVTPFKYENVTA  123

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVS  565
            LP +M+W ++GAVT IK+Q +CG CWAFSAV ATEG+ ++RT KL+SLSEQ+LVDC+   
Sbjct  124  LPYSMDWRRKGAVTSIKDQRECGSCWAFSAVAATEGVHKLRTGKLVSLSEQELVDCDVKG  183

Query  566  H--GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
               GC GG M+ AFK++ +N GITT ANY Y  R G C+T K +   A+I+G Q +P NS
Sbjct  184  EDKGCQGGLMEDAFKFIKRNGGITTEANYAYRGRDGKCDTKKEASHVAKITGYQVVPENS  243

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            EAA+++AVA+QPVSV+IDA    FQFY+ G+++  C +   H V AVGYG    G KYW+
Sbjct  244  EAALLKAVAHQPVSVSIDAGSMSFQFYQSGIYAGSCGSDLNHGVAAVGYGTSSSGSKYWI  303

Query  920  LKN  928
            +KN
Sbjct  304  VKN  306



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/305 (51%), Positives = 195/305 (64%), Gaps = 10/305 (3%)
 Frame = +2

Query  35   RHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSV  214
            + L   A I  +   A  + T+R      E    +++E+W+ +YG+VY N  EK KRF +
Sbjct  6    QSLCKLALIFLIFATATSQVTSR---KLQEASLSEKHEQWMSKYGKVYKNPEEKEKRFRI  62

Query  215  FKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMP---SHSEKTPFMYENV  379
            FKDNVE+I S N  GN  + L +N+FAD TN EF+        P   +  + T F YENV
Sbjct  63   FKDNVEFIESLNAAGNKPYKLSVNEFADQTNQEFKAFRNGYRRPNGLASRKGTSFKYENV  122

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
              +P TM+W + GAVT IKNQG CG CWAFSAV ATEGITQ+ T KLISLSEQ+LV C+T
Sbjct  123  IDVPATMDWRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVSCDT  182

Query  560  --VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
              V HGC GG M+ AFK++  N GITT ANYPY    G CN  K +   A+I G + +P 
Sbjct  183  SGVDHGCEGGEMEDAFKFIIHNDGITTEANYPYQAADGTCNKTKEASHVAKIKGYETVPA  242

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            NSE A+++AVANQPV+V+IDA G  FQFY  G+F+  C T   H VTAVGYG    G KY
Sbjct  243  NSEEALLKAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGTKY  302

Query  914  WLLKN  928
            WL+KN
Sbjct  303  WLVKN  307



>ref|XP_004306836.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 202/305 (66%), Gaps = 10/305 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            N+   +  A++ + +GA   EAT+R   D    G   RYE+WI  YGRVY +  EK  RF
Sbjct  5    NQSKCICLALVLIMLGAWSSEATSRSLQDALAYG---RYEQWIARYGRVYNDAIEKEDRF  61

Query  209  SVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENV  379
             +FK+N  Y+ S N  GN  + L +NQFADLTN+EF  T    +     ++ T F YEN 
Sbjct  62   KIFKENEAYVESSNKDGNKLYKLSLNQFADLTNEEFTATRNRFLGHECSTKTTTFKYENA  121

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
             V P TM+W ++GAVT +K+QGQCG CWAFSAVGA EGITQ+ T KLISLSEQ+LVDC+ 
Sbjct  122  YV-PATMDWRKKGAVTPVKDQGQCGSCWAFSAVGAMEGITQLTTGKLISLSEQELVDCDV  180

Query  560  --VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
              V  GC+GG M  AF++V +N GI T ANYPYT   G CN  K +  AA I+G +++P 
Sbjct  181  NGVDQGCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPA  240

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            NSE+A+++AVANQP+SVAIDA G  FQ Y  G+F+  C T   H VTAVGYGV   G KY
Sbjct  241  NSESALLKAVANQPISVAIDASGYDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKY  300

Query  914  WLLKN  928
            WL+KN
Sbjct  301  WLVKN  305



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 198/302 (66%), Gaps = 15/302 (5%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            L +   +LALE  AR    A           ++RYE+W+ + G+VY    EK  R+ +FK
Sbjct  14   LFLVFGLLALETNARSLEDAS---------LLERYEQWMTQNGKVYKGSQEKALRYQIFK  64

Query  221  DNVEYINSFNLG-NYTFTLGINQFADLTNDEFRT--TMACEMPSHSEKTP-FMYENVTVL  388
            +NV++I +FN G N  + LGINQFADLTN+EF+T       M S   +TP F YE+VT +
Sbjct  65   ENVQFIEAFNKGGNKPYKLGINQFADLTNEEFKTRNKFKGHMCSTITRTPTFKYEHVTSV  124

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P  ++W Q+GAVT IK+QGQCG CWAFSAV ATEGIT++ + KL+SLSEQ+LVDC+   V
Sbjct  125  PAALDWRQKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSSGKLVSLSEQELVDCDIKGV  184

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ +N+G+TT   YPY    G CN        A I G +++P NSE
Sbjct  185  DQGCEGGLMDDAFKFMLQNKGLTTEVVYPYQGVDGTCNAKAEGNHVASIKGYEDVPANSE  244

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+
Sbjct  245  SALLKAVANQPISVAIDASGSEFQFYSSGVFTGTCGTELDHGVTAVGYGVSEDGTKYWLV  304

Query  923  KN  928
            KN
Sbjct  305  KN  306



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 199/299 (67%), Gaps = 12/299 (4%)
 Frame = +2

Query  56   AILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEY  235
            AIL L +   C A    R  +++   + R+E+W+ +Y RVY + TEK +RF VFK NV++
Sbjct  10   AILGLAL--FCGAALAARDLNDDSAMVARHEQWMAQYNRVYKDATEKAQRFEVFKANVKF  67

Query  236  INSFNLG-NYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--LPPT  397
            I SFN G N  F LG+NQFADLTNDEFR T   +   PS  +  T F YENV+V  LP +
Sbjct  68   IESFNAGGNRKFWLGVNQFADLTNDEFRATKTNKGFKPSPVKVPTGFRYENVSVDALPAS  127

Query  398  MNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHG  571
            ++W  +GAVT IK+QGQCGCCWAFSAV ATEGI +I T KLISLSEQ+LVDC+      G
Sbjct  128  IDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTDKLISLSEQELVDCDVHGEDQG  187

Query  572  CNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAI  751
            C GG M  AFK++ KN G+TT ++YPYT   G C +   + +AA I G +++P N EAA+
Sbjct  188  CEGGLMDDAFKFIIKNGGLTTESSYPYTATDGKCKS--GTNSAANIKGFEDVPANDEAAL  245

Query  752  MQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            M+AVANQPVSVA+D     FQ Y GG+ +  C T   H + A+GYG    G KYWLLKN
Sbjct  246  MKAVANQPVSVAVDGGDMTFQLYSGGVMTGSCGTDLDHGIAAIGYGQTSDGTKYWLLKN  304



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 203/309 (66%), Gaps = 11/309 (4%)
 Frame = +2

Query  23   SRKNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMK  202
            S    + I  A +  L + A  + T+R   DD+     +R+ +W+ +YG++Y +  E+  
Sbjct  3    SNNQVYHISLALVFCLGLFA-IQVTSRTLQDDS---MYERHGQWMSQYGKIYKDHQERET  58

Query  203  RFSVFKDNVEYINSFNLGNY-TFTLGINQFADLTNDEF---RTTMACEMPSH-SEKTPFM  367
            RF +F +NV Y+ + N  +  ++ LGINQFADLTN+EF   R      M S  +  T F 
Sbjct  59   RFKIFTENVNYVEASNADDTKSYKLGINQFADLTNEEFVASRNKFKGHMCSSITRTTTFK  118

Query  368  YENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLV  547
            YENV+ +P T++W ++GAVT +KNQGQCGCCWAFSAV ATEGI ++ T KLISLSEQ+LV
Sbjct  119  YENVSAIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELV  178

Query  548  DCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQ  721
            DC+T  V  GC GG M  AFK++ +N G++T A YPY    G CN  KAS  A  I+G +
Sbjct  179  DCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEAQYPYEGVDGTCNANKASVQAVTITGYE  238

Query  722  NIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPG  901
            ++P NSE A+ +AVANQP+SVAIDA G  FQFYK G+F+  C T   H VTAVGYGV   
Sbjct  239  DVPANSEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSND  298

Query  902  GKKYWLLKN  928
            G KYWL+KN
Sbjct  299  GTKYWLVKN  307



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 189/268 (71%), Gaps = 6/268 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFR  316
            +YE+W+  YGRVY +  EK  RF +FK+NV +I S N   N  + L +NQFADLTN+EF+
Sbjct  40   KYEQWMARYGRVYTDIQEKEMRFKIFKENVAFIESSNSDANKPYKLSVNQFADLTNEEFK  99

Query  317  TTMACEMPSH--SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATE  490
             +    +     ++ T F YENVT  PPT++W  +GAVT IK+QGQCGCCWAFSAV A E
Sbjct  100  ASRNGFLGHECSTKTTTFKYENVTA-PPTVDWRTKGAVTPIKDQGQCGCCWAFSAVAAME  158

Query  491  GITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRK  664
            GIT++ T  LISLSEQ+LVDC+T  V  GC GG M  AF+++++N G+ T  NYPYT   
Sbjct  159  GITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFISQNHGLRTETNYPYTGVD  218

Query  665  GMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTG  844
            G CNT K +  AA+I+G +++P NSEAA+++AVANQP+SVAIDA G  FQFY  G+F+  
Sbjct  219  GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFYSSGVFTGS  278

Query  845  CTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            C T   H VTAVGYGV   G KYWL+KN
Sbjct  279  CGTSLDHGVTAVGYGVSADGTKYWLVKN  306



>ref|XP_004233054.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=351

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/310 (48%), Positives = 202/310 (65%), Gaps = 11/310 (4%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            NR   +  A+  +  G      A  R  +NE     R+E+WI  + ++Y +  EK  RF 
Sbjct  6    NRSKYICLALFFIVFGLWSSQLASSRPINNETTMRVRHEQWIAHHDKIYNDLKEKEIRFK  65

Query  212  VFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFR--------TTMACEMPSHSEKTPF  364
            +FK+NVE I +FN G +  + LG+N+FADLTN+EFR        ++    M S   KT F
Sbjct  66   IFKENVERIETFNAGEDKGYKLGVNKFADLTNEEFRVLHTGYKSSSHPKIMSSSKPKTHF  125

Query  365  MYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQL  544
             Y N+T +PP M+W ++GAVT IK+Q +CGCCWAFSAV A EG+ Q++T KLI LSEQ+L
Sbjct  126  RYANITDVPPIMDWRRKGAVTPIKDQMECGCCWAFSAVAAMEGLHQLKTGKLIPLSEQEL  185

Query  545  VDCETVSH--GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGL  718
            VDC+      GC GG + TAF+++ KN+G+TT ANYPY    G+CN  K++ + A+I+G 
Sbjct  186  VDCDVEGEDLGCTGGLLDTAFQFIIKNKGLTTEANYPYQAADGVCNKKKSALSVAKITGY  245

Query  719  QNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMP  898
            +++P N+E A++QAVANQPVSVAID     FQFY  G+FS  C+T   HAVTAVGYG   
Sbjct  246  EDVPANNEKALLQAVANQPVSVAIDGSSFDFQFYSSGVFSGSCSTWLNHAVTAVGYGAAS  305

Query  899  GGKKYWLLKN  928
             G KYW++KN
Sbjct  306  DGTKYWIIKN  315



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 183/269 (68%), Gaps = 6/269 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            R+E+W+  YGRVY +  EK +RF +FKDN  YI S N  GN  + LG+NQFAD+TN+EF+
Sbjct  35   RHEQWMARYGRVYKDAVEKERRFQIFKDNHNYIESVNRAGNRKYKLGLNQFADMTNEEFK  94

Query  317  TTMACEMPSHSEKT---PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGAT  487
             +     P H  K+    F Y N+T +  +M+W  RGAVT IKNQ  CGCCWAFS+V A 
Sbjct  95   ASHLGFKPMHLAKSATGSFQYANLTDVSDSMDWRTRGAVTPIKNQKSCGCCWAFSSVAAI  154

Query  488  EGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMR  661
            EGITQI T  L+SLSEQQLV+C+     +GC GG+M  AF YV  N GIT+ ANYPY   
Sbjct  155  EGITQINTGNLVSLSEQQLVNCDVNDGDNGCQGGFMTRAFHYVINNGGITSEANYPYKAA  214

Query  662  KGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFST  841
             G C+T KAS + A ISG +N+P N E++++QAV+ QPVSV ID  G+ FQ+Y  G+F+ 
Sbjct  215  DGTCDTNKASSSVATISGYENVPANDESSLLQAVSKQPVSVGIDGGGKDFQYYSSGIFTG  274

Query  842  GCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             CTT   HAVTA+GYG    G KYWLLKN
Sbjct  275  ACTTDMDHAVTAIGYGKAKDGTKYWLLKN  303



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 201/295 (68%), Gaps = 10/295 (3%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L   +GA   +AT+R   D +  G   +YE+W+  YGRVY +  EK  RF +FK+NV +I
Sbjct  16   LIFMLGAWSSQATSRNLQDASMYG---KYEQWMARYGRVYTDIQEKEMRFKIFKENVAFI  72

Query  239  NSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVTVLPPTMNWL  409
             S N   N  + L +NQFADLTN+EF+ +    +     ++ T F YENVT  PPT++W 
Sbjct  73   ESSNSDANKPYKLSVNQFADLTNEEFKASRNGFLGHECSTKTTTFKYENVTA-PPTVDWR  131

Query  410  QRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGG  583
             +GAVT IK+QGQCGCCWAFSAV A EGIT++ T  LISLSEQ+LVDC+T  V  GC GG
Sbjct  132  TKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGG  191

Query  584  WMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAV  763
             M  AF+++ +N G++T  NYPYT   G CNT K +  AA+I+G +++P NSEAA+++AV
Sbjct  192  LMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAV  251

Query  764  ANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            ANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  252  ANQPISVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSADGTKYWLVKN  306



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 202/305 (66%), Gaps = 11/305 (4%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            N    ++ A++ +      EAT+R   D    G   RYE+W+  Y RVY++  EK KRF 
Sbjct  5    NHCKCIYLALIIMLGAWSSEATSRSLQDVIMYG---RYEQWMARYERVYSDFDEKEKRFQ  61

Query  212  VFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENV  379
            +FK+NV ++ S N   N  + L +N+FADLTN+EF T        H   +E T + YENV
Sbjct  62   IFKENVAFVESSNGEANKPYKLSVNRFADLTNEEF-TASRNRFKGHECSTETTSYKYENV  120

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            TV P TM+W Q+GAVT IK+QGQCGCCWAFSAV A EGITQ+ T KLISLSEQ+LVDC+ 
Sbjct  121  TV-PATMDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDV  179

Query  560  --VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GC GG M  AF+++ +N G++T ANYPYT   G CN  K +  AA I+G +++P 
Sbjct  180  NGEDQGCEGGLMDDAFQFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPA  239

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            NSE+A+++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KY
Sbjct  240  NSESALLKAVANQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDNGTKY  299

Query  914  WLLKN  928
            WL+KN
Sbjct  300  WLVKN  304



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/270 (55%), Positives = 192/270 (71%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+ +YGRVY +  E+  R+S+FK+NV  +++FN     ++ LG+NQFADLTN+EF
Sbjct  57   ERHEQWMTQYGRVYKDDNERATRYSIFKENVARVDAFNSQTGKSYKLGVNQFADLTNEEF  116

Query  314  ---RTTMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
               R      M S  +  PF YENV+ +P TM+W + GAVT  K+QGQCGCCWAFSAV A
Sbjct  117  KASRNRFKGHMCS-PQAGPFRYENVSAVPSTMDWRKEGAVTPAKDQGQCGCCWAFSAVAA  175

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGI ++ T KLI LSEQ++VDC+T     GCNGG M  AFK++ +N+G+TT ANYPY  
Sbjct  176  IEGINKLTTGKLIFLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEANYPYKG  235

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT KA+  AA+I+G + +P NSEAA+M+AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  236  TDGTCNTKKATNHAAKITGFEYVPANSEAALMKAVAEQPVSVAIDAGGYDFQFYSSGIFT  295

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T+  H VTAVGYGV   G KYWL+KN
Sbjct  296  GSCDTQLDHGVTAVGYGV-SDGSKYWLVKN  324



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 183/270 (68%), Gaps = 6/270 (2%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEFR  316
            +R+E+W+ ++GRVY +  EK +RF +FK NVE I SFN GN  + LG+NQFADLT +EF+
Sbjct  37   ERHEQWMSQHGRVYGDSAEKERRFQIFKANVELIESFNAGNSKYKLGVNQFADLTIEEFK  96

Query  317  TTMACEMPSH----SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
              M    PS          F YENVT +P +M+W   GAVT IK+QG  GCCWAFSAV A
Sbjct  97   AMMNGFKPSSVNTFKATNVFRYENVTAVPTSMDWRAEGAVTPIKDQGDYGCCWAFSAVAA  156

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGIT+++T KLISLSEQ+LVDC+      GC GG M  AF+++ +N G+TT  NYPY  
Sbjct  157  MEGITKLKTGKLISLSEQELVDCDVAGEDQGCEGGLMDDAFEFIIRNGGLTTETNYPYKG  216

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K+   AA I G +++P NSEAA++ AV+NQPVSVAI+A G  FQFY  G+F+
Sbjct  217  IDGTCNTKKSFSHAASIKGYEDVPANSEAALLNAVSNQPVSVAIEASGYSFQFYSSGVFT  276

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYG    G KYWL+KN
Sbjct  277  GSCGTDLDHGVTAVGYGTARDGTKYWLVKN  306



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 187/271 (69%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  YG+VY +  E+ KRF +FK+NV YI +FN   N  + L INQFADLTN+EF
Sbjct  20   ERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEF  79

Query  314  ---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S   +T  F YENVT +P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  80   IAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  139

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ+LVDC+T  V  GC GG M  AFK+V +N G+ T ANYPY 
Sbjct  140  ATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANYPYK  199

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+     I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  200  GVDGKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKSGVF  259

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  260  TGSCGTELDHGVTAVGYGVSNDGTEYWLVKN  290



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 187/270 (69%), Gaps = 8/270 (3%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFR  316
            RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N  + L +NQFADLTN+EF+
Sbjct  40   RYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNXDANKPYKLSVNQFADLTNEEFK  99

Query  317  TTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
             +       H   ++ T F YENVT  LP TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  100  VSRN-GFKGHECSTKTTSFKYENVTASLPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  158

Query  485  TEGITQIRTKKLISLSEQQLVDCETVS--HGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
            TEGITQ+ T  LISLSEQ+LVDC+T S   GC GG M  AF+++ +N GI T ANYPY  
Sbjct  159  TEGITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGIGTEANYPYEG  218

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN+ K +  AA+I+G +++P NSE  ++ AVA+QPVSVAIDA G  FQFY  G+F+
Sbjct  219  VDGTCNSKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDFQFYSSGVFT  278

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYGV   G KYWL+KN
Sbjct  279  GTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  308



>sp|Q7XWK5.2|SAG39_ORYSJ RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa Japonica Group]
 gb|EAZ29764.1| hypothetical protein OsJ_13822 [Oryza sativa Japonica Group]
Length=339

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 196/302 (65%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +  L +   C A    R   ++     R+E W+ +YGRVY +  EK +RF VFK 
Sbjct  7    LLFAILGCLCL---CSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKA  63

Query  224  NVEYINSFNLGNYTFTLGINQFADLTNDEFR--TTMACEMPSHSE-KTPFMYENVTV--L  388
            NV +I SFN GN+ F LG+NQFADLTNDEFR   T    +PS +   T F YENV +  L
Sbjct  64   NVAFIESFNAGNHNFWLGVNQFADLTNDEFRWMKTNKGFIPSTTRVPTGFRYENVNIDAL  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P T++W  +GAVT IK+QGQCGCCWAFSAV A EGI ++ T KLISLSEQ+LVDC+    
Sbjct  124  PATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT +NYPY      C +   S + A I G +++P N+E
Sbjct  184  DQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCKSV--SNSVASIKGYEDVPANNE  241

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFYKGG+ +  C T   H + A+GYG    G KYWLL
Sbjct  242  AALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  923  KN  928
            KN
Sbjct  302  KN  303



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 160/309 (52%), Positives = 204/309 (66%), Gaps = 14/309 (5%)
 Frame = +2

Query  32   NRHLIVFAAILAL--EMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMK  202
            N  L      LAL   +GA   +AT+R   D +  G   R+E+W+V YGRVY +  EK K
Sbjct  5    NLQLCKLCTCLALIIMLGAWSSKATSRSLQDASMYG---RHEQWMVRYGRVYTDNEEKEK  61

Query  203  RFSVFKDNVEYINSFNLGNYT-FTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMY  370
            RF +FK+NV YI S N  +   + L +NQF DLTN+EF  +       H   ++ T F Y
Sbjct  62   RFKIFKENVAYIESSNADSSKPYKLRVNQFTDLTNEEFIASRN-RFKGHECSTKTTSFKY  120

Query  371  ENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLV  547
            ENVT  +P TM+W ++GAVT IK+QGQCGCCWAFSAV ATEGITQ+ T KL+SLSEQ+LV
Sbjct  121  ENVTASVPATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELV  180

Query  548  DCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQ  721
            DC+T  V  GC GG M  AF+++ +N G++T ANYPY    G CNT K +  AA+I+  +
Sbjct  181  DCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITDHE  240

Query  722  NIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPG  901
            ++P N E A++ AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   
Sbjct  241  DVPANDEKALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDD  300

Query  902  GKKYWLLKN  928
            G KYWL+KN
Sbjct  301  GTKYWLVKN  309



>emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa Japonica Group]
 gb|EAZ29777.1| hypothetical protein OsJ_13835 [Oryza sativa Japonica Group]
Length=339

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 198/302 (66%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +  L +   C A    R   +    + R+E W+ +YGRVY + TEK +RF +FK 
Sbjct  7    LLFAILSCLCL---CSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIFKA  63

Query  224  NVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--L  388
            NV +I SFN GN+ F LG+NQFADLTN EFR T   +  +PS     T F YENV++  L
Sbjct  64   NVAFIESFNAGNHKFWLGVNQFADLTNYEFRATKTNKGFIPSTVRVPTTFRYENVSIDTL  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P T++W  +GAVT IK+QGQCGCCWAFSAV A EGI ++ T KLISLSEQ+LVDC+    
Sbjct  124  PATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT + YPYT   G CN    S +AA I G +++P N+E
Sbjct  184  DQGCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKCN--GGSNSAATIKGYEDVPANNE  241

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFY GG+ +  C T   H + A+GYG    G +YWLL
Sbjct  242  AALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIVAIGYGKDGDGTQYWLL  301

Query  923  KN  928
            KN
Sbjct  302  KN  303



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/274 (52%), Positives = 188/274 (69%), Gaps = 5/274 (2%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADL  298
            +E  ++R+E+W+ +YGRVY +  EK +RF +F+ N EYI S N  G+  + LG+NQFAD+
Sbjct  17   DEPMLRRHEQWMAQYGRVYKDAAEKERRFQIFRGNYEYIESINRAGDRKYKLGLNQFADM  76

Query  299  TNDEFRTTMAC--EMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFS  472
            TN+EF+ +      MP+ S    F Y N++  P +M+W  +GAVT +KNQ  CGCCWAFS
Sbjct  77   TNEEFKASRLGFKPMPTESTTGSFQYANLSDAPDSMDWRTKGAVTAVKNQRSCGCCWAFS  136

Query  473  AVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANY  646
            +V A E IT+I+T  L+SLSEQQLVDC+T   + GC+GG M  AF+YV  N GITT  NY
Sbjct  137  SVAAIEAITEIKTGNLVSLSEQQLVDCDTNDGNKGCDGGLMTRAFQYVIDNGGITTEDNY  196

Query  647  PYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKG  826
            PY    G C+T +AS +AA ISG + +P N E++++QAVANQPVSV ID  G  FQ Y  
Sbjct  197  PYKAADGTCDTNRASSSAATISGYETVPANDESSLLQAVANQPVSVGIDGSGPDFQHYSS  256

Query  827  GLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            G+F+  C T  THAVTAVGYG    G KYWL+KN
Sbjct  257  GIFTGPCETEMTHAVTAVGYGTAEDGTKYWLVKN  290



>ref|XP_004306813.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 203/305 (67%), Gaps = 10/305 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            N+   +  A++ + +GA   EAT+R   D    G   RYE+WI  YGRVY +  EK  RF
Sbjct  5    NQSKCICLALVLIMLGAWSSEATSRSLQDALAYG---RYEQWIAHYGRVYNDINEKEDRF  61

Query  209  SVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENV  379
             +FK+N  Y+ S N  GN  + L +NQFADLTN+EF  +    + +   ++ T F YEN 
Sbjct  62   KIFKENEAYVESSNKDGNKLYKLSLNQFADLTNEEFTASRNRFLGNECSTKTTTFKYENA  121

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            TV P TM+W ++GAVT +K+QGQCG CWAFSAVGA EGITQ+   KLISLSEQ+LVDC+ 
Sbjct  122  TV-PATMDWRKKGAVTPVKDQGQCGSCWAFSAVGAMEGITQLTIGKLISLSEQELVDCDV  180

Query  560  --VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
              V  GC+GG M  AF++V +N GI T ANYPYT   G CN  K +  AA I+G +++P 
Sbjct  181  NGVDQGCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPA  240

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            NSE+A+++AVANQP+SVAIDA G  FQ Y  G+F+  C T   H VTAVGYGV   G KY
Sbjct  241  NSESALLKAVANQPISVAIDASGYDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKY  300

Query  914  WLLKN  928
            WL+KN
Sbjct  301  WLVKN  305



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 156/297 (53%), Positives = 200/297 (67%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L +GA   +AT+R   D +  G   RYE+W+  YGRVY +  EK  RF +FK+NV +I
Sbjct  16   LILMLGAWSSQATSRSLQDASMYG---RYEQWLARYGRVYNDVDEKETRFKIFKENVAFI  72

Query  239  NSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
             S N   N  + L +NQFADLTN+EF+ +       H   ++ T F Y+NVT  LP TM+
Sbjct  73   ESSNKDANKPYKLSVNQFADLTNEEFKASRN-GFKGHECSTKTTSFKYKNVTAALPATMD  131

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCN  577
            W  +GAVT +K+QGQCGCCWAFSAV ATEG+TQ+ T +LISLSEQ+LVDC+T     GC 
Sbjct  132  WRTKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGRLISLSEQELVDCDTAGEDQGCE  191

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N GI+T  NYPY    G CNT K +  AA+I+G +++P NSE A++ 
Sbjct  192  GGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLT  251

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  308



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 187/271 (69%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  YG+VY +  E+ KRF +FK+NV YI +FN   N  + L INQFADLTN+EF
Sbjct  37   ERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEF  96

Query  314  ---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S   +T  F YENVT +P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ+LVDC+T  V  GC GG M  AFK+V +N G+ T ANYPY 
Sbjct  157  ATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+     I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  217  GVDGKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKSGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSNDGTEYWLVKN  307



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 155/305 (51%), Positives = 201/305 (66%), Gaps = 20/305 (7%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVF  217
            +I FA      M AR         D +++  M  R+E+W+ +Y RVY + +EK +RF VF
Sbjct  11   IIGFAFFCGAAMAAR---------DLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEVF  61

Query  218  KDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACE-MPSHSEKTP--FMYENVTV  385
            K NV++I SFN G N  F LG+NQFADLTNDEFR+T   + + S + K P  F YENV+ 
Sbjct  62   KANVQFIESFNAGGNNKFWLGVNQFADLTNDEFRSTKTNKGLKSSNMKIPTGFRYENVSA  121

Query  386  --LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
              LP T++W  +GAVT IK+QGQCGCCWAFSAV ATEGI +I T KL+SL+EQ+LVDC+ 
Sbjct  122  DALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELVDCDV  181

Query  560  --VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GC GG M  AFK++ KN G+TT ++YPYT   G C +   S +AA I G +++P 
Sbjct  182  HGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCKSG--SNSAATIKGYEDVPA  239

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N EAA+M+AVANQPVSVA+D     FQFY GG+ +  C T   H + A+GYG    G KY
Sbjct  240  NDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTSDGTKY  299

Query  914  WLLKN  928
            WL+KN
Sbjct  300  WLMKN  304



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 184/276 (67%), Gaps = 7/276 (3%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADL  298
            E    +++E+W+ +YG+VY N  EK KRF +FKDNVE+I S N  GN  + L IN+FAD 
Sbjct  13   EASLSEKHEQWMSKYGKVYKNPEEKEKRFRIFKDNVEFIESLNAAGNKPYKLSINEFADQ  72

Query  299  TNDEFRTTM-ACEMP---SHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWA  466
            TN EF+        P   +  + T F YENV  +P TM+W + GAVT IKNQG CG CWA
Sbjct  73   TNQEFKAFRNGYRRPDGLTSRKGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPCGSCWA  132

Query  467  FSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGA  640
            FSAV ATEGITQ+ T KLISLSEQ+LV C+T  V HGC GG M+ AFK++  N GITT A
Sbjct  133  FSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEA  192

Query  641  NYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFY  820
            NYPY    G CN    +   A+I G + +P NSE A+++AVANQPV+V+IDA G  FQFY
Sbjct  193  NYPYQAVDGTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQFY  252

Query  821  KGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  253  SSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKN  288



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 192/276 (70%), Gaps = 7/276 (3%)
 Frame = +2

Query  119  NEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFAD  295
            NE    + +++W+  YGRVY    EK +R ++F++N++YI +FN   N  + LG+N+FAD
Sbjct  31   NEASMTETHDQWMARYGRVYKTANEKNRRSTIFQENLKYIQTFNKANNKPYKLGVNEFAD  90

Query  296  LTNDEFRTTMACEMPSHSEKTP---FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWA  466
            LTN+EF TT   +  SH   T    F YENVT +P TM+W ++GAVT IKNQGQCGCCWA
Sbjct  91   LTNEEF-TTSRNKFKSHVCATVTNVFRYENVTAVPATMDWRKKGAVTPIKNQGQCGCCWA  149

Query  467  FSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGA  640
            FSAV A EGITQ++T KLISLSEQ+LVDC+T     GC GG M  AF ++ +N G++T  
Sbjct  150  FSAVAAMEGITQLKTGKLISLSEQELVDCDTNGEDQGCEGGLMDYAFDFIQQNHGLSTET  209

Query  641  NYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFY  820
            NYPY+   G CN  K +  AA I+G +++P NSE+A+++AVANQP+SVAIDA G  FQFY
Sbjct  210  NYPYSGTDGTCNANKEANHAATITGHEDVPANSESALLKAVANQPISVAIDASGSDFQFY  269

Query  821  KGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  270  SSGVFTGECGTELDHGVTAVGYGTAADGTKYWLVKN  305



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 186/271 (69%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  YG VY +  E+ KRF +FK NV YI +FN   N  + LG NQFADLTN+EF
Sbjct  38   ERHEEWMTRYGSVYKDPEEREKRFRIFKKNVNYIETFNNAANKPYQLGTNQFADLTNEEF  97

Query  314  ---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S   +T  F YENVT +P T++W Q+GAVT +K+QGQCGCCWAFSAV 
Sbjct  98   IAGRNRFKGHMCSSILRTTTFKYENVTTIPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVA  157

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ+LVDC+T  V  GC GG+M  AFK++ KN GI T  NYPY 
Sbjct  158  ATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGFMDGAFKFIIKNHGINTEVNYPYK  217

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN    +   A I+G +++P N+E+A+ +AV++QPVSVAIDA G  FQFYK G+F
Sbjct  218  GVDGKCNAKAEAVNGATITGYEDVPVNNESALEKAVSSQPVSVAIDASGSDFQFYKSGVF  277

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            S  C T   H VTAVGYGV   GKKYWL+KN
Sbjct  278  SGSCGTELDHGVTAVGYGVSDDGKKYWLVKN  308



>ref|XP_003609015.1| Cysteine proteinase [Medicago truncatula]
 gb|AES91212.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/272 (55%), Positives = 188/272 (69%), Gaps = 8/272 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN--LGNYTFTLGINQFADLTNDE  310
            +R+E+W+ +Y +VY +  E+ +R  +F  NV YI  FN    N  + LGINQFADLTN+E
Sbjct  38   ERHEQWMSQYSKVYKDPQEREERHKIFTANVNYIEVFNNDANNKLYKLGINQFADLTNEE  97

Query  311  F---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAV  478
            F   R      M S   KT  F YENV+ +P T++W ++GAVT +KNQGQCGCCWAFSAV
Sbjct  98   FIASRNKFKGHMCSSIAKTTTFKYENVSAIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAV  157

Query  479  GATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPY  652
             ATEGIT++ T KL+SLSEQ+LVDC+T  V  GC GG M  AFK++ +N G++T A YPY
Sbjct  158  AATEGITKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEAAYPY  217

Query  653  TMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGL  832
                G CN  KAS  AA I+G +++P N+E A+ +AVANQP+SVAIDA G  FQFYK G+
Sbjct  218  QGVDGTCNANKASIHAATITGYEDVPANNEQALQKAVANQPISVAIDASGSDFQFYKSGV  277

Query  833  FSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            FS  C T   H VTAVGYGV   G KYWL+KN
Sbjct  278  FSGSCGTELDHGVTAVGYGVGNDGTKYWLVKN  309



>gb|EMT08019.1| Vignain [Aegilops tauschii]
Length=309

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 185/272 (68%), Gaps = 7/272 (3%)
 Frame = +2

Query  134  MKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEF  313
            ++R+E+W+ ++ RVY + TEK +RF VFK NV +I SFN GN+ F LG+NQF DLTNDEF
Sbjct  2    VERHEQWMAKFNRVYKDGTEKAQRFEVFKANVAFIESFNAGNHKFWLGVNQFTDLTNDEF  61

Query  314  RTTM---ACEMPSHSEKTPFMYENVT--VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAV  478
            + T      +       T F Y NV+   LP  ++W  +GAVT IK+QGQCGCCWAFSAV
Sbjct  62   KATKTNKGLKRSGSQAPTGFKYNNVSTDALPAAVDWRTKGAVTPIKDQGQCGCCWAFSAV  121

Query  479  GATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPY  652
             ATEGI ++ T KL+SLSEQ+LVDC+   V  GC GG M  AFK++ KN G+TT ANYPY
Sbjct  122  AATEGIVKLSTGKLVSLSEQELVDCDIHGVDQGCEGGEMDDAFKFIIKNGGLTTEANYPY  181

Query  653  TMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGL  832
            T + G C T+ AS + A I G +++P N E+++M+AVANQPVSVA+D     FQ Y GG+
Sbjct  182  TAQDGQCKTSIASNSVATIKGYEDVPANDESSLMKAVANQPVSVAVDGGDVIFQHYSGGV  241

Query  833  FSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             +  C T   H +  +GYG+   G KYWLLKN
Sbjct  242  MTGSCGTDLDHGIATIGYGMTSDGTKYWLLKN  273



>gb|EAY93078.1| hypothetical protein OsI_14879 [Oryza sativa Indica Group]
Length=339

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 197/302 (65%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +  L +   C A    R   +    + R+E W+ +YGRVY + TEK +RF +FK 
Sbjct  7    LLFAILSCLCL---CSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIFKA  63

Query  224  NVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--L  388
            NV +I SFN GN+ F LG+NQFADLTN EFR T   +  +PS     T F YENV++  L
Sbjct  64   NVAFIESFNAGNHKFWLGVNQFADLTNYEFRATKTNKGFIPSTVRVPTTFRYENVSIDTL  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P T++W  +GAVT IK+QGQCGCCWAFSAV A EGI ++ T KLISLSEQ+LVDC+    
Sbjct  124  PATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT + YPYT   G CN    S +AA I G + +P N+E
Sbjct  184  DQGCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKCN--GGSNSAATIKGYEEVPANNE  241

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFY GG+ +  C T   H + A+GYG    G +YWLL
Sbjct  242  AALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIVAIGYGKDGDGTQYWLL  301

Query  923  KN  928
            KN
Sbjct  302  KN  303



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 200/300 (67%), Gaps = 10/300 (3%)
 Frame = +2

Query  47   VFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            VF       +GA   +AT+R   D        +YE+W+  YGR YA   EK K F++FK+
Sbjct  153  VFCLAFIFILGALSSQATSRTLQD---ASMYAKYEQWMARYGRAYAEINEKEKHFNIFKE  209

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEM--PSHSEKTPFMYENVTVLPP  394
            NV +I S N   N  + L +NQFADLTN+EF+ +    M     ++ T F YENVT  PP
Sbjct  210  NVAFIESSNNDANKLYKLSVNQFADLTNEEFKASRNGFMGHECSTKTTAFKYENVTA-PP  268

Query  395  TMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSH  568
            T++W  +GAVT IK+QGQCGCCWAFSAV A EGIT++ T KLISLSEQ+LVDC+T  V  
Sbjct  269  TVDWRNKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQ  328

Query  569  GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAA  748
            GC GG M  AF+++ KN G++T  NYPYT   G CNT K +  AA+I+G +++P NSE A
Sbjct  329  GCGGGLMDDAFQFINKNHGLSTETNYPYTGVDGTCNTKKEASHAAQITGYEDVPANSEEA  388

Query  749  IMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +++AVANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYG+   G KYWL+KN
Sbjct  389  LLKAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGISADGTKYWLVKN  448



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/274 (52%), Positives = 193/274 (70%), Gaps = 9/274 (3%)
 Frame = +2

Query  134  MKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADLTNDE  310
            +KR+EEW  ++GRVY +  EK K++ VFKDN+E I SFN G +  + LG+N+FADLT++E
Sbjct  2    LKRHEEWRAQHGRVYKDTAEKQKKYLVFKDNLERIESFNNGVDRGYKLGLNKFADLTDEE  61

Query  311  FRT------TMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFS  472
            F+       +   ++ S S+   F Y NVT +P T++W + GAVT +K+QG CG CWAFS
Sbjct  62   FQAMHLGYKSPPSKLMSTSKSRSFRYRNVTSVPTTIDWRKAGAVTPVKDQGSCGSCWAFS  121

Query  473  AVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANY  646
            AV A EGIT+++T  LISLSEQ+LVDC+     +GC+GG+M TAF+Y+ KN G+T+ ANY
Sbjct  122  AVAAMEGITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGGLTSEANY  181

Query  647  PYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKG  826
            PY    G+C+  K + + A+I+G +++P NSE A++QAVANQPVSVAIDA G  F+FY  
Sbjct  182  PYQGEDGICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASGYDFRFYSS  241

Query  827  GLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            G+F   C T   HAVT +GYG    G KYWLLKN
Sbjct  242  GVFKGDCPTDLNHAVTVIGYGSSSDGTKYWLLKN  275



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 200/295 (68%), Gaps = 10/295 (3%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L   +GA   +AT+R   D +  G   +YE+W+  YGRV+    EK  RF +FK+NV +I
Sbjct  16   LIFMLGAWSSQATSRNLQDASMYG---KYEQWMTRYGRVFTGVQEKEMRFKIFKENVAFI  72

Query  239  NSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVTVLPPTMNWL  409
             S N   N  + L +NQFADLTN+EF+ +    +     ++ T F YENVT  PPT++W 
Sbjct  73   ESSNSDANKPYKLSVNQFADLTNEEFKASRNGFLGHECSTKTTTFKYENVTA-PPTVDWR  131

Query  410  QRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGG  583
             +GAVT IK+QGQCGCCWAFSAV A EGIT++ T  LISLSEQ+LVDC+T  V  GC GG
Sbjct  132  TKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDTKGVDQGCEGG  191

Query  584  WMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAV  763
             M  AF+++ +N G++T  NYPYT   G CNT K +  AA+I+G +++P NSEAA+++AV
Sbjct  192  LMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAV  251

Query  764  ANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            ANQPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  252  ANQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKN  306



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 184/276 (67%), Gaps = 7/276 (3%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADL  298
            E    +++E+W+ +YG+VY N  EK KRF +FKDNVE+I S N  GN  + L IN+FAD 
Sbjct  32   EASLSEKHEQWMSKYGKVYKNPEEKEKRFRIFKDNVEFIESLNAAGNKPYKLSINEFADQ  91

Query  299  TNDEFRTTM-ACEMP---SHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWA  466
            TN EF+        P   +  + T F YENV  +P TM+W + GAVT IKNQG CG CWA
Sbjct  92   TNQEFKAFRNGYRRPDGLTSRKGTSFKYENVIDVPATMDWRKNGAVTPIKNQGPCGSCWA  151

Query  467  FSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGA  640
            FSAV ATEGITQ+ T KLISLSEQ+LV C+T  V HGC GG M+ AFK++  N GITT A
Sbjct  152  FSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKFIIHNDGITTEA  211

Query  641  NYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFY  820
            NYPY    G CN    +   A+I G + +P NSE A+++AVANQPV+V+IDA G  FQFY
Sbjct  212  NYPYQAVDGTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVSIDASGSAFQFY  271

Query  821  KGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  272  SSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKN  307



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 199/303 (66%), Gaps = 9/303 (3%)
 Frame = +2

Query  29   KNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            K +H++    +L++     C +    R + +E    +R+E+W+ +YG+VY +  EK KR 
Sbjct  6    KKQHILALVLLLSI-----CTSQVMSR-NLHEASMSERHEQWMKKYGKVYKDAAEKQKRL  59

Query  209  SVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEKTPFMYENVT  382
             +FKDNVE+I SFN  GN  + L IN  AD TN+EF  +    +      +TPF Y NVT
Sbjct  60   LIFKDNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQTPFKYGNVT  119

Query  383  VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             +P  ++W Q GAVT +K+QGQCG CWAFS V ATEGI QI T  L+SLSEQ+LVDC++V
Sbjct  120  DIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSV  179

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
             HGC+GG M+  F+++ KN GI++ ANYPYT   G C+ +K +  AA+I G + +P NSE
Sbjct  180  DHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSE  239

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGG-KKYWL  919
             A+ QAVANQPVSV+IDA G  FQFY  G+F+  C T+  H VT VGYG    G  +YW+
Sbjct  240  EALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWI  299

Query  920  LKN  928
            +KN
Sbjct  300  VKN  302



>ref|XP_006582263.1| PREDICTED: vignain-like [Glycine max]
Length=338

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 199/303 (66%), Gaps = 9/303 (3%)
 Frame = +2

Query  29   KNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            K +H++    +L++     C +    R + +E    +R+E+W+ +YG+VY +  EK KR 
Sbjct  6    KKQHILALVLLLSI-----CTSQVMSR-NLHEASMSERHEQWMKKYGKVYKDAAEKQKRL  59

Query  209  SVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEKTPFMYENVT  382
             +FKDNVE+I SFN  GN  + L IN  AD TN+EF  +    +      +TPF Y NVT
Sbjct  60   LIFKDNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQTPFKYGNVT  119

Query  383  VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             +P  ++W Q GAVT +K+QGQCG CWAFS V ATEGI QI T  L+SLSEQ+LVDC++V
Sbjct  120  DIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSV  179

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
             HGC+GG M+  F+++ KN GI++ ANYPYT   G C+ +K +  AA+I G + +P NSE
Sbjct  180  DHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSE  239

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGG-KKYWL  919
             A+ QAVANQPVSV+IDA G  FQFY  G+F+  C T+  H VT VGYG    G  +YW+
Sbjct  240  EALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWI  299

Query  920  LKN  928
            +KN
Sbjct  300  VKN  302



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 184/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  Y RVY +  EK KRF +FK N+ YI +FN   N  + L INQFADLTN+EF
Sbjct  37   ERHEEWMARYSRVYKDPQEKEKRFRIFKQNMNYIEAFNNAANKPYKLAINQFADLTNEEF  96

Query  314  ---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S   KT  F YENVT +P T++W Q+GAVT +K+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMRSSIIKTTTFKYENVTSVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            + EGI Q+ T KLISLSEQ+LVDC+T  V  GC GG M  AFK++ +N G+ T ANYP+ 
Sbjct  157  SAEGIHQLTTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNNGLNTEANYPFK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN   AS  AA I G +++P N+E A+ +AV NQPVSVAIDA G  F+FYK G+F
Sbjct  217  GVDGTCNAKAASSHAATIRGYEDVPANNEKALQKAVTNQPVSVAIDASGSDFKFYKSGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSDDGTEYWLVKN  307



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 199/303 (66%), Gaps = 9/303 (3%)
 Frame = +2

Query  29   KNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            K +H++    +L++     C +    R + +E    +R+E+W+ +YG+VY +  EK KR 
Sbjct  3    KKQHILALVLLLSI-----CTSQVMSR-NLHEASMSERHEQWMKKYGKVYKDAAEKQKRL  56

Query  209  SVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEKTPFMYENVT  382
             +FKDNVE+I SFN  GN  + L IN  AD TN+EF  +    +      +TPF Y NVT
Sbjct  57   LIFKDNVEFIESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGSHSQTPFKYGNVT  116

Query  383  VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             +P  ++W Q GAVT +K+QGQCG CWAFS V ATEGI QI T  L+SLSEQ+LVDC++V
Sbjct  117  DIPTAVDWRQNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCDSV  176

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
             HGC+GG M+  F+++ KN GI++ ANYPYT   G C+ +K +  AA+I G + +P NSE
Sbjct  177  DHGCDGGLMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSE  236

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGG-KKYWL  919
             A+ QAVANQPVSV+IDA G  FQFY  G+F+  C T+  H VT VGYG    G  +YW+
Sbjct  237  EALQQAVANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWI  296

Query  920  LKN  928
            +KN
Sbjct  297  VKN  299



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 196/301 (65%), Gaps = 10/301 (3%)
 Frame = +2

Query  47   VFAAILALEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            +F ++L L M A   A A  R    +  +M +R+E+W+  YGR Y + +EK KRF +FK 
Sbjct  10   IFVSLLVLGMWA---ALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFKS  66

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMAC--EMPSHSEKTP-FMYENVTVLP  391
            NVEYI S N  GN  + LGIN+FAD TN+EFR +       P      P F YE+VT +P
Sbjct  67   NVEYIESVNKAGNKPYKLGINEFADQTNEEFRASRNGYKRSPIPRPINPSFRYESVTKVP  126

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VS  565
             +++W ++GAVT +K+QGQCGCCWAFSAV A EGITQ+ T KLISLSEQ+LVDC+T    
Sbjct  127  SSVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDTSGTD  186

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AF ++  N G+TT + YPY      CN  KAS  AA I+G +++P NSE 
Sbjct  187  QGCEGGLMDDAFDFILGNEGLTTESKYPYKGVDETCNKKKASSHAASITGHEDVPANSEK  246

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+ +AVANQPVSVAIDA G  FQ Y  G+F+  C T   H VTAVGYG    G KYWL+K
Sbjct  247  ALQKAVANQPVSVAIDAGGSDFQLYSSGVFTGECGTELDHGVTAVGYGKTEDGTKYWLVK  306

Query  926  N  928
            N
Sbjct  307  N  307



>gb|EEC84514.1| hypothetical protein OsI_31214 [Oryza sativa Indica Group]
Length=348

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 194/302 (64%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +  L +   C A    R   ++     R+E W+ +YGR+Y +  EK +RF VFK 
Sbjct  7    LLFAILGCLCL---CSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKA  63

Query  224  NVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--L  388
            N  +I SFN GN+ F LG+NQFADLTNDEFR T   +  +PS +   T F YENV +  L
Sbjct  64   NAAFIESFNAGNHKFWLGVNQFADLTNDEFRLTKTNKGFIPSTTRVPTGFRYENVNIDAL  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P TM+W  +G VT IK+QGQCGCCWAFSAV A EGI ++ T KLISLSEQ+LVDC+    
Sbjct  124  PATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT +NYPY      C +   S + A I G +++P N+E
Sbjct  184  DQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAADDKCKSV--SNSVASIKGYEDVPANNE  241

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFYKGG+    C T   H + A+GYG    G KYWLL
Sbjct  242  AALMKAVANQPVSVAVDGDDMTFQFYKGGVMIGSCGTDLDHGIVAIGYGKASDGTKYWLL  301

Query  923  KN  928
            KN
Sbjct  302  KN  303



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 185/269 (69%), Gaps = 6/269 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            R+E+W+ +YGRVY +  EK +RF +FKDN  YI S N  GN  + LG+NQFAD+TN+EF+
Sbjct  35   RHEQWMAQYGRVYKDAVEKERRFQIFKDNSNYIESVNRAGNRKYKLGLNQFADMTNEEFK  94

Query  317  TTMACEMP---SHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGAT  487
             +     P   + S    F Y N+T +  +M+W  RGAVT +K+QG CGCCWAFS++ A 
Sbjct  95   ASHLGFKPMRLTKSTTGSFQYANLTDVSDSMDWRTRGAVTPVKDQGSCGCCWAFSSIAAI  154

Query  488  EGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMR  661
            EGITQI T  L+SLSEQQLVDC+    ++GCNGG M  AF+YV  N GITT  NYPY   
Sbjct  155  EGITQINTGNLVSLSEQQLVDCDVKDGNNGCNGGLMTRAFQYVIDNGGITTENNYPYMAA  214

Query  662  KGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFST  841
             G C+T +AS +AA ISG +N+P N E++++QAV+NQPVSV ID  G+ FQ Y  G+F+ 
Sbjct  215  DGTCDTDRASSSAATISGYENVPVNDESSLLQAVSNQPVSVGIDGGGQDFQHYSSGIFTG  274

Query  842  GCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             C T   HAVTA+GYG    G KYWL+KN
Sbjct  275  PCKTNMDHAVTAIGYGTAEDGTKYWLIKN  303



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 186/270 (69%), Gaps = 8/270 (3%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFR  316
            RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N    L +NQFADLTN+EF+
Sbjct  40   RYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIESSNKDANKPCRLSVNQFADLTNEEFK  99

Query  317  TTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
             +       H   ++ + F YENVT  LP TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  100  ASRN-GFKGHECSTKTSSFKYENVTASLPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  158

Query  485  TEGITQIRTKKLISLSEQQLVDCETVS--HGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
            TEGITQ+ T  LISLSEQ+LVDC+T S   GC GG M  AF+++ +N GI+T ANYPY  
Sbjct  159  TEGITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGISTEANYPYEG  218

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN  K +  AA+I+G +++P NSE  ++ AVA+QPVSVAIDA G  FQFY  G+FS
Sbjct  219  VDGTCNAKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDFQFYSSGVFS  278

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYGV   G KYWL+KN
Sbjct  279  GTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  308



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 187/270 (69%), Gaps = 8/270 (3%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFR  316
            RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N    L +NQFADLTN+EF+
Sbjct  89   RYEQWLARYGRVYNDVDEKEIRFKIFKENVAFIESSNKDANKPHKLSVNQFADLTNEEFK  148

Query  317  TTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
             +       H   ++ T F YENVT  LP TM+W ++GAVT +K+QGQCGCCWAFSAV A
Sbjct  149  ASRN-GFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQGQCGCCWAFSAVAA  207

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
            TEG+TQ+ T KLISLSEQ+LVDC+T     GC GG M  AF+++ +N GI+T  NYPY  
Sbjct  208  TEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNG  267

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K +  AA+I+G +++P NSE A++ AVA+QPVSVAIDA G  FQFY  G+F+
Sbjct  268  VDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYSSGVFT  327

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYGV   G KYWL+KN
Sbjct  328  GTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  357



>gb|ADP02218.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
 gb|EMT08021.1| Vignain [Aegilops tauschii]
Length=341

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 185/272 (68%), Gaps = 7/272 (3%)
 Frame = +2

Query  134  MKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEF  313
            ++R+E+W+ ++ RVY + TEK +RF VFK NV +I SFN  N  F LG+NQF DLTNDEF
Sbjct  34   VERHEQWMAKFNRVYKDGTEKAQRFEVFKANVAFIESFNAENRKFWLGVNQFTDLTNDEF  93

Query  314  RTTM---ACEMPSHSEKTPFMYENVTV--LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAV  478
            R T      +M      T F Y NV++  LP  ++W  +G VT IK+QGQCGCCWAFSAV
Sbjct  94   RATKTNKGLKMSGGRAPTGFKYSNVSIDALPTAVDWRTKGVVTPIKDQGQCGCCWAFSAV  153

Query  479  GATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPY  652
             ATEGI ++ T KLISLSEQ+LVDC+   V  GC GG M  AFK++ KN G+TT ANYPY
Sbjct  154  VATEGIVKLSTGKLISLSEQELVDCDVHGVDQGCEGGEMDDAFKFIIKNGGLTTEANYPY  213

Query  653  TMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGL  832
            T + G C T+ AS + A I G +++P N E+++M+AVANQPVSVA+D     FQ Y GG+
Sbjct  214  TAQDGQCKTSIASNSVATIKGYEDVPANDESSLMKAVANQPVSVAVDGGDVIFQHYSGGV  273

Query  833  FSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             +  C T   H + A+GYG+   G KYWLLKN
Sbjct  274  MTGSCGTDLDHGIAAIGYGMTSDGTKYWLLKN  305



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 201/304 (66%), Gaps = 11/304 (4%)
 Frame = +2

Query  35   RHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSV  214
            RH  +  A++        +A AR   D +     +++EEW+  + RVY++  EK  R+ +
Sbjct  6    RHGCISLALIFFLGALASQAIARTLQDAS---IHEKHEEWMTRFKRVYSDAKEKEIRYKI  62

Query  215  FKDNVEYINSFNLGN-YTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVT  382
            FK+NV+ I SFN  +  ++ LGINQFADLTN+EF+T+       H   S+  PF YEN+T
Sbjct  63   FKENVQRIESFNKASEKSYKLGINQFADLTNEEFKTSRN-RFKGHMCSSQAGPFRYENIT  121

Query  383  VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             +P +M+W + GAVT IK+QGQCG CWAFSAV A EGITQ+ T KLISLSEQ+LVDC+T 
Sbjct  122  AVPSSMDWRKEGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVDCDTK  181

Query  563  --SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPN  736
                GC GG M  AFK++ +N+G+TT ANYPY    G CNT + +  AA+I+G +++P N
Sbjct  182  GEDQGCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFEDVPAN  241

Query  737  SEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYW  916
            +E A+M+AVA QPVSVAIDA G  FQFY  G+F+  C T   H V AVGYG    G  YW
Sbjct  242  NEGALMKAVAKQPVSVAIDAGGFEFQFYSSGIFTGDCGTELDHGVAAVGYG-ESNGMNYW  300

Query  917  LLKN  928
            L+KN
Sbjct  301  LVKN  304



>emb|CAH66233.1| H0825G02.10 [Oryza sativa Indica Group]
Length=339

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 197/302 (65%), Gaps = 12/302 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            ++FA +  L +   C A    R   +    + R+E W+ +YGRVY + TEK +RF +FK 
Sbjct  7    LLFAILSCLCL---CSAVLAAREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIFKA  63

Query  224  NVEYINSFNLGNYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--L  388
            NV +I SFN GN+ F L +NQFADLTN EFR T   +  +PS     T F YENV++  L
Sbjct  64   NVAFIESFNAGNHKFWLSVNQFADLTNYEFRATKTNKGFIPSTVRVPTTFRYENVSIDTL  123

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P T++W  +GAVT IK+QGQCGCCWAFSAV A EGI ++ T KLISLSEQ+LVDC+    
Sbjct  124  PATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGE  183

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT + YPYT   G CN    S +AA I G +++P N+E
Sbjct  184  DQGCEGGLMDDAFKFIIKNGGLTTESKYPYTAADGKCN--GGSNSAATIKGYEDVPANNE  241

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFY GG+ +  C T   H + A+GYG    G +YWLL
Sbjct  242  AALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIVAIGYGKDGDGTQYWLL  301

Query  923  KN  928
            KN
Sbjct  302  KN  303



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 201/304 (66%), Gaps = 15/304 (5%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMK-RYEEWIVEYGRVYANQTEKMKRFSVF  217
            ++V  AIL L         ++ R  +  + TM+ R+E+W+  +G VY +  EK +RFS+F
Sbjct  10   VLVMVAILGL-------WASQVRSRELHKATMRQRHEQWMARHGWVYQDDAEKERRFSIF  62

Query  218  KDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTT----MACEMPSHSEKTPFMYENVT  382
            K+NV++I SFN  GN  +TL IN FADLT +EF+ +         P      PF YE+VT
Sbjct  63   KNNVDFIESFNKDGNKPYTLAINAFADLTIEEFKASRNGYKRSSSPRQVSTKPFRYEHVT  122

Query  383  VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV  562
             +P +M+W ++GAVT IK+QGQCG CWAFSAVGA EG  Q+ T KLISLSEQ+LVDC+T 
Sbjct  123  AVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISLSEQELVDCDTS  182

Query  563  --SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPN  736
                GC GG+M  AF+++  N G+TT  NYPY    G CN  K + +AA+I+G +++P N
Sbjct  183  GEDQGCEGGFMDNAFEFIIGNHGLTTETNYPYQAVDGTCNARKEASSAAKITGYEDVPAN  242

Query  737  SEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYW  916
            SE+A+++AVA+QPVSVAIDA    FQFY  G+F+  C T   H VTAVGYG    G KYW
Sbjct  243  SESALLKAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDHGVTAVGYGTSEDGTKYW  302

Query  917  LLKN  928
            L+KN
Sbjct  303  LVKN  306



>ref|XP_003527350.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003556993.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 189/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  YG+VY +  EK KRF VFK+NV YI +FN   N  + LGINQFADLT++EF
Sbjct  37   ERHEQWMARYGKVYKDPEEKEKRFRVFKENVNYIEAFNNAANKPYKLGINQFADLTSEEF  96

Query  314  RTTM----ACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
                         S++  T F YENVTVLP +++W Q+GAVT IKNQG CGCCWAFSA+ 
Sbjct  97   IVPRNRFNGHTRSSNTRTTTFKYENVTVLPDSIDWRQKGAVTPIKNQGSCGCCWAFSAIA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI +I T KL+SLSEQ++VDC+T    HGC GG+M  AFK++ +N GI T A+YPY 
Sbjct  157  ATEGIHKISTGKLVSLSEQEVVDCDTKGTDHGCEGGYMDGAFKFIIQNHGINTEASYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  + +  AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  217  GVDGKCNIKEEAVHAATITGYEDVPINNEKALQKAVANQPVSVAIDASGADFQFYKSGIF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYG    G KYWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGENNEGTKYWLVKN  307



>ref|XP_002446135.1| hypothetical protein SORBIDRAFT_06g002170 [Sorghum bicolor]
 gb|EES10463.1| hypothetical protein SORBIDRAFT_06g002170 [Sorghum bicolor]
Length=338

 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 190/278 (68%), Gaps = 11/278 (4%)
 Frame = +2

Query  119  NEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFAD  295
            ++   ++R+E W+VEYGRVY +  EK +RF VFKDNV ++ SFN   N  F LGINQFAD
Sbjct  28   SDAAMVERHENWMVEYGRVYKDAAEKARRFEVFKDNVAFVESFNTNKNNKFWLGINQFAD  87

Query  296  LTNDEFRTTMACEMPSHSEKTP---FMYENVTV--LPPTMNWLQRGAVTQIKNQGQCGCC  460
            LT +EF+     + P  +EK P   F YEN++V  LP  ++W  +GAVT IKNQGQCGCC
Sbjct  88   LTIEEFKANKGFK-PISAEKVPTTGFKYENLSVSALPTAVDWRTKGAVTPIKNQGQCGCC  146

Query  461  WAFSAVGATEGITQIRTKKLISLSEQQLVDCETVS--HGCNGGWMQTAFKYVAKNRGITT  634
            WAFSAV A EGI ++ T  LISLSEQ+LVDC+T S   GC GGWM +AF++V KN G+ T
Sbjct  147  WAFSAVAAMEGIVKLSTGNLISLSEQELVDCDTHSMDEGCEGGWMDSAFEFVIKNGGLAT  206

Query  635  GANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQ  814
             ++YPY    G C     S++AA I G +++P N EAA+M+AVANQPVSVA+DA  R F 
Sbjct  207  VSSYPYKAVDGKCKGG--SKSAATIKGHEDVPVNDEAALMKAVANQPVSVAVDASDRTFM  264

Query  815  FYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             Y GG+ +  C T   H + A+GYGV   G KYW+LKN
Sbjct  265  LYSGGVMTGSCGTELDHGIAAIGYGVESDGTKYWILKN  302



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 189/270 (70%), Gaps = 6/270 (2%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  +G+VY +  EK +++  FK+NV+ I +FN  GN  + LGIN FADLTN+EF
Sbjct  3    ERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNNAGNKPYKLGINHFADLTNEEF  62

Query  314  RTTMACEMPSHSEKT---PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            +     +    S++T    F YENVT +P +++W Q+GAVT IK+QGQCGCCWAFSAV A
Sbjct  63   KAINRFKGHVCSKRTRTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAA  122

Query  485  TEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
            TEGIT++ T KLISLSEQ+LVDC+T  V  GC GG M  AFK++ +N+G+   A YPY  
Sbjct  123  TEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAAEAIYPYEG  182

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CN       AA I G +++P NSE+A+++AVANQPVSVAI+A G  FQFY GG+F+
Sbjct  183  VDGTCNAKAEGNHAASIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQFYSGGVFT  242

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H VTAVGYGV   G KYWL+KN
Sbjct  243  GSCGTNLDHGVTAVGYGVSDDGTKYWLVKN  272



>ref|XP_006449486.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
 gb|ESR62726.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
Length=312

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 186/275 (68%), Gaps = 12/275 (4%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG--NYTFTLGINQFADLTNDE  310
            +R+E W+ +YGRVY +  EK  RF +FK+N EYI SFN    N  + LGIN+FAD TN+E
Sbjct  3    ERHEMWMAQYGRVYRDNAEKEMRFKIFKENAEYIASFNSKARNKPYKLGINEFADQTNEE  62

Query  311  FRTT-------MACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAF  469
            FR         +     S +    F YENV+V P +++W + GAVT +K+QGQCGCCWAF
Sbjct  63   FRAPRNGYKRRLPNVRSSDTTDVSFRYENVSV-PASIDWRKNGAVTGVKDQGQCGCCWAF  121

Query  470  SAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGAN  643
            SAV A EGI QI T+KL SLSEQ+LVDC+T     GC GG M  AF+++  N+G+ T A 
Sbjct  122  SAVAAMEGINQITTRKLTSLSEQELVDCDTSGEDQGCEGGLMDDAFEFIINNKGLATEAK  181

Query  644  YPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYK  823
            YPY    G CN  +A+ +AA+ISG +++P N+EAA+M+AVANQPVSVAIDA G  FQFY 
Sbjct  182  YPYKASDGSCNKKEANPSAAKISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQFYS  241

Query  824  GGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  242  SGVFTGQCGTELDHGVTAVGYGTADDGTKYWLVKN  276



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/282 (53%), Positives = 189/282 (67%), Gaps = 10/282 (4%)
 Frame = +2

Query  107  RVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGIN  283
            R   ++   + R+E+W+ +Y RVY +  EK +RF VF  NV++I SFN  GN  F LG+N
Sbjct  25   RALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFNANVKFIESFNAAGNRKFWLGVN  84

Query  284  QFADLTNDEFRTTMACEMPSHSE-KTP--FMYENVTV--LPPTMNWLQRGAVTQIKNQGQ  448
            QFADLTNDEFR T   +   HS  K P  F YENV++  LP T++W  +GAVT IK+QGQ
Sbjct  85   QFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVSIDALPATIDWRSKGAVTPIKDQGQ  144

Query  449  CGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNR  622
            CGCCWAFSAV ATEGI +I T KLISLSEQ+LVDC+      GC GG M  AFK++ KN 
Sbjct  145  CGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNG  204

Query  623  GITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMG  802
            G+TT + YPYT   G C +   S +AA I G +++P N+EAA+M+AVANQPVSVA+D   
Sbjct  205  GLTTESGYPYTAADGKCKS--GSNSAATIKGYEDVPANNEAALMKAVANQPVSVAVDGGD  262

Query  803  RPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              FQFY GG+ +  C T   H + A+GYG    G  YWL+KN
Sbjct  263  MTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLMKN  304



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 197/305 (65%), Gaps = 11/305 (4%)
 Frame = +2

Query  35   RHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSV  214
            + L  FA IL L M A  E  +R   +  E     R+E+W+  +G+VYA+  E  +RF +
Sbjct  6    KRLCFFAFILILGMWAY-EVASR---ELQEPSMSARHEQWMATFGKVYADAAETERRFEI  61

Query  215  FKDNVEYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEK---TPFMYENV  379
            FKDNVEYI SFN  GN  + L +N+FAD TN+E +        P  +     T F YENV
Sbjct  62   FKDNVEYIESFNTTGNKPYKLSVNKFADQTNEELKVARNGYRRPLQTRPMKVTSFKYENV  121

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            T +P TM+W ++GAVT IK+QGQCG CWAFS V ATEGI Q+ T KL+SLSEQ+LVDC+ 
Sbjct  122  TAVPATMDWRKKGAVTLIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDI  181

Query  560  --VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GC GG M+  F+++ KN GITT ANYPY    G CN+   +   A+I+G +++P 
Sbjct  182  QGEDQGCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKIEASRIAKITGYESVPA  241

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            NSEAA+++AVANQP+SV+IDA G  FQFY  G F+  C T   H VTAVGYG    G KY
Sbjct  242  NSEAALLKAVANQPISVSIDAGGSDFQFYSSGDFTGQCGTELDHGVTAVGYGETSDGTKY  301

Query  914  WLLKN  928
            WL+KN
Sbjct  302  WLVKN  306



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 193/287 (67%), Gaps = 11/287 (4%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYT  265
            +AT+R   D +  G   RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N  
Sbjct  15   QATSRSLQDASMYG---RYEQWLARYGRVYNDVDEKETRFKIFKENVAFIESSNKDANKP  71

Query  266  FTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQI  433
            + L +NQF DLTN+EF+ +       H   ++ T F YENVT  LP TM+W ++GAVT +
Sbjct  72   YKLSVNQFXDLTNEEFKASRN-GFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPV  130

Query  434  KNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKY  607
            K+QGQCGCCWAFSAV ATEG+TQ+ T  LISLSEQ+LVDC+T     GC GG M  AF++
Sbjct  131  KDQGQCGCCWAFSAVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGCEGGLMDDAFQF  190

Query  608  VAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVA  787
              +N GI+T  NYPY    G CNT K +  AA+I+G +++P NSE A++ AVA+QPVSVA
Sbjct  191  XQQNHGISTEXNYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVA  250

Query  788  IDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            IDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  251  IDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  297



>ref|XP_004975184.1| PREDICTED: vignain-like [Setaria italica]
Length=340

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/274 (51%), Positives = 186/274 (68%), Gaps = 5/274 (2%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLT  301
            ++    R+E+W+ +YGRVY +  EK +RF VF+ NV +I S N  N+ F + +NQFADLT
Sbjct  31   DQAMAARHEQWMAKYGRVYVDAAEKARRFEVFRANVAFIESVNSQNHKFWVEVNQFADLT  90

Query  302  NDEFRTTMACEMPS-HSEKTPFMYENVTV--LPPTMNWLQRGAVTQIKNQGQCGCCWAFS  472
            +DEFR T     P+  +  T F Y NV++  LP +++W  +GAVT IK+QGQCGCCWAFS
Sbjct  91   DDEFRATRTGYKPAGKARTTAFRYANVSLDDLPDSVDWRTKGAVTPIKDQGQCGCCWAFS  150

Query  473  AVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANY  646
             V + EGI ++ T KLISLSEQ+LVDC+   +  GC GG M  AF+++  N G+TT +NY
Sbjct  151  TVASMEGIVKLSTGKLISLSEQELVDCDVNGMDQGCEGGEMDNAFEFIIDNGGLTTESNY  210

Query  647  PYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKG  826
            PYT   G CN+ KAS  AA I G +++P N EA++ +AVANQPVSVA+D     F+FYKG
Sbjct  211  PYTASDGTCNSNKASNDAASIKGYEDVPANDEASLRKAVANQPVSVAVDGGDSLFRFYKG  270

Query  827  GLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            G+ S  C T   H + AVGYGV   G KYWL+KN
Sbjct  271  GVLSGSCGTELDHGIAAVGYGVASDGTKYWLMKN  304



>ref|XP_008669676.1| PREDICTED: ervatamin-B-like [Zea mays]
 tpg|DAA38581.1| TPA: hypothetical protein ZEAMMB73_156486 [Zea mays]
Length=347

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 195/288 (68%), Gaps = 13/288 (5%)
 Frame = +2

Query  98   ARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL----GNYT  265
            AR    D+E   + R+E+W+V++GRVY ++T+K  RF VFK NV++I SFN     GN  
Sbjct  26   ARELGGDDELAMVARHEQWMVQHGRVYKDETDKAHRFLVFKANVKFIESFNAAAAAGNRK  85

Query  266  FTLGINQFADLTNDEFRTTMACE-MPSHSEKTP--FMYENVTV--LPPTMNWLQRGAVTQ  430
            F LG+NQFADLTNDEFR T   +    +  K P  F Y+N+++  LP T++W  +GAVT 
Sbjct  86   FWLGVNQFADLTNDEFRATKTNKGFNPNVVKVPTGFRYQNLSIDALPQTVDWRTKGAVTP  145

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV ATEGI +I T KL SLSEQ+LVDC+      GCNGG M  AFK
Sbjct  146  IKDQGQCGCCWAFSAVAATEGIVKISTGKLTSLSEQELVDCDVHGEDQGCNGGEMDDAFK  205

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ KN G+TT +NYPYT + G C +   S  AA I G +++P N EAA+M+AVA+QPVSV
Sbjct  206  FIIKNGGLTTESNYPYTAQDGQCKS--GSNGAATIKGYEDVPANDEAALMKAVASQPVSV  263

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A+D     FQFY GG+ +  C T   H + A+GYG    G KYWL+KN
Sbjct  264  AVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLMKN  311



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/301 (52%), Positives = 200/301 (66%), Gaps = 12/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            I FA IL L +    +A AR   D +     +R+EEW+ +YG VY +  EK  R  +F +
Sbjct  10   ICFAFILIL-VALAYQAEARSLPDAS---MYERHEEWMAKYGIVYKDANEKEMRHKIFNE  65

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTVLP  391
            NVE I  FN   N  + LGINQFADLTN+EF+T+       H    +  PF YENVT +P
Sbjct  66   NVERIEYFNRAANKPYKLGINQFADLTNEEFKTSRN-RFKGHMCSPQAGPFRYENVTAVP  124

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--S  565
             +M+W ++GAVT IK+QGQCG CWAFSAV A EGITQ+ T+KLISLSEQ+LVDC+T    
Sbjct  125  SSMDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTTQKLISLSEQELVDCDTKGED  184

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AFK++  N+G+TT ANYPY    G CN+ K +  AA+I+G +++P N+EA
Sbjct  185  QGCQGGLMDDAFKFIETNQGLTTEANYPYEGSDGTCNSNKEANHAAKITGYEDVPANNEA  244

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVA QPVSVAIDA G  FQFY  G+F+  C T   H V AVGYGV   G  YWL+K
Sbjct  245  ALLKAVAKQPVSVAIDAGGYEFQFYSSGIFTGDCGTELDHGVAAVGYGVSQ-GTNYWLVK  303

Query  926  N  928
            N
Sbjct  304  N  304



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/303 (51%), Positives = 196/303 (65%), Gaps = 11/303 (4%)
 Frame = +2

Query  35   RHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSV  214
            + LI+  AIL +      + TAR  VD   E  M +YE+W+++YGRVY N  EK   F +
Sbjct  2    KFLILLFAILGIWAS---KTTARTLVD---EPLMLKYEQWMIQYGRVYKNNAEKDSHFKI  55

Query  215  FKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEK-TPFMYENVTV  385
            FK N E I +FN   N  + LGIN FADLTN+EFR      ++P    K T F YENVT 
Sbjct  56   FKKNAERIEAFNDAANQPYKLGINAFADLTNEEFRAARNGLKIPFCEPKITSFRYENVTA  115

Query  386  LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVS  565
            +P TM+W  +GAVT IK+QGQCG CWAFSA+ ATEGIT++ T KLISLSEQ+L+DC+  S
Sbjct  116  IPTTMDWRIKGAVTPIKDQGQCGSCWAFSAIAATEGITKLSTGKLISLSEQELMDCDRNS  175

Query  566  --HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNS  739
               GC GG+M+ AF+++ KN+G+TT   YPY      CNT K S   A I G + +P  +
Sbjct  176  EDQGCEGGYMEDAFEFIVKNKGLTTETTYPYKAADEKCNTKKESSHVADIKGYEKVPKYN  235

Query  740  EAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWL  919
            E A++ AVANQP+SV+IDA    FQFY  G+F+  C T   H VTAVGYG    G KYWL
Sbjct  236  EKALLNAVANQPISVSIDASDFSFQFYTSGVFTGTCGTELDHGVTAVGYGKAEDGTKYWL  295

Query  920  LKN  928
            +KN
Sbjct  296  IKN  298



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 204/304 (67%), Gaps = 10/304 (3%)
 Frame = +2

Query  32   NRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFS  211
            N++  V  A+L +      +AT+R     +E    +R+E+W+  YGR+Y +  EK KRF 
Sbjct  5    NQYQYVSMALLFILAAWASQATSR---SLHEASMYERHEDWMARYGRMYKDANEKEKRFK  61

Query  212  VFKDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVT  382
            +FKDNV  I SFN   + T+ L IN+FADLTN+EFR+ +     +H  SE T F YENVT
Sbjct  62   IFKDNVARIESFNKAMDKTYKLSINEFADLTNEEFRS-LRNRFKAHICSEATTFKYENVT  120

Query  383  VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET-  559
             +P T++W ++GAVT IK+Q QCGCCWAFSAV ATEGITQI T KLISLSEQ+LVDC+T 
Sbjct  121  AVPSTIDWRKKGAVTPIKDQQQCGCCWAFSAVAATEGITQITTGKLISLSEQELVDCDTG  180

Query  560  -VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPN  736
              + GC+GG M  AF+++ K  G+ + A YPY    G CN+ K +  AA+I G +++P N
Sbjct  181  GENQGCSGGLMDDAFRFI-KIHGLASEATYPYEGDDGTCNSKKEAHPAAKIKGYEDVPAN  239

Query  737  SEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYW  916
            +E A+ +AVA+QPV+VAIDA G  FQFY  G+F+  C T   H V AVGYG+   G  YW
Sbjct  240  NEKALQKAVAHQPVAVAIDAGGFEFQFYTSGVFTGQCGTELDHGVAAVGYGIGDDGMMYW  299

Query  917  LLKN  928
            L+KN
Sbjct  300  LVKN  303



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 193/287 (67%), Gaps = 11/287 (4%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYT  265
            +AT+R   D +  G   RYE+W+  YGRVY +  EK  RF +FK+NV +I S N   N  
Sbjct  15   QATSRSLQDASMYG---RYEQWLARYGRVYNDVDEKETRFKIFKENVAFIESSNKDANKP  71

Query  266  FTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMNWLQRGAVTQI  433
            + L +NQF DLTN+EF+ +       H   ++ T F YENVT  LP TM+W ++GAVT +
Sbjct  72   YKLSVNQFXDLTNEEFKASRN-GFKGHECSTKTTSFKYENVTAALPATMDWRKKGAVTPV  130

Query  434  KNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKY  607
            K+QGQCGCCWAFSAV ATEG+TQ+ T  LISLSEQ+LVDC+T     GC GG M  AF++
Sbjct  131  KDQGQCGCCWAFSAVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGCEGGLMDDAFQF  190

Query  608  VAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVA  787
            + +N GI+T  NYPY    G CNT K +  AA+I+G +++P NSE A++ AVA+QPVSVA
Sbjct  191  IQQNHGISTEXNYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVA  250

Query  788  IDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            IDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+ N
Sbjct  251  IDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVXN  297



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 192/284 (68%), Gaps = 8/284 (3%)
 Frame = +2

Query  92   ATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTF  268
            ATAR   D   E    ++E+W+ + GRVY +  EK +RF +F+DN EYI S N  G+  +
Sbjct  20   ATARGIAD---EPMRTKHEQWMAQNGRVYTDAAEKERRFQIFRDNYEYIKSVNRAGDRKY  76

Query  269  TLGINQFADLTNDEFRTTMAC--EMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQ  442
             LG+NQFADLTN EF+ +      MP+ S    F Y N+T +P +M+W  RGAVT +KNQ
Sbjct  77   KLGLNQFADLTNGEFKASRLAFKPMPTASTTGSFQYANLTDVPNSMDWRTRGAVTPVKNQ  136

Query  443  GQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAK  616
            G CGC WAFS+V A E ITQI+T  L+SLSEQQLVDC+    + GC+GG M  AF+YV  
Sbjct  137  GSCGCFWAFSSVAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGCDGGLMTRAFQYVID  196

Query  617  NRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDA  796
            N GITT  NYPY    G C+T K S +AA ISG +++P N E++++QAVANQPVSV ID 
Sbjct  197  NGGITTEDNYPYMAANGTCDTNKTSSSAATISGYESVPANDESSLLQAVANQPVSVGIDG  256

Query  797  MGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             G+ F+ Y  G+F+  C T+ THAVTAVGYG+   G +YWL+KN
Sbjct  257  SGQDFRHYSSGIFTGPCETQMTHAVTAVGYGIAEDGTEYWLVKN  300



>ref|XP_006362420.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=347

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 193/278 (69%), Gaps = 8/278 (3%)
 Frame = +2

Query  119  NEEGTMK-RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFA  292
            N E TM+ R+E+WI  + ++Y +  EK  RF +FK+NV+ I +FN G +  + LG+N+FA
Sbjct  34   NYETTMRVRHEQWIAHHDKIYNDLKEKEMRFKIFKENVKRIETFNAGEDKGYKLGVNKFA  93

Query  293  DLTNDEFRTTM----ACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCC  460
            DLTN+EFR       +  M S   KT F Y N+T +PPTM+W ++GAVT IK+Q +CG C
Sbjct  94   DLTNEEFRVVHTGYKSSFMSSSKPKTHFRYANITDVPPTMDWRKKGAVTPIKDQMECGSC  153

Query  461  WAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSH--GCNGGWMQTAFKYVAKNRGITT  634
            WAFSAV A EG+ Q+ T KLI LSEQ+LVDC+      GC GG + TAF+++ KN+G+TT
Sbjct  154  WAFSAVAAMEGVHQVTTGKLIPLSEQELVDCDVEGEDVGCTGGLLDTAFQFIIKNKGLTT  213

Query  635  GANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQ  814
             ANYPY    G+CN  K++ + A+I+G +++P N+E A++QAVANQPVSVAID     FQ
Sbjct  214  EANYPYEAADGVCNKKKSAVSVAKITGYEDVPANNEKALLQAVANQPVSVAIDGSSFDFQ  273

Query  815  FYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            FY  G+FS  C+T   HAVTAVGYG    G KYW++KN
Sbjct  274  FYSSGVFSGSCSTWLNHAVTAVGYGAASDGAKYWIIKN  311



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 189/269 (70%), Gaps = 6/269 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            R+E+W+ ++G+VY +  EK++RF +FK NV +I SFN  GN ++ LGIN+FADLTN+EFR
Sbjct  38   RHEKWMAKHGKVYKDDKEKLRRFQIFKSNVVFIESFNTAGNKSYMLGINKFADLTNEEFR  97

Query  317  T---TMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGAT  487
                     + +  + TPF YENVT LP +++W  +GAVT IK+QG CG CWAFSAV AT
Sbjct  98   AFWNGYKRPLGASRKITPFKYENVTALPSSIDWRSKGAVTPIKDQGVCGSCWAFSAVAAT  157

Query  488  EGITQIRTKKLISLSEQQLVDCETVSH--GCNGGWMQTAFKYVAKNRGITTGANYPYTMR  661
            EGI ++RT KL+SLSEQ+LVDC+      GC GG M  AFK++ ++ G+T+ ANYPY  R
Sbjct  158  EGIHKLRTGKLVSLSEQELVDCDVKGQDKGCQGGLMVDAFKFIKRHGGMTSEANYPYQGR  217

Query  662  KGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFST  841
             G C+T K +  A +I+G Q +P NSEAA+++AVANQPVSVAIDA    FQFY+ G+F+ 
Sbjct  218  DGKCDTKKEASRAVKITGYQAVPKNSEAALLKAVANQPVSVAIDAGSLSFQFYRSGIFTG  277

Query  842  GCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             C     H V AVGYG    G KYW++KN
Sbjct  278  ICGKDINHGVAAVGYGRSNSGSKYWIVKN  306



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/297 (53%), Positives = 199/297 (67%), Gaps = 12/297 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L +GA   EAT+R   D +  G   RYE+W+  YGRV+ +  EK  RF +FK+NV +I
Sbjct  16   LILMLGAWSSEATSRSLKDASMYG---RYEQWLALYGRVHNDINEKETRFKIFKENVAFI  72

Query  239  NSFNLGNYT-FTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTV-LPPTMN  403
               N   +  + L +NQFADLTN+EF+ T       H   ++ + F YENVTV LP TM+
Sbjct  73   EFSNKDAHKPYKLSVNQFADLTNEEFKATRN-GFKGHECSTKASSFKYENVTVPLPATMD  131

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCN  577
            W ++GAVT +K+ GQCGCCWAFSAV ATEGITQ+ T  LISLSEQ+LVDC+T     GC 
Sbjct  132  WRKKGAVTPVKDXGQCGCCWAFSAVAATEGITQLTTGNLISLSEQELVDCDTAGEDQGCE  191

Query  578  GGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQ  757
            GG M  AF+++ +N GI+T  NYPY    G CNT K +  AA+I+G +++P NSE A++ 
Sbjct  192  GGLMDDAFQFIQQNHGISTEXNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLT  251

Query  758  AVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AVA+QPVSVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  252  AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKN  308



>gb|ADV74756.1| cysteine protease [Lactuca sativa]
Length=363

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 190/278 (68%), Gaps = 8/278 (3%)
 Frame = +2

Query  119  NEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFAD  295
            N+   + R+E+W+  +GR+Y ++ EK  RF +FK+NV YI++ N   + ++TL +N+FAD
Sbjct  47   NDPTMIARHEQWMAHHGRIYTDENEKQLRFQIFKNNVAYIDAHNARSDQSYTLEVNKFAD  106

Query  296  LTNDEFRTT-----MACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCC  460
            LTNDEFR +        +  SH     F Y NV+ +P  ++W + GAVT +K+QG CGCC
Sbjct  107  LTNDEFRASRNGYKKQPDSDSHVVSGLFRYANVSAVPDEVDWRKEGAVTPVKDQGDCGCC  166

Query  461  WAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITT  634
            WAFSAV A EGI ++   KL+SLSEQ+LVDC+   +  GC GG M+ AF+++ K +G+  
Sbjct  167  WAFSAVAAMEGINKLENGKLVSLSEQELVDCDIDGIDQGCEGGLMENAFQFIEKRKGLAA  226

Query  635  GANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQ  814
             + YPYT   G+CNT KA+  AA+ISG + +P N+E A++QAVANQPVS+AIDA G  FQ
Sbjct  227  ESVYPYTGEDGICNTKKAAIPAAKISGHEKVPANNEKALLQAVANQPVSIAIDASGYEFQ  286

Query  815  FYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            FY GG+F+  C T   HA+TAVGYG    G KYWL+KN
Sbjct  287  FYSGGVFTGSCGTELDHAITAVGYGATMDGTKYWLMKN  324



>gb|AFW86317.1| hypothetical protein ZEAMMB73_339067 [Zea mays]
Length=433

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/305 (51%), Positives = 201/305 (66%), Gaps = 20/305 (7%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTM-KRYEEWIVEYGRVYANQTEKMKRFSVF  217
            +I FA      M AR         D +++  M  R+E+W+ +Y RVY + +EK +RF VF
Sbjct  104  IIGFAFFCGAAMAAR---------DLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEVF  154

Query  218  KDNVEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACE-MPSHSEKTP--FMYENVTV  385
            K NV++I SFN G N  F LG+NQFADLTNDEFR+T   + + S + K P  F YENV+ 
Sbjct  155  KANVQFIESFNAGGNNKFWLGVNQFADLTNDEFRSTKTNKGLKSSNMKIPTGFRYENVSA  214

Query  386  --LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
              LP T++W  +GAVT IK+QGQCGCCWAFSAV ATEGI +I T KL+SL+EQ+LVDC+ 
Sbjct  215  DALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELVDCDV  274

Query  560  --VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
                 GC GG M  AFK++ KN G+TT ++YPYT   G C +   S +AA I G +++P 
Sbjct  275  HGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCKSG--SNSAATIKGYEDVPA  332

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N EAA+M+AVANQPVSVA+D     FQFY GG+ +  C T   H + A+GYG    G KY
Sbjct  333  NDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTSDGTKY  392

Query  914  WLLKN  928
            WL+KN
Sbjct  393  WLMKN  397



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 192/284 (68%), Gaps = 8/284 (3%)
 Frame = +2

Query  92   ATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTF  268
            ATAR   D   E    ++E+W+ + GRVY +  EK +RF +F+DN EYI S N  G+  +
Sbjct  46   ATARGIAD---EPMRTKHEQWMAQNGRVYTDAAEKERRFQIFRDNYEYIKSVNRAGDRKY  102

Query  269  TLGINQFADLTNDEFRTTMAC--EMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQ  442
             LG+NQFADLTN EF+ +      MP+ S    F Y N+T +P +M+W  RGAVT +KNQ
Sbjct  103  KLGLNQFADLTNGEFKASRLAFKPMPTASTTGSFQYANLTDVPNSMDWRTRGAVTPVKNQ  162

Query  443  GQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAK  616
            G CGC WAFS+V A E ITQI+T  L+SLSEQQLVDC+    + GC+GG M  AF+YV  
Sbjct  163  GSCGCFWAFSSVAAIEAITQIKTGNLVSLSEQQLVDCDVNDGNQGCDGGLMTRAFQYVID  222

Query  617  NRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDA  796
            N GITT  NYPY    G C+T K S +AA ISG +++P N E++++QAVANQPVSV ID 
Sbjct  223  NGGITTEDNYPYMAANGTCDTNKTSSSAATISGYESVPANDESSLLQAVANQPVSVGIDG  282

Query  797  MGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             G+ F+ Y  G+F+  C T+ THAVTAVGYG+   G +YWL+KN
Sbjct  283  SGQDFRHYSSGIFTGPCETQMTHAVTAVGYGIAEDGTEYWLVKN  326



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/305 (51%), Positives = 201/305 (66%), Gaps = 12/305 (4%)
 Frame = +2

Query  38   HLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVF  217
            + I  A  L L + A  + T+R   DD+     + +E+W+  YG+VY +  EK KR  +F
Sbjct  8    YYISLALFLCLGLWA-IQGTSRTLQDDS---MYESHEQWMRHYGKVYKDSQEKEKRSKIF  63

Query  218  KDNVEYINSFN-LGN-YTFTLGINQFADLTNDEF---RTTMACEMPSHSEKTP-FMYENV  379
              N+ YI +FN  GN   + LGINQ+ADLTN+EF   R      M S   +T  F YENV
Sbjct  64   TQNINYIQAFNNAGNDKAYKLGINQYADLTNEEFISSRNKFKGHMCSSIIRTTTFKYENV  123

Query  380  TVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET  559
            + +P T++W ++GAVT +KNQGQCGCCWAFSAV ATEGI ++ T KLISLSEQ+LVDC+T
Sbjct  124  SAVPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDT  183

Query  560  --VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPP  733
              V  GC GG M  AFK++ +N G+ T A YPY    G CN  +AS  AA I+G +++P 
Sbjct  184  KGVDQGCEGGLMDDAFKFIIQNHGLDTEAQYPYQGVDGTCNANEASIHAATITGYEDVPV  243

Query  734  NSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKY  913
            N+E A+ +AVANQP+SVAIDA G  FQFYK G+F+  C T   H VTAVGYGV   G KY
Sbjct  244  NNEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKY  303

Query  914  WLLKN  928
            WL+KN
Sbjct  304  WLVKN  308



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 200/295 (68%), Gaps = 10/295 (3%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L   +GA   +AT+R   D +  G   +YE+W+  Y RVY +  EK  RF +FK+NV +I
Sbjct  16   LIFMLGAWSSQATSRNLQDASMYG---KYEQWMARYERVYMDIQEKEMRFKIFKENVAFI  72

Query  239  NSFNLG-NYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVTVLPPTMNWL  409
             S N   N  + L +NQFADLTN+EF+ +    +     ++ T F YENVT  PPT++W 
Sbjct  73   ESSNGNTNKPYKLSVNQFADLTNEEFKASRNGFLGHECSTKTTTFKYENVTA-PPTVDWR  131

Query  410  QRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGG  583
             +GAVT IK+QGQCGCCWAFSAV A EGIT++ T  LISLSEQ+LVDC+T  V  GC GG
Sbjct  132  TKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCEGG  191

Query  584  WMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAV  763
             M  AF+++ +N G++T  NYPYT   G CNT K +  AA+I+G +++P NSEAA+++AV
Sbjct  192  LMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLKAV  251

Query  764  ANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            ANQP+SVAIDA G  FQFY  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  252  ANQPISVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKN  306



>ref|XP_004294729.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/296 (54%), Positives = 196/296 (66%), Gaps = 12/296 (4%)
 Frame = +2

Query  62   LALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI  238
            L L +GA   EAT+R   D    G   RYE+WI  Y RVY +  EK   F +FK+N  Y+
Sbjct  14   LVLMLGAWSSEATSRSLQDALAYG---RYEQWIARYRRVYKDVNEKEDHFKIFKENEAYV  70

Query  239  NSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTVLPPTMNW  406
             S N  GN  + L +NQFADLTN+EF TT       H   ++ T F YEN TV P TM+W
Sbjct  71   ESSNKDGNKLYKLSLNQFADLTNEEF-TTSRNRFLGHECSTKTTTFKYENATV-PATMDW  128

Query  407  LQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNG  580
             ++GAVT +K+QGQCG CWAFSAV A EGITQ+ T KLISLSEQ+LVDC+   V  GC+G
Sbjct  129  RKKGAVTPVKDQGQCGSCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCSG  188

Query  581  GWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQA  760
            G M  AFK+V +N GI T ANYPYT   G CN  K +  AA I+G +++P NSE+A+++A
Sbjct  189  GEMDDAFKFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPANSESALLKA  248

Query  761  VANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            VANQP++VAIDA G  FQ Y  G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  249  VANQPIAVAIDASGFDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKN  304



>gb|EMT08022.1| Vignain [Aegilops tauschii]
Length=341

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 191/288 (66%), Gaps = 7/288 (2%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT  265
            C +T     +  +   ++++E+W+ ++ RVY + TEK +RF  FK NV +I SFN GN+ 
Sbjct  18   CSSTVLSARELGDAAMVEKHEQWMAKFNRVYKDSTEKAQRFKAFKANVAFIESFNTGNHK  77

Query  266  FTLGINQFADLTNDEFRTTMACE-MPSHSEKTP--FMYENVT--VLPPTMNWLQRGAVTQ  430
            F LG+NQF DLTNDEFR T   + +  +  + P  F Y NV+   LP  ++W  +G VT 
Sbjct  78   FWLGVNQFTDLTNDEFRATKTNKGLKRNGARAPTRFKYNNVSTDALPAAVDWRTKGVVTP  137

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV ATEGI ++ T KL+SLSEQ+LVDC+   V  GC GG M  AFK
Sbjct  138  IKDQGQCGCCWAFSAVAATEGIVKLSTGKLVSLSEQELVDCDVHGVDQGCEGGEMDDAFK  197

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ KN G+TT ANYPYT + G C T+  S + A I G +++P N E+++M+AVANQPVSV
Sbjct  198  FIIKNGGLTTEANYPYTAQDGQCKTSTTSNSVATIKGYEDVPANDESSLMKAVANQPVSV  257

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A+D     FQ Y GG+ +  C T   H + A+GYG+   G K+WLLKN
Sbjct  258  AVDGGDVIFQHYSGGVMTGSCGTDLDHGIVAIGYGMTSDGTKFWLLKN  305



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/298 (52%), Positives = 199/298 (67%), Gaps = 12/298 (4%)
 Frame = +2

Query  56   AILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVE  232
            A++ L  GA   EAT+R   D +  G   RYE+W+  YGRVY +  EK KRF +FK NV 
Sbjct  13   ALILLMFGAWSSEATSRTLQDASMYG---RYEQWMARYGRVYNDINEKEKRFQIFKANVA  69

Query  233  YINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTVLPPTM  400
             + S N   +  + L +NQFADLTN+EF T+       H   ++ T F YENVTV P T+
Sbjct  70   IVESSNNDASKPYKLSVNQFADLTNEEFITSRN-RFKGHECSTKTTSFKYENVTV-PATV  127

Query  401  NWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGC  574
            +W Q+GAVT +K+QGQCGCCWAFSAV A EGITQ+ T KLISLSEQ+LVDC+      GC
Sbjct  128  DWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGC  187

Query  575  NGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIM  754
             GG M  AF ++ +N G++T ANYPYT   G CN  K +  AA I+G +++P NSE+A++
Sbjct  188  EGGLMDNAFDFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALL  247

Query  755  QAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +AVANQP+SVAIDA G  FQ Y  G+F+  C T   H VTAVGYGV   G +YWL+KN
Sbjct  248  KAVANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTQYWLVKN  305



>gb|AGT16936.1| vignain-like protein [Saccharum hybrid cultivar R570]
Length=341

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 201/302 (67%), Gaps = 12/302 (4%)
 Frame = +2

Query  53   AAILALEMGA-RCEATARWR-VDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDN  226
            A I  + +GA  C A    R ++D++   ++R+E+W+ +Y RVY + TEK +RF VFK N
Sbjct  6    ALIFGILVGAFLCSAALAARDLNDDDSAMVERHEQWMAQYSRVYKDATEKAQRFEVFKVN  65

Query  227  VEYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--L  388
            V++I SFN   N  F LG+NQFADLT DEFR T   +   PS  +  T F YENV+V  L
Sbjct  66   VKFIESFNAARNRKFWLGVNQFADLTIDEFRATKTNKGFKPSRVKVPTGFRYENVSVDVL  125

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P +++W  +GAVT IK+QGQCGCCWAFSAV ATEGI +I T KL SLSEQ+L+DC+    
Sbjct  126  PASVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLTSLSEQELIDCDVHGE  185

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ KN G+TT ++YPYT   G C +   S +AA I G +++P N E
Sbjct  186  DQGCEGGLMDDAFKFIVKNGGLTTESSYPYTAADGKCKSR--SNSAATIKGYEDVPANDE  243

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            AA+M+AVANQPVSVA+D     FQFY GG+ +  C T   H + A+GYG    G KYWL+
Sbjct  244  AALMKAVANQPVSVAVDGGDMTFQFYSGGVIAGSCGTNLDHGIAAIGYGKTSDGTKYWLM  303

Query  923  KN  928
            KN
Sbjct  304  KN  305



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 189/270 (70%), Gaps = 8/270 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGN-YTFTLGINQFADLTNDEF  313
            +++EEW+  +GRVY +  EK  R+ +FK+NV+ I SFN  +  ++ LGINQFADLTN+EF
Sbjct  37   EKHEEWMSRFGRVYNDGNEKEIRYKIFKENVQRIESFNKASGKSYKLGINQFADLTNEEF  96

Query  314  RTTMACEMPSH---SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            +T+       H   S+  PF YEN+T  P +M+W ++GAVT IK+QGQCG CWAFSAV A
Sbjct  97   KTSRN-RFKGHMCSSQAGPFRYENLTAAPSSMDWRKKGAVTAIKDQGQCGSCWAFSAVAA  155

Query  485  TEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGITQ+ T KLISLSEQ+LVDC+T     GC GG M  AFK++ +N+G+TT ANYPY  
Sbjct  156  VEGITQLATSKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIEQNQGLTTEANYPYEG  215

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT + +  AA+I+G +++P N+E A+M+AVA QPVSVAIDA G  FQFY  G+F+
Sbjct  216  SDGTCNTKQEANHAAKINGFEDVPANNEGALMKAVAKQPVSVAIDAGGFGFQFYSSGIFT  275

Query  839  TGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              C T   H V AVGYG    G  YWL+KN
Sbjct  276  GDCGTELDHGVAAVGYG-ESNGMNYWLVKN  304



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/301 (51%), Positives = 198/301 (66%), Gaps = 11/301 (4%)
 Frame = +2

Query  53   AAILA-LEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNV  229
            A+ILA L     C A    R   ++   + R+E+W+ +Y RVY + +EK +RF VFK NV
Sbjct  6    ASILAILGFAFFCGAALAARDLSDDSAMVARHEQWMAQYSRVYKDASEKARRFEVFKANV  65

Query  230  EYINSFNLG-NYTFTLGINQFADLTNDEFRTTMACE-MPSHSEKTP--FMYENVTV--LP  391
            ++I SFN G N  F LG+NQFADLTNDEFR+    +   S + K P  F YENV+V  LP
Sbjct  66   KFIESFNAGGNNKFWLGVNQFADLTNDEFRSIKTNKGFKSSNMKIPTGFRYENVSVDALP  125

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VS  565
             T++W  +GAVT IK+QGQCGCCWAFSAV ATEGI +I T KL+SL+EQ+LVDC+     
Sbjct  126  TTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELVDCDVHGED  185

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AFK++  N G+TT ++YPYT   G C +   S +AA I G +++P N EA
Sbjct  186  QGCEGGLMDDAFKFIINNGGLTTESSYPYTAADGKCKS--GSNSAATIKGYEDVPANDEA  243

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+M+AVANQPVSVA+D     FQFY  G+ +  C T   H + A+GYG    G KYWL+K
Sbjct  244  ALMKAVANQPVSVAVDGGDMTFQFYSSGVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLMK  303

Query  926  N  928
            N
Sbjct  304  N  304



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 188/282 (67%), Gaps = 10/282 (4%)
 Frame = +2

Query  107  RVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGIN  283
            R   ++   + R+E+W+ +Y RVY +  EK +R  VF  NV++I SFN  GN  F LG+N
Sbjct  25   RALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFNANVKFIESFNAAGNRKFWLGVN  84

Query  284  QFADLTNDEFRTTMACEMPSHSE-KTP--FMYENVTV--LPPTMNWLQRGAVTQIKNQGQ  448
            QFADLTNDEFR T   +   HS  K P  F YENV++  LP T++W  +GAVT IK+QGQ
Sbjct  85   QFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVSIDALPATIDWRSKGAVTPIKDQGQ  144

Query  449  CGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNR  622
            CGCCWAFSAV ATEGI +I T KLISLSEQ+LVDC+      GC GG M  AFK++ KN 
Sbjct  145  CGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNG  204

Query  623  GITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMG  802
            G+TT + YPYT   G C +   S +AA I G +++P N+EAA+M+AVANQPVSVA+D   
Sbjct  205  GLTTESGYPYTAADGKCKS--GSNSAATIKGYEDVPANNEAALMKAVANQPVSVAVDGGD  262

Query  803  RPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              FQFY GG+ +  C T   H + A+GYG    G  YWL+KN
Sbjct  263  MTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLMKN  304



>gb|EMT15489.1| Thiol protease SEN102 [Aegilops tauschii]
Length=340

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/288 (51%), Positives = 190/288 (66%), Gaps = 9/288 (3%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT  265
            C +    R   ++   + R+E W+ +YGRVY + TEK ++F VFK NVE+I SFN  N+ 
Sbjct  19   CSSVLAARELSDDLSIVARHESWMAQYGRVYKDATEKAQKFKVFKANVEFIESFNAENHK  78

Query  266  FTLGINQFADLTNDEFRTTMA---CEMPSHSEKTPFMYENVTV--LPPTMNWLQRGAVTQ  430
            F LG+NQFADLTN EF+ T A    +    S  T F YENV++  LP T++W  +GAVT 
Sbjct  79   FFLGVNQFADLTNGEFKMTKANKGYKASLGSAPTGFRYENVSLDALPATVDWRTKGAVTP  138

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV ATEGI +++T KLISLSEQ+LVDC+   V  GC GG M  AFK
Sbjct  139  IKDQGQCGCCWAFSAVAATEGIVKLKTGKLISLSEQELVDCDVHGVDQGCEGGLMDDAFK  198

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++  N G+T  ++YPYT   G C +   S+ AA I   +++P N+E A+M AVANQP+SV
Sbjct  199  FIISNGGLTGESSYPYTAEDGKCKS--GSKDAATIKSYEDVPANNEGALMAAVANQPISV  256

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A+D     FQFYKGG+ +  C T   H +  +GYG    G KYWLLKN
Sbjct  257  AVDGGDMMFQFYKGGVMTGSCGTDLDHGIATIGYGKTSDGTKYWLLKN  304



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/300 (51%), Positives = 194/300 (65%), Gaps = 11/300 (4%)
 Frame = +2

Query  50   FAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNV  229
            FA IL L M A  E  +R   +  E     R+E+W+  YG+VY +  E  +RF +FKDNV
Sbjct  11   FAFILILGMWA-FEVASR---ELQESSMSARHEQWMATYGKVYVDAAEIERRFKIFKDNV  66

Query  230  EYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEK---TPFMYENVTVLPP  394
            EYI SFN  GN  + L +N+FAD TN+EF+        P  +       F YENVT +P 
Sbjct  67   EYIESFNTAGNKPYKLSVNKFADQTNEEFKGAHNGYRRPFQTRPMKVKSFKYENVTAIPA  126

Query  395  TMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSH  568
             M+W ++GAVT IK+QGQCG CWAFS V ATEGI Q+ T KL+SLSEQ+LVDC+T     
Sbjct  127  AMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQ  186

Query  569  GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAA  748
            GC GG M+  F+++ KN GITT ANYPY    G CN  K +   A+I+G +++P NSEA 
Sbjct  187  GCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNPEKRASHIAKITGYESVPANSEAE  246

Query  749  IMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +++AVANQP+SV+IDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  247  LLKAVANQPISVSIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKN  306



>gb|KHN33962.1| Vignain [Glycine soja]
Length=309

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 185/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  Y +VY +  E+ +RF +FK+NV YI +FN   N  +TLGINQFADLTN+EF
Sbjct  3    ERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFADLTNEEF  62

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT +P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  63   IAPRNRFKGHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  122

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  +   KLISLSEQ++VDC+T     GC GG+M  AFK++ +N G+    NYPY 
Sbjct  123  ATEGIHALSAGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNNEPNYPYK  182

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN   A+   A I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFY+ G+F
Sbjct  183  AVDGKCNAKAAANHVATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYQSGVF  242

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  243  TGSCGTELDHGVTAVGYGVSADGTEYWLVKN  273



>ref|XP_010054322.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76126.1| hypothetical protein EUGRSUZ_D00502 [Eucalyptus grandis]
Length=345

 Score =   296 bits (759),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 190/278 (68%), Gaps = 9/278 (3%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADL  298
            EE  +K++EEW+  +GRVY +  EK KR+ +FK+N++ IN+FN G +  + + +N+FADL
Sbjct  32   EEQLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENIKRINAFNNGKDVGYKMAVNKFADL  91

Query  299  TNDEFRTTMA------CEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCC  460
            TN+EFR +          + S  EK PF Y N T +P  ++W  + AVT +K+QG CG C
Sbjct  92   TNEEFRASYTGYKRRPTRVLSSGEKKPFKYANFTAIPAALDWRTKKAVTPVKDQGNCGSC  151

Query  461  WAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGA  640
            WAFSAV A EGIT I+ +KL+ LS Q+LVDC+    GC GG M +AF+++  N G+TT A
Sbjct  152  WAFSAVAAMEGITMIKKRKLVPLSVQELVDCDDNDDGCIGGLMDSAFEFIVSNGGLTTEA  211

Query  641  NYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFY  820
            NYPY   KG CNTAKA+  AA I+G +++P N+E A++QAVANQPVSVAI+  G  FQFY
Sbjct  212  NYPYQENKGTCNTAKAANPAASITGYKDVPANNEKALLQAVANQPVSVAIEGGGFDFQFY  271

Query  821  KGGLFSTGCTTRTTHAVTAVGYGVM--PGGKKYWLLKN  928
              G+F+  C T   HAVTAVGYG     GG KYWL+KN
Sbjct  272  STGVFTGSCGTDIDHAVTAVGYGKTSGSGGTKYWLMKN  309



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   296 bits (759),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 188/282 (67%), Gaps = 10/282 (4%)
 Frame = +2

Query  107  RVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGIN  283
            R   ++   + R+E+W+ +Y RVY +  EK +R  VF  NV++I SFN  GN  F LG+N
Sbjct  25   RALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEVFNANVKFIESFNAAGNRKFWLGVN  84

Query  284  QFADLTNDEFRTTMACEMPSHSE-KTP--FMYENVTV--LPPTMNWLQRGAVTQIKNQGQ  448
            QFADLTNDEFR T   +   HS  K P  F YENV++  LP T++W  +GAVT IK+QGQ
Sbjct  85   QFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVSIDALPATIDWRTKGAVTPIKDQGQ  144

Query  449  CGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNR  622
            CGCCWAFSAV ATEGI +I T KLISLSEQ+LVDC+      GC GG M  AFK++ KN 
Sbjct  145  CGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNG  204

Query  623  GITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMG  802
            G+TT + YPYT   G C +   S +AA I G +++P N+EAA+M+AVANQPVSVA+D   
Sbjct  205  GLTTESGYPYTAADGKCKS--GSNSAATIKGYEDVPANNEAALMKAVANQPVSVAVDGGD  262

Query  803  RPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              FQFY GG+ +  C T   H + A+GYG    G  YWL+KN
Sbjct  263  MTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLMKN  304



>ref|NP_568651.1| cysteine protease SAG12 [Arabidopsis thaliana]
 sp|Q9FJ47.1|SAG12_ARATH RecName: Full=Senescence-specific cysteine protease SAG12; AltName: 
Full=Cysteine proteinase SAG12; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK43946.1|AF370131_1 putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 dbj|BAB09317.1| senescence-specific cysteine protease [Arabidopsis thaliana]
 gb|AAK64131.1| putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 gb|AED95312.1| cysteine protease [Arabidopsis thaliana]
Length=346

 Score =   296 bits (759),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/311 (49%), Positives = 199/311 (64%), Gaps = 15/311 (5%)
 Frame = +2

Query  29   KNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRF  208
            K+  + +F AI +    + C +    R  DNE    KR+ EW+ ++GRVYA+  E+  R+
Sbjct  4    KHMQIFLFVAIFS----SFCFSITLSRPLDNELIMQKRHIEWMTKHGRVYADVKEENNRY  59

Query  209  SVFKDNVEYINSFNL--GNYTFTLGINQFADLTNDEFRT-------TMACEMPSHSEKTP  361
             VFK+NVE I   N      TF L +NQFADLTNDEFR+         A    S ++ +P
Sbjct  60   VVFKNNVERIEHLNSIPAGRTFKLAVNQFADLTNDEFRSMYTGFKGVSALSSQSQTKMSP  119

Query  362  FMYENVT--VLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSE  535
            F Y+NV+   LP +++W ++GAVT IKNQG CGCCWAFSAV A EG TQI+  KLISLSE
Sbjct  120  FRYQNVSSGALPVSVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSE  179

Query  536  QQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISG  715
            QQLVDC+T   GC GG M TAF+++    G+TT +NYPY      CN+ K +  A  I+G
Sbjct  180  QQLVDCDTNDFGCEGGLMDTAFEHIKATGGLTTESNYPYKGEDATCNSKKTNPKATSITG  239

Query  716  LQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVM  895
             +++P N E A+M+AVA+QPVSV I+  G  FQFY  G+F+  CTT   HAVTA+GYG  
Sbjct  240  YEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDHAVTAIGYGES  299

Query  896  PGGKKYWLLKN  928
              G KYW++KN
Sbjct  300  TNGSKYWIIKN  310



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 196/300 (65%), Gaps = 11/300 (4%)
 Frame = +2

Query  50   FAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNV  229
            FA IL L M A  E  +R   +  E     R+E+W+  YG+VY +  EK +RF +FK+NV
Sbjct  11   FAFILILGMWA-FEVASR---ELQESYMSARHEQWMATYGKVYVDAAEKERRFKIFKNNV  66

Query  230  EYINSFNL-GNYTFTLGINQFADLTNDEFRTTM-ACEMPSHSEK---TPFMYENVTVLPP  394
            EYI SFN  GN  + L +N+FAD TN++F+        P  +     T F YENVT +P 
Sbjct  67   EYIESFNTAGNKPYKLSVNKFADQTNEKFKGARNGYRRPFQTRPMKVTSFKYENVTAVPA  126

Query  395  TMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSH  568
            TM+W ++GAVT IK+QGQCG CWAFS V ATEGI Q+ T KL+SLSEQ+LVDC+      
Sbjct  127  TMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDNQGEDQ  186

Query  569  GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAA  748
            GC GG M+  F+++ KN GITT ANYPY    G CN+ K +   A+I+G +++P NSEA 
Sbjct  187  GCEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKKQASHIAKITGYESVPANSEAE  246

Query  749  IMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +++ VANQP+SV+IDA G  FQFY  G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  247  LLKVVANQPISVSIDAGGSDFQFYSSGVFTGKCGTELDHGVTAVGYGETSDGTKYWLVKN  306



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   296 bits (758),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 196/302 (65%), Gaps = 15/302 (5%)
 Frame = +2

Query  41   LIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            L +  A  A E  AR    A  R         +R+E+W+  +G+VY +  EK +++  FK
Sbjct  15   LCLVFAFCAFEGNARTLEDAPMR---------ERHEQWMAIHGKVYTHSYEKEQKYQTFK  65

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTT--MACEMPSHSEKTP-FMYENVTVL  388
            +NV+ I +FN  GN  + LGIN FADLTN+EF+        + S   +TP F YEN+T +
Sbjct  66   ENVQRIEAFNHAGNKPYKLGINHFADLTNEEFKAINRFKGHVCSKITRTPTFRYENMTAV  125

Query  389  PPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--V  562
            P T++W Q GAVT IK+QGQCGCCWAFSAV ATEGIT++ T KLISLSEQ+LVDC+T  V
Sbjct  126  PATLDWRQEGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGV  185

Query  563  SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSE  742
              GC GG M  AFK++ +N+G+   A YPY    G CN       A  I G +++P NSE
Sbjct  186  DQGCEGGLMDDAFKFILQNKGLAAEAIYPYEGVDGTCNAKAEGNHATSIKGYEDVPANSE  245

Query  743  AAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLL  922
            +A+++AVANQPVSVAI+A G  FQFY GG+F+  C T   H VTAVGYGV   G KYWL+
Sbjct  246  SALLKAVANQPVSVAIEASGFEFQFYSGGVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLV  305

Query  923  KN  928
            KN
Sbjct  306  KN  307



>ref|XP_006592475.1| PREDICTED: vignain-like [Glycine max]
Length=336

 Score =   296 bits (757),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 185/274 (68%), Gaps = 7/274 (3%)
 Frame = +2

Query  119  NEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFAD  295
            +E    +R+E+W+ EYG+VY +  EK KRF +FK NVE+I SFN   N  + LG+N  AD
Sbjct  30   HETSMRERHEQWMAEYGKVYKDAAEKEKRFLIFKHNVEFIESFNAAANKPYKLGVNHLAD  89

Query  296  LTNDEFRTTM-ACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFS  472
            LT +EF+ +    + P     TPF YENVT +P  ++W  +GAVT IK+QGQCG CWAFS
Sbjct  90   LTVEEFKASRNGLKRPYELSTTPFKYENVTAIPAAIDWRTKGAVTSIKDQGQCGSCWAFS  149

Query  473  AVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANY  646
             V ATEGI QI T KL+SLSEQ+LVDC+T  V  GC GG+M+  F+++ KN GIT+ ANY
Sbjct  150  TVAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITSEANY  209

Query  647  PYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKG  826
            PY    G CN  KA+   A+I G + +PPNSE  + +AVANQPVSV+IDA G  F FY  
Sbjct  210  PYKAVDGKCN--KATSPVAQIKGYEKVPPNSEKTLQKAVANQPVSVSIDANGEGFMFYSS  267

Query  827  GLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            G+++  C T   H VTAVGYG+   G  YWL+KN
Sbjct  268  GIYNGECGTELDHGVTAVGYGI-ANGTDYWLVKN  300



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score =   296 bits (758),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 183/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  YGRVY +  E+ KR  +FK+NV YI +FN   N  + L +NQFADLTN+EF
Sbjct  37   ERHEEWMTRYGRVYKDPPEREKRLRIFKENVNYIEAFNNAANKPYKLAVNQFADLTNEEF  96

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT +P T++W Q+GAVT +K+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSITRTTSFKYENVTAVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            A EGI  +   KLISLSEQ+LVDC++  V  GC GG M  AFK+V +N+G+ T ANYPY 
Sbjct  157  AAEGIHALTAGKLISLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLNTEANYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
                 CN   AS  AA I G +++P N+E A+ +AV NQPVSVAIDA G  FQFY+ G+F
Sbjct  217  GTDETCNANAASGHAATIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSDDGTEYWLVKN  307



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 185/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGINQFADLTNDEF  313
            +R+E+W+  +GRVY +  EK + FS+FK  VEYI SFN  GN  + L IN FADLT++EF
Sbjct  3    ERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPYKLAINAFADLTSEEF  62

Query  314  RTTMACEMPSHSEKT----PFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
            + +      S S +     PF YE+VT +P +M+W ++GAVT IK+QGQCGC WAFSAV 
Sbjct  63   KASRTGYKRSSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQCGCRWAFSAVA  122

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            A EGITQ+ T KL SLSEQ+LVDC+      GC GG M  AF+++  N G+TT ANYPY 
Sbjct  123  AMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTTEANYPYQ  182

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
                 CN  KA+  AA+ISG +++P NSE+A+++AVA+QPVSVAIDA    FQFY  G+F
Sbjct  183  AVDNTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAGETDFQFYSTGIF  242

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYG    G KYWL+KN
Sbjct  243  TGECGTDLDHGVTAVGYGTSENGTKYWLVKN  273



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 182/269 (68%), Gaps = 6/269 (2%)
 Frame = +2

Query  140  RYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEFR  316
            R+E+W+ +YGRVY +  EK +RF +FKDN  YI S N  GN  + LG+NQFAD+TN+EF+
Sbjct  33   RHEQWMAQYGRVYKDAAEKERRFQIFKDNCNYIESVNRAGNRKYKLGLNQFADMTNEEFK  92

Query  317  TTMACEMP---SHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGAT  487
             +     P   + S    F Y N+T +  +++W  RGAVT +KNQG CGCCWAFS V A 
Sbjct  93   ASHLGFKPMRLTKSTTGSFQYANLTDVSDSVDWRTRGAVTPVKNQGSCGCCWAFSTVAAI  152

Query  488  EGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMR  661
            EGITQI    L+SLSEQQ+VDC+    + GC+GG+M  AF+YV  N GITT  NYPY   
Sbjct  153  EGITQINNGNLVSLSEQQVVDCDVKDGNRGCHGGFMTRAFQYVIDNGGITTEENYPYMAA  212

Query  662  KGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFST  841
             G C+T KAS +AA ISG QN+P N E++++QAV+ QPVSV ID  G+ FQ Y  G+F+ 
Sbjct  213  DGTCDTNKASSSAATISGYQNVPVNDESSLLQAVSKQPVSVGIDGGGQDFQHYSSGIFAG  272

Query  842  GCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             C T   HAVTA+GYG    G KYWLLKN
Sbjct  273  PCETNMDHAVTAIGYGTAEDGTKYWLLKN  301



>ref|XP_010052197.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76117.1| hypothetical protein EUGRSUZ_D00494 [Eucalyptus grandis]
Length=369

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/278 (50%), Positives = 187/278 (67%), Gaps = 9/278 (3%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADL  298
            EE  +K++E+W+  +GRVY +  EK KR+ +FK NV  IN+FN   +  + L +N+FADL
Sbjct  56   EEHLLKQHEQWMAVHGRVYKDADEKAKRYEIFKQNVNRINAFNNDKDAAYKLAVNKFADL  115

Query  299  TNDEFRTTM------ACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCC  460
            TN+EFR +       +  + S  ++ PF Y N T  PP ++W  + AVT +K+Q  CG C
Sbjct  116  TNEEFRASFTGYKRRSTRVLSSVDEKPFKYANFTAAPPVLDWRTKKAVTSVKDQSSCGAC  175

Query  461  WAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITT  634
            WAFSAV A EGIT ++  KL+SLSEQ+LVDC+   V+ GC GG M +AF+++    G+T+
Sbjct  176  WAFSAVAAMEGITMLKKGKLVSLSEQELVDCDVNGVNEGCEGGLMDSAFQFIKSKGGLTS  235

Query  635  GANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQ  814
             ANYPY    G C TAKA+   A I+G Q++P N+E A++QAVANQPVSVAI+  G  FQ
Sbjct  236  EANYPYQGNDGTCRTAKAANIVASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFSFQ  295

Query  815  FYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            FY GG+F+  C T   HAVTAVGYG   GG KYWLLKN
Sbjct  296  FYSGGVFTGSCGTSLDHAVTAVGYGTTSGGAKYWLLKN  333



>ref|XP_003607571.1| Cysteine proteinase EP-B [Medicago truncatula]
 gb|AAQ63885.1| putative cysteine proteinase [Medicago truncatula]
 gb|AES89768.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 202/313 (65%), Gaps = 12/313 (4%)
 Frame = +2

Query  14   MQGSRKNRHLIVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTE  193
            M  + +  H I  A    L + A  + T+R   DD+     +++E+W+V YG+VY +  E
Sbjct  1    MAANNQLYHSISLALFFCLGLFA-IQVTSRTLQDDSI--IYEKHEQWMVHYGKVYKDLQE  57

Query  194  KMKRFSVFKDNVEYINSFNLG--NYTFTLGINQFADLTNDEF---RTTMACEMPSHSEKT  358
            +  R  +FK+NV YI + N    N  + LGINQFADLTN+EF   R      M S   KT
Sbjct  58   RENRLKIFKENVNYIEASNNAGNNKLYKLGINQFADLTNEEFIASRNKFKGHMCSSITKT  117

Query  359  P-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSE  535
              F YEN +V P T++W ++GAVT +KNQGQCGCCWAFSAV ATEGI ++ T KL+SLSE
Sbjct  118  STFKYENASV-PSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSE  176

Query  536  QQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARI  709
            Q+LVDC+T  V  GC GG M  AFK++ +N G+ T A YPY    G C+  KAS  A  I
Sbjct  177  QELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTEAQYPYQGVDGTCSANKASIHAVTI  236

Query  710  SGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYG  889
            +G +++P N+E A+ +AVANQP+SVAIDA G  FQFYK G+F+  C T   H VTAVGYG
Sbjct  237  TGYEDVPANNEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYG  296

Query  890  VMPGGKKYWLLKN  928
            V   G KYWL+KN
Sbjct  297  VGNDGTKYWLVKN  309



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 189/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  YG+VY +  E+ KRF +FK+NV YI +FN   N  + L INQFADLTN+EF
Sbjct  37   ERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAINQFADLTNEEF  96

Query  314  ---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S   +T  F YENVT +P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ+LVDC+T  V  GC GG M  AFK+V +N G+ T ANYPY 
Sbjct  157  ATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFVIQNHGLNTEANYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+  AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  217  GVDGKCNANEAANNAATITGYEDVPANNEKALQKAVANQPVSVAIDASGSDFQFYKSGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSNDGTEYWLVKN  307



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 199/301 (66%), Gaps = 11/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGARCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKD  223
            +  A IL +  G   EAT+R   D +  G   RYE+W+  YGRVY +  EK KRF +FK+
Sbjct  10   LCLALILMMFGGWYSEATSRTLQDASMYG---RYEQWMARYGRVYNDINEKEKRFQIFKE  66

Query  224  NVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKT-PFMYENVTVLP  391
            NV  + S N   +  +TL +NQFADLTN+EF  +       H  S KT  F YEN TV P
Sbjct  67   NVAIVESSNNDASKPYTLSVNQFADLTNEEFIASRN-RFKGHECSTKTMSFKYENFTV-P  124

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VS  565
             T++W Q+GAVT +K+QGQCGCCWAFSAV A EGITQ+ T KLISLSEQ+LVDC+     
Sbjct  125  ATVDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGED  184

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AF ++ +N G++T A+YPYT   G CN  K +  AA I+G +++P NSE+
Sbjct  185  QGCEGGLMDNAFDFINQNHGLSTEAHYPYTGVDGTCNAQKEASHAASITGHEDVPANSES  244

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQP+SVAIDA G  FQ Y  G+F+  C T   H VTAVGYG+   G KYWL+K
Sbjct  245  ALLKAVANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDHGVTAVGYGISDDGTKYWLVK  304

Query  926  N  928
            N
Sbjct  305  N  305



>gb|KHN13720.1| Vignain [Glycine soja]
Length=309

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 190/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  Y +VY +  E+ KRF +FK+NV YI +FN   +  + LGINQFADLTN+EF
Sbjct  3    ERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAADKPYKLGINQFADLTNEEF  62

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT LP T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  63   IAPRNRFKGHMCSSITRTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  122

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ++VDC+T     GC GG+M  AFK++ +N G+ T ANYPY 
Sbjct  123  ATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANYPYK  182

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+  AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  183  AVDGKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKTGVF  242

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T+  H VTAVGYGV   G +YWL+KN
Sbjct  243  TGSCGTQLDHGVTAVGYGVSADGTQYWLVKN  273



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 189/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  YG+VY +  E+ KRF VFK+NV YI +FN   N ++ LGINQFADLTN EF
Sbjct  37   ERHEQWMTRYGKVYKDPQEREKRFRVFKENVNYIEAFNNAANKSYKLGINQFADLTNKEF  96

Query  314  ---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S   +T  F +ENVT  P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  97   IAPRNGFKGHMCSSIIRTTTFKFENVTATPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  +   KLISLSEQ+LVDC+T  V  GC GG M  AFK++ +N G+ T ANYPY 
Sbjct  157  ATEGIHALSAGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTEANYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A++ AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  217  GVDGKCNANEAAKNAATITGYEDVPANNEMALQKAVANQPVSVAIDASGSDFQFYKSGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSDDGTEYWLVKN  307



>ref|XP_003527349.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 185/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  Y +VY +  E+ +RF +FK+NV YI +FN   N  +TLGINQFADLTN+EF
Sbjct  37   ERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFADLTNEEF  96

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT +P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  +   KLISLSEQ++VDC+T     GC GG+M  AFK++ +N G+    NYPY 
Sbjct  157  ATEGIHALSAGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNNEPNYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN   A+   A I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFY+ G+F
Sbjct  217  AVDGKCNAKAAANHVATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYQSGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSADGTEYWLVKN  307



>ref|XP_003556992.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 185/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  Y +VY +  E+ +RF +FK+NV YI +FN   N  +TLGINQFADLTN+EF
Sbjct  37   ERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFADLTNEEF  96

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT +P T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  +   KLISLSEQ++VDC+T     GC GG+M  AFK++ +N G+    NYPY 
Sbjct  157  ATEGIHALSAGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNNEPNYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN   A+   A I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFY+ G+F
Sbjct  217  AVDGKCNAKAAANHVATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYQSGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSADGTEYWLVKN  307



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 190/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  Y +VY +  E+ KRF +FK+NV YI +FN   N  + LGINQFADLTN+EF
Sbjct  37   ERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAANKPYKLGINQFADLTNEEF  96

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT LP T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSITRTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ++VDC+T     GC GG+M  AFK++ +N G+ T ANYPY 
Sbjct  157  ATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+  AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  217  AVDGKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKTGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T+  H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTQLDHGVTAVGYGVSADGTQYWLVKN  307



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 189/282 (67%), Gaps = 10/282 (4%)
 Frame = +2

Query  107  RVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGIN  283
            R   ++   + R+E+W+ +Y RVY +  EK +RF VFK NV++I SFN  GN  F LG+N
Sbjct  25   RALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVKFIESFNAAGNRKFWLGVN  84

Query  284  QFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--LPPTMNWLQRGAVTQIKNQGQ  448
            QFADLTNDEFR T   +   PS  +  T F YENV++  LP T++W  +GAVT IK+QGQ
Sbjct  85   QFADLTNDEFRATKTNKGFKPSPMKVPTGFRYENVSIDALPATIDWRTKGAVTPIKDQGQ  144

Query  449  CGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNR  622
            CGCCWAFSAV ATEGI +I T KLISLSEQ+LVDC+      GC GG M  AFK++ KN 
Sbjct  145  CGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNG  204

Query  623  GITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMG  802
            G+TT + YPYT     C +   S +AA I G +++P N+EAA+M+AVANQPVSVA+D   
Sbjct  205  GLTTESGYPYTAADDKCKS--GSNSAATIKGYEDVPANNEAALMKAVANQPVSVAVDGGD  262

Query  803  RPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              FQFY GG+ +  C T   H + A+GYG    G  YWL+KN
Sbjct  263  MTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLMKN  304



>ref|XP_010054319.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW76119.1| hypothetical protein EUGRSUZ_D00496 [Eucalyptus grandis]
Length=345

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 187/278 (67%), Gaps = 9/278 (3%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADL  298
            EE  +K++EEW+  +GRVY +  EK KR+ +FK+NV+ IN+FN G +  + + +N+FADL
Sbjct  32   EEHLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNKFADL  91

Query  299  TNDEFRTTMA------CEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCC  460
            TN+EFR +          + S  EK PF Y N T +P  ++W  + AVT +K+QG CG C
Sbjct  92   TNEEFRASYTGYKRRPTRVLSSGEKKPFKYANFTAIPAALDWRTKKAVTPVKDQGGCGSC  151

Query  461  WAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGA  640
            WAFSAV A EGIT I+  KL+ LS Q+LVDC+    GC GG M +AFK++  N G+TT A
Sbjct  152  WAFSAVAAMEGITMIKKGKLVPLSVQELVDCDDNDEGCGGGLMDSAFKFIVSNGGLTTEA  211

Query  641  NYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFY  820
            NYPY    G CNTAK +  AA I+G Q++P N+E A++QAVANQPVSVAI+  G  FQFY
Sbjct  212  NYPYQGDDGTCNTAKTANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGFDFQFY  271

Query  821  KGGLFSTGCTTRTTHAVTAVGYGVM--PGGKKYWLLKN  928
              G+F+  C +   HAVTAVGYG     GG KYWL+KN
Sbjct  272  SSGVFTGSCGSDIDHAVTAVGYGKTSGSGGTKYWLMKN  309



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 189/282 (67%), Gaps = 10/282 (4%)
 Frame = +2

Query  107  RVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTFTLGIN  283
            R   ++   + R+E+W+ +Y RVY +  EK +RF VFK NV++I SFN  GN  F LG+N
Sbjct  25   RTLSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVKFIESFNAAGNRKFWLGVN  84

Query  284  QFADLTNDEFRTTMACE--MPSHSE-KTPFMYENVTV--LPPTMNWLQRGAVTQIKNQGQ  448
            QFADLTNDEFR T   +   PS  +  T F YENV++  LP T++W  +GAVT IK+QGQ
Sbjct  85   QFADLTNDEFRATKTNKGFKPSPMKVPTGFRYENVSIDALPATIDWRTKGAVTPIKDQGQ  144

Query  449  CGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNR  622
            CGCCWAFSAV ATEGI +I T KLISLSEQ+LVDC+      GC GG M  AFK++ KN 
Sbjct  145  CGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNG  204

Query  623  GITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMG  802
            G+TT + YPYT   G C +   S +AA I   +++P N+EAA+M+AVANQPVSVA+D   
Sbjct  205  GLTTESGYPYTAADGKCKS--GSNSAATIKSYEDVPANNEAALMKAVANQPVSVAVDGGD  262

Query  803  RPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
              FQFY GG+ +  C T   H + A+GYG    G  YWL+KN
Sbjct  263  MTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTNYWLMKN  304



>ref|XP_008669668.1| PREDICTED: ervatamin-B-like [Zea mays]
 tpg|DAA38567.1| TPA: hypothetical protein ZEAMMB73_390779 [Zea mays]
Length=343

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 198/306 (65%), Gaps = 18/306 (6%)
 Frame = +2

Query  50   FAAILALEMGARCE-----ATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSV  214
            F  +LA+  G  C        AR   DD      +R+E W+  YGRVY +  EK +RF V
Sbjct  7    FLLLLAILTGCACSFPSPVLAARELSDD--AAMAERHERWMAVYGRVYKDAAEKARRFEV  64

Query  215  FKDNVEYINSFNLGNYT-FTLGINQFADLTNDEFRTTMACEMPSHSEKTP---FMYENVT  382
            FKDN+ ++ SFN      F LG+NQFADLT +EF+     + P  +E+ P   F YEN++
Sbjct  65   FKDNLAFVESFNADKKNKFWLGVNQFADLTTEEFKANKGFK-PISAEEVPTTGFKYENLS  123

Query  383  V--LPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCE  556
            V  LP  ++W  +GAVT IKNQGQCGCCWAFSAV A EGI ++ T  L+SLSEQ+LVDC+
Sbjct  124  VSALPTAVDWRTKGAVTPIKNQGQCGCCWAFSAVAAMEGIVKLSTDNLVSLSEQELVDCD  183

Query  557  TVS--HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIP  730
            T S   GC GGWM +AF++V KN G+ T ++YPY    G C     S++AA I G +++P
Sbjct  184  THSMDEGCEGGWMDSAFEFVIKNGGLATESSYPYKAVDGKCKGG--SKSAATIKGHEDVP  241

Query  731  PNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKK  910
            PN+EAA+M+AVA+QPVSVA+DA  R F  Y GG+ +  C T+  H + A+GYGV   G K
Sbjct  242  PNNEAALMKAVASQPVSVAVDASDRTFMLYSGGVMTGSCGTQLDHGIAAIGYGVESDGTK  301

Query  911  YWLLKN  928
            YW+LKN
Sbjct  302  YWILKN  307



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/301 (52%), Positives = 204/301 (68%), Gaps = 12/301 (4%)
 Frame = +2

Query  44   IVFAAILALEMGA-RCEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFK  220
            + FA I  L  GA    AT+R   D +  G   +YE+W+  YGRVY +  EK KRF++FK
Sbjct  212  MCFALIFML--GALSSHATSRTLQDASMYG---KYEQWMARYGRVYTDINEKEKRFNIFK  266

Query  221  DNVEYINSFN-LGNYTFTLGINQFADLTNDEFRTTMACEMPSH--SEKTPFMYENVTVLP  391
             NV++I S N   N  + L +NQFADLTN+EF+T+    M     ++ T F YENVT  P
Sbjct  267  ANVDFIESSNNDANKPYKLKVNQFADLTNEEFKTSRNRFMGHECSTKTTSFKYENVTA-P  325

Query  392  PTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VS  565
             T++W ++GAVT IK+QGQCGCCWAFSAV A +GIT++ T KLISLSEQ+LVDC+T  V 
Sbjct  326  ATVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMKGITKLTTGKLISLSEQELVDCDTSSVD  385

Query  566  HGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEA  745
             GC GG M  AF+++ +N G++T  NYPYT   G CNT   +  AA I+G +++P NSEA
Sbjct  386  QGCEGGLMDDAFQFITQNHGLSTETNYPYTGVDGTCNTKNEASHAATITGHEDVPANSEA  445

Query  746  AIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLK  925
            A+++AVANQP+SV IDA G  FQFY  G+F+  C T   H VTAVG+GV   G KYWL+K
Sbjct  446  ALLKAVANQPISVVIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVK  505

Query  926  N  928
            N
Sbjct  506  N  506



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 182/271 (67%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  YGRVY +  E+ KR  +FK+NV YI +FN   N  + L INQFADLTN+EF
Sbjct  37   ERHEEWMTRYGRVYKDPQEREKRLRIFKENVNYIEAFNNAANKPYKLAINQFADLTNEEF  96

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT +P T++W Q+GAVT +K+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSITRTTSFKYENVTAVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  +   KLISLSEQ+LVDC++  V  GC GG M  AFK+V +N+G+ T A YPY 
Sbjct  157  ATEGIHALTAGKLISLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLNTEAKYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
                 CN   AS  A  I G +++P N+E A+ +AV NQPVSVAIDA G  FQFY+ G+F
Sbjct  217  GTDETCNANAASGHAVTIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSDDGTEYWLVKN  307



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/288 (52%), Positives = 195/288 (68%), Gaps = 12/288 (4%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG--NY  262
            + T+R   DD+     +R+E+W+  YG+VY N  E+ KR  +F +N++YI + N    N 
Sbjct  24   QVTSRTLQDDS---IFERHEQWMTHYGKVYKNPQEREKRLRIFTENLKYIEASNNAGNNK  80

Query  263  TFTLGINQFADLTNDEF---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQ  430
             + LGINQFADLTN+EF   R      M S   +T  F YEN +V P T++W ++GAVT 
Sbjct  81   PYKLGINQFADLTNEEFIASRNKFKGHMCSSIIRTTTFKYENTSV-PSTVDWRKKGAVTP  139

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            +KNQGQCGCCWAFSA+ ATEGI +I T KL+SLSEQ+LVDC+T  V  GC GG M  AFK
Sbjct  140  VKNQGQCGCCWAFSAIAATEGIHKISTGKLVSLSEQELVDCDTNGVDQGCEGGLMDDAFK  199

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ +N GI+T A YPY    G C   +AS +AA I+G +++P N+E A+ +AVANQP+SV
Sbjct  200  FIIQNNGISTEAGYPYQGVDGTCKANEASTSAATITGYEDVPANNENALQKAVANQPISV  259

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AIDA G  FQFYK G+F+  C T   H VTAVGYG+   G KYWL+KN
Sbjct  260  AIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGISNDGTKYWLVKN  307



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 190/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  Y +VY +  E+ KRF +FK+NV YI +FN   +  + LGINQFADLTN+EF
Sbjct  37   ERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAADKPYKLGINQFADLTNEEF  96

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT LP T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  97   IAPRNKFKGHMCSSITRTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ++VDC+T     GC GG+M  AFK++ +N G+ T ANYPY 
Sbjct  157  ATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+  AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  217  AVDGKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKTGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T+  H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTQLDHGVTAVGYGVSADGTQYWLVKN  307



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 186/268 (69%), Gaps = 3/268 (1%)
 Frame = +2

Query  134  MKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADLTNDE  310
            +KR+ EW+ +YGRVY +  EK KR+ +FK+N+E I +FN G +  + LG+N+FADLTN+E
Sbjct  2    LKRHGEWMAQYGRVYGDMKEKDKRYLIFKENIERIEAFNNGSDRGYKLGVNKFADLTNEE  61

Query  311  FRTTMACEMPSHSE--KTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
            FR          S+   + F YEN++ +P +M+W    AVT +K+QG+CGCCWAFS V A
Sbjct  62   FRAMYHGYKRQSSKLMSSSFRYENLSDIPTSMDWRNAEAVTPVKDQGRCGCCWAFSTVAA  121

Query  485  TEGITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRK  664
             EGI +++T KLISLSEQQLVDC+  ++GC+GG+M  AF+Y+ +N G+ +  NYPY    
Sbjct  122  IEGIIKLKTGKLISLSEQQLVDCDVGNNGCHGGFMDNAFQYIIRNGGLASEDNYPYQGVD  181

Query  665  GMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTG  844
            G CN+ KAS   A I+G +++P N+E A++QAVA QPVSV +D  G+ FQFYK G+F   
Sbjct  182  GTCNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVVVDGGGQDFQFYKSGVFKGD  241

Query  845  CTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            C T   HAVTA+GYG    G  YWL+KN
Sbjct  242  CGTEQNHAVTAIGYGTDSDGTDYWLVKN  269



>gb|KHN32068.1| Vignain [Glycine soja]
Length=309

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 189/271 (70%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+EEW+  Y +VY +  E+ KRF +FK+NV YI +FN   N  + LGINQFADLTN+EF
Sbjct  3    ERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAANKPYKLGINQFADLTNEEF  62

Query  314  ---RTTMACEMP-SHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M  S    T F YENVT LP T++W Q+GAVT IK+QGQCGCCWAFSAV 
Sbjct  63   IVPRNRFNGHMRFSFITTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVA  122

Query  482  ATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  + + KLISLSEQ++VDC+T     GC GG+M  AFK++ +N G+ T ANYPY 
Sbjct  123  ATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANYPYK  182

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN  +A+  AA I+G +++P N+E A+ +AVANQPVSVAIDA G  FQFYK G+F
Sbjct  183  AVDGKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKTGVF  242

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T+  H VTAVGYGV   G +YWL+KN
Sbjct  243  TGSCGTQLDHGVTAVGYGVSADGTQYWLVKN  273



>gb|EMT29822.1| Vignain [Aegilops tauschii]
Length=339

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/288 (52%), Positives = 191/288 (66%), Gaps = 9/288 (3%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT  265
            C +    R  +++   + R+E W+V+Y RVY + TEK +RF VFK NV +I SFN  N  
Sbjct  18   CSSVLAARELNDDLSMVARHESWMVQYNRVYKDTTEKAQRFQVFKANVGFIESFNTENCK  77

Query  266  FTLGINQFADLTNDEFRTTMACEMPSHS-EKTP--FMYENVTV--LPPTMNWLQRGAVTQ  430
            F LGINQF DLTN EF+ T A +    S E+ P  F YENV++  LP T++W  +GAVT 
Sbjct  78   FYLGINQFTDLTNKEFKATKANKGYKPSLERVPTGFRYENVSLVALPETVDWRTKGAVTP  137

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV ATEGI +++T KLISLSEQ+LVDC+      GC GG M  AFK
Sbjct  138  IKDQGQCGCCWAFSAVAATEGIVKLKTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAFK  197

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ KN G+TT +NYPYT     C +   +  AA I   +++P N+E A+MQAVA+QPVSV
Sbjct  198  FIIKNGGLTTESNYPYTAADDKCKS--GTNGAATIKSYEDVPANNEGALMQAVASQPVSV  255

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A+D     FQFYKGG+ +  C T   H + A+GYG    G KYWLLKN
Sbjct  256  AVDGGDMTFQFYKGGVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLLKN  303



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 191/286 (67%), Gaps = 7/286 (2%)
 Frame = +2

Query  92   ATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNL-GNYTF  268
            A+  W  + ++    +R+E+W+  +GRVY +  EK + FS+FK  VEYI SFN  GN  +
Sbjct  43   ASQAWSRELHDATMRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPY  102

Query  269  TLGINQFADLTNDEFRTTMACEMPSHSEKT----PFMYENVTVLPPTMNWLQRGAVTQIK  436
             L IN FADLT++EF+ +      S S +     PF YE+VT +P +M+W ++GAVT IK
Sbjct  103  KLAINAFADLTSEEFKASRTGYKRSSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIK  162

Query  437  NQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETV--SHGCNGGWMQTAFKYV  610
            +QGQCGC WAFSAV A EGITQ+ T KL SLSEQ+LVDC+      GC GG M  AF+++
Sbjct  163  DQGQCGCRWAFSAVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFI  222

Query  611  AKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAI  790
              N G+TT ANYPY      CN  KA+  AA+ISG +++P NSE+A+++AVA+QPVSVAI
Sbjct  223  ISNHGLTTEANYPYQAVDNTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAI  282

Query  791  DAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            DA    FQFY  G+F+  C T   H VTAVGYG    G KYWL+KN
Sbjct  283  DAGETDFQFYSTGIFTGECGTDLDHGVTAVGYGTSENGTKYWLVKN  328



>ref|XP_003607548.1| Cysteine protease [Medicago truncatula]
 ref|XP_003637653.1| Cysteine protease [Medicago truncatula]
 gb|AES89745.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 193/288 (67%), Gaps = 11/288 (4%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG--NY  262
            + T+R   DD+     +++E+W+V YG+VY +  E+  R  +FK+NV YI + N    N 
Sbjct  25   QVTSRTLQDDSN--IYEKHEQWMVHYGKVYKDLQERENRLKIFKENVNYIEASNNAGNNK  82

Query  263  TFTLGINQFADLTNDEF---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQ  430
             + LGINQFADLTN+EF   R      M S   KT  F YEN +V P T++W ++GAVT 
Sbjct  83   LYKLGINQFADLTNEEFIASRNKFKGHMCSSITKTSTFKYENASV-PSTVDWRKKGAVTP  141

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            +KNQGQCGCCWAFSAV ATEGI ++ T KL+SLSEQ+LVDC+T  V  GC GG M  AFK
Sbjct  142  VKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFK  201

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ +N G+ T A YPY    G C+  KAS  A  I+G +++P N+E A+ +AVANQP+SV
Sbjct  202  FIIQNHGLNTEAQYPYQGVDGTCSANKASIHAVTITGYEDVPANNEQALQKAVANQPISV  261

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AIDA G  FQFYK G+F+  C T   H VTAVGYGV   G KYWL+KN
Sbjct  262  AIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKN  309



>gb|AAP32198.1| cysteine protease 12 [Trifolium repens]
Length=343

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 196/288 (68%), Gaps = 12/288 (4%)
 Frame = +2

Query  89   EATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYIN-SFNLGNYT  265
            + T+R   DD+     +R+E+W+  YG+VY N  E+ KR  +F +N++YI  S N GN  
Sbjct  24   QVTSRTLQDDS---IFERHEQWMTHYGKVYKNPQEREKRLRIFTENLKYIEASNNAGNKK  80

Query  266  -FTLGINQFADLTNDEF---RTTMACEMPSHSEKTP-FMYENVTVLPPTMNWLQRGAVTQ  430
             + LGINQFADLTN+EF   R      M S   +T  F YEN +V P T++W ++GAVT 
Sbjct  81   PYKLGINQFADLTNEEFIASRNKFKGHMCSSIIRTTTFKYENTSV-PSTVDWRKKGAVTP  139

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            +KNQGQCGCCWAFSA+ ATEGI +I T KL+SLSEQ+LVDC+T  V  GC GG M  AFK
Sbjct  140  VKNQGQCGCCWAFSAIAATEGIHKISTGKLVSLSEQELVDCDTNGVDQGCEGGLMDDAFK  199

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ +N GI+T A YPY    G C   +AS +AA I+G +++P N+E A+ +AVANQP+SV
Sbjct  200  FIIQNNGISTEAGYPYQGVDGTCKANEASTSAATITGYEDVPANNENALQKAVANQPISV  259

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            AIDA G  FQFYK G+F+  C T   H VTAVGYG+   G KYWL+KN
Sbjct  260  AIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGISNDGTKYWLVKN  307



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 183/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+ EW+  YGRVY +  E+ KR  +FK+NV YI +FN   N  + L +NQFADLTN+EF
Sbjct  37   ERHAEWMTRYGRVYKDPQEREKRLRIFKENVNYIEAFNNAANKPYKLAVNQFADLTNEEF  96

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      M S  +  T F YENVT +P  ++W Q+GAVT +K+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHMCSSITRTTSFKYENVTAVPSKVDWRQKGAVTPVKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI  +   KLISLSEQ+LVDC++  V  GC GG M  AFK+V +N+G++T ANYPY 
Sbjct  157  ATEGIHALTAGKLISLSEQELVDCDSKGVDQGCEGGLMDDAFKFVIQNQGLSTEANYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
                 CN   AS  AA I G +++P N+E A+ +AV NQPVSVAIDA G  FQFY+ G+F
Sbjct  217  GTDETCNANAASGHAATIKGYEDVPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G +YWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSDDGTEYWLVKN  307



>gb|EMT20796.1| Vignain [Aegilops tauschii]
Length=394

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 192/289 (66%), Gaps = 11/289 (4%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT  265
            C +    R  +++   + R+E W+V+Y RVY + TEK  RF VFK NV +I SFN  N  
Sbjct  73   CSSVLAARELNDDLSMVARHERWMVQYNRVYKDTTEKAHRFEVFKANVGFIESFNAENRK  132

Query  266  FTLGINQFADLTNDEFRTTMACE--MPSHSEKTP--FMYENVTV--LPPTMNWLQRGAVT  427
            F LGINQF DLTN+EF+ T A +   PS  E+ P  F YENV++  LP T++W  +GAVT
Sbjct  133  FYLGINQFTDLTNEEFKATKANKGYRPSL-ERVPTGFRYENVSLDALPETIDWRTKGAVT  191

Query  428  QIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAF  601
             IK+QGQCGCCWAFSAV ATEGI +++T KLISLSEQ+LVDC+      GC GG M  AF
Sbjct  192  PIKDQGQCGCCWAFSAVAATEGIVKLKTGKLISLSEQELVDCDVHGEDQGCEGGLMDDAF  251

Query  602  KYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVS  781
            K++ KN G+TT +NYPYT     C +   +  AA I   +++P N+E A+MQAVA+QPVS
Sbjct  252  KFIIKNGGLTTESNYPYTAADDKCKS--GTNDAATIKSYEDVPANNEGALMQAVASQPVS  309

Query  782  VAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            VA+D     FQFYKGG+ +  C T   H + A+GYG    G KYWLLKN
Sbjct  310  VAVDGGDMTFQFYKGGVMTGSCGTDLDHGIAAIGYGKTSDGTKYWLLKN  358



>ref|XP_007132888.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
 gb|ESW04882.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
Length=343

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 188/271 (69%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFN-LGNYTFTLGINQFADLTNDEF  313
            +R+E+W+  Y RVY +  EK KRF +FK+NV+YI +FN   N  + L INQFADLTN+EF
Sbjct  37   ERHEQWMTRYSRVYKDPEEKEKRFRIFKENVKYIEAFNNAANKAYNLAINQFADLTNEEF  96

Query  314  ---RTTMACEMPSH-SEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVG  481
               R      + S  +  T F YENV+ +P T++W Q+GAVT +K+QGQCGCCWAFSAV 
Sbjct  97   IAPRNRFKGHVCSSITRTTTFKYENVSAVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVA  156

Query  482  ATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYT  655
            ATEGI ++ T KLISLSEQ+LVDC+   V  GC GG M  AFK++ +N G+ T A+YPY 
Sbjct  157  ATEGIHKLSTGKLISLSEQELVDCDIKGVDQGCGGGLMDDAFKFIIQNHGLNTEASYPYK  216

Query  656  MRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLF  835
               G CN   A+  AA I+G +++P N+E A+ +AV NQPVSVAIDA G  FQFYK G+F
Sbjct  217  GVDGKCNANAAANHAATITGYEDVPANNEKALQKAVTNQPVSVAIDASGSDFQFYKSGVF  276

Query  836  STGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            +  C T   H VTAVGYGV   G+KYWL+KN
Sbjct  277  TGSCGTELDHGVTAVGYGVSDDGRKYWLVKN  307



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 188/277 (68%), Gaps = 7/277 (3%)
 Frame = +2

Query  116  DNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFA  292
            D     + R+E+W+  Y  +Y +  E+ KRF +FKDNVE+I SFN   N  + L IN FA
Sbjct  32   DAHTSMLDRHEQWMARYVPIYKDDEEREKRFQIFKDNVEFIESFNYASNQPYKLNINGFA  91

Query  293  DLTNDEF---RTTMACEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCW  463
            D +++EF   R      + + S KTPF YENVT +P +M+W ++GAVT IK+QG+CGCCW
Sbjct  92   DQSHEEFQASRNRYRTSLNTMSSKTPFRYENVTAIPSSMDWRKKGAVTPIKDQGECGCCW  151

Query  464  AFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTG  637
            AFSAV ATEG T++++ KL+SLSEQ+LVDC+T   + GC GG M  AFK+V +N+G+   
Sbjct  152  AFSAVAATEGTTKLKSGKLVSLSEQELVDCDTQGENQGCEGGLMDDAFKFVMRNKGLAAE  211

Query  638  ANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQF  817
            ANYPY    G+CN  K +  AA+I+G +++P N E A+++AVANQPVSVAIDA G  FQF
Sbjct  212  ANYPYRGIDGICNKNKVAYHAAKITGYEDVPAN-ELALLKAVANQPVSVAIDAGGYEFQF  270

Query  818  YKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            Y  G+ +  C T   H VT VGYG    G KYWL+KN
Sbjct  271  YSRGILTGDCGTHLNHGVTVVGYGTGADGTKYWLVKN  307



>gb|KFK31512.1| hypothetical protein AALP_AA6G122300 [Arabis alpina]
Length=342

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 193/295 (65%), Gaps = 14/295 (5%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYI---NSFNLG  256
            C +    R  D+E    KR+++W+ ++GRVYA+  EK  R+ VFK NVE I   N+    
Sbjct  12   CLSITLSRPLDDELIMQKRHDDWMAKHGRVYADVKEKDNRYIVFKRNVERIELSNNIFDS  71

Query  257  NYTFTLGINQFADLTNDEFRT---------TMACEMPSHSEKTPFMYENVT--VLPPTMN  403
              TF L +NQF+DLTNDEFR+          ++ +  S S+ T F Y+NV+  VLP +++
Sbjct  72   KRTFKLAVNQFSDLTNDEFRSMYTGYKGDYVLSSQSQSRSKTTSFRYQNVSSSVLPISVD  131

Query  404  WLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSHGCNGG  583
            W ++GAVT IKNQG CGCCWAFSAV A EG TQI+  KLISLSEQQLVDC+   +GC GG
Sbjct  132  WKKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLVDCDINDYGCRGG  191

Query  584  WMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAV  763
             M TAF+++    G+TT +NYPY    G CN+ K +  A  ISG +++P N E A+M+AV
Sbjct  192  LMDTAFEHIIATGGLTTESNYPYKGEDGTCNSKKTNPKATSISGYEDVPVNDEKALMKAV  251

Query  764  ANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A QPVSV I+  G  FQFY  G+F+  CTT   HAVTAVGYG    G KYW++KN
Sbjct  252  AYQPVSVGIEGGGFDFQFYSTGVFTGECTTSLDHAVTAVGYGESANGSKYWIIKN  306



>ref|XP_010054320.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76122.1| hypothetical protein EUGRSUZ_D00499 [Eucalyptus grandis]
Length=345

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 187/278 (67%), Gaps = 9/278 (3%)
 Frame = +2

Query  122  EEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFADL  298
            EE  +K++EEW+  +GRVY +  EK KR+ +FK+NV+ IN+FN G +  + L +N+FADL
Sbjct  32   EEHLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENVKRINAFNNGKDVGYKLAVNKFADL  91

Query  299  TNDEFRTTMA------CEMPSHSEKTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCC  460
            TN+EFR +          + S  EK PF Y N T +P  ++W  + AVT +K+QG CG C
Sbjct  92   TNEEFRASYTGYKRRPTRVLSSGEKKPFKYANFTAIPAALDWRTKKAVTPVKDQGNCGSC  151

Query  461  WAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGA  640
            WAFSAV A EGIT I+  KL+ LS Q+LVDC+    GC GG M +AF+++  N G+TT A
Sbjct  152  WAFSAVAAMEGITMIKKGKLVPLSVQELVDCDDNDDGCMGGLMDSAFEFIVSNGGLTTEA  211

Query  641  NYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFY  820
            NYPY    G CNTAK +  AA I+G Q++P N+E A++QAVANQPVSVAI+  G  FQFY
Sbjct  212  NYPYQGIDGTCNTAKTANQAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGYNFQFY  271

Query  821  KGGLFSTGCTTRTTHAVTAVGYGVM--PGGKKYWLLKN  928
              G+F+  C T   HAVTAVGYG     GG KYWL+KN
Sbjct  272  SSGVFTGSCGTDIDHAVTAVGYGKTSGSGGTKYWLMKN  309



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 200/309 (65%), Gaps = 16/309 (5%)
 Frame = +2

Query  38   HLIVFAAILALEMGAR--CEATARWRVDDNEEGTMK-RYEEWIVEYGRVYANQTEKMKRF  208
              +  A +++L   A+   EAT+R   D +   T+K R+EEW+  +G VY +  EK KRF
Sbjct  8    QFVYLALVISLGTWAKYNVEATSRSLQDAS---TLKIRHEEWMSRHGIVYKDADEKAKRF  64

Query  209  SVFKDNVEYINSFNLGNYT-FTLGINQFADLTNDEFRT------TMACEMPSHSEKTPFM  367
             +FK+NV  I +FN      + LGIN+FADLTN+EF T         C+    +  T F 
Sbjct  65   EIFKENVARIEAFNRAAIKPYKLGINKFADLTNEEFITKRNKFKAHVCD-SGRAISTSFK  123

Query  368  YENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLV  547
            YENVT +P  ++W ++GAVT +K+QGQCGCCWAFS V A EGIT++ T KL+SLSEQ+LV
Sbjct  124  YENVTSVPSALDWRKKGAVTPVKDQGQCGCCWAFSTVAAMEGITKLSTGKLLSLSEQELV  183

Query  548  DCETV--SHGCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQ  721
            DC+      GCNGG M  AFK++  N G+TT ANYPY    G CN  K +  AA+I+G +
Sbjct  184  DCDVKGEDQGCNGGLMDEAFKFIQHNGGLTTEANYPYEGVDGTCNAKKEATHAAKITGYE  243

Query  722  NIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPG  901
            ++P NSE  +++AV +QPVSVAIDA G  FQFY GG+F+  C T   H VTAVGYG    
Sbjct  244  DVPANSEKDLLKAVTHQPVSVAIDASGFEFQFYSGGVFTGACGTNLDHGVTAVGYGATKD  303

Query  902  GKKYWLLKN  928
            G KYWL+KN
Sbjct  304  GTKYWLVKN  312



>ref|XP_010518799.1| PREDICTED: senescence-specific cysteine protease SAG12 [Tarenaya 
hassleriana]
Length=348

 Score =   294 bits (752),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/284 (50%), Positives = 189/284 (67%), Gaps = 13/284 (5%)
 Frame = +2

Query  116  DNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNY---TFTLGINQ  286
            D E   +KR+EEW+ ++GRVY +  EK +R+++FK NVE I + N  N     F LG+NQ
Sbjct  29   DEELMMLKRHEEWMAKHGRVYLDAKEKERRYTIFKLNVERIETLNNDNVPERKFKLGVNQ  88

Query  287  FADLTNDEFRTTMACEMPSHS--------EKTPFMYENVTVL--PPTMNWLQRGAVTQIK  436
            FADLTNDEFR+        HS        + T FM++NV++   P +++W ++GAVT IK
Sbjct  89   FADLTNDEFRSMYTGYKGQHSTDVITDELKTTSFMHQNVSLRASPVSLDWRKKGAVTPIK  148

Query  437  NQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAK  616
            NQ  CGCCWAFS V A EG T+I+  KLISLSEQQLVDC+   +GC GG + TAF+++ +
Sbjct  149  NQASCGCCWAFSVVAAIEGATKIKKGKLISLSEQQLVDCDKYDYGCEGGLLDTAFEHIKE  208

Query  617  NRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDA  796
            + G+TT ANYPY    G CN+ KAS  AA I+G +++P N E A+M+AV NQPVSVAI+ 
Sbjct  209  SHGLTTEANYPYNGEDGTCNSKKASAKAATITGYEDVPANDEKALMKAVTNQPVSVAIEG  268

Query  797  MGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             G  FQFY  G+F+  C T   HAV  VGYG    G K+W++KN
Sbjct  269  GGFEFQFYSSGVFTGQCGTDLDHAVAVVGYGETVDGTKHWIIKN  312



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   293 bits (751),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 183/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  137  KRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYTFTLGINQFADLTNDEFR  316
            +R+E+W+V +GRVY    EK +RF +FK NVE+I SFN GN  + LG+NQFADLTN+EF+
Sbjct  37   ERHEQWMVRHGRVYKESAEKERRFQIFKANVEFIESFNAGNSKYKLGVNQFADLTNEEFK  96

Query  317  TTMACEMPSHSEKTP----FMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWAFSAVGA  484
                   PS  + +     F Y NVT +P  M+W  +GAVT IK+QG CG CWAF+ V A
Sbjct  97   AMRNGLKPSGVKTSKATSVFRYANVTAVPTRMDWRTKGAVTPIKDQGDCGSCWAFAVVAA  156

Query  485  TEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFKYVAKNRGITTGANYPYTM  658
             EGIT+++T KLISLSEQ+LV+C+      GCNGG    A +++ KN G+ T  NYPY  
Sbjct  157  MEGITKLKTHKLISLSEQELVECDVGGEDEGCNGGLPDAALEFIIKNGGLATETNYPYKG  216

Query  659  RKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKGGLFS  838
              G CNT K++  AA I G + +P NSEAA+++AVANQPVSV ID+ G  FQFY  G+F+
Sbjct  217  MDGTCNTKKSASHAASIKGYEQVPANSEAALLKAVANQPVSVNIDSGGSSFQFYASGVFT  276

Query  839  TG-CTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
             G C T   H+VTAVGYG    G KYWL+KN
Sbjct  277  GGSCETDLDHSVTAVGYGKAKDGTKYWLVKN  307



>gb|ADP02219.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
Length=419

 Score =   296 bits (758),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 191/288 (66%), Gaps = 7/288 (2%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT  265
            C +T     +  +   ++++E+W+ ++ RVY + TEK +RF  FK NV +I SFN GN+ 
Sbjct  18   CSSTVLSARELGDAAMVEKHEQWMAKFNRVYKDSTEKAQRFKAFKANVAFIESFNTGNHK  77

Query  266  FTLGINQFADLTNDEFRTTMACE-MPSHSEKTP--FMYENVTV--LPPTMNWLQRGAVTQ  430
            F LG+NQF DLTNDEFR T   + +  +  + P  F Y NV+   LP  ++W  +G VT 
Sbjct  78   FWLGVNQFTDLTNDEFRATKTNKGLKRNGARAPTRFKYNNVSTDALPAAVDWRTKGVVTP  137

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV ATEGI ++ T KL+SLSEQ+LVDC+   V  GC GG M  AFK
Sbjct  138  IKDQGQCGCCWAFSAVAATEGIVKLSTGKLVSLSEQELVDCDVHGVDQGCEGGEMDNAFK  197

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ KN G+TT ANYPYT + G C T+  S + A I G +++P N E+++M+AVANQPVSV
Sbjct  198  FIIKNGGLTTEANYPYTAQDGQCKTSTTSNSVATIKGYEDVPANDESSLMKAVANQPVSV  257

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A+D     FQ Y GG+ +  C T   H + A+GYG+   G K+WLLKN
Sbjct  258  AVDGGDVIFQHYSGGVMTGSCGTDLDHGIVAIGYGMTSDGTKFWLLKN  305



>ref|XP_003578808.1| PREDICTED: senescence-specific cysteine protease SAG39 [Brachypodium 
distachyon]
Length=339

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 192/288 (67%), Gaps = 9/288 (3%)
 Frame = +2

Query  86   CEATARWRVDDNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLGNYT  265
            C +    R  +++   + R+E W+++YGRVY +  EK ++F VFK N E+INSFN GN+ 
Sbjct  18   CGSVLAARELNDDLSMVARHENWMLQYGRVYKDAAEKAQKFEVFKANAEFINSFNAGNHK  77

Query  266  FTLGINQFADLTNDEFRTTMACE-MPSHSEKTP--FMYENVT--VLPPTMNWLQRGAVTQ  430
            F LGINQFAD+TN+EF+ T   +   S+  + P  FMYEN++   LP T++W  +GAVT 
Sbjct  78   FWLGINQFADITNEEFKATKTNKGFISNKVRVPTGFMYENMSFDALPATIDWRTKGAVTP  137

Query  431  IKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSHGCNGGWMQTAFK  604
            IK+QGQCGCCWAFSAV A EGI ++ T KL+SLSEQ+LVDC+      GC GG M  AFK
Sbjct  138  IKDQGQCGCCWAFSAVAAMEGIVKLSTGKLVSLSEQELVDCDVHGEDQGCEGGLMDDAFK  197

Query  605  YVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSV  784
            ++ KN G+T  +NYPY    G C +   S +AA I   +++P N+E A+M+AVANQPVSV
Sbjct  198  FIIKNGGLTQESNYPYDAADGKCKS--GSSSAATIKSYEDVPANNEGALMKAVANQPVSV  255

Query  785  AIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            A+D     FQFY GG+ +  C T   H + A+GYG    G K+W++KN
Sbjct  256  AVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGTTSDGTKFWIMKN  303



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 196/300 (65%), Gaps = 10/300 (3%)
 Frame = +2

Query  50   FAAILALEMGARCEATARWRVDDNEEGTMK-RYEEWIVEYGRVYANQTEKMKRFSVFKDN  226
            F  ++ + +GA     A  R    ++ +M+ R+EEW+  YGRVY +  EK KR+ +F++N
Sbjct  8    FCLVVMVTLGALASQLAAAR--SLQDASMRERHEEWMASYGRVYKDINEKQKRYKIFEEN  65

Query  227  VEYINSFNL-GNYTFTLGINQFADLTNDEFRTTMACEMPSH---SEKTPFMYENVTVLPP  394
            V  I S N   N  + L +NQFADLTN+EF+ +       H   ++ T F Y NV+ +P 
Sbjct  66   VALIESSNKDANKPYKLSVNQFADLTNEEFKASRN-RFKGHICSTKSTSFKYGNVSAVPS  124

Query  395  TMNWLQRGAVTQIKNQGQCGCCWAFSAVGATEGITQIRTKKLISLSEQQLVDCET--VSH  568
             M+W  +GAVT +K+QGQCGCCWAFSAV ATEGIT++ T +LISLSEQ+LVDC+T  V  
Sbjct  125  AMDWRMKGAVTPVKDQGQCGCCWAFSAVAATEGITKLTTGELISLSEQELVDCDTSGVDQ  184

Query  569  GCNGGWMQTAFKYVAKNRGITTGANYPYTMRKGMCNTAKASQAAARISGLQNIPPNSEAA  748
            GC GG M  AF ++  N G+ + ANYPY    G CNT K +  AA I+G +++P NSE A
Sbjct  185  GCEGGLMDNAFTFIQHNHGLASEANYPYKGVDGTCNTNKQAIHAAEINGFEDVPANSEEA  244

Query  749  IMQAVANQPVSVAIDAMGRPFQFYKGGLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            ++ AVA+QPVSVAIDA G  FQFY  G+F   C T+  H VTAVGYG    G KYWL+KN
Sbjct  245  LLNAVAHQPVSVAIDAGGSGFQFYSKGVFIGACGTQLDHGVTAVGYGTSDDGTKYWLVKN  304



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 188/274 (69%), Gaps = 3/274 (1%)
 Frame = +2

Query  116  DNEEGTMKRYEEWIVEYGRVYANQTEKMKRFSVFKDNVEYINSFNLG-NYTFTLGINQFA  292
            D +E  +KR+EEW+ ++GRVY +  EK KR+ +FK+N+E I +FN G +  + LG+N+FA
Sbjct  31   DEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKENIERIEAFNNGSDRGYKLGVNKFA  90

Query  293  DLTNDEFRTTMACEMPSHSE--KTPFMYENVTVLPPTMNWLQRGAVTQIKNQGQCGCCWA  466
            DLTN+EFR          S+   + F YEN++ +P +M+W   GAVT +K+QG CGCCWA
Sbjct  91   DLTNEEFRAMYHGYKRQSSKLMSSSFRYENLSDIPTSMDWRNDGAVTPVKDQGTCGCCWA  150

Query  467  FSAVGATEGITQIRTKKLISLSEQQLVDCETVSHGCNGGWMQTAFKYVAKNRGITTGANY  646
            FS V A EGI +++T  LISLSEQQLVDC   + GC GG M TAF+Y+ +N G+T+  NY
Sbjct  151  FSTVAAIEGIIKLQTGNLISLSEQQLVDCTAGNKGCQGGLMDTAFQYIIRNGGLTSEDNY  210

Query  647  PYTMRKGMCNTAKASQAAARISGLQNIPPNSEAAIMQAVANQPVSVAIDAMGRPFQFYKG  826
            PY    G C++ KA+   A+I+G +++P N+E A++QAVA QPVSVA++  G  FQFYK 
Sbjct  211  PYQGVDGTCSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFYKS  270

Query  827  GLFSTGCTTRTTHAVTAVGYGVMPGGKKYWLLKN  928
            G+F   C T   HAVTA+GYG    G  YWL+KN
Sbjct  271  GVFEGDCGTNLNHAVTAIGYGTDSDGTDYWLVKN  304



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1960666385524