BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6630_g1_i1 len=1336 path=[1:0-953 955:954-1335]

Length=1336
                                                                      Score     E

ref|XP_011071390.1|  PREDICTED: seed maturation protein PM36            224   1e-66   
gb|EYU45499.1|  hypothetical protein MIMGU_mgv1a024518mg                224   1e-66   
ref|XP_006360520.1|  PREDICTED: seed maturation protein PM36-like       219   4e-64   
ref|XP_009592106.1|  PREDICTED: seed maturation protein PM36            216   2e-63   
ref|XP_010312567.1|  PREDICTED: seed maturation protein PM36-like       213   2e-62   
ref|XP_008223329.1|  PREDICTED: seed maturation protein PM36            212   1e-61   
ref|XP_009784764.1|  PREDICTED: LOW QUALITY PROTEIN: seed maturat...    210   3e-61   
ref|XP_007035775.1|  Heme oxygenase-like, multi-helical                 209   1e-60   
ref|XP_003609761.1|  Seed maturation protein PM36                       207   3e-60   
emb|CDO98777.1|  unnamed protein product                                206   9e-60   
ref|XP_008340611.1|  PREDICTED: seed maturation protein PM36            207   9e-60   
ref|NP_001238329.1|  seed maturation protein PM36                       206   1e-59   
gb|KHG27139.1|  Seed maturation PM36                                    205   2e-59   
ref|XP_004508154.1|  PREDICTED: seed maturation protein PM36-like       205   4e-59   
ref|XP_003609760.1|  Seed maturation protein PM36                       207   7e-59   
ref|XP_010063635.1|  PREDICTED: seed maturation protein PM36            204   7e-59   
ref|XP_010649525.1|  PREDICTED: seed maturation protein PM36            203   9e-59   
ref|XP_009773390.1|  PREDICTED: seed maturation protein PM36-like       201   1e-57   
ref|XP_010671689.1|  PREDICTED: seed maturation protein PM36 homolog    200   2e-57   
ref|XP_007154370.1|  hypothetical protein PHAVU_003G113400g             198   2e-56   
ref|XP_004295090.1|  PREDICTED: seed maturation protein PM36-like       197   3e-56   
gb|KDP27900.1|  hypothetical protein JCGZ_18980                         194   2e-55   
ref|XP_010259307.1|  PREDICTED: seed maturation protein PM36 isof...    190   1e-53   
ref|XP_010259305.1|  PREDICTED: seed maturation protein PM36 isof...    190   1e-53   
ref|XP_008813385.1|  PREDICTED: seed maturation protein PM36            189   3e-53   
ref|XP_002311391.1|  seed maturation protein PM36                       189   3e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006419403.1|  hypothetical protein CICLE_v10005751mg             189   5e-53   
ref|XP_006840456.1|  hypothetical protein AMTR_s00045p00175590          190   5e-53   
gb|AFK43098.1|  unknown                                                 188   6e-53   
ref|XP_004148207.1|  PREDICTED: seed maturation protein PM36-like       189   7e-53   
gb|KDO71902.1|  hypothetical protein CISIN_1g0264162mg                  188   8e-53   
ref|XP_006488852.1|  PREDICTED: seed maturation protein PM36-like       188   1e-52   
ref|XP_011020153.1|  PREDICTED: seed maturation protein PM36            188   2e-52   
ref|XP_002519208.1|  Seed maturation protein PM36, putative             187   2e-52   Ricinus communis
emb|CBI22896.3|  unnamed protein product                                186   4e-52   
gb|ACU13338.1|  unknown                                                 185   5e-52   Glycine max [soybeans]
ref|XP_007222899.1|  hypothetical protein PRUPE_ppa009974mg             186   1e-51   
ref|XP_010910448.1|  PREDICTED: seed maturation protein PM36            182   9e-51   
ref|XP_008458358.1|  PREDICTED: seed maturation protein PM36 isof...    183   1e-50   
ref|XP_008458359.1|  PREDICTED: seed maturation protein PM36 isof...    182   1e-50   
ref|XP_010524576.1|  PREDICTED: seed maturation protein PM36 homolog    179   2e-49   
emb|CDX75896.1|  BnaC03g39790D                                          178   4e-49   
emb|CDX82386.1|  BnaA03g34350D                                          178   5e-49   
ref|XP_010312566.1|  PREDICTED: seed maturation protein PM36-like       176   2e-48   
gb|KFK39038.1|  hypothetical protein AALP_AA3G192800                    176   4e-48   
ref|XP_006406781.1|  hypothetical protein EUTSA_v10021446mg             175   9e-48   
ref|XP_002885182.1|  TENA/THI-4 family protein                          174   1e-47   
ref|XP_009135508.1|  PREDICTED: seed maturation protein PM36 homolog    174   1e-47   
ref|XP_010487569.1|  PREDICTED: seed maturation protein PM36 homolog    174   1e-47   
gb|AGM20687.1|  PM36                                                    172   7e-47   
ref|XP_010504855.1|  PREDICTED: seed maturation protein PM36 homolog    172   7e-47   
ref|XP_010097795.1|  hypothetical protein L484_004209                   172   2e-46   
ref|NP_188324.1|  heme oxygenase-like, multi-helical protein            171   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64658.1|  seed maturation protein, putative                       170   5e-46   
ref|XP_009382500.1|  PREDICTED: seed maturation protein PM36            169   9e-46   
pdb|2F2G|A  Chain A, X-Ray Structure Of Gene Product From Arabido...    169   1e-45   
ref|XP_010465728.1|  PREDICTED: seed maturation protein PM36 homolog    169   1e-45   
ref|XP_006298483.1|  hypothetical protein CARUB_v10014589mg             167   4e-45   
ref|XP_004984625.1|  PREDICTED: seed maturation protein PM36 homolog    164   9e-44   
ref|NP_001049891.1|  Os03g0306900                                       164   1e-43   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95534.1|  Seed maturation protein PM36, putative, expressed       163   1e-43   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04920.1|  predicted protein                                      159   1e-41   
ref|XP_003558083.1|  PREDICTED: seed maturation protein PM36 homolog    158   2e-41   
ref|NP_001131451.1|  uncharacterized protein LOC100192786               157   4e-41   Zea mays [maize]
gb|ACF79863.1|  unknown                                                 156   8e-41   Zea mays [maize]
ref|XP_002465376.1|  hypothetical protein SORBIDRAFT_01g037500          156   9e-41   Sorghum bicolor [broomcorn]
gb|EMT03123.1|  hypothetical protein F775_01815                         150   1e-37   
ref|XP_009592107.1|  PREDICTED: transcriptional activator DEMETER...    158   1e-37   
gb|KHN02900.1|  Seed maturation protein PM36                            145   4e-37   
ref|XP_008361811.1|  PREDICTED: protein ROS1-like                       137   1e-35   
ref|XP_009784770.1|  PREDICTED: transcriptional activator DEMETER...    151   2e-35   
ref|XP_007010232.1|  DNA N-glycosylase/DNA-(Apurinic or apyrimidi...    150   5e-35   
ref|XP_007010230.1|  DNA N-glycosylase/DNA-(Apurinic or apyrimidi...    150   5e-35   
ref|XP_007203210.1|  hypothetical protein PRUPE_ppa000207mg             149   5e-35   
ref|XP_008240460.1|  PREDICTED: transcriptional activator DEMETER...    149   8e-35   
ref|XP_008446781.1|  PREDICTED: transcriptional activator DEMETER...    148   2e-34   
gb|KDO71903.1|  hypothetical protein CISIN_1g0264162mg                  137   2e-34   
ref|XP_004150492.1|  PREDICTED: transcriptional activator DEMETER...    148   2e-34   
ref|XP_002316518.2|  hypothetical protein POPTR_0010s24060g             148   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004164145.1|  PREDICTED: transcriptional activator DEMETER...    148   2e-34   
gb|KGN52209.1|  hypothetical protein Csa_5G615310                       148   2e-34   
ref|XP_010049911.1|  PREDICTED: protein ROS1-like isoform X1            147   4e-34   
ref|XP_010049920.1|  PREDICTED: protein ROS1-like isoform X2            147   4e-34   
ref|XP_006419402.1|  hypothetical protein CICLE_v10005751mg             136   4e-34   
ref|XP_002311968.2|  hypothetical protein POPTR_0008s02610g             146   5e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002311047.2|  hypothetical protein POPTR_0008s02610g             146   6e-34   Populus trichocarpa [western balsam poplar]
ref|XP_006360485.1|  PREDICTED: transcriptional activator DEMETER...    147   6e-34   
ref|XP_011024268.1|  PREDICTED: transcriptional activator DEMETER       146   7e-34   
gb|KDO71905.1|  hypothetical protein CISIN_1g0264162mg                  135   7e-34   
gb|KDO71904.1|  hypothetical protein CISIN_1g0264162mg                  135   7e-34   
ref|XP_011032803.1|  PREDICTED: transcriptional activator DEMETER...    146   1e-33   
ref|XP_011032804.1|  PREDICTED: transcriptional activator DEMETER...    146   1e-33   
ref|XP_011010411.1|  PREDICTED: transcriptional activator DEMETER...    146   1e-33   
ref|XP_002277401.1|  PREDICTED: transcriptional activator DEMETER...    146   1e-33   Vitis vinifera
ref|XP_011010412.1|  PREDICTED: transcriptional activator DEMETER...    146   1e-33   
ref|XP_009612084.1|  PREDICTED: protein ROS1-like isoform X1            145   1e-33   
ref|XP_004250000.2|  PREDICTED: transcriptional activator DEMETER...    145   2e-33   
ref|XP_010312568.1|  PREDICTED: transcriptional activator DEMETER...    145   2e-33   
ref|XP_011018881.1|  PREDICTED: protein ROS1 isoform X2                 145   2e-33   
ref|XP_011018880.1|  PREDICTED: protein ROS1 isoform X1                 145   2e-33   
dbj|BAN14901.1|  repressor of silencing 1                               145   3e-33   
ref|XP_004161268.1|  PREDICTED: uncharacterized protein LOC101230418    144   3e-33   
emb|CBI30244.3|  unnamed protein product                                144   3e-33   
dbj|BAF52855.1|  repressor of silencing 1                               144   3e-33   Nicotiana tabacum [American tobacco]
ref|XP_004138006.1|  PREDICTED: uncharacterized protein LOC101222935    144   3e-33   
gb|KGN59055.1|  hypothetical protein Csa_3G748840                       144   3e-33   
ref|XP_009791223.1|  PREDICTED: protein ROS1-like isoform X1            144   3e-33   
ref|XP_008442796.1|  PREDICTED: protein ROS1-like                       144   4e-33   
ref|XP_006381317.1|  hypothetical protein POPTR_0006s11720g             144   4e-33   
gb|EEE54121.1|  hypothetical protein OsJ_00892                          144   6e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70183.1|  hypothetical protein OsI_00912                          144   6e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006606917.1|  PREDICTED: transcriptional activator DEMETER...    144   6e-33   
gb|KDO39948.1|  hypothetical protein CISIN_1g002245mg                   142   7e-33   
ref|XP_006660456.1|  PREDICTED: transcriptional activator DEMETER...    143   7e-33   
ref|XP_006647291.1|  PREDICTED: uncharacterized protein LOC102715...    142   1e-32   
ref|XP_006647290.1|  PREDICTED: uncharacterized protein LOC102715...    142   1e-32   
ref|XP_002871102.1|  hypothetical protein ARALYDRAFT_487239             142   1e-32   
ref|XP_004956377.1|  PREDICTED: uncharacterized protein LOC101769...    142   1e-32   
gb|AGU16984.1|  DEMETER                                                 142   2e-32   
gb|KDP42755.1|  hypothetical protein JCGZ_23695                         142   2e-32   
ref|XP_009371824.1|  PREDICTED: transcriptional activator DEMETER...    142   2e-32   
ref|XP_008381296.1|  PREDICTED: transcriptional activator DEMETER...    142   2e-32   
gb|EPS64413.1|  hypothetical protein M569_10368                         141   2e-32   
ref|XP_008386936.1|  PREDICTED: protein ROS1 isoform X2                 142   2e-32   
ref|XP_008386935.1|  PREDICTED: protein ROS1 isoform X1                 142   2e-32   
ref|XP_011077237.1|  PREDICTED: transcriptional activator DEMETER       142   2e-32   
emb|CAB85564.1|  putative protein                                       133   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386937.1|  PREDICTED: protein ROS1 isoform X3                 141   3e-32   
ref|XP_009361453.1|  PREDICTED: transcriptional activator DEMETER...    141   3e-32   
ref|XP_002267310.1|  PREDICTED: transcriptional activator DEMETER...    141   3e-32   Vitis vinifera
ref|XP_010658709.1|  PREDICTED: transcriptional activator DEMETER...    141   3e-32   
ref|XP_006492175.1|  PREDICTED: transcriptional activator DEMETER...    141   3e-32   
ref|XP_003577140.1|  PREDICTED: uncharacterized protein LOC100841571    141   3e-32   
ref|XP_002981477.1|  hypothetical protein SELMODRAFT_444885             132   4e-32   
ref|XP_006492173.1|  PREDICTED: transcriptional activator DEMETER...    141   4e-32   
ref|XP_006436684.1|  hypothetical protein CICLE_v10030474mg             141   4e-32   
ref|XP_009335110.1|  PREDICTED: transcriptional activator DEMETER...    141   4e-32   
ref|XP_009365322.1|  PREDICTED: protein ROS1-like isoform X1            141   4e-32   
ref|XP_009623013.1|  PREDICTED: LOW QUALITY PROTEIN: protein ROS1...    141   4e-32   
ref|XP_010452358.1|  PREDICTED: transcriptional activator DEMETER...    141   4e-32   
ref|XP_010452355.1|  PREDICTED: transcriptional activator DEMETER...    141   5e-32   
ref|XP_009379777.1|  PREDICTED: protein ROS1-like isoform X2            141   5e-32   
ref|XP_010490971.1|  PREDICTED: transcriptional activator DEMETER...    141   5e-32   
ref|XP_009365323.1|  PREDICTED: protein ROS1-like isoform X2            140   5e-32   
ref|XP_002970007.1|  hypothetical protein SELMODRAFT_92107              132   5e-32   
ref|XP_006286880.1|  hypothetical protein CARUB_v10000024mg             140   5e-32   
gb|AEF38423.1|  5-methylcytosine DNA glycosylase                        140   6e-32   
ref|XP_006649962.1|  PREDICTED: seed maturation protein PM36-like       131   7e-32   
ref|XP_009353005.1|  PREDICTED: protein ROS1-like                       140   7e-32   
emb|CAQ58412.1|  putative transcriptional activator DEMETER             140   8e-32   Hordeum vulgare [barley]
ref|XP_009421124.1|  PREDICTED: transcriptional activator DEMETER...    140   9e-32   
ref|XP_006589373.1|  PREDICTED: transcriptional activator DEMETER...    140   9e-32   
ref|XP_003625748.1|  DNA glycosylase                                    136   9e-32   
ref|XP_007145257.1|  hypothetical protein PHAVU_007G223600g             140   9e-32   
gb|AEF38425.1|  5-methylcytosine DNA glycosylase                        140   9e-32   
emb|CBI40219.3|  unnamed protein product                                139   1e-31   
gb|AEF38424.1|  5-methylcytosine DNA glycosylase                        140   1e-31   
ref|XP_004496178.1|  PREDICTED: transcriptional activator DEMETER...    139   1e-31   
gb|KHF99880.1|  Protein ROS1 -like protein                              139   1e-31   
ref|NP_196076.2|  transcriptional activator DEMETER                     139   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAM77215.1|  DEMETER protein                                         139   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423561.1|  PREDICTED: transcriptional activator DEMETER...    139   2e-31   
ref|NP_001078527.1|  transcriptional activator DEMETER                  139   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006594195.1|  PREDICTED: protein ROS1-like isoform X1            139   2e-31   
gb|KHN48192.1|  Protein ROS1                                            139   2e-31   
ref|XP_007027611.1|  Repressor of gene silencing 1 isoform 1            139   2e-31   
gb|KEH24122.1|  HhH-GPD base excision DNA repair family protein         139   2e-31   
ref|XP_011094546.1|  PREDICTED: protein ROS1-like                       139   2e-31   
ref|XP_010423565.1|  PREDICTED: transcriptional activator DEMETER...    139   2e-31   
ref|XP_006430302.1|  hypothetical protein CICLE_v10010892mg             138   3e-31   
ref|XP_006430303.1|  hypothetical protein CICLE_v10010892mg             138   3e-31   
ref|XP_006481896.1|  PREDICTED: protein ROS1-like isoform X4            138   3e-31   
gb|AEC12446.1|  repressor of gene silencing 1                           138   3e-31   
ref|XP_008462535.1|  PREDICTED: protein ROS1-like                       138   4e-31   
gb|KDP45028.1|  hypothetical protein JCGZ_01528                         138   4e-31   
dbj|BAC42629.1|  unknown protein                                        133   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391745.1|  PREDICTED: protein ROS1-like                       137   5e-31   
gb|AFW71475.1|  hypothetical protein ZEAMMB73_049283                    137   6e-31   
ref|XP_009360014.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    137   6e-31   
gb|EYU19798.1|  hypothetical protein MIMGU_mgv1a000238mg                137   6e-31   
ref|XP_004249459.2|  PREDICTED: LOW QUALITY PROTEIN: protein ROS1...    137   7e-31   
ref|XP_010325938.1|  PREDICTED: protein ROS1                            137   7e-31   
ref|NP_181190.3|  protein ROS1                                          137   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341256.1|  PREDICTED: protein ROS1-like                       137   1e-30   
ref|XP_008241295.1|  PREDICTED: protein ROS1                            137   1e-30   
ref|XP_006295565.1|  hypothetical protein CARUB_v10024677mg             136   1e-30   
ref|XP_006851720.1|  hypothetical protein AMTR_s00040p00215000          137   1e-30   
ref|XP_002453864.1|  hypothetical protein SORBIDRAFT_04g019820          136   1e-30   Sorghum bicolor [broomcorn]
ref|XP_007204687.1|  hypothetical protein PRUPE_ppa000163mg             136   1e-30   
emb|CDP15361.1|  unnamed protein product                                136   1e-30   
ref|XP_004507056.1|  PREDICTED: transcriptional activator DEMETER...    136   2e-30   
ref|XP_004143374.1|  PREDICTED: protein ROS1-like                       136   2e-30   
gb|EMS55066.1|  hypothetical protein TRIUR3_29340                       128   2e-30   
gb|KDO61025.1|  hypothetical protein CISIN_1g0021411mg                  130   2e-30   
gb|KHN18729.1|  Protein ROS1                                            135   2e-30   
ref|XP_006577053.1|  PREDICTED: protein ROS1-like isoform X3            135   2e-30   
ref|XP_003520681.1|  PREDICTED: protein ROS1-like isoform X1            135   2e-30   
ref|XP_006577052.1|  PREDICTED: protein ROS1-like isoform X2            135   2e-30   
ref|XP_004293493.1|  PREDICTED: protein ROS1-like                       135   3e-30   
ref|XP_002443104.1|  hypothetical protein SORBIDRAFT_08g008620          134   5e-30   Sorghum bicolor [broomcorn]
ref|XP_008677131.1|  PREDICTED: uncharacterized protein LOC100280...    134   5e-30   
gb|EPS65696.1|  hypothetical protein M569_09081                         132   5e-30   
ref|XP_010683880.1|  PREDICTED: protein ROS1                            134   5e-30   
ref|XP_003572540.1|  PREDICTED: uncharacterized protein LOC100823274    134   5e-30   
ref|XP_004303030.1|  PREDICTED: protein ROS1-like                       134   7e-30   
ref|XP_010516871.1|  PREDICTED: protein ROS1-like                       134   7e-30   
ref|XP_002881450.1|  hypothetical protein ARALYDRAFT_482629             134   8e-30   
ref|XP_004952516.1|  PREDICTED: uncharacterized protein LOC101760859    134   8e-30   
ref|XP_010543600.1|  PREDICTED: transcriptional activator DEMETER...    134   9e-30   
gb|KFK24901.1|  hypothetical protein AALP_AA8G039800                    134   9e-30   
gb|EYU35128.1|  hypothetical protein MIMGU_mgv1a000089mg                133   1e-29   
ref|XP_010509466.1|  PREDICTED: protein ROS1-like                       132   2e-29   
ref|XP_004292428.1|  PREDICTED: transcriptional activator DEMETER...    132   2e-29   
ref|XP_010558957.1|  PREDICTED: protein ROS1 isoform X1                 132   2e-29   
ref|XP_010558958.1|  PREDICTED: protein ROS1 isoform X2                 132   3e-29   
ref|XP_010032106.1|  PREDICTED: transcriptional activator DEMETER...    132   3e-29   
ref|XP_010505197.1|  PREDICTED: protein ROS1-like                       131   4e-29   
ref|XP_008804392.1|  PREDICTED: transcriptional activator DEMETER...    131   5e-29   
ref|XP_008804393.1|  PREDICTED: transcriptional activator DEMETER...    131   5e-29   
ref|XP_010909158.1|  PREDICTED: transcriptional activator DEMETER...    131   5e-29   
ref|XP_010909161.1|  PREDICTED: transcriptional activator DEMETER...    131   6e-29   
ref|XP_010909160.1|  PREDICTED: transcriptional activator DEMETER...    131   7e-29   
ref|XP_010273107.1|  PREDICTED: transcriptional activator DEMETER...    130   8e-29   
ref|XP_010912229.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    130   8e-29   
ref|XP_006410826.1|  hypothetical protein EUTSA_v10016139mg             130   1e-28   
ref|XP_010509464.1|  PREDICTED: protein ROS1-like isoform X2            129   2e-28   
ref|XP_010509463.1|  PREDICTED: protein ROS1-like isoform X1            129   2e-28   
ref|XP_009122582.1|  PREDICTED: transcriptional activator DEMETER       129   2e-28   
emb|CDX70214.1|  BnaA10g25630D                                          129   2e-28   
ref|XP_010506092.1|  PREDICTED: protein ROS1-like                       129   2e-28   
emb|CDY44867.1|  BnaC09g50670D                                          129   4e-28   
emb|CDO99852.1|  unnamed protein product                                128   4e-28   
ref|XP_010038860.1|  PREDICTED: LOW QUALITY PROTEIN: protein ROS1       119   5e-28   
ref|NP_001146555.1|  uncharacterized protein LOC100280151               124   7e-28   Zea mays [maize]
emb|CDY33158.1|  BnaC04g08810D                                          127   8e-28   
ref|XP_009143581.1|  PREDICTED: protein ROS1 isoform X2                 127   8e-28   
ref|XP_009143580.1|  PREDICTED: protein ROS1 isoform X1                 127   8e-28   
gb|KEH42104.1|  endonuclease/exonuclease/phosphatase family protein     127   1e-27   
emb|CDX75034.1|  BnaA05g07800D                                          127   1e-27   
ref|XP_002881449.1|  hypothetical protein ARALYDRAFT_902767             126   2e-27   
ref|XP_010940517.1|  PREDICTED: transcriptional activator DEMETER       126   2e-27   
ref|XP_008807513.1|  PREDICTED: uncharacterized protein LOC103719...    125   5e-27   
ref|XP_008807510.1|  PREDICTED: uncharacterized protein LOC103719...    125   5e-27   
ref|XP_010516874.1|  PREDICTED: protein ROS1-like isoform X2            125   5e-27   
ref|XP_008807511.1|  PREDICTED: uncharacterized protein LOC103719...    125   5e-27   
ref|XP_010516872.1|  PREDICTED: protein ROS1-like isoform X1            125   6e-27   
ref|XP_008793977.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    124   8e-27   
gb|KHN45686.1|  Protein ROS1                                            124   9e-27   
ref|XP_006588820.1|  PREDICTED: protein ROS1-like isoform X1            124   9e-27   
ref|XP_006588823.1|  PREDICTED: protein ROS1-like isoform X4            124   9e-27   
ref|XP_001772040.1|  predicted protein                                  117   1e-26   
ref|XP_008803804.1|  PREDICTED: protein ROS1-like                       122   1e-26   
gb|AAK32760.1|AF361592_1  AT3g16990/K14A17_11                           114   1e-26   
ref|XP_010278236.1|  PREDICTED: transcriptional activator DEMETER...    124   1e-26   
ref|XP_010278237.1|  PREDICTED: transcriptional activator DEMETER...    124   1e-26   
ref|XP_004497617.1|  PREDICTED: protein ROS1-like                       124   1e-26   
ref|XP_010552932.1|  PREDICTED: transcriptional activator DEMETER...    123   2e-26   
gb|EAY98235.1|  hypothetical protein OsI_20146                          120   2e-25   Oryza sativa Indica Group [Indian rice]
gb|EEE63901.1|  hypothetical protein OsJ_18726                          120   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910078.1|  PREDICTED: transcriptional activator DEMETER...    119   3e-25   
ref|XP_009394020.1|  PREDICTED: transcriptional activator DEMETER...    119   3e-25   
ref|XP_006655367.1|  PREDICTED: protein ROS1-like                       119   3e-25   
gb|AAU44279.1|  unknow protein                                          115   4e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79309.1|  hypothetical protein OsI_20143                          119   4e-25   Oryza sativa Indica Group [Indian rice]
gb|EEE63898.1|  hypothetical protein OsJ_18723                          119   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|ACL80319.1|  DNA glycosylase/lyase 701                               119   6e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007162853.1|  hypothetical protein PHAVU_001G186500g             118   8e-25   
ref|NP_001172234.1|  Os01g0217900                                       106   1e-24   
ref|NP_001055685.1|  Os05g0445900                                       115   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007219430.1|  hypothetical protein PRUPE_ppa020575mg             116   4e-24   
ref|XP_010231317.1|  PREDICTED: protein ROS1-like isoform X2            114   2e-23   
ref|XP_010237664.1|  PREDICTED: uncharacterized protein LOC100830...    114   2e-23   
ref|XP_010231316.1|  PREDICTED: uncharacterized protein LOC100844...    114   2e-23   
emb|CAN77395.1|  hypothetical protein VITISV_035357                     113   3e-23   Vitis vinifera
ref|XP_010543902.1|  PREDICTED: transcriptional activator DEMETER...    112   4e-23   
ref|XP_010110180.1|  Transcriptional activator DEMETER                  112   5e-23   
gb|AFW78144.1|  hypothetical protein ZEAMMB73_419140                    109   5e-22   
ref|XP_008649684.1|  PREDICTED: uncharacterized protein LOC103630409    109   5e-22   
ref|XP_006836725.1|  hypothetical protein AMTR_s00088p00128580          108   7e-22   
gb|EMT33140.1|  Transcriptional activator DEMETER                       108   1e-21   
ref|XP_002270885.2|  PREDICTED: protein ROS1-like                       108   1e-21   
ref|XP_008232098.1|  PREDICTED: transcriptional activator DEMETER...    108   1e-21   
ref|XP_002441186.1|  hypothetical protein SORBIDRAFT_09g021920          107   2e-21   
ref|XP_009793912.1|  PREDICTED: protein ROS1-like                       107   2e-21   
emb|CBI17085.3|  unnamed protein product                                106   4e-21   
gb|AFW81765.1|  hypothetical protein ZEAMMB73_889003                  97.8    4e-21   
gb|KHN37846.1|  Transcriptional activator DEMETER                       106   6e-21   
gb|KDO71906.1|  hypothetical protein CISIN_1g0264162mg                97.1    9e-21   
gb|KHN00920.1|  Transcriptional activator DEMETER                       105   1e-20   
ref|XP_010096854.1|  Protein ROS1                                       105   1e-20   
ref|XP_001754515.1|  predicted protein                                  101   5e-20   
gb|KDO71908.1|  hypothetical protein CISIN_1g0264161mg                95.5    5e-20   
gb|AEC12445.1|  DNA N-glycosylase/DNA-(apurinic or apyrimidinic s...    103   5e-20   
ref|XP_009628467.1|  PREDICTED: protein ROS1-like                       102   6e-20   
ref|XP_008458622.1|  PREDICTED: protein ROS1-like                       102   9e-20   
ref|XP_010090875.1|  Transcriptional activator DEMETER                  100   3e-19   
ref|XP_009763771.1|  PREDICTED: transcriptional activator DEMETER...    100   5e-19   
ref|XP_009600026.1|  PREDICTED: uncharacterized protein LOC104095575    100   6e-19   
ref|XP_011101791.1|  PREDICTED: protein ROS1-like                     99.4    6e-19   
ref|XP_004172250.1|  PREDICTED: transcriptional activator DEMETER...  99.8    7e-19   
ref|XP_002986643.1|  hypothetical protein SELMODRAFT_450920           98.6    7e-19   
ref|XP_002990766.1|  hypothetical protein SELMODRAFT_161136           98.2    8e-19   
ref|XP_007010229.1|  DNA N-glycosylase/DNA-(Apurinic or apyrimidi...  99.8    8e-19   
ref|XP_004145830.1|  PREDICTED: uncharacterized protein LOC101216331  99.4    9e-19   
gb|KGN46920.1|  hypothetical protein Csa_6G150590                     99.4    9e-19   
ref|XP_006296214.1|  hypothetical protein CARUB_v10025379mg           99.4    1e-18   
ref|XP_006355382.1|  PREDICTED: transcriptional activator DEMETER...  99.0    1e-18   
ref|XP_002527453.1|  conserved hypothetical protein                   96.7    8e-18   
ref|XP_006407616.1|  hypothetical protein EUTSA_v10019961mg           95.9    1e-17   
ref|XP_010486583.1|  PREDICTED: DEMETER-like protein 2                89.0    2e-17   
gb|AAL69364.1|AF462201_1  unknown                                     85.5    4e-17   
ref|XP_010034190.1|  PREDICTED: transcriptional activator DEMETER...  94.4    4e-17   
ref|XP_007015945.1|  HhH-GPD base excision DNA repair family prot...  91.3    9e-17   
ref|XP_010677271.1|  PREDICTED: DEMETER-like protein 3 isoform X2     93.2    9e-17   
ref|XP_010677270.1|  PREDICTED: DEMETER-like protein 3 isoform X1     93.2    9e-17   
ref|XP_006342913.1|  PREDICTED: transcriptional activator DEMETER...  92.0    2e-16   
ref|XP_010318462.1|  PREDICTED: protein ROS1-like isoform X1          92.0    2e-16   
ref|XP_010318464.1|  PREDICTED: protein ROS1-like isoform X2          91.7    3e-16   
ref|XP_009777502.1|  PREDICTED: LOW QUALITY PROTEIN: protein ROS1...  91.7    3e-16   
gb|EYU28211.1|  hypothetical protein MIMGU_mgv1a0203722mg             84.7    2e-15   
ref|XP_007010228.1|  DNA N-glycosylase/DNA-(Apurinic or apyrimidi...  88.6    3e-15   
gb|KFK38383.1|  hypothetical protein AALP_AA3G106500                  88.2    4e-15   
gb|EYU40748.1|  hypothetical protein MIMGU_mgv1a021118mg              87.8    4e-15   
ref|NP_187612.5|  putative DNA glycosylase                            87.8    5e-15   
ref|XP_008338745.1|  PREDICTED: protein ROS1-like                     80.9    6e-15   
gb|EEC73208.1|  hypothetical protein OsI_07289                        87.4    7e-15   
ref|XP_006385376.1|  hypothetical protein POPTR_0003s03210g           87.0    7e-15   
ref|NP_001046891.1|  Os02g0496500                                     87.0    8e-15   
ref|XP_010463521.1|  PREDICTED: DEMETER-like protein 2                85.1    9e-15   
gb|EEE57031.1|  hypothetical protein OsJ_06813                        87.0    9e-15   
ref|XP_006399026.1|  hypothetical protein EUTSA_v10012472mg           87.0    1e-14   
ref|XP_006648646.1|  PREDICTED: transcriptional activator DEMETER...  86.7    1e-14   
gb|KDO45499.1|  hypothetical protein CISIN_1g000414mg                 86.7    1e-14   
ref|XP_006424337.1|  hypothetical protein CICLE_v10027676mg           86.7    1e-14   
ref|XP_006471412.1|  PREDICTED: protein ROS1-like isoform X2          86.7    1e-14   
ref|XP_006471411.1|  PREDICTED: protein ROS1-like isoform X1          86.7    1e-14   
gb|KDO45498.1|  hypothetical protein CISIN_1g000414mg                 86.3    2e-14   
ref|XP_002528585.1|  Protein ROS1, putative                           86.3    2e-14   
gb|KDO45497.1|  hypothetical protein CISIN_1g000414mg                 86.3    2e-14   
gb|KFK22330.1|  hypothetical protein AALP_AAs71059U000100             84.7    2e-14   
ref|XP_008361537.1|  PREDICTED: protein ROS1-like                     83.6    3e-14   
gb|AAS79601.1|  putative endonuclease III protein                     85.5    3e-14   
ref|XP_002884770.1|  hypothetical protein ARALYDRAFT_341139           85.1    4e-14   
ref|XP_004487732.1|  PREDICTED: transcriptional activator DEMETER...  84.7    4e-14   
ref|XP_004304875.1|  PREDICTED: protein ROS1-like                     84.3    7e-14   
gb|KFM27252.1|  Seed maturation protein PM36                          80.1    8e-14   
ref|XP_001785533.1|  predicted protein                                84.3    8e-14   
gb|EMT28671.1|  Transcriptional activator DEMETER                     84.0    1e-13   
ref|XP_002530889.1|  conserved hypothetical protein                   83.6    1e-13   
ref|XP_006296678.1|  hypothetical protein CARUB_v10012825mg           82.4    3e-13   
ref|XP_011088841.1|  PREDICTED: protein ROS1-like isoform X1          82.4    3e-13   
ref|XP_011088845.1|  PREDICTED: protein ROS1-like isoform X3          82.4    3e-13   
ref|XP_011088844.1|  PREDICTED: protein ROS1-like isoform X2          82.4    3e-13   
ref|XP_011018710.1|  PREDICTED: transcriptional activator DEMETER...  82.0    3e-13   
ref|XP_009337406.1|  PREDICTED: transcriptional activator DEMETER...  82.0    4e-13   
ref|XP_006594197.1|  PREDICTED: protein ROS1-like isoform X3          82.0    4e-13   
ref|XP_009337409.1|  PREDICTED: transcriptional activator DEMETER...  81.6    4e-13   
gb|AEJ87849.1|  hypothetical protein                                  80.5    7e-13   
ref|XP_008228211.1|  PREDICTED: uncharacterized protein LOC103327644  81.3    7e-13   
ref|XP_009337408.1|  PREDICTED: transcriptional activator DEMETER...  80.9    8e-13   
gb|KDO39949.1|  hypothetical protein CISIN_1g002245mg                 80.9    9e-13   
ref|XP_009337407.1|  PREDICTED: transcriptional activator DEMETER...  80.9    9e-13   
ref|XP_008385446.1|  PREDICTED: protein ROS1-like isoform X1          80.9    1e-12   
ref|XP_008385448.1|  PREDICTED: protein ROS1-like isoform X2          80.5    1e-12   
ref|XP_008385449.1|  PREDICTED: protein ROS1-like isoform X3          80.5    1e-12   
ref|WP_012946346.1|  TenA family transcriptional regulator            76.6    1e-12   
ref|XP_006481897.1|  PREDICTED: protein ROS1-like isoform X5          80.5    1e-12   
ref|XP_006481893.1|  PREDICTED: protein ROS1-like isoform X1          80.5    1e-12   
ref|XP_004301529.1|  PREDICTED: protein ROS1-like                     80.1    2e-12   
ref|XP_007027612.1|  Repressor of gene silencing 1 isoform 2          80.1    2e-12   
ref|XP_010521693.1|  PREDICTED: protein ROS1 isoform X2               79.3    3e-12   
ref|XP_010521692.1|  PREDICTED: protein ROS1 isoform X1               79.3    3e-12   
ref|XP_010521696.1|  PREDICTED: protein ROS1 isoform X3               79.3    3e-12   
gb|KHG11823.1|  Protein ROS1 -like protein                            72.0    4e-12   
ref|XP_001777735.1|  predicted protein                                78.6    6e-12   
gb|KFK22331.1|  hypothetical protein AALP_AAs71059U000100             76.3    7e-12   
ref|XP_006588822.1|  PREDICTED: protein ROS1-like isoform X3          77.8    8e-12   
ref|WP_016867345.1|  hypothetical protein                             73.9    1e-11   
ref|XP_004170551.1|  PREDICTED: LOW QUALITY PROTEIN: protein ROS1...  77.4    1e-11   
ref|XP_009617660.1|  PREDICTED: seed maturation protein PM36-like     72.4    1e-11   
ref|XP_002869177.1|  hypothetical protein ARALYDRAFT_353424           77.0    1e-11   
ref|WP_015150223.1|  transcription activator                          73.2    2e-11   
ref|WP_015153665.1|  TenA family transcriptional activator            72.8    3e-11   
ref|XP_006286148.1|  hypothetical protein CARUB_v10007707mg           76.3    3e-11   
ref|WP_016872792.1|  hypothetical protein                             72.0    4e-11   
ref|XP_008343012.1|  PREDICTED: transcriptional activator DEMETER     70.9    4e-11   
ref|WP_038680587.1|  TenA family transcriptional regulator            71.6    6e-11   
ref|NP_195132.3|  DEMETER-like protein 3                              74.7    7e-11   
ref|XP_010432469.1|  PREDICTED: DEMETER-like protein 3                74.7    7e-11   
gb|AAU44533.1|  hypothetical protein AT4G34060                        74.7    7e-11   
ref|WP_026720680.1|  TenA family transcriptional regulator            71.2    8e-11   
ref|XP_010235446.1|  PREDICTED: protein ROS1-like isoform X1          74.7    8e-11   
ref|XP_003572541.1|  PREDICTED: protein ROS1-like isoform X2          74.3    8e-11   
ref|XP_003617825.1|  DNA glycosylase                                  73.9    1e-10   
ref|XP_009117384.1|  PREDICTED: DEMETER-like protein 3                73.9    1e-10   
gb|AID60163.1|  demetre-like protein 3                                73.9    1e-10   
gb|AID60120.1|  demeter-like protein 3                                73.9    1e-10   
ref|WP_039724955.1|  TenA family transcriptional regulator            70.5    2e-10   
ref|WP_014374019.1|  TenA family transcriptional regulator            70.1    2e-10   
ref|XP_010447148.1|  PREDICTED: DEMETER-like protein 3 isoform X1     73.6    2e-10   
ref|XP_010447150.1|  PREDICTED: DEMETER-like protein 3 isoform X2     73.6    2e-10   
emb|CDX75395.1|  BnaA01g03070D                                        73.6    2e-10   
ref|XP_010447151.1|  PREDICTED: DEMETER-like protein 3 isoform X3     73.6    2e-10   
ref|XP_002448569.1|  hypothetical protein SORBIDRAFT_06g029335        73.2    2e-10   
ref|WP_016858688.1|  hypothetical protein                             70.1    2e-10   
gb|KHN19189.1|  Transcriptional activator DEMETER                     68.2    2e-10   
ref|WP_017300320.1|  hypothetical protein                             70.1    2e-10   
emb|CDX69023.1|  BnaC01g04300D                                        73.2    2e-10   
gb|AET00784.2|  HhH-GPD base excision DNA repair family protein       72.8    3e-10   
ref|WP_017311748.1|  hypothetical protein                             69.7    3e-10   
ref|XP_010437672.1|  PREDICTED: DEMETER-like protein 3                72.0    4e-10   
gb|AFW71481.1|  hypothetical protein ZEAMMB73_696780                  72.0    4e-10   
ref|NP_001168988.1|  uncharacterized protein LOC100382817             72.0    4e-10   
ref|XP_008644022.1|  PREDICTED: uncharacterized protein LOC100382...  72.0    6e-10   
ref|XP_007153405.1|  hypothetical protein PHAVU_003G032300g           71.2    8e-10   
ref|WP_035986530.1|  TenA family transcriptional regulator            67.8    1e-09   
gb|EMS60774.1|  Protein ROS1                                          70.9    1e-09   
ref|WP_006516435.1|  putative transcription activator                 67.4    1e-09   
ref|XP_004952519.1|  PREDICTED: transcriptional activator DEMETER...  70.5    1e-09   
ref|WP_036008799.1|  TenA family transcriptional regulator            67.4    2e-09   
ref|WP_015141891.1|  transcription activator                          67.4    2e-09   
dbj|BAL57145.1|  TenA family transcription regulator                  67.4    2e-09   
ref|XP_006412280.1|  hypothetical protein EUTSA_v10026936mg           70.1    2e-09   
ref|WP_036400780.1|  TenA family transcriptional regulator            66.2    3e-09   
gb|EMS51956.1|  Protein ROS1                                          67.0    4e-09   
emb|CDO09150.1|  TenA family transcription regulator                  65.9    4e-09   
ref|XP_010667367.1|  PREDICTED: protein ROS1-like                     68.9    4e-09   
ref|WP_017659161.1|  hypothetical protein                             65.5    6e-09   
ref|WP_024450959.1|  TenA family transcriptional regulator            65.1    7e-09   
ref|WP_026256449.1|  TenA family transcriptional regulator            64.7    1e-08   
gb|EMS46483.1|  Protein ROS1                                          68.2    1e-08   
ref|WP_039715959.1|  TenA family transcriptional regulator            64.7    1e-08   
ref|XP_010237665.1|  PREDICTED: uncharacterized protein LOC100830...  67.8    1e-08   
emb|CCG47990.1|  conserved hypothetical protein, expressed            67.0    2e-08   
ref|WP_017303622.1|  hypothetical protein                             63.9    2e-08   
ref|WP_029370957.1|  TenA family transcriptional regulator            63.5    3e-08   
ref|WP_023076030.1|  transcription activator                          63.5    3e-08   
gb|AFK39253.1|  unknown                                               61.6    3e-08   
ref|WP_015954913.1|  TenA family transcriptional regulator            63.2    4e-08   
ref|WP_027846674.1|  TenA family transcriptional regulator            62.8    4e-08   
gb|EMT20310.1|  Protein ROS1                                          65.9    5e-08   
ref|WP_011610175.1|  TenA family transcriptional regulator            62.4    6e-08   
ref|WP_014210158.1|  TenA family transcriptional regulator            62.0    8e-08   
ref|WP_024446316.1|  TenA family transcriptional regulator            61.6    9e-08   
ref|WP_029112729.1|  TenA family transcriptional regulator            61.6    9e-08   
ref|WP_019970525.1|  hypothetical protein                             60.8    2e-07   
ref|WP_015304859.1|  putative transcription activator                 60.8    2e-07   
ref|WP_008310777.1|  putative transcription activator                 60.8    2e-07   
gb|EYU36975.1|  hypothetical protein MIMGU_mgv1a000323mg              63.2    4e-07   
ref|WP_006242801.1|  TenA family transcriptional regulator            59.7    4e-07   
gb|KDP33380.1|  hypothetical protein JCGZ_12929                       62.8    4e-07   
ref|XP_003621000.1|  DNA glycosylase                                  57.4    5e-07   
gb|ABN09778.1|  hypothetical protein MtrDRAFT_AC152184g6v2            57.0    8e-07   
gb|KFM27251.1|  Seed maturation protein PM36-like protein             58.5    1e-06   
ref|WP_006456597.1|  TenA family transcriptional regulator            57.8    2e-06   
ref|NP_001173891.1|  Os04g0358000                                     60.5    2e-06   
gb|KDO71910.1|  hypothetical protein CISIN_1g0264161mg                55.1    3e-06   
ref|NP_001118934.1|  uncharacterized protein                          55.5    4e-06   
ref|XP_005649215.1|  hypothetical protein COCSUDRAFT_62092            58.9    7e-06   
gb|KDO39950.1|  hypothetical protein CISIN_1g002245mg                 58.5    8e-06   
ref|WP_011565715.1|  TenA family transcriptional regulator            55.8    1e-05   
ref|WP_030137345.1|  MULTISPECIES: TenA family transcriptional re...  54.7    2e-05   
ref|WP_019513687.1|  MULTISPECIES: hypothetical protein               54.3    3e-05   
ref|WP_011778774.1|  TenA family transcriptional regulator            54.3    3e-05   
ref|WP_036369888.1|  TenA family transcriptional regulator            53.9    3e-05   
gb|AAF04422.1|AC010927_15  hypothetical protein                       56.2    5e-05   
ref|WP_018466614.1|  hypothetical protein                             53.1    7e-05   
ref|WP_036335945.1|  TenA family transcriptional regulator            53.1    8e-05   
ref|XP_008649682.1|  PREDICTED: protein ROS1                          51.6    8e-05   
ref|WP_015224826.1|  TenA family transcriptional activator            52.8    1e-04   
gb|EYU35129.1|  hypothetical protein MIMGU_mgv1a000089mg              54.7    1e-04   
ref|WP_008655596.1|  TenA family transcription regulator              52.8    2e-04   
ref|WP_008670932.1|  TenA family transcription regulator              52.4    2e-04   
ref|XP_007673218.1|  hypothetical protein BAUCODRAFT_340725           53.1    3e-04   
gb|KCW51500.1|  hypothetical protein EUGRSUZ_J01016                   52.8    6e-04   
ref|XP_004986419.1|  PREDICTED: DEMETER-like protein 2-like           52.0    0.001   



>ref|XP_011071390.1| PREDICTED: seed maturation protein PM36 [Sesamum indicum]
Length=223

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 148/218 (68%), Gaps = 5/218 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E      MT+TW++KH LL + ATR+PF   IRD ++  +SF  WLGQ+Y +  RAFVP 
Sbjct  2     EGSDRAAMTDTWLKKHRLLYVGATRHPFVLGIRDGSVDFTSFKRWLGQDY-IFVRAFVPL  60

Query  1060  LSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             +++LL KA  ES+D   V VI  GI   ND+I+W ++EA K  ++L+SVVP+Q  +DY +
Sbjct  61    VASLLLKAWKESDDNSDVDVILGGIAALNDEIAWFKKEASKWGIALNSVVPHQTNLDYCR  120

Query  886   LLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LESLT  D +YT A++  WA + VY  +FAHCL +GS+TPEE+KE C++WG D  G YC
Sbjct  121   FLESLTSPDVEYTLAITAFWAIEAVYQESFAHCLEDGSKTPEELKETCQRWGNDGFGQYC  180

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              +LQ  A+  LEKA  DV+ KAEV +L  LE  V+FWN
Sbjct  181   RALQNIANRRLEKASDDVLAKAEVNILRILEHEVEFWN  218



>gb|EYU45499.1| hypothetical protein MIMGU_mgv1a024518mg [Erythranthe guttata]
Length=225

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 147/218 (67%), Gaps = 5/218 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E      +T TW++KH LL + ATR+PF   IRD ++ +SSF  WLGQ+Y +  RAFVPF
Sbjct  2     EGTDRTAITVTWLKKHRLLYVGATRHPFILGIRDGSVDISSFKRWLGQDY-IFVRAFVPF  60

Query  1060  LSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             ++++L KA  ES+D   V VI  GI   ND++SW + EA K  V+LDSVVP Q  ++Y +
Sbjct  61    VASVLLKAWKESDDKADVDVILGGISALNDEVSWFKNEASKWAVALDSVVPQQANLNYCR  120

Query  886   LLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LE L   + DYT A++  WA +TVY  +FAHCL EGSRTP+E+KE C++WG D  G YC
Sbjct  121   FLERLMSPEVDYTQAITAFWAIETVYRESFAHCLEEGSRTPQELKETCQRWGNDGFGQYC  180

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              SLQ  A+  LEKA  +V+ KAEV LLE LE  V+FWN
Sbjct  181   SSLQSIANRRLEKASDEVVAKAEVNLLEILEHEVEFWN  218



>ref|XP_006360520.1| PREDICTED: seed maturation protein PM36-like [Solanum tuberosum]
Length=279

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 148/215 (69%), Gaps = 5/215 (2%)
 Frame = -1

Query  1231  KGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLST  1052
             K M M + W+ +H+ L  +ATR+PFT +IRD ++ LS+F  WLGQ+Y +  RAFVPF+++
Sbjct  60    KKMLMIQKWLNQHNELYTSATRHPFTLSIRDGSVDLSAFKRWLGQDY-IFVRAFVPFVAS  118

Query  1051  LLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLE  878
             LL KA  ES+D   ++VI  G+   ND++SW +REA K  VSL S VP +  ++Y + LE
Sbjct  119   LLLKAWKESDDDSDIEVILGGMAALNDEVSWFKREASKWSVSLSSTVPQKTNLEYCRFLE  178

Query  877   SLTDD--DYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSL  704
             SL     DYT A++  WA + VY  ++AHCLS+GS+TPEE+KE C++WG D  G YC +L
Sbjct  179   SLMSPEVDYTVAVTAFWAIEAVYQESYAHCLSDGSKTPEELKETCQRWGNDGFGQYCHTL  238

Query  703   QRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             Q  A+  LEK+P D+I KAE T++  LE  V+FWN
Sbjct  239   QNIANRRLEKSPEDIISKAEATVMRVLEYEVEFWN  273



>ref|XP_009592106.1| PREDICTED: seed maturation protein PM36 [Nicotiana tomentosiformis]
Length=225

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 150/217 (69%), Gaps = 5/217 (2%)
 Frame = -1

Query  1237  SKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFL  1058
             +KK + M + W+ +H  L  AATR+PFT +IRD ++ LS+F  WLGQ+Y +  RAFVPF+
Sbjct  4     AKKDIPMIKKWLNQHHQLYTAATRHPFTLSIRDGSVQLSAFKRWLGQDY-IFVRAFVPFV  62

Query  1057  STLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKL  884
             ++LL KA  ES+D   ++VI  G+   ND+ISW +REA K +VSL ++VP +  ++Y + 
Sbjct  63    ASLLLKAWKESDDDSDIEVILGGVAALNDEISWFKREASKWNVSLSNIVPQKANLEYCRF  122

Query  883   LESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCL  710
             LESL  DD  YT A++  WA + VY  ++AHCL++GS+T EE+KE C++WG D  G YC 
Sbjct  123   LESLMSDDVEYTIAVTAFWAIEAVYQESYAHCLADGSKTSEELKETCQRWGNDDFGRYCG  182

Query  709   SLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             SLQ  A+  LEK+P D+I KAE  ++  LE  V+FW+
Sbjct  183   SLQDIANRRLEKSPEDIISKAEAIVIRVLEYEVEFWS  219



>ref|XP_010312567.1| PREDICTED: seed maturation protein PM36-like [Solanum lycopersicum]
Length=225

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 148/218 (68%), Gaps = 5/218 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E  K + M + W+ +H+ L  +ATR+PFT +IRD ++ LS+F  WLGQ+Y +  RAFVPF
Sbjct  3     ECNKEISMIQKWLNQHNELYTSATRHPFTLSIRDGSVDLSAFKRWLGQDY-IFVRAFVPF  61

Query  1060  LSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             +++LL KA  ES++   ++VI  GI   ND++SW + EA K  VSL + VP +  ++Y +
Sbjct  62    VASLLLKAWKESDEDSDIEVILGGIAALNDEVSWFKSEASKWSVSLSTTVPQKTNLEYCR  121

Query  886   LLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LESL   + DYT A++  WA + VY  ++AHCLS+GS+TPEE+KE C++WG D  G YC
Sbjct  122   FLESLMSPEVDYTVAVTAFWAIEAVYQESYAHCLSDGSKTPEELKETCQRWGNDGFGQYC  181

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              +LQ  A+  LEK+  D+I KAE T++  LE  V+FWN
Sbjct  182   HTLQNIANRRLEKSSEDIISKAEATVIRVLEYEVEFWN  219



>ref|XP_008223329.1| PREDICTED: seed maturation protein PM36 [Prunus mume]
Length=247

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 150/233 (64%), Gaps = 19/233 (8%)
 Frame = -1

Query  1243  AESKKGM---GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRA  1073
              +SK G+   GMT+TW++KH L+ I ATR+PF  +IRD T+ LS+F  WLGQ+Y    RA
Sbjct  3     GKSKPGVPYGGMTDTWVKKHRLIYIGATRHPFILSIRDGTVDLSAFKRWLGQDYIFV-RA  61

Query  1072  FVPFLSTLLQKARH---ESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPT  902
             FVPF++++L +A     ES+  ++V+ +G+G  ND+I+W ++EA K  V L  V P +PT
Sbjct  62    FVPFVASVLIRAYKKGDESSGDMEVMLSGLGSLNDEIAWFKQEASKWGVDLSQVAPEKPT  121

Query  901   IDYSKLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDA  728
               Y + LE L   + DYT A++  WA +TVY  +FAHCL EGS+TP E++EAC++WG D 
Sbjct  122   QHYCRFLEELMRPEVDYTVAMAAFWAIETVYQESFAHCLEEGSKTPPELQEACQRWGNDG  181

Query  727   QGDYCLSLQRTADGALEKAP----------RDVIVKAEVTLLEFLEISVQFWN  599
              G YC SL+  AD  LEKA            DV+ KAEVT L  LE  V FWN
Sbjct  182   FGHYCSSLRNIADRQLEKAASGSEPLVKVSEDVVSKAEVTFLRVLEYEVDFWN  234



>ref|XP_009784764.1| PREDICTED: LOW QUALITY PROTEIN: seed maturation protein PM36-like 
[Nicotiana sylvestris]
Length=225

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 149/217 (69%), Gaps = 5/217 (2%)
 Frame = -1

Query  1237  SKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFL  1058
             +K+ + M E W+ +H  L  AATR+PFT +IRD ++ LS+F  WLGQ+Y +  RAFVPF+
Sbjct  4     AKQEIPMIEKWLNQHRELYTAATRHPFTLSIRDGSVDLSAFKRWLGQDY-IFVRAFVPFV  62

Query  1057  STLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKL  884
             ++LL K+  ES+D   ++VI  G+   ND+ISW +REA K +V L S+VP +  ++Y + 
Sbjct  63    ASLLLKSWKESDDDSDIEVILGGVAALNDEISWFKREASKWNVLLSSIVPQKANLEYCRF  122

Query  883   LESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCL  710
             LESL   + +YT A++  WA + VY  ++AHCL++GS+T EE+K+ C++WG D  G YC 
Sbjct  123   LESLMSPEVEYTVAVTAFWAIEVVYQESYAHCLADGSKTSEELKKTCQRWGNDDFGQYCR  182

Query  709   SLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             SLQ  A+  LEK+P D+I KAE  ++  LE  V+FWN
Sbjct  183   SLQDIANRRLEKSPEDIISKAEAIVIXLLEYEVEFWN  219



>ref|XP_007035775.1| Heme oxygenase-like, multi-helical [Theobroma cacao]
 gb|EOY06701.1| Heme oxygenase-like, multi-helical [Theobroma cacao]
Length=230

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 147/225 (65%), Gaps = 13/225 (6%)
 Frame = -1

Query  1240  ESKKG--MG---MTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKR  1076
             E K G  MG   MTETW+RKH LL + ATR+PF ++IRD  + LSSF  WLGQ+Y    R
Sbjct  2     EGKTGEEMGKTLMTETWLRKHRLLYVGATRHPFIRSIRDGNIDLSSFKTWLGQDYVFV-R  60

Query  1075  AFVPFLSTLLQKA----RHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQ  908
             AFVPF++++L KA     + SND V+V+  G+   ND+I+W ++EA K  V L  +VP +
Sbjct  61    AFVPFVASVLSKACKGSDNSSND-VEVMLGGMAALNDEIAWFKKEASKWGVQLSDIVPQK  119

Query  907   PTIDYSKLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGG  734
                +Y + LESL   + +YT A++  WA + VY  +FAHCL +G++ P E++E C++WG 
Sbjct  120   ANQNYCRFLESLMSPEVEYTVAITAFWAIEAVYQESFAHCLEDGTKPPPELQETCQRWGN  179

Query  733   DAQGDYCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             +  G YC +L++ AD  LEKA  DVI KAEVT L  LE  V FWN
Sbjct  180   EGFGQYCNALRKIADRQLEKASDDVITKAEVTFLRVLEHEVDFWN  224



>ref|XP_003609761.1| Seed maturation protein PM36 [Medicago truncatula]
 gb|AES91958.1| seed maturation PM36-like protein [Medicago truncatula]
Length=231

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 142/219 (65%), Gaps = 6/219 (3%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
             AE KK +G+TETW+RKH  +  AATR+PF  +IRD T+   SF  WL Q+Y L  RAFVP
Sbjct  9     AEEKK-IGLTETWLRKHRPIYDAATRHPFILSIRDGTVQSHSFKTWLAQDY-LFVRAFVP  66

Query  1063  FLSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
             F++++L KA  ES+D   V+VI  G+    D+I W +REA K  +S   VVP +  I+Y 
Sbjct  67    FVASVLIKACKESDDSDDVEVILGGMASLKDEILWFKREANKWGISFSDVVPQKANINYC  126

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
             +LLESL   D DYT  L+  WA + VY  +FAHC+ EGS+TP E+KE C +WG +  G Y
Sbjct  127   RLLESLMSPDVDYTVTLTAFWAIEVVYQESFAHCIEEGSKTPPELKETCERWGNEGFGQY  186

Query  715   CLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             C SLQ+  +  L+KA  D + KAEV LL  +E  V FWN
Sbjct  187   CQSLQKILNQRLQKASDDELKKAEVMLLSIIEHEVHFWN  225



>emb|CDO98777.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   206 bits (525),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 144/218 (66%), Gaps = 5/218 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E+K  + + ETW+RKH LL + ATR+PF  +IRD ++ +SSF  WL Q+Y +  RAFVPF
Sbjct  9     EAKSKVSVIETWLRKHRLLYVGATRHPFIHSIRDGSVDVSSFKRWLEQDY-IFVRAFVPF  67

Query  1060  LSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             ++T+L KA  ES D   + VI +G+   ND+ +W  +EA K  VSL +V P +  +DY +
Sbjct  68    VATVLLKAWKESFDATDLDVILSGMASLNDEFAWFNKEASKWGVSLTNVAPQKANLDYCR  127

Query  886   LLESL--TDDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LESL  ++ +YT A++  WA +TVY  +FAHCL +GS TPEE+++ C++WG D  G YC
Sbjct  128   FLESLMSSEVEYTVAITAFWAIETVYQDSFAHCLEDGSNTPEELRDTCQRWGNDGFGRYC  187

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              +LQ  A+  LEKA  DV  + E  +L+ LE  V FWN
Sbjct  188   HALQSIAEHHLEKASDDVRKRTEAAVLDVLEYEVAFWN  225



>ref|XP_008340611.1| PREDICTED: seed maturation protein PM36 [Malus domestica]
Length=242

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 142/231 (61%), Gaps = 18/231 (8%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
              + K G+ MT TW+RKH L+   ATR+PF  +IRD T+ LS+F  WLGQ+Y +  RAFVP
Sbjct  3     GKPKAGVSMTSTWLRKHRLIYAGATRHPFILSIRDGTVDLSAFKRWLGQDY-IFVRAFVP  61

Query  1063  FLSTLLQKA----RHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTID  896
             F++++L KA     HES DI +++ +G+   ND+I W ++EA K  V L  VVP + T  
Sbjct  62    FVASVLIKAWKNSDHESGDI-ELVLSGVAALNDEIEWFKQEASKWGVELSGVVPEKTTXX  120

Query  895   YSKLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQG  722
             Y + LE L   D DY  A++  WA + VY  +FAHCL EGS+TP E++EAC++WG D  G
Sbjct  121   YCRFLEDLMSPDVDYAVAMTAFWAIEAVYQESFAHCLEEGSKTPPELQEACQRWGNDGFG  180

Query  721   DYCLSLQRTAD----------GALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              YC SL+  AD          G L K   D++ KAEV     LE  VQFWN
Sbjct  181   QYCSSLRNIADRELEKXASDGGPLVKVSEDMVTKAEVEFQRVLEYEVQFWN  231



>ref|NP_001238329.1| seed maturation protein PM36 [Glycine max]
 sp|Q9SWB6.1|PM36_SOYBN RecName: Full=Seed maturation protein PM36 [Glycine max]
 gb|AAD51624.1| seed maturation protein PM36 [Glycine max]
 gb|KHN03303.1| Seed maturation protein PM36 [Glycine soja]
Length=229

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 144/219 (66%), Gaps = 6/219 (3%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
             AE KK +GMTETW++KH LL   ATR+P   +IRD T+  +SF  WL Q+Y L  RAFVP
Sbjct  7     AEQKK-IGMTETWLKKHRLLYNGATRHPLIISIRDGTINTASFKTWLAQDY-LFVRAFVP  64

Query  1063  FLSTLLQKARHESN--DIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
             F++++L KA  ES+    ++VI  G+    D+ISW + EA K  +SL  VVP Q   +Y 
Sbjct  65    FVASVLIKAWKESDCSGDMEVILGGMASLEDEISWFKTEANKWGISLSDVVPQQANKNYC  124

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
              LLESL   D +YT A++  WA +TVY  +FAHC+ EGS+TP E+KE C +WG +A G Y
Sbjct  125   GLLESLMSPDAEYTVAITAFWAIETVYQESFAHCIEEGSKTPPELKETCVRWGNEAFGKY  184

Query  715   CLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             C SLQ  A+  L+KA  + + KAEV LL  LE  V+FWN
Sbjct  185   CQSLQNIANRCLQKASDEELKKAEVMLLSVLEHEVEFWN  223



>gb|KHG27139.1| Seed maturation PM36 [Gossypium arboreum]
Length=223

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 141/212 (67%), Gaps = 6/212 (3%)
 Frame = -1

Query  1219  MTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQK  1040
             +TETW+RKH  L   ATR+PF ++IRD  + +S+F  WLGQ+Y +  RAFVPF++++L K
Sbjct  7     VTETWLRKHRHLYDGATRHPFIRSIRDGNIDISAFKTWLGQDY-IFVRAFVPFVASVLTK  65

Query  1039  ARHESND---IVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             A   S+D    V+VI  G+   +D+ISW ++EA K  V L S+VP +   +Y + LESL 
Sbjct  66    AYKGSDDGNGDVEVILGGVAALHDEISWFKKEAFKWGVQLSSIVPQKANQEYCRFLESLI  125

Query  868   --DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               + +YT A    WA +T+Y  +FAHCL + S+TP E+KE C++WG ++ G+YC SL+  
Sbjct  126   GPEVEYTVAAVAFWAIETIYQESFAHCLEDDSKTPPELKETCKRWGNESFGEYCNSLRNI  185

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              DG LEKA  DVI KAE TLL  LE  V FWN
Sbjct  186   VDGQLEKASDDVITKAEATLLRVLEHEVDFWN  217



>ref|XP_004508154.1| PREDICTED: seed maturation protein PM36-like [Cicer arietinum]
Length=230

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 142/217 (65%), Gaps = 6/217 (3%)
 Frame = -1

Query  1234  KKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLS  1055
             +K +GMTETW+RKH L+  AATR+PF  +IRDAT+   SF  WL Q+Y L  RAFVPF++
Sbjct  9     EKKIGMTETWLRKHRLIYDAATRHPFILSIRDATVQSHSFKTWLAQDY-LFVRAFVPFVA  67

Query  1054  TLLQKARHESND---IVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKL  884
             ++L KA  ES+D    V++I  G+    D+ISW +REA KL +SL  V+P +P   Y  L
Sbjct  68    SVLIKACKESSDESDDVEIILGGMASLQDEISWFKREANKLDISLSEVLPQKPNQKYCGL  127

Query  883   LESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCL  710
             LESL  +D  Y+ A++  WA + VY  +FAHC+ EGS+TP ++KE C +WG    G YC 
Sbjct  128   LESLMSEDVEYSVAITAFWAIEAVYQESFAHCIEEGSKTPPQLKETCARWGNQDFGHYCQ  187

Query  709   SLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             S++   +  L+ A  D + KAE+  L  L++ V+FWN
Sbjct  188   SIKNIVNRRLQMASDDELKKAELVFLSVLQLEVEFWN  224



>ref|XP_003609760.1| Seed maturation protein PM36 [Medicago truncatula]
Length=318

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 142/219 (65%), Gaps = 6/219 (3%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
             AE KK +G+TETW+RKH  +  AATR+PF  +IRD T+   SF  WL Q+Y L  RAFVP
Sbjct  9     AEEKK-IGLTETWLRKHRPIYDAATRHPFILSIRDGTVQSHSFKTWLAQDY-LFVRAFVP  66

Query  1063  FLSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
             F++++L KA  ES+D   V+VI  G+    D+I W +REA K  +S   VVP +  I+Y 
Sbjct  67    FVASVLIKACKESDDSDDVEVILGGMASLKDEILWFKREANKWGISFSDVVPQKANINYC  126

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
             +LLESL   D DYT  L+  WA + VY  +FAHC+ EGS+TP E+KE C +WG +  G Y
Sbjct  127   RLLESLMSPDVDYTVTLTAFWAIEVVYQESFAHCIEEGSKTPPELKETCERWGNEGFGQY  186

Query  715   CLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             C SLQ+  +  L+KA  D + KAEV LL  +E  V FWN
Sbjct  187   CQSLQKILNQRLQKASDDELKKAEVMLLSIIEHEVHFWN  225



>ref|XP_010063635.1| PREDICTED: seed maturation protein PM36 [Eucalyptus grandis]
 gb|KCW87951.1| hypothetical protein EUGRSUZ_A00353 [Eucalyptus grandis]
Length=227

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 141/212 (67%), Gaps = 5/212 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G T TW++KH L+  AATR+PF  +IRD ++ L+SF  WLGQ+Y L  RAFVPF+S++L 
Sbjct  13    GTTATWLKKHRLVYTAATRHPFILSIRDGSIDLNSFKRWLGQDY-LFVRAFVPFVSSVLL  71

Query  1042  KARHES--NDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             KA HES  N  ++V  +G+   ND+I W ++E+ K  V L S+ P +   DY + LESL 
Sbjct  72    KACHESDNNSDMEVFLSGLAALNDEIKWFKKESSKWGVVLSSIAPQKVNEDYCRFLESLM  131

Query  868   --DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               + +YT A++ LWA + VY ++FAHCL E SRTP E+ E C++WG +  G YC SLQ+ 
Sbjct  132   GPNVEYTVAITALWAIELVYQQSFAHCLEEASRTPLELAETCQRWGNEGFGQYCRSLQKI  191

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             AD  L +A  + + KAE TLL  LE  V+FWN
Sbjct  192   ADRRLLRATSEELKKAEATLLRVLEHEVEFWN  223



>ref|XP_010649525.1| PREDICTED: seed maturation protein PM36 [Vitis vinifera]
Length=220

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 142/214 (66%), Gaps = 5/214 (2%)
 Frame = -1

Query  1228  GMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTL  1049
             G G+ ETW++KH +L I AT++P   +IRD T+  SSF  WLGQ+Y +  RAFVPF +++
Sbjct  4     GGGVIETWLKKHRMLYIRATKHPLILSIRDGTIDFSSFKRWLGQDY-IFVRAFVPFSASV  62

Query  1048  LQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLES  875
             L KA  ES++   ++VI  G+   ND+I+W ++EA K  + L ++VP +   +Y + LES
Sbjct  63    LLKACKESDNSSDMEVILGGMASLNDEIAWFKKEASKWGLELSTIVPQKVNQEYCRFLES  122

Query  874   LTDD--DYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQ  701
             L     +YT A++  WA + VY   FA CL +GS+TP E+KE C++WG D  G YC SLQ
Sbjct  123   LMSPQVEYTVAITAFWAIEAVYQEGFALCLQDGSKTPPELKETCQRWGNDGFGQYCRSLQ  182

Query  700   RTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
               A+  L KAP DV+ +AEV LL+ LE+ V+FWN
Sbjct  183   NIANRHLGKAPPDVVARAEVALLQVLELEVEFWN  216



>ref|XP_009773390.1| PREDICTED: seed maturation protein PM36-like [Nicotiana sylvestris]
Length=234

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 141/221 (64%), Gaps = 5/221 (2%)
 Frame = -1

Query  1246  VAESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFV  1067
             + + K+ +   E W+RKH L   AAT++PF  +I D ++  SSF  WLG+EY   K A  
Sbjct  10    IEKPKEKLTQIEKWLRKHKLQYTAATKHPFINSIHDGSIDFSSFKIWLGREYVFVKTALA  69

Query  1066  PFLSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVV-PYQPTID  896
             PF +++L KA  ES D   V+VI  G+   ND+ISWL+ EA   HVSL SVV  ++P +D
Sbjct  70    PFAASVLLKAWKESVDSSDVEVILAGLPYLNDEISWLKEEAPMWHVSLTSVVVDHKPILD  129

Query  895   YSKLLESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQG  722
             Y +  E LT  D  YT A++ILWA ++VYH  FAHCL E + TPEEMK AC++WG ++  
Sbjct  130   YFRFFERLTSSDVKYTEAVTILWAVESVYHYGFAHCLEEDNTTPEEMKAACKRWGNESFK  189

Query  721   DYCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              +C SL+  A+  LE+A  + + KAEV  LEFLE  V FW+
Sbjct  190   QHCQSLETVANNKLEQASEEEVSKAEVLFLEFLENVVGFWS  230



>ref|XP_010671689.1| PREDICTED: seed maturation protein PM36 homolog [Beta vulgaris 
subsp. vulgaris]
Length=226

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 144/220 (65%), Gaps = 5/220 (2%)
 Frame = -1

Query  1246  VAESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFV  1067
             +A+ ++ M   E W+ KHD +  AATR+PF  +IRD ++ LSSF  WLGQ+Y   +R F+
Sbjct  1     MADEREKMNFIENWVIKHDSVYTAATRHPFIHSIRDGSVDLSSFKTWLGQDYLFVRR-FI  59

Query  1066  PFLSTLLQKARHESND--IVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDY  893
             PF++++L KA  ES+D   ++VI  G+   ND+I W ++EA K  V L++V P +   +Y
Sbjct  60    PFVASVLLKACKESDDESDMEVILAGLASLNDEIHWFKKEAAKWDVQLNAVTPQKTNQNY  119

Query  892   SKLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGD  719
              + LESL   + +YT A++  WA + VY  +FAHCL + ++TP E++ AC +WG +  G 
Sbjct  120   CRFLESLMQPEVNYTVAITAFWAIEAVYQLSFAHCLEDDAKTPPELRAACERWGNEGFGK  179

Query  718   YCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             YC SL+  A+  L KA  DV VKAEVTLL+  E+ V+FWN
Sbjct  180   YCDSLRMIANRCLSKALEDVQVKAEVTLLQVFELEVEFWN  219



>ref|XP_007154370.1| hypothetical protein PHAVU_003G113400g [Phaseolus vulgaris]
 gb|ESW26364.1| hypothetical protein PHAVU_003G113400g [Phaseolus vulgaris]
Length=229

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 139/216 (64%), Gaps = 5/216 (2%)
 Frame = -1

Query  1234  KKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLS  1055
             +K +G+ ETW+RKH LL   ATR+P   +IRD ++ ++SF +WL Q+Y L  RAFVPF++
Sbjct  9     EKKIGVIETWLRKHRLLFQGATRHPLILSIRDGSINIASFKSWLAQDY-LFVRAFVPFVA  67

Query  1054  TLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLL  881
             ++L KA  ES++   ++VI  G+    D++SW +RE+ K  +SL  VVP Q    Y  LL
Sbjct  68    SVLIKAWKESDESGDMEVILGGVASLEDELSWFKRESSKWGISLSEVVPQQANKKYCGLL  127

Query  880   ESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLS  707
             ESL   D +YT A++  W  + VY  +FAHC+ EGS+TP+E+KE C +WG +A   YC S
Sbjct  128   ESLMSPDVEYTVAITAFWVIEAVYQESFAHCIGEGSKTPQELKETCERWGNEAFAKYCQS  187

Query  706   LQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             LQ  A+  L+ A  + + KAEV  L  LE  V FWN
Sbjct  188   LQNIANRRLQNASDEELKKAEVMFLNVLEYEVDFWN  223



>ref|XP_004295090.1| PREDICTED: seed maturation protein PM36-like [Fragaria vesca 
subsp. vesca]
Length=228

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 135/213 (63%), Gaps = 6/213 (3%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             GM +TW++KH L+   ATR+PF  AIRD T+ +S+F  WL Q+Y +  RAFVPF ++L+ 
Sbjct  9     GMIDTWLKKHTLIHTGATRHPFILAIRDGTVDISAFKRWLSQDY-IFVRAFVPFAASLVV  67

Query  1042  KARHESNDI---VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESL  872
             K    S+D    V+VI +G+   ND+I W +++A K  V L  V P QP +DY + LE+L
Sbjct  68    KGWKNSDDSDGDVEVILSGLAALNDEIDWFKKQASKWGVDLSVVAPQQPALDYCRFLENL  127

Query  871   TDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQR  698
             T  +  YT A++  WA + VY  +FAHCL EG +T  E++E C +WG D  G YC +++ 
Sbjct  128   TSPEVEYTVAMTAYWAIEAVYQESFAHCLEEGFKTRPELQEVCHRWGNDGFGSYCSAIRS  187

Query  697   TADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              AD  L KA  D + KAEVT L  LE  V+FWN
Sbjct  188   IADRLLLKASDDEVRKAEVTFLRVLEYEVEFWN  220



>gb|KDP27900.1| hypothetical protein JCGZ_18980 [Jatropha curcas]
Length=225

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 139/215 (65%), Gaps = 5/215 (2%)
 Frame = -1

Query  1231  KGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLST  1052
             K  G+ E W+ KH LL   ATR+PF  +IRD ++ +SSF  WL Q+Y +  R FVPF+++
Sbjct  6     KEEGIIERWVMKHLLLYTGATRHPFILSIRDGSVDISSFKRWLEQDY-IFVREFVPFVAS  64

Query  1051  LLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLE  878
             +L KA   S D   ++VI  G+   ND+I+W + EA K  VSL + V ++    Y + LE
Sbjct  65    VLLKACKNSEDGNDMEVILGGLASLNDEIAWFKSEASKWDVSLSNTVVHKANQTYCRFLE  124

Query  877   SLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSL  704
             SL   + +Y  AL+ LWA +  Y  +FAHCL +GS+TP E++E CR+WG +  G+YC SL
Sbjct  125   SLMSREVEYALALTALWAIEATYQESFAHCLEDGSKTPPELQETCRRWGNEGFGEYCRSL  184

Query  703   QRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             ++ A+  LEKA  DVI KAEVTLL  LE  V+FWN
Sbjct  185   KKIANRYLEKASADVIAKAEVTLLHVLEHEVEFWN  219



>ref|XP_010259307.1| PREDICTED: seed maturation protein PM36 isoform X2 [Nelumbo nucifera]
Length=230

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 133/221 (60%), Gaps = 5/221 (2%)
 Frame = -1

Query  1249  NVAESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAF  1070
             N AE   G GM   W+ KH  +   ATR+PF  + RD T+ LSSF  WL Q+Y +  R F
Sbjct  6     NAAEGASGGGMIMAWLNKHHTIYSRATRHPFILSTRDGTVDLSSFKRWLEQDY-IFVREF  64

Query  1069  VPFLSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTID  896
             VPF++++L KA  ES D   ++VI +G+   ND+ISW ++EA K  V L    P +   D
Sbjct  65    VPFVASVLLKAWRESEDGSDMEVILSGLASLNDEISWFKKEALKWGVLLSGTSPQKANQD  124

Query  895   YSKLLESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQG  722
             Y + LESL   +  YT A++  WA + VY  +F+ CL  GSRTP E+ E C++WG D+ G
Sbjct  125   YCRFLESLMSSEISYTVAITAFWAIEAVYQESFSLCLKHGSRTPAELMETCQRWGSDSFG  184

Query  721   DYCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              YC SLQ  A+  LEKAP  ++ KAE   L  LE  ++FWN
Sbjct  185   QYCHSLQMIANKRLEKAPDYILGKAEEAFLSVLEHEIEFWN  225



>ref|XP_010259305.1| PREDICTED: seed maturation protein PM36 isoform X1 [Nelumbo nucifera]
 ref|XP_010259306.1| PREDICTED: seed maturation protein PM36 isoform X1 [Nelumbo nucifera]
Length=231

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 133/221 (60%), Gaps = 5/221 (2%)
 Frame = -1

Query  1249  NVAESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAF  1070
             N AE   G GM   W+ KH  +   ATR+PF  + RD T+ LSSF  WL Q+Y +  R F
Sbjct  6     NAAEGASGGGMIMAWLNKHHTIYSRATRHPFILSTRDGTVDLSSFKRWLEQDY-IFVREF  64

Query  1069  VPFLSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTID  896
             VPF++++L KA  ES D   ++VI +G+   ND+ISW ++EA K  V L    P +   D
Sbjct  65    VPFVASVLLKAWRESEDGSDMEVILSGLASLNDEISWFKKEALKWGVLLSGTSPQKANQD  124

Query  895   YSKLLESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQG  722
             Y + LESL   +  YT A++  WA + VY  +F+ CL  GSRTP E+ E C++WG D+ G
Sbjct  125   YCRFLESLMSSEISYTVAITAFWAIEAVYQESFSLCLKHGSRTPAELMETCQRWGSDSFG  184

Query  721   DYCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              YC SLQ  A+  LEKAP  ++ KAE   L  LE  ++FWN
Sbjct  185   QYCHSLQMIANKRLEKAPDYILGKAEEAFLSVLEHEIEFWN  225



>ref|XP_008813385.1| PREDICTED: seed maturation protein PM36 [Phoenix dactylifera]
Length=227

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 134/214 (63%), Gaps = 5/214 (2%)
 Frame = -1

Query  1228  GMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTL  1049
             G G T TWM ++ L+   ATR+PF  +IRD T+ +S+F  WLGQ+Y    R FVPFL+++
Sbjct  9     GRGKTATWMEQYRLMYDRATRHPFVLSIRDGTVDISAFKRWLGQDYRFV-REFVPFLASI  67

Query  1048  LQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLES  875
             L KA  +S+D   V+VI  G+   ND++SW ++EA K  V L  + P +  ++Y +LL++
Sbjct  68    LLKAWKDSDDNSDVEVILGGMASLNDELSWFKKEASKWDVHLGGIAPQKANLEYCRLLQN  127

Query  874   LT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQ  701
             L   + DY   ++  WA +TVY  +F+ CL  GS+TP E+ E C++WG     DYC SLQ
Sbjct  128   LMLPEIDYAVVITAFWAIETVYQDSFSLCLESGSKTPAELMETCKRWGNAHFKDYCRSLQ  187

Query  700   RTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             + AD  LE AP DV+ KAE   L  LE  + FWN
Sbjct  188   KIADRCLENAPGDVVRKAEEAFLSVLEHEIGFWN  221



>ref|XP_002311391.1| seed maturation protein PM36 [Populus trichocarpa]
 gb|EEE88758.1| seed maturation protein PM36 [Populus trichocarpa]
Length=225

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 140/212 (66%), Gaps = 5/212 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ + W++KH +L   ATR+PF  +IRD T+  SSF  WLGQ+Y +  R FVPF +++L 
Sbjct  8     GVIDRWVKKHLVLYTGATRHPFILSIRDGTIDFSSFKRWLGQDY-IFVREFVPFAASVLL  66

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             KA   S+D   ++VI +G+   +D+ISW ++EA K  V L  VV ++   +Y + LESL 
Sbjct  67    KASKNSDDNSDMEVILSGLASLSDEISWFKQEAAKWDVPLSDVVVHKSNQNYCRFLESLM  126

Query  868   DD--DYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
                 +Y+   + LWA +TVY  +F+HCL +GS+TP E+ EAC++WG +  G++C SL++ 
Sbjct  127   LPAVEYSVVFTALWAIETVYQESFSHCLEDGSKTPPELLEACKRWGSEGFGEFCRSLKKI  186

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              +  LEKAP + + KAEVT L  LE+ ++FW+
Sbjct  187   VNRCLEKAPDEELKKAEVTFLHVLELEIEFWD  218



>ref|XP_006419403.1| hypothetical protein CICLE_v10005751mg [Citrus clementina]
 gb|ESR32643.1| hypothetical protein CICLE_v10005751mg [Citrus clementina]
Length=239

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 141/228 (62%), Gaps = 16/228 (7%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E+ KG G+ +TW+RKH L+ I ATR+PF  AIRD T+  SSF  WLGQ+Y +  R FV F
Sbjct  8     EAGKG-GVIDTWLRKHRLIYIGATRHPFILAIRDGTVNYSSFKKWLGQDY-IFVREFVAF  65

Query  1060  LSTLLQKARHESNDI---VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
              +++L KA  ES+D     +VI  G+   +D+I+W ++EA K  V L   VP +    Y 
Sbjct  66    AASVLIKAWKESDDSEGDTEVILGGMAGLHDEIAWFKKEASKWGVELSETVPQKANQLYC  125

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
             + LESL   + DYT A+++ WA + VY  +FAHCL   + TP E++E C++WG D  G Y
Sbjct  126   RFLESLMSPEVDYTVAITVFWAIEAVYQESFAHCLEPDTNTPPELQEVCQRWGNDGFGQY  185

Query  715   CLSLQRTADGALEKAPRDVIV---------KAEVTLLEFLEISVQFWN  599
             C SL++ A+  LEKA  D+IV         KAEV L+  LE  V+FWN
Sbjct  186   CHSLKKIANRLLEKASDDLIVGKAGDDVLKKAEVELIRVLEHEVEFWN  233



>ref|XP_006840456.1| hypothetical protein AMTR_s00045p00175590 [Amborella trichopoda]
 gb|ERN02131.1| hypothetical protein AMTR_s00045p00175590 [Amborella trichopoda]
Length=270

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 137/220 (62%), Gaps = 6/220 (3%)
 Frame = -1

Query  1243  AESKKGMGMTETWMR-KHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFV  1067
              E +  +G T+ WMR KH LL   AT +PF  +I + TL +SSF  WLGQ+Y L  R F+
Sbjct  10    GEERGSLGFTDIWMREKHHLLYSKATHHPFILSISNGTLHISSFKRWLGQDY-LFVRQFI  68

Query  1066  PFLSTLLQKARHES--NDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDY  893
             PF++++L K+  E+  N  + +I +G+   ND+ISW ++EA K  + L  ++P +   DY
Sbjct  69    PFVASILIKSWKEAVDNSDMDLILSGLASLNDEISWFKKEASKWDIVLSDIIPQESNQDY  128

Query  892   SKLLESLTDD--DYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGD  719
             S+ LESLT+   DY   L+ LWA + VY  +F+ CL + S+TP E+ EAC +WG +    
Sbjct  129   SRFLESLTNSEIDYPVVLTALWAIEVVYQESFSLCLKDDSKTPPELLEACHRWGNEEFKQ  188

Query  718   YCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             YC  LQRT D  LEKAP +V+ KAE   +  LE  V+FWN
Sbjct  189   YCCLLQRTTDRYLEKAPINVVAKAEEVFVRVLENEVKFWN  228



>gb|AFK43098.1| unknown [Medicago truncatula]
Length=225

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 129/198 (65%), Gaps = 6/198 (3%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
             AE KK +G+TETW+RKH  +  AATR+PF  +IRD T+   SF  WL Q+Y L  RAFVP
Sbjct  9     AEEKK-IGLTETWLRKHRPIYDAATRHPFILSIRDGTVQSHSFKTWLAQDY-LFVRAFVP  66

Query  1063  FLSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
             F++++L KA  ES+D   V+VI  G+    D+I W +REA K  +S   VVP +  I+Y 
Sbjct  67    FVASVLIKACKESDDSDDVEVILGGMASLKDEILWFKREANKWGISFSDVVPQKANINYC  126

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
             +LLESL   D DYT  L+  WA + VY  +FAHC+ EGS+TP E+KE C +WG +  G Y
Sbjct  127   RLLESLMSPDVDYTVTLTAFWAIEVVYQESFAHCIEEGSKTPPELKETCERWGNEGFGQY  186

Query  715   CLSLQRTADGALEKAPRD  662
             C SLQ+  +  L+KA  D
Sbjct  187   CQSLQKILNQRLQKASDD  204



>ref|XP_004148207.1| PREDICTED: seed maturation protein PM36-like [Cucumis sativus]
 ref|XP_004161390.1| PREDICTED: seed maturation protein PM36-like [Cucumis sativus]
 gb|KGN47379.1| hypothetical protein Csa_6G307400 [Cucumis sativus]
Length=244

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 136/222 (61%), Gaps = 5/222 (2%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
             A+    M  TE+W+RKH L+   ATR+PF   IRD T+ LS+F  WL Q++    R+F  
Sbjct  8     AQLAGAMTATESWLRKHRLIYTGATRHPFILTIRDGTIDLSAFKTWLEQDFGFL-RSFAA  66

Query  1063  FLSTLLQKARHESNDIV--QVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
             F+ ++L KA  ES+D    +VI   +   ND+ +W ++E+ K  ++L  VVP   T  YS
Sbjct  67    FVGSVLVKAWKESDDRADEEVILACLAALNDEFAWFKKESLKRDINLSEVVPQNATAGYS  126

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
             + LESL   + +YT A++ LW  + VYH +FAHCL EG++TP E++EAC +WG +  G Y
Sbjct  127   RFLESLMRPEVEYTVAITALWLIEAVYHESFAHCLEEGTKTPLELREACERWGNEGFGSY  186

Query  715   CLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWNNVV  590
             C +L++ AD  LE    +V  KAEV  L  LE  V+FWN V 
Sbjct  187   CNTLKKIADRRLEMGSEEVSKKAEVGFLRVLEYEVEFWNMVC  228



>gb|KDO71902.1| hypothetical protein CISIN_1g0264162mg [Citrus sinensis]
Length=239

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 141/228 (62%), Gaps = 16/228 (7%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E+ KG G+ +TW+RKH L+ I ATR+PF  AIRD T+  SSF  WLGQ+Y +  R FV F
Sbjct  8     EAGKG-GVIDTWLRKHRLIYIGATRHPFILAIRDGTVNYSSFKKWLGQDY-IFVREFVAF  65

Query  1060  LSTLLQKARHESNDI---VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
              +++L KA  ES+D     +VI  G+   +D+I+W ++EA K  V L   VP +    Y 
Sbjct  66    AASVLVKAWKESDDSKGDTEVILGGMAGLHDEIAWFKKEASKWGVELSETVPQKANQVYC  125

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
             + LESL   + DYT A+++ WA + VY  +FAHCL   + TP E++E C++WG D  G Y
Sbjct  126   RFLESLMSPEVDYTVAITVFWAIEAVYQESFAHCLEPDTNTPPELQEVCQRWGNDGFGQY  185

Query  715   CLSLQRTADGALEKAPRDVIV---------KAEVTLLEFLEISVQFWN  599
             C SL++ A+  LEKA  D+I+         KAEV L+  LE  V+FWN
Sbjct  186   CHSLKKIANRLLEKASDDLIMGKAGDDVLKKAEVELIRVLEHEVEFWN  233



>ref|XP_006488852.1| PREDICTED: seed maturation protein PM36-like [Citrus sinensis]
Length=239

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 137/222 (62%), Gaps = 15/222 (7%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ +TW+RKH L+ I ATR+PF  AIRD T+  SSF  WLGQ+Y +  R FV F +++L 
Sbjct  13    GVIDTWLRKHRLIYIGATRHPFILAIRDGTVNYSSFKKWLGQDY-IFVREFVAFAASVLI  71

Query  1042  KARHESNDI---VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESL  872
             KA  ES+D     +VI  G+   +D+I+W ++EA K  V L   VP +    Y + LESL
Sbjct  72    KAWKESDDSEGDTEVILGGMAGLHDEIAWFKKEASKWGVELSETVPQKANQVYCRFLESL  131

Query  871   T--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQR  698
                + DYT A+++ WA + VY  +FAHCL   + TP E++E C++WG D  G YC SL++
Sbjct  132   MSPEVDYTVAITVFWAIEAVYQESFAHCLEPDTNTPPELQEVCQRWGNDGFGQYCHSLKK  191

Query  697   TADGALEKAPRDVIV---------KAEVTLLEFLEISVQFWN  599
              A+  LEKA  D+IV         KAEV L+  LE  V+FWN
Sbjct  192   IANRLLEKASDDLIVGKAGDDVLKKAEVELIRVLEHEVEFWN  233



>ref|XP_011020153.1| PREDICTED: seed maturation protein PM36 [Populus euphratica]
Length=247

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 138/212 (65%), Gaps = 5/212 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ + W++KH +L   ATR+PF  +IRD T+  SSF  WLGQ+Y    R FVPF ++ L 
Sbjct  31    GVIDRWVKKHLVLYTGATRHPFILSIRDGTIDFSSFKRWLGQDYIFV-REFVPFTASALL  89

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             KA   S+D   ++VI +G+   ND+ISW ++EA    V L  VV ++   +Y + LESL 
Sbjct  90    KASKNSDDNSDMEVILSGLASLNDEISWFKQEAANWDVPLSDVVVHKSNQNYCRFLESLM  149

Query  868   DD--DYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
                 +Y+   + LWA +TVY  +F+HCL +GS+TP E+ E+C++WG +  G++C SL++ 
Sbjct  150   LPAVEYSVVFTALWAIETVYQESFSHCLEDGSKTPPELLESCKRWGSEGFGEFCRSLKKV  209

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             A+  LEKAP + + KAE+T L  LE+ ++FW+
Sbjct  210   ANRCLEKAPDEELKKAEMTFLRVLELEIEFWD  241



>ref|XP_002519208.1| Seed maturation protein PM36, putative [Ricinus communis]
 gb|EEF43072.1| Seed maturation protein PM36, putative [Ricinus communis]
Length=230

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 139/218 (64%), Gaps = 5/218 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E  +  G+TE W+++H +L I ATR+PF  +IRD ++ LSSF  WL Q+Y +  R F PF
Sbjct  8     EEGENSGVTERWIKRHLVLYIGATRHPFILSIRDGSIDLSSFKRWLEQDY-IFVRQFTPF  66

Query  1060  LSTLLQKARHESND--IVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             ++++L KA  +S+D   ++V+  G+   +++I W + EA K  V L ++  ++    Y +
Sbjct  67    VASVLIKASKKSDDENDMEVVLGGLASLDEEIDWFKSEASKWDVPLSNIAVHKTNQKYCR  126

Query  886   LLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LESL   + +Y  A++  WA + VY ++FAHCL +G+RT  E++  CR+WG +A  +YC
Sbjct  127   FLESLMLPEVEYAVAITAYWAIEAVYQQSFAHCLEDGNRTSLELENTCRRWGNEAFAEYC  186

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              SLQ   +  LEKAP DVI KAEVT L  LE  V+FWN
Sbjct  187   RSLQTIVNRCLEKAPEDVIAKAEVTFLSVLEHEVEFWN  224



>emb|CBI22896.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 132/201 (66%), Gaps = 5/201 (2%)
 Frame = -1

Query  1189  LLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQKARHESNDI--  1016
             +L I AT++P   +IRD T+  SSF  WLGQ+Y +  RAFVPF +++L KA  ES++   
Sbjct  1     MLYIRATKHPLILSIRDGTIDFSSFKRWLGQDY-IFVRAFVPFSASVLLKACKESDNSSD  59

Query  1015  VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTDD--DYTAALS  842
             ++VI  G+   ND+I+W ++EA K  + L ++VP +   +Y + LESL     +YT A++
Sbjct  60    MEVILGGMASLNDEIAWFKKEASKWGLELSTIVPQKVNQEYCRFLESLMSPQVEYTVAIT  119

Query  841   ILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTADGALEKAPRD  662
               WA + VY   FA CL +GS+TP E+KE C++WG D  G YC SLQ  A+  L KAP D
Sbjct  120   AFWAIEAVYQEGFALCLQDGSKTPPELKETCQRWGNDGFGQYCRSLQNIANRHLGKAPPD  179

Query  661   VIVKAEVTLLEFLEISVQFWN  599
             V+ +AEV LL+ LE+ V+FWN
Sbjct  180   VVARAEVALLQVLELEVEFWN  200



>gb|ACU13338.1| unknown [Glycine max]
Length=211

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 129/195 (66%), Gaps = 6/195 (3%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
             AE KK +GMTETW++KH LL   ATR+P   +IRD T+  +SF  WL Q+Y L  RAFVP
Sbjct  7     AEQKK-IGMTETWLKKHRLLYNGATRHPLIISIRDGTINTASFKTWLAQDY-LFVRAFVP  64

Query  1063  FLSTLLQKARHESN--DIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
             F++++L KA  ES+    ++VI  G+    D+ISW + EA K  +SL  VVP Q   +Y 
Sbjct  65    FVASVLIKAWKESDCSGDMEVILGGMASLEDEISWFKTEANKWGISLSDVVPQQANKNYC  124

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
              LLESL   D +YT A++  WA +TVY  +FAHC+ EGS+TP E+KE C +WG +A G Y
Sbjct  125   GLLESLMSPDAEYTVAITAFWAIETVYQESFAHCIEEGSKTPPELKETCVRWGNEAFGKY  184

Query  715   CLSLQRTADGALEKA  671
             C SLQ  A+  L+KA
Sbjct  185   CQSLQNIANRCLQKA  199



>ref|XP_007222899.1| hypothetical protein PRUPE_ppa009974mg [Prunus persica]
 gb|EMJ24098.1| hypothetical protein PRUPE_ppa009974mg [Prunus persica]
Length=269

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 130/200 (65%), Gaps = 9/200 (5%)
 Frame = -1

Query  1243  AESKKGM---GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRA  1073
              +SK G+   GMT+TW++KH L+ I ATR+PF  +IRD T+ L +F  WLGQ+Y    RA
Sbjct  22    GKSKPGLPHGGMTDTWVKKHRLIYIGATRHPFILSIRDGTVDLPAFKRWLGQDYIFV-RA  80

Query  1072  FVPFLSTLLQKARH---ESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPT  902
             FVPF++++L +A     ES+  ++VI +G+G  ND+I+W ++EA K  V L  V P +PT
Sbjct  81    FVPFVASVLIRAYKKGDESSGDMEVILSGLGSLNDEIAWFKQEASKWGVDLSQVAPEKPT  140

Query  901   IDYSKLLESL--TDDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDA  728
               Y + LE L   + DYT A++  WA + VY  +FAHCL EGS+ P E+KEAC++WG D 
Sbjct  141   QHYCRFLEELMRPEVDYTVAMAAFWAIEAVYQESFAHCLEEGSKAPPELKEACQRWGNDG  200

Query  727   QGDYCLSLQRTADGALEKAP  668
              G YC SL+  AD     AP
Sbjct  201   FGHYCSSLRNIADRINPPAP  220



>ref|XP_010910448.1| PREDICTED: seed maturation protein PM36 [Elaeis guineensis]
Length=227

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 133/214 (62%), Gaps = 5/214 (2%)
 Frame = -1

Query  1228  GMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTL  1049
             G G T TW+ ++ L+   ATR+PF  +I D T+ +S+F  WLGQ+Y +  R FVPFL+++
Sbjct  9     GRGKTATWIDQYRLMYDRATRHPFVLSIHDGTVDISAFKRWLGQDY-IFVREFVPFLASV  67

Query  1048  LQKA--RHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLES  875
             L KA    + +  V+VI  GI   ND++SW ++EA K  V L  + P +  ++Y +LL+S
Sbjct  68    LLKAWKDSDDDSDVEVILGGIASLNDELSWFKKEASKWDVHLGGITPQKANLEYCRLLQS  127

Query  874   LT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQ  701
             L   + DY   +++ WA +TVY  +F+ CL  GS TP E+ E C++WG     +YC SLQ
Sbjct  128   LMLPEIDYAVVITVFWAIETVYQDSFSLCLESGSNTPAELMETCKRWGNALFREYCCSLQ  187

Query  700   RTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             + AD  LEKAP DV+ KAE   +  LE  + FWN
Sbjct  188   KIADRCLEKAPGDVVRKAEEAFISVLEHEIGFWN  221



>ref|XP_008458358.1| PREDICTED: seed maturation protein PM36 isoform X1 [Cucumis melo]
Length=243

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 136/221 (62%), Gaps = 5/221 (2%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
             A+    M  T++W+RKH L+   ATR+PF   IRD T+ LS+F  WL QE     R+F  
Sbjct  8     AQLAGAMTATDSWLRKHRLIYTGATRHPFILTIRDGTVDLSAFKTWLEQECEFL-RSFAA  66

Query  1063  FLSTLLQKARHESNDIV--QVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
             F+ ++L KA  ES+D    +VI   +   ND+ +W ++EA K  ++L  +VP + T  YS
Sbjct  67    FVGSVLVKAWKESDDRADEEVILGSLAALNDEFAWFKKEALKRDINLSEIVPQKATAGYS  126

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
             + LESL   + +YT A++ LWA + VYH +FA+CL EG++TP E++EAC +WG +    Y
Sbjct  127   RFLESLMRPEVEYTVAITALWAIEAVYHESFAYCLEEGTKTPLELREACERWGSEGFDKY  186

Query  715   CLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWNNV  593
             C +L++ AD  LE    +V  KAEV LL  LE  V FWN +
Sbjct  187   CSTLKKIADRRLEMGSGEVNKKAEVGLLRVLEYEVGFWNMI  227



>ref|XP_008458359.1| PREDICTED: seed maturation protein PM36 isoform X2 [Cucumis melo]
Length=241

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 136/221 (62%), Gaps = 7/221 (3%)
 Frame = -1

Query  1243  AESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVP  1064
             A+    M  T++W+RKH L+   ATR+PF   IRD T+ LS+F  WL  E+    R+F  
Sbjct  8     AQLAGAMTATDSWLRKHRLIYTGATRHPFILTIRDGTVDLSAFKTWLECEFL---RSFAA  64

Query  1063  FLSTLLQKARHESNDIV--QVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYS  890
             F+ ++L KA  ES+D    +VI   +   ND+ +W ++EA K  ++L  +VP + T  YS
Sbjct  65    FVGSVLVKAWKESDDRADEEVILGSLAALNDEFAWFKKEALKRDINLSEIVPQKATAGYS  124

Query  889   KLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDY  716
             + LESL   + +YT A++ LWA + VYH +FA+CL EG++TP E++EAC +WG +    Y
Sbjct  125   RFLESLMRPEVEYTVAITALWAIEAVYHESFAYCLEEGTKTPLELREACERWGSEGFDKY  184

Query  715   CLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWNNV  593
             C +L++ AD  LE    +V  KAEV LL  LE  V FWN +
Sbjct  185   CSTLKKIADRRLEMGSGEVNKKAEVGLLRVLEYEVGFWNMI  225



>ref|XP_010524576.1| PREDICTED: seed maturation protein PM36 homolog [Tarenaya hassleriana]
 ref|XP_010524577.1| PREDICTED: seed maturation protein PM36 homolog [Tarenaya hassleriana]
Length=217

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 127/213 (60%), Gaps = 5/213 (2%)
 Frame = -1

Query  1225  MGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLL  1046
             MGM +TW+ +H  +  AATR+PF  AIRD ++ LSSF  WLGQ+Y L  R FVPF++  L
Sbjct  1     MGMIDTWLDQHRPIYEAATRHPFILAIRDGSVHLSSFKTWLGQDY-LFVREFVPFVANAL  59

Query  1045  QKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESL  872
              +A  ES +   ++V+  G+   ND+I W + E  K  V   +V+P +   DY + LE L
Sbjct  60    IRAGRESGESSDMEVVLGGLSALNDEIDWFKSEGSKWGVDFSTVLPQKTNQDYCRFLEKL  119

Query  871   TDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQR  698
             T+ +  Y+  ++  WA + VY  +FAHCL EG+R P E+  ACR+WG D    YC S++ 
Sbjct  120   TEKEVKYSVVMTAFWAIEAVYQESFAHCLEEGNRIPPELAGACRRWGNDGFRRYCSSVKA  179

Query  697   TADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              AD  LE A  D + +AE   +  LE  + FW+
Sbjct  180   IADRCLENASGDDLAEAEAVFVSVLEHEIAFWD  212



>emb|CDX75896.1| BnaC03g39790D [Brassica napus]
Length=224

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 131/217 (60%), Gaps = 5/217 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E  +  G+ +TW+ KH  L  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF
Sbjct  2     EKSEKKGVIDTWIDKHRSLYAAATRHDFVVSIRDGSVDLSSFKTWLGQDY-LFVRGFVPF  60

Query  1060  LSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             ++ +L +A  ES +   ++V+  G+   ND+I W + E  K  V   +VV  +   +YS+
Sbjct  61    VANVLIRAGKESGETSDMEVVLGGLASLNDEIEWFKSEGSKWGVDFSTVVAQKANQEYSR  120

Query  886   LLESL--TDDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LE+L  ++ +Y+  ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC
Sbjct  121   FLEALMSSEVEYSVVMTAFWAIEAVYQESFAHCLGDGNKTPAELIGACNRWGNDGFRQYC  180

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             LS++  A+  LE A RD  V+AE  L+  LE  V FW
Sbjct  181   LSVKNIAERCLENASRDAFVEAENVLVRVLEHEVAFW  217



>emb|CDX82386.1| BnaA03g34350D [Brassica napus]
Length=222

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 131/217 (60%), Gaps = 5/217 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E  +  GM +TW+ KH  L  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF
Sbjct  2     EKPEKRGMIDTWLDKHRSLYTAATRHDFVVSIRDGSVDLSSFKTWLGQDY-LFVREFVPF  60

Query  1060  LSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             ++ +L +A  ES +   ++V+  G+   ND+I W + E  K  V   +VV  +   +YS+
Sbjct  61    VANVLIRAGKESGETSDMEVVLGGLASLNDEIEWFKSEGSKWGVDFSTVVAQKANQEYSR  120

Query  886   LLESL--TDDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LE+L  ++ +Y+  ++  W  + VY  +FAHCL +G++TP E+  AC +WG D    YC
Sbjct  121   FLEALMSSEVEYSVVMTAFWGIEAVYQESFAHCLGDGNKTPAELTGACNRWGNDGFRQYC  180

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             LS++  A+  LE A RD +V+AE  L+  LE  V FW
Sbjct  181   LSVKNIAERCLENASRDALVEAEDVLVRVLEHEVAFW  217



>ref|XP_010312566.1| PREDICTED: seed maturation protein PM36-like [Solanum lycopersicum]
Length=233

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 130/216 (60%), Gaps = 5/216 (2%)
 Frame = -1

Query  1231  KGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLST  1052
             K +   E W+RKH L   AATR+PF  +I D ++  S +  WL +EY   K A VPF ++
Sbjct  12    KQLTQIEKWIRKHKLEYSAATRHPFIYSIHDGSIDFSCYKKWLEREYLFVKTALVPFAAS  71

Query  1051  LLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVV-PYQPTIDYSKLL  881
             +L KA  ES D   V+VI   +   ND++SWL++EA K H+SL SVV   +P +DY    
Sbjct  72    VLVKAWKESIDSHDVEVILALLAYMNDEVSWLKQEAPKWHISLTSVVVDDKPLLDYFSFF  131

Query  880   ESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLS  707
             E LT  +  YT A++ILWA ++VY+  F HCL  G+ TP EMKE C+ WG D    Y  S
Sbjct  132   ERLTSPEVKYTEAITILWAVESVYYNGFKHCLEGGNNTPNEMKEGCKIWGNDNFKQYYES  191

Query  706   LQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             ++  A+  L +A  + + K EV +LEFL+  V FWN
Sbjct  192   VENIANRTLGEALDEDVSKIEVLILEFLDNVVHFWN  227



>gb|KFK39038.1| hypothetical protein AALP_AA3G192800 [Arabis alpina]
Length=224

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 129/217 (59%), Gaps = 5/217 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E  +  G+ +TW+ KH  +   ATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF
Sbjct  2     EKPEKRGVIDTWLDKHRSIYTEATRHAFVVSIRDGSVDLSSFRTWLGQDY-LFVRGFVPF  60

Query  1060  LSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             ++ +L +A  ES +   ++V+  G+   ND+I W + E  K  V   +VVP +   DY +
Sbjct  61    VANVLIRACKESGETSDMEVVLGGLASLNDEIEWFKSEGSKWDVDFSTVVPQKANQDYRR  120

Query  886   LLESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LE++  D+  Y+  ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC
Sbjct  121   FLEAMMSDEVKYSVIMTAFWAIEAVYQESFAHCLEDGNKTPAELTGACNRWGNDGFRQYC  180

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
              S+++ A+  LE A  DV+  AE  L+  LE+ V FW
Sbjct  181   SSVKKIAERCLENASGDVLADAEDVLVRVLELEVAFW  217



>ref|XP_006406781.1| hypothetical protein EUTSA_v10021446mg [Eutrema salsugineum]
 gb|ESQ48234.1| hypothetical protein EUTSA_v10021446mg [Eutrema salsugineum]
Length=231

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+  TW+ KH  +  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF++ +L 
Sbjct  16    GVINTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDY-LFVRGFVPFVANVLI  74

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             +A  ES +   ++V+  G+   ND+I W + E  K  V   +VVP    ++YS+ LE+L 
Sbjct  75    RAGKESGETSDMEVVLGGLASLNDEIEWFKSEGAKWDVDFSTVVPQTANLEYSRFLEALM  134

Query  868   DDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               +  Y+  ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC S++  
Sbjct  135   SSEVKYSVMMTAFWAIEAVYQESFAHCLEDGNKTPTELTGACHRWGNDGFKQYCSSVKNI  194

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             A+  LE A  DV+ +AE  L+  LE  V FW
Sbjct  195   AERCLENASGDVLAEAEDVLVRVLEHEVAFW  225



>ref|XP_002885182.1| TENA/THI-4 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61441.1| TENA/THI-4 family protein [Arabidopsis lyrata subsp. lyrata]
Length=221

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             GM +TW+ KH  +  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF++++L 
Sbjct  5     GMIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDY-LFVRGFVPFVASVLI  63

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             KA  +S +   ++V+  G+   ND+I W ++E  K  V   +VVP     +Y + LE+L 
Sbjct  64    KACKDSGESSDMEVVLGGLASLNDEIEWFKKEGTKWDVDFSTVVPQNANQEYRRFLEALM  123

Query  868   DDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               +  Y   ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YCLS++  
Sbjct  124   SSEVKYPVIMTAFWAIEAVYQESFAHCLEDGNKTPVELTGACHRWGNDGFKQYCLSVKNI  183

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             A+  LE A  +V+V+AE  L+  LE  V FW
Sbjct  184   AERCLENASGEVLVEAEDVLVRVLEHEVAFW  214



>ref|XP_009135508.1| PREDICTED: seed maturation protein PM36 homolog [Brassica rapa]
Length=222

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 130/217 (60%), Gaps = 5/217 (2%)
 Frame = -1

Query  1240  ESKKGMGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPF  1061
             E  +  GM +TW+ KH  L  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF
Sbjct  2     EKTEKRGMIDTWLDKHRSLYTAATRHDFVVSIRDGSVDLSSFKTWLGQDY-LFVREFVPF  60

Query  1060  LSTLLQKARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSK  887
             ++ +L +A  ES +   ++V+  G+   ND+I W + E  K  V   +VV  +   +YS+
Sbjct  61    VANVLIRAGKESGETSDMEVVLGGLASLNDEIEWFKSEGSKWGVDFSTVVSQKANQEYSR  120

Query  886   LLESL--TDDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYC  713
              LE++  ++ +Y+  ++  W  + VY  +FAHCL +G++TP E+  AC +WG D    YC
Sbjct  121   FLEAMMGSEVEYSVVMTAFWGIEAVYQESFAHCLGDGNKTPAELTGACNRWGNDGFRQYC  180

Query  712   LSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             L ++  A+  LE A R+ +V+AE  L+  LE  V FW
Sbjct  181   LCVKNIAERCLENASREALVEAEDVLVRVLEHEVAFW  217



>ref|XP_010487569.1| PREDICTED: seed maturation protein PM36 homolog [Camelina sativa]
Length=225

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 129/211 (61%), Gaps = 5/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ +TW+ KH  +  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF++++L 
Sbjct  9     GVIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDY-LFVRGFVPFVASVLI  67

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             +A  ES +   ++V+  G+   ND+I W +REA K  V   +VVP +   +Y++ LE+L 
Sbjct  68    RAGKESGESSDMEVVLGGMASLNDEIEWFKREASKWDVDFSTVVPQKANQEYNRFLEALM  127

Query  868   DDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               +  Y+  ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC S++  
Sbjct  128   SSEVKYSVMMTAFWAIEAVYQESFAHCLEDGNKTPLELTGACHRWGNDGFKQYCSSVKNI  187

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             AD  LE A  + + +AE  L+  LE  V FW
Sbjct  188   ADRCLETASGEALSEAEDVLVRVLEYEVAFW  218



>gb|AGM20687.1| PM36 [Populus tomentosa]
Length=225

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 131/213 (62%), Gaps = 5/213 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+   W++ H +L    TR+PF  +IRD T+  SSF  WLGQ+Y +  R FVPF +++L 
Sbjct  8     GVIARWVKTHLVLYTGPTRHPFILSIRDRTIDFSSFKRWLGQDY-IFVREFVPFAASVLL  66

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             KA   S+D   ++VI +G+   +D+ISW ++EA K  V L  VV ++   +Y + LESL 
Sbjct  67    KASKNSDDNSDMEVILSGLASLSDEISWFKQEAAKWDVPLSDVVVHKSNQNYCRFLESLM  126

Query  868   --DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
                 +Y    + LWA +TVY  +F+HCL  G +TP E+  AC++WG +  G++C SL++ 
Sbjct  127   LPAVEYCVVFTALWAIETVYQESFSHCLEAGRKTPPELLAACKRWGREGFGEFCRSLKKI  186

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFWNN  596
              +  LEKA  + + KAEVT L  L + ++FW+ 
Sbjct  187   VNRCLEKAADEALKKAEVTFLHVLGLEIEFWDT  219



>ref|XP_010504855.1| PREDICTED: seed maturation protein PM36 homolog [Camelina sativa]
Length=220

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ +TW+ KH  +  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF++++L 
Sbjct  5     GVIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDY-LFVRGFVPFVASVLI  63

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             +A  ES +   ++V+  G+   ND+I W +REA K  V   +VVP +   +Y++ LE+L 
Sbjct  64    RAGKESGESSDMEVVLGGMASLNDEIEWFKREASKWDVDFSTVVPQKANQEYTRFLEALM  123

Query  868   DDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               D  Y+  ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC S++  
Sbjct  124   SSDVKYSVIMTAFWAIEAVYQESFAHCLEDGNKTPVELTGACHRWGNDGFKQYCSSVKNI  183

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             A   LE A  + + +AE   +  +E  V FW
Sbjct  184   AGRCLENASGEALAEAEDVFVRVIEHEVAFW  214



>ref|XP_010097795.1| hypothetical protein L484_004209 [Morus notabilis]
 gb|EXB71074.1| hypothetical protein L484_004209 [Morus notabilis]
Length=236

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 134/216 (62%), Gaps = 9/216 (4%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ +TW  KH +L + ATR+P   +I D T+  S+F  WLGQ+  +  RA VPF+ +L+ 
Sbjct  13    GVVDTWKNKHRMLWVGATRHPMILSISDGTIHPSAFKRWLGQDC-IFVRALVPFVGSLIV  71

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSL-DSVVPYQPTIDYSKLLESL  872
             KA  ES+D   V  I  G+   ND++ W ++EA K  V L + +VP +P  +Y + LE+L
Sbjct  72    KAWKESDDSSDVDTILRGMAALNDELDWFKKEANKWGVHLSEMLVPQKPNQEYCRFLENL  131

Query  871   T--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQR  698
                + +YT AL+  WA + VY  +FA CL EG+RTP E+++ C++WG +A G YC SL+ 
Sbjct  132   MGPEVEYTVALTAYWAIEAVYQESFALCLEEGTRTPPELEDTCQRWGNEAFGKYCSSLKN  191

Query  697   TADGALEKAP---RDVIVKAEVTLLEFLEISVQFWN  599
              A+  L+KA     DV+ KAEV  L  LE  ++FWN
Sbjct  192   IAERRLKKASDDYEDVLKKAEVVFLRVLEHEIEFWN  227



>ref|NP_188324.1| heme oxygenase-like, multi-helical protein [Arabidopsis thaliana]
 sp|Q9ASY9.3|PM36_ARATH RecName: Full=Seed maturation protein PM36 homolog [Arabidopsis 
thaliana]
 gb|AEE75892.1| heme oxygenase-like, multi-helical protein [Arabidopsis thaliana]
Length=221

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ +TW+ KH  +  AATR+ F  +IRD ++ LSSF  WLGQ+Y   +R FVPF++++L 
Sbjct  5     GVIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDYLFVRR-FVPFVASVLI  63

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             +A  +S +   ++V+  GI   ND+I W +RE  K  V   +VVP +   +Y + LE L 
Sbjct  64    RACKDSGESSDMEVVLGGIASLNDEIEWFKREGSKWDVDFSTVVPQRANQEYGRFLEDLM  123

Query  868   DDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               +  Y   ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC S++  
Sbjct  124   SSEVKYPVIMTAFWAIEAVYQESFAHCLEDGNKTPVELTGACHRWGNDGFKQYCSSVKNI  183

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             A+  LE A  +V+ +AE  L+  LE+ V FW
Sbjct  184   AERCLENASGEVLGEAEDVLVRVLELEVAFW  214



>gb|AAM64658.1| seed maturation protein, putative [Arabidopsis thaliana]
Length=221

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ +TW+ KH  +  A+TR+ F  +IRD ++ LSSF  WLGQ+Y   +R FVPF++++L 
Sbjct  5     GVIDTWIDKHRSIYTASTRHAFVVSIRDGSVDLSSFRTWLGQDYLFVRR-FVPFVASVLI  63

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             +A  +S +   ++V+  GI   ND+I W +RE  K  V   +VVP +   +Y + LE L 
Sbjct  64    RACKDSGESSDMEVVLGGIASLNDEIEWFKREGSKWDVDFSTVVPQRANQEYGRFLEDLM  123

Query  868   DDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               +  Y   ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC S++  
Sbjct  124   SSEVKYPVIMTAFWAIEAVYQESFAHCLEDGNKTPVELTGACHRWGNDGFKQYCSSVKNI  183

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             A+  LE A  +V+ +AE  L+  LE+ V FW
Sbjct  184   AERCLENASGEVLGEAEDVLVRVLELEVAFW  214



>ref|XP_009382500.1| PREDICTED: seed maturation protein PM36 [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 127/213 (60%), Gaps = 5/213 (2%)
 Frame = -1

Query  1225  MGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLL  1046
             MG   +W++ H  +   AT++PF   I D ++ LS+F  WL Q+Y   K  FVPFL+++L
Sbjct  1     MGRIASWVKSHRPMYDRATQHPFVVGISDGSVDLSAFKRWLAQDYIFVKE-FVPFLASVL  59

Query  1045  QKARHESND--IVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESL  872
              KA   S+D   ++++  G+   +D+++W  +EA K  V L  +VP +  ++Y + L+SL
Sbjct  60    LKAWKHSDDESDMEILLGGMASLSDELAWFRKEASKWDVKLVGIVPQKANLEYCRFLQSL  119

Query  871   T--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQR  698
                + DY  A++  WA +TVY  +F+ CL   S+TPEE+ E C++WG    G YC SLQ+
Sbjct  120   MLPEVDYAVAITAFWAIETVYQESFSLCLDSSSKTPEELMETCQRWGSANFGHYCRSLQK  179

Query  697   TADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              AD  LEKA  D+I KAE   +  LE    FWN
Sbjct  180   IADRCLEKASSDIIRKAEEAFVCVLEHEFNFWN  212



>pdb|2F2G|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At3g16990
 pdb|2F2G|B Chain B, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At3g16990
 pdb|2Q4X|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At3g16990
 pdb|2Q4X|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At3g16990
Length=221

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ +TW+ KH  +  AATR+ F  +IRD ++ LSSF  WLGQ+Y   +R FVPF++++L 
Sbjct  5     GVIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDYLFVRR-FVPFVASVLI  63

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             +A  +S +    +V+  GI   ND+I W +RE  K  V   +VVP +   +Y + LE L 
Sbjct  64    RACKDSGESSDXEVVLGGIASLNDEIEWFKREGSKWDVDFSTVVPQRANQEYGRFLEDLX  123

Query  868   DDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
               +  Y    +  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC S++  
Sbjct  124   SSEVKYPVIXTAFWAIEAVYQESFAHCLEDGNKTPVELTGACHRWGNDGFKQYCSSVKNI  183

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             A+  LE A  +V+ +AE  L+  LE+ V FW
Sbjct  184   AERCLENASGEVLGEAEDVLVRVLELEVAFW  214



>ref|XP_010465728.1| PREDICTED: seed maturation protein PM36 homolog [Camelina sativa]
Length=238

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G+ +TW+ KH  +  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF++++L 
Sbjct  22    GVIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDY-LFVRGFVPFVASVLI  80

Query  1042  KARHESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
             +A  ES +   ++V+  G+   N +I W + EA K  V   +VVP +   +Y + LE+L 
Sbjct  81    RAGKESGESSDMEVVLGGMASLNGEIEWFKTEASKWDVDFSTVVPQKANQEYLRFLEALM  140

Query  868   DDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
              ++  Y+  ++  WAT+ VY  +FAHCL +G++TP E+  AC +WG D    YC S++  
Sbjct  141   SNEVKYSVMMTAFWATEAVYQESFAHCLEDGNKTPVELTGACHRWGNDGFKQYCSSVKSI  200

Query  694   ADGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             A+  LE A  + + +AE  L+  LE  V FW
Sbjct  201   AERCLENASGEALAEAEDVLVRVLEYEVAFW  231



>ref|XP_006298483.1| hypothetical protein CARUB_v10014589mg [Capsella rubella]
 gb|EOA31381.1| hypothetical protein CARUB_v10014589mg [Capsella rubella]
Length=220

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 125/208 (60%), Gaps = 5/208 (2%)
 Frame = -1

Query  1213  ETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQKAR  1034
             +TW+ KH  +  AATR+ F  +IRD ++ LSSF  WLGQ+Y L  R FVPF++++L +A 
Sbjct  8     DTWLDKHRSVYTAATRHAFVVSIRDGSVDLSSFRTWLGQDY-LFVREFVPFVASVLIRAG  66

Query  1033  HESNDI--VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTDDD  860
              ES +   ++V+  G+   ND+I W +RE  K  V   +VVP +   +Y + LE+L   +
Sbjct  67    KESGESSDMEVVLGGMASLNDEIEWFKREGSKWDVDFSTVVPQKANEEYRRFLEALMSSE  126

Query  859   --YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTADG  686
               Y+  ++  WA + VY  +FAHCL +G++TP E+  AC +WG D    YC S++  A+ 
Sbjct  127   VKYSVIMTAFWAIEAVYQESFAHCLEDGNKTPVELTGACHRWGNDGFKQYCSSVKNIAER  186

Query  685   ALEKAPRDVIVKAEVTLLEFLEISVQFW  602
              LE A  + + +AE  L+  LE  V FW
Sbjct  187   CLENASDEALAEAEDVLVRVLEHEVAFW  214



>ref|XP_004984625.1| PREDICTED: seed maturation protein PM36 homolog [Setaria italica]
Length=224

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 121/208 (58%), Gaps = 4/208 (2%)
 Frame = -1

Query  1216  TETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFL-STLLQK  1040
             T  WM +H  +   ATR+PFT +IRD T+ LS+F  WL Q+Y L  R FV F+ S LL+ 
Sbjct  11    TAAWMERHGQMYDRATRHPFTVSIRDGTIDLSAFKRWLSQDY-LFVREFVAFIASVLLKC  69

Query  1039  ARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTDDD  860
              + E +  +++I  G+   +D++SW + EA +  V L SV P +  I+Y + L S  + +
Sbjct  70    CKQEDSMDMEIILGGVASLSDELSWFKNEAARWGVDLASVSPLKSNIEYHRFLRSFAEPE  129

Query  859   --YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTADG  686
               Y  A++  W  +TVY  +F  C+ EG++TP E+   C++WG      YC SLQR AD 
Sbjct  130   ISYAVAVTTFWIIETVYQDSFGFCIEEGNKTPPELLGTCQRWGSAEFKQYCQSLQRIADR  189

Query  685   ALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             +LE AP D +  AE   +  LE+ V FW
Sbjct  190   SLENAPADAVKSAEEAFIRVLELEVGFW  217



>ref|NP_001049891.1| Os03g0306900 [Oryza sativa Japonica Group]
 gb|ABF95533.1| Seed maturation protein PM36, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11805.1| Os03g0306900 [Oryza sativa Japonica Group]
 gb|EAZ26658.1| hypothetical protein OsJ_10561 [Oryza sativa Japonica Group]
 dbj|BAG93558.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75086.1| hypothetical protein OsI_11238 [Oryza sativa Indica Group]
Length=233

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 121/209 (58%), Gaps = 4/209 (2%)
 Frame = -1

Query  1216  TETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFL-STLLQK  1040
             T  WM +H  +   ATR+PFT +IRD T+ LS+F  WLGQ+Y   K  FV FL S LL+ 
Sbjct  20    TAAWMARHRGMYERATRHPFTVSIRDGTVDLSAFRRWLGQDYMFVKE-FVAFLASVLLKC  78

Query  1039  ARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTDDD  860
              R      +++I  G+   +D++SW ++EAEK  V+L  V P +   +Y + L+S ++ +
Sbjct  79    CRQSDGSDMEIILGGLASLSDELSWFKKEAEKWSVNLAEVSPLKSNTEYCRFLQSFSEPE  138

Query  859   --YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTADG  686
               Y  A++  W  +TVY  +FA C+ EG++TP E+   C++WG      YC SLQR AD 
Sbjct  139   ISYVVAITTFWIIETVYQDSFAFCIEEGNKTPPELLGTCQRWGSPEFKQYCQSLQRIADR  198

Query  685   ALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              L +A  D    AE   L  LE+ + FW+
Sbjct  199   CLAEASADAARSAEEAFLRVLELEIGFWD  227



>gb|ABF95534.1| Seed maturation protein PM36, putative, expressed [Oryza sativa 
Japonica Group]
Length=224

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 121/209 (58%), Gaps = 4/209 (2%)
 Frame = -1

Query  1216  TETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFL-STLLQK  1040
             T  WM +H  +   ATR+PFT +IRD T+ LS+F  WLGQ+Y   K  FV FL S LL+ 
Sbjct  11    TAAWMARHRGMYERATRHPFTVSIRDGTVDLSAFRRWLGQDYMFVKE-FVAFLASVLLKC  69

Query  1039  ARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTDDD  860
              R      +++I  G+   +D++SW ++EAEK  V+L  V P +   +Y + L+S ++ +
Sbjct  70    CRQSDGSDMEIILGGLASLSDELSWFKKEAEKWSVNLAEVSPLKSNTEYCRFLQSFSEPE  129

Query  859   --YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTADG  686
               Y  A++  W  +TVY  +FA C+ EG++TP E+   C++WG      YC SLQR AD 
Sbjct  130   ISYVVAITTFWIIETVYQDSFAFCIEEGNKTPPELLGTCQRWGSPEFKQYCQSLQRIADR  189

Query  685   ALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              L +A  D    AE   L  LE+ + FW+
Sbjct  190   CLAEASADAARSAEEAFLRVLELEIGFWD  218



>dbj|BAK04920.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 121/211 (57%), Gaps = 4/211 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQ  1043
             G    WM  H  +   ATR+PFT +IRD ++ L++F  WLGQ+Y   +  FV F++++L 
Sbjct  25    GTAAAWMATHRGMYERATRHPFTVSIRDGSIDLAAFKRWLGQDYTFVQ-GFVAFVASVLL  83

Query  1042  KARHESNDI-VQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTD  866
             K   ES+   ++ I  G+   +D++SW ++EA K  V L  + P    ++Y + L+S  D
Sbjct  84    KCCKESDSSDMETILGGLASLSDELSWFKKEAAKWSVDLAGISPLSSNMEYCRFLQSFDD  143

Query  865   DD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTA  692
              +  YT A++  W  +TVY  +FA C+ EG++TP E+   C++WG      YC SLQ+ A
Sbjct  144   PEISYTVAITTFWIIETVYQDSFAFCIEEGNKTPGELLRTCQRWGSPEFKLYCQSLQQIA  203

Query  691   DGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             D  L  AP DV+  AE   L  LE+   FW+
Sbjct  204   DRCLANAPPDVVKSAEEAFLRVLELETGFWD  234



>ref|XP_003558083.1| PREDICTED: seed maturation protein PM36 homolog [Brachypodium 
distachyon]
Length=238

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 125/210 (60%), Gaps = 6/210 (3%)
 Frame = -1

Query  1216  TETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLLQKA  1037
             T +W+ +H  +   ATR+PFT +IRD T+ L++F  WLGQ+Y   +  FV FL+++L K 
Sbjct  11    TASWLARHREMYKRATRHPFTVSIRDGTVDLAAFKRWLGQDYMFVQE-FVAFLASVLLKC  69

Query  1036  --RHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTDD  863
               + ES+D+ ++I  G+   +D++SW ++EA K  V L  V P    ++Y + L+S  + 
Sbjct  70    CKQSESSDM-EIILGGLASLSDELSWFKKEAAKWSVDLAGVSPLSSNMEYRRFLQSFGEP  128

Query  862   D--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTAD  689
             +  YT A++  W  +TVY  +FA C+ EG++TP E+   C++WG      YC +LQ+  D
Sbjct  129   EISYTVAITTFWIIETVYQDSFAFCIEEGNKTPPELLGTCQRWGSPEFKQYCQALQQITD  188

Query  688   GALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
               L  AP D +  AE   L  L++ V FW+
Sbjct  189   RCLANAPSDAVKSAEEAFLRVLDLEVGFWD  218



>ref|NP_001131451.1| uncharacterized protein LOC100192786 [Zea mays]
 gb|ACG38985.1| seed maturation protein PM36 [Zea mays]
 gb|AFW88599.1| seed maturation protein PM36 [Zea mays]
Length=224

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 118/209 (56%), Gaps = 4/209 (2%)
 Frame = -1

Query  1216  TETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFL-STLLQK  1040
             T  WM KH  +   ATR+PFT +IRD T+ +S+F  WL Q+Y L  R FV F+ S LL+ 
Sbjct  11    TAAWMEKHRHMYERATRHPFTVSIRDGTVDMSAFKRWLSQDY-LFVREFVAFIASVLLKC  69

Query  1039  ARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTDDD  860
              + E +  +++I  G+   +D+ISW + EA    V L SV P +  ++Y + L S T+ +
Sbjct  70    CKQEDSSDMEIILGGVASISDEISWFKNEATVWGVDLASVSPLKANLEYHRFLRSFTEPE  129

Query  859   --YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTADG  686
               Y  A++  W  +TVY  +F  C+ +G++TP E+   C++WG      YC SLQ   D 
Sbjct  130   ISYAVAVTTFWTIETVYQDSFGFCIQDGNKTPPELLGTCQRWGSAGFRQYCQSLQSIVDR  189

Query  685   ALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              L  AP D +  AE   +  LE+ + FW+
Sbjct  190   CLANAPADAVQSAEEAFVRVLELEIGFWD  218



>gb|ACF79863.1| unknown [Zea mays]
Length=224

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 118/209 (56%), Gaps = 4/209 (2%)
 Frame = -1

Query  1216  TETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFL-STLLQK  1040
             T  WM KH  +   ATR+PFT +IRD T+ +S+F  WL Q+Y L  R FV F+ S LL+ 
Sbjct  11    TAAWMEKHRHMYERATRHPFTVSIRDGTVDMSAFKRWLSQDY-LFVREFVAFIASVLLKC  69

Query  1039  ARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTDDD  860
              + E +  +++I  G+   +D+ISW + EA    V L SV P +  ++Y + L S T+ +
Sbjct  70    CKQEDSSDMEIILGGVASISDEISWFKNEATVWGVDLASVSPLKANLEYHRFLRSFTEPE  129

Query  859   --YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTADG  686
               Y  A++  W  +TVY  +F  C+ +G++TP E+   C++WG      YC SLQ   D 
Sbjct  130   ISYAVAVTTFWTIETVYQDSFGLCIQDGNKTPPELLGTCQRWGSAGFRQYCQSLQSIVDR  189

Query  685   ALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              L  AP D +  AE   +  LE+ + FW+
Sbjct  190   CLANAPADAVQSAEEAFVRVLELEIGFWD  218



>ref|XP_002465376.1| hypothetical protein SORBIDRAFT_01g037500 [Sorghum bicolor]
 gb|EER92374.1| hypothetical protein SORBIDRAFT_01g037500 [Sorghum bicolor]
Length=224

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 118/210 (56%), Gaps = 4/210 (2%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFL-STLL  1046
             G T  WM KH  +   ATR+PFT +IRD T+ +S+F  WL Q+Y L  R FV F+ S LL
Sbjct  9     GTTAAWMEKHRQMYERATRHPFTVSIRDGTVDMSAFKRWLSQDY-LFVREFVAFIASVLL  67

Query  1045  QKARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLTD  866
             +  + E +  +++I  G+   +D+ISW + EA +  V+L SV P +  ++Y + L+S T+
Sbjct  68    KCCKQEDSSDMEIILGGVASISDEISWFKNEATRWGVNLASVSPLKANLEYHRFLQSFTE  127

Query  865   DD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTA  692
              +  Y  A++  W  +TVY  +F  C+ +G+RTP E     ++WG      YC  LQ   
Sbjct  128   PEVSYVVAVTTFWIIETVYQDSFGFCIQDGNRTPPEFLGPSQRWGSAGFRQYCQFLQSIV  187

Query  691   DGALEKAPRDVIVKAEVTLLEFLEISVQFW  602
             D  L  AP D +  AE   +  LE+ + FW
Sbjct  188   DRCLANAPADAVKSAEEAFIRVLELEIGFW  217



>gb|EMT03123.1| hypothetical protein F775_01815 [Aegilops tauschii]
Length=305

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 122/237 (51%), Gaps = 30/237 (13%)
 Frame = -1

Query  1222  GMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWL--------------------  1103
             G    WM  H  +   ATR+PFT +IRD ++ L++F  WL                    
Sbjct  64    GTAAAWMATHRGMYERATRHPFTVSIRDGSVDLAAFKRWLVSIFSAFAYQLIQGDYTYIG  123

Query  1102  ------GQEYWLAKRAFVPFLSTLLQKARHESNDI-VQVIQTGIGLQNDKISWLEREAEK  944
                   GQ+Y    R FV FL+++L K   +S+   ++ I  G+   +D++SW ++EA K
Sbjct  124   LSGSCYGQDYMFV-REFVAFLASVLLKCCKQSDSSDMETILGGLASLSDELSWFKKEAAK  182

Query  943   LHVSLDSVVPYQPTIDYSKLLESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTP  770
               V L  + P    ++Y + L+S  D +  YT A++  W  +TVY  +FA C+ EG++TP
Sbjct  183   WSVDLAGISPLSSNMEYCRFLQSFDDPEISYTVAITTFWIIETVYQDSFASCIEEGNKTP  242

Query  769   EEMKEACRKWGGDAQGDYCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
              E+   C++WG      YC SLQR AD  L  AP DV+  AE   L  LE+ + FW+
Sbjct  243   AELLGTCQRWGSPEFKQYCQSLQRIADRCLANAPPDVVKNAEEAFLRVLELEIGFWD  299



>ref|XP_009592107.1| PREDICTED: transcriptional activator DEMETER-like [Nicotiana 
tomentosiformis]
 ref|XP_009592108.1| PREDICTED: transcriptional activator DEMETER-like [Nicotiana 
tomentosiformis]
 ref|XP_009592109.1| PREDICTED: transcriptional activator DEMETER-like [Nicotiana 
tomentosiformis]
Length=1934

 Score =   158 bits (399),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI+VPR+L+W LPRRTVYFGTSVSTIFKGLST+QIQHCFWRGFVCVRGFD KTRAPRPL
Sbjct  1834  NPINVPRKLLWSLPRRTVYFGTSVSTIFKGLSTEQIQHCFWRGFVCVRGFDHKTRAPRPL  1893

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             IARLHFPAS+L KN++++ +K+ +AA+
Sbjct  1894  IARLHFPASKLVKNRSDDRKKEGAAAE  1920



>gb|KHN02900.1| Seed maturation protein PM36 [Glycine soja]
Length=188

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 114/211 (54%), Gaps = 42/211 (20%)
 Frame = -1

Query  1225  MGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLL  1046
             +GM+ETW+RKH L+   ATR+P   +I D T+ ++SF  WL Q+Y L  RAFVPF +++L
Sbjct  12    IGMSETWLRKHRLIYDGATRHPLIISICDGTIIIASFKTWLAQDY-LFVRAFVPFAASVL  70

Query  1045  QKARHESN--DIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESL  872
              KA  ES+    ++VI  G+    D+ISW + EA K                        
Sbjct  71    IKAWKESDCRGDMEVILGGVASLEDEISWFKAEANK------------------------  106

Query  871   TDDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRTA  692
                         WA   VY  +FAHC+ EGS+ P E+KE C +WG +A G YC SLQ  A
Sbjct  107   ------------WA---VYQESFAHCIEEGSKIPPELKETCARWGNEAFGKYCQSLQNIA  151

Query  691   DGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             +  L+KA  + + KAE  LL  LE  V+FWN
Sbjct  152   NRRLQKASDEELKKAEFMLLSVLEHEVEFWN  182



>ref|XP_008361811.1| PREDICTED: protein ROS1-like [Malus domestica]
Length=105

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
            NPIDVPR  IW LPRRTVYFGTSVSTIFKGLST+ IQ+CFWRG+VCVRGF++KTRAPRPL
Sbjct  26   NPIDVPRGWIWNLPRRTVYFGTSVSTIFKGLSTEGIQYCFWRGYVCVRGFERKTRAPRPL  85

Query  182  IARLHFPASRLAKNKNENGR  241
            +ARLHFPAS++ K KNE  +
Sbjct  86   MARLHFPASKMTKTKNEEKK  105



>ref|XP_009784770.1| PREDICTED: transcriptional activator DEMETER-like [Nicotiana 
sylvestris]
 ref|XP_009784777.1| PREDICTED: transcriptional activator DEMETER-like [Nicotiana 
sylvestris]
 ref|XP_009784785.1| PREDICTED: transcriptional activator DEMETER-like [Nicotiana 
sylvestris]
Length=1940

 Score =   151 bits (382),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 66/78 (85%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI+VPR+L+W LPRRTVYFGTSVSTIFKGLST+QIQHCFWRGFVCVRGFD KTRAPRPL
Sbjct  1840  NPINVPRKLLWSLPRRTVYFGTSVSTIFKGLSTEQIQHCFWRGFVCVRGFDHKTRAPRPL  1899

Query  182   IARLHFPASRLAKNKNEN  235
             IARLHFPAS+L KN++++
Sbjct  1900  IARLHFPASKLVKNRSDD  1917



>ref|XP_007010232.1| DNA N-glycosylase/DNA-(Apurinic or apyrimidinic site) lyase, 
putative isoform 5 [Theobroma cacao]
 gb|EOY19042.1| DNA N-glycosylase/DNA-(Apurinic or apyrimidinic site) lyase, 
putative isoform 5 [Theobroma cacao]
Length=1978

 Score =   150 bits (379),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+DVPR  +W LPRRTVYFGTSVSTIFKGLST++IQ+CFW+GFVCVRGFDQKTRAPRPL
Sbjct  1899  NPMDVPREWLWNLPRRTVYFGTSVSTIFKGLSTEEIQYCFWKGFVCVRGFDQKTRAPRPL  1958

Query  182   IARLHFPASRLAKNKNENGR  241
             +ARLHFPAS+LAK +N++ R
Sbjct  1959  MARLHFPASKLAKTQNKSKR  1978



>ref|XP_007010230.1| DNA N-glycosylase/DNA-(Apurinic or apyrimidinic site) lyase, 
putative isoform 3 [Theobroma cacao]
 ref|XP_007010231.1| DNA N-glycosylase/DNA-(Apurinic or apyrimidinic site) lyase, 
putative isoform 3 [Theobroma cacao]
 gb|EOY19040.1| DNA N-glycosylase/DNA-(Apurinic or apyrimidinic site) lyase, 
putative isoform 3 [Theobroma cacao]
 gb|EOY19041.1| DNA N-glycosylase/DNA-(Apurinic or apyrimidinic site) lyase, 
putative isoform 3 [Theobroma cacao]
Length=1979

 Score =   150 bits (379),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+DVPR  +W LPRRTVYFGTSVSTIFKGLST++IQ+CFW+GFVCVRGFDQKTRAPRPL
Sbjct  1900  NPMDVPREWLWNLPRRTVYFGTSVSTIFKGLSTEEIQYCFWKGFVCVRGFDQKTRAPRPL  1959

Query  182   IARLHFPASRLAKNKNENGR  241
             +ARLHFPAS+LAK +N++ R
Sbjct  1960  MARLHFPASKLAKTQNKSKR  1979



>ref|XP_007203210.1| hypothetical protein PRUPE_ppa000207mg [Prunus persica]
 gb|EMJ04409.1| hypothetical protein PRUPE_ppa000207mg [Prunus persica]
Length=1469

 Score =   149 bits (377),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PIDVPR  IW LPRRTVYFGTSVSTIFKGLST+ IQ+CFWRG+VCVRGFD+KTRAPRPL
Sbjct  1390  SPIDVPRGWIWNLPRRTVYFGTSVSTIFKGLSTEGIQYCFWRGYVCVRGFDRKTRAPRPL  1449

Query  182   IARLHFPASRLAKNKNENGR  241
             IARLHFPASRL K KNE  R
Sbjct  1450  IARLHFPASRLTKTKNEEKR  1469



>ref|XP_008240460.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Prunus mume]
 ref|XP_008240461.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Prunus mume]
 ref|XP_008240462.1| PREDICTED: transcriptional activator DEMETER-like isoform X2 
[Prunus mume]
Length=1999

 Score =   149 bits (377),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PIDVPR  IW LPRRTVYFGTSVSTIFKGLST+ IQ+CFWRG+VCVRGFD+KTRAPRPL
Sbjct  1920  SPIDVPRGWIWNLPRRTVYFGTSVSTIFKGLSTEGIQYCFWRGYVCVRGFDRKTRAPRPL  1979

Query  182   IARLHFPASRLAKNKNENGR  241
             IARLHFPASRL K KNE  R
Sbjct  1980  IARLHFPASRLTKTKNEEKR  1999



>ref|XP_008446781.1| PREDICTED: transcriptional activator DEMETER isoform X1 [Cucumis 
melo]
 ref|XP_008446782.1| PREDICTED: transcriptional activator DEMETER isoform X1 [Cucumis 
melo]
Length=1844

 Score =   148 bits (374),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR+ +W LPRRTVYFGTSVSTIFKGL T++IQ CFWRGFVCVRGFDQKTRAPRPLI
Sbjct  1766  PIDVPRKWLWNLPRRTVYFGTSVSTIFKGLVTEEIQQCFWRGFVCVRGFDQKTRAPRPLI  1825

Query  185   ARLHFPASRLAKNKN  229
             ARLHFPAS+LAK KN
Sbjct  1826  ARLHFPASKLAKVKN  1840



>gb|KDO71903.1| hypothetical protein CISIN_1g0264162mg [Citrus sinensis]
Length=192

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 109/183 (60%), Gaps = 15/183 (8%)
 Frame = -1

Query  1105  LGQEYWLAKRAFVPFLSTLLQKARHESNDI---VQVIQTGIGLQNDKISWLEREAEKLHV  935
             LGQ+Y +  R FV F +++L KA  ES+D     +VI  G+   +D+I+W ++EA K  V
Sbjct  5     LGQDY-IFVREFVAFAASVLVKAWKESDDSKGDTEVILGGMAGLHDEIAWFKKEASKWGV  63

Query  934   SLDSVVPYQPTIDYSKLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEM  761
              L   VP +    Y + LESL   + DYT A+++ WA + VY  +FAHCL   + TP E+
Sbjct  64    ELSETVPQKANQVYCRFLESLMSPEVDYTVAITVFWAIEAVYQESFAHCLEPDTNTPPEL  123

Query  760   KEACRKWGGDAQGDYCLSLQRTADGALEKAPRDVIV---------KAEVTLLEFLEISVQ  608
             +E C++WG D  G YC SL++ A+  LEKA  D+I+         KAEV L+  LE  V+
Sbjct  124   QEVCQRWGNDGFGQYCHSLKKIANRLLEKASDDLIMGKAGDDVLKKAEVELIRVLEHEVE  183

Query  607   FWN  599
             FWN
Sbjct  184   FWN  186



>ref|XP_004150492.1| PREDICTED: transcriptional activator DEMETER-like [Cucumis sativus]
Length=1679

 Score =   148 bits (374),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR+ +W LPRRTVYFGTSVSTIFKGL T++IQ CFWRGFVCVRGFDQKTRAPRPLI
Sbjct  1601  PIDVPRKWLWNLPRRTVYFGTSVSTIFKGLVTEEIQQCFWRGFVCVRGFDQKTRAPRPLI  1660

Query  185   ARLHFPASRLAKNKN  229
             ARLHFPAS+LAK KN
Sbjct  1661  ARLHFPASKLAKVKN  1675



>ref|XP_002316518.2| hypothetical protein POPTR_0010s24060g [Populus trichocarpa]
 gb|EEF02689.2| hypothetical protein POPTR_0010s24060g [Populus trichocarpa]
Length=1867

 Score =   148 bits (374),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 67/77 (87%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRR VYFGTSVS+IFKGLST+ IQ CFWRGFVCVRGFDQKTRAPRPL
Sbjct  1789  NPIDVPRSLIWNLPRRIVYFGTSVSSIFKGLSTEGIQFCFWRGFVCVRGFDQKTRAPRPL  1848

Query  182   IARLHFPASRLAKNKNE  232
              ARLHFPASRL K KNE
Sbjct  1849  KARLHFPASRLVKTKNE  1865



>ref|XP_004164145.1| PREDICTED: transcriptional activator DEMETER-like [Cucumis sativus]
Length=1736

 Score =   148 bits (373),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR+ +W LPRRTVYFGTSVSTIFKGL T++IQ CFWRGFVCVRGFDQKTRAPRPLI
Sbjct  1658  PIDVPRKWLWNLPRRTVYFGTSVSTIFKGLVTEEIQQCFWRGFVCVRGFDQKTRAPRPLI  1717

Query  185   ARLHFPASRLAKNKN  229
             ARLHFPAS+LAK KN
Sbjct  1718  ARLHFPASKLAKVKN  1732



>gb|KGN52209.1| hypothetical protein Csa_5G615310 [Cucumis sativus]
Length=1844

 Score =   148 bits (373),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR+ +W LPRRTVYFGTSVSTIFKGL T++IQ CFWRGFVCVRGFDQKTRAPRPLI
Sbjct  1766  PIDVPRKWLWNLPRRTVYFGTSVSTIFKGLVTEEIQQCFWRGFVCVRGFDQKTRAPRPLI  1825

Query  185   ARLHFPASRLAKNKN  229
             ARLHFPAS+LAK KN
Sbjct  1826  ARLHFPASKLAKVKN  1840



>ref|XP_010049911.1| PREDICTED: protein ROS1-like isoform X1 [Eucalyptus grandis]
 gb|KCW89251.1| hypothetical protein EUGRSUZ_A01547 [Eucalyptus grandis]
Length=1851

 Score =   147 bits (371),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR L+W L RRTVYFGTS+ TIFKGLST+ IQHCFWRGFVCVRGFD+KTRAPRPL
Sbjct  1770  NPIDVPRSLLWKLQRRTVYFGTSIPTIFKGLSTEGIQHCFWRGFVCVRGFDRKTRAPRPL  1829

Query  182   IARLHFPASRLAKNKNENGRKQ  247
             +ARLHFPAS+L KNK + G  Q
Sbjct  1830  MARLHFPASKLPKNKGKKGDGQ  1851



>ref|XP_010049920.1| PREDICTED: protein ROS1-like isoform X2 [Eucalyptus grandis]
Length=1852

 Score =   147 bits (371),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR L+W L RRTVYFGTS+ TIFKGLST+ IQHCFWRGFVCVRGFD+KTRAPRPL
Sbjct  1771  NPIDVPRSLLWKLQRRTVYFGTSIPTIFKGLSTEGIQHCFWRGFVCVRGFDRKTRAPRPL  1830

Query  182   IARLHFPASRLAKNKNENGRKQ  247
             +ARLHFPAS+L KNK + G  Q
Sbjct  1831  MARLHFPASKLPKNKGKKGDGQ  1852



>ref|XP_006419402.1| hypothetical protein CICLE_v10005751mg [Citrus clementina]
 gb|ESR32642.1| hypothetical protein CICLE_v10005751mg [Citrus clementina]
Length=189

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 108/182 (59%), Gaps = 15/182 (8%)
 Frame = -1

Query  1102  GQEYWLAKRAFVPFLSTLLQKARHESNDI---VQVIQTGIGLQNDKISWLEREAEKLHVS  932
             GQ+Y +  R FV F +++L KA  ES+D     +VI  G+   +D+I+W ++EA K  V 
Sbjct  3     GQDY-IFVREFVAFAASVLIKAWKESDDSEGDTEVILGGMAGLHDEIAWFKKEASKWGVE  61

Query  931   LDSVVPYQPTIDYSKLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMK  758
             L   VP +    Y + LESL   + DYT A+++ WA + VY  +FAHCL   + TP E++
Sbjct  62    LSETVPQKANQLYCRFLESLMSPEVDYTVAITVFWAIEAVYQESFAHCLEPDTNTPPELQ  121

Query  757   EACRKWGGDAQGDYCLSLQRTADGALEKAPRDVIV---------KAEVTLLEFLEISVQF  605
             E C++WG D  G YC SL++ A+  LEKA  D+IV         KAEV L+  LE  V+F
Sbjct  122   EVCQRWGNDGFGQYCHSLKKIANRLLEKASDDLIVGKAGDDVLKKAEVELIRVLEHEVEF  181

Query  604   WN  599
             WN
Sbjct  182   WN  183



>ref|XP_002311968.2| hypothetical protein POPTR_0008s02610g [Populus trichocarpa]
 gb|EEE89335.2| hypothetical protein POPTR_0008s02610g [Populus trichocarpa]
Length=1372

 Score =   146 bits (369),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRR VYFGTSV +IFKGLST+ +QHCFW+GFVCVRGFDQKTRAPRPL
Sbjct  1294  NPIDVPRSLIWNLPRRIVYFGTSVPSIFKGLSTEGVQHCFWKGFVCVRGFDQKTRAPRPL  1353

Query  182   IARLHFPASRLAKNKNE  232
              ARLHFP SRL K KNE
Sbjct  1354  KARLHFPVSRLVKTKNE  1370



>ref|XP_002311047.2| hypothetical protein POPTR_0008s02610g [Populus trichocarpa]
 gb|EEE88414.2| hypothetical protein POPTR_0008s02610g [Populus trichocarpa]
Length=1375

 Score =   146 bits (369),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRR VYFGTSV +IFKGLST+ +QHCFW+GFVCVRGFDQKTRAPRPL
Sbjct  1297  NPIDVPRSLIWNLPRRIVYFGTSVPSIFKGLSTEGVQHCFWKGFVCVRGFDQKTRAPRPL  1356

Query  182   IARLHFPASRLAKNKNE  232
              ARLHFP SRL K KNE
Sbjct  1357  KARLHFPVSRLVKTKNE  1373



>ref|XP_006360485.1| PREDICTED: transcriptional activator DEMETER-like [Solanum tuberosum]
Length=1851

 Score =   147 bits (370),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PI VPR+L+W L RRTVYFGTSVSTIFKGLST+QIQ+CFWRGFVCVRGFD++ RAPRPL
Sbjct  1751  DPIHVPRKLLWSLSRRTVYFGTSVSTIFKGLSTEQIQYCFWRGFVCVRGFDREMRAPRPL  1810

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             IARLHFPAS++ KN++++ +K+ +AA+
Sbjct  1811  IARLHFPASKMVKNRSDDKKKEGTAAE  1837



>ref|XP_011024268.1| PREDICTED: transcriptional activator DEMETER [Populus euphratica]
 ref|XP_011024269.1| PREDICTED: transcriptional activator DEMETER [Populus euphratica]
 ref|XP_011024270.1| PREDICTED: transcriptional activator DEMETER [Populus euphratica]
Length=1867

 Score =   146 bits (369),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 66/77 (86%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRR VYFGTSVS+IFKGLST+ IQ CFWRGFVCVRGFD+KTRAPRPL
Sbjct  1789  NPIDVPRSLIWNLPRRIVYFGTSVSSIFKGLSTEGIQFCFWRGFVCVRGFDRKTRAPRPL  1848

Query  182   IARLHFPASRLAKNKNE  232
              ARLHFPASRL K KNE
Sbjct  1849  KARLHFPASRLVKTKNE  1865



>gb|KDO71905.1| hypothetical protein CISIN_1g0264162mg, partial [Citrus sinensis]
Length=187

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 15/182 (8%)
 Frame = -1

Query  1102  GQEYWLAKRAFVPFLSTLLQKARHESNDI---VQVIQTGIGLQNDKISWLEREAEKLHVS  932
             GQ+Y +  R FV F +++L KA  ES+D     +VI  G+   +D+I+W ++EA K  V 
Sbjct  1     GQDY-IFVREFVAFAASVLVKAWKESDDSKGDTEVILGGMAGLHDEIAWFKKEASKWGVE  59

Query  931   LDSVVPYQPTIDYSKLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMK  758
             L   VP +    Y + LESL   + DYT A+++ WA + VY  +FAHCL   + TP E++
Sbjct  60    LSETVPQKANQVYCRFLESLMSPEVDYTVAITVFWAIEAVYQESFAHCLEPDTNTPPELQ  119

Query  757   EACRKWGGDAQGDYCLSLQRTADGALEKAPRDVIV---------KAEVTLLEFLEISVQF  605
             E C++WG D  G YC SL++ A+  LEKA  D+I+         KAEV L+  LE  V+F
Sbjct  120   EVCQRWGNDGFGQYCHSLKKIANRLLEKASDDLIMGKAGDDVLKKAEVELIRVLEHEVEF  179

Query  604   WN  599
             WN
Sbjct  180   WN  181



>gb|KDO71904.1| hypothetical protein CISIN_1g0264162mg [Citrus sinensis]
Length=189

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 15/182 (8%)
 Frame = -1

Query  1102  GQEYWLAKRAFVPFLSTLLQKARHESNDI---VQVIQTGIGLQNDKISWLEREAEKLHVS  932
             GQ+Y +  R FV F +++L KA  ES+D     +VI  G+   +D+I+W ++EA K  V 
Sbjct  3     GQDY-IFVREFVAFAASVLVKAWKESDDSKGDTEVILGGMAGLHDEIAWFKKEASKWGVE  61

Query  931   LDSVVPYQPTIDYSKLLESLT--DDDYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMK  758
             L   VP +    Y + LESL   + DYT A+++ WA + VY  +FAHCL   + TP E++
Sbjct  62    LSETVPQKANQVYCRFLESLMSPEVDYTVAITVFWAIEAVYQESFAHCLEPDTNTPPELQ  121

Query  757   EACRKWGGDAQGDYCLSLQRTADGALEKAPRDVIV---------KAEVTLLEFLEISVQF  605
             E C++WG D  G YC SL++ A+  LEKA  D+I+         KAEV L+  LE  V+F
Sbjct  122   EVCQRWGNDGFGQYCHSLKKIANRLLEKASDDLIMGKAGDDVLKKAEVELIRVLEHEVEF  181

Query  604   WN  599
             WN
Sbjct  182   WN  183



>ref|XP_011032803.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Populus euphratica]
Length=1881

 Score =   146 bits (368),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRR VYFGTSV +IFKGLST+ +QHCFW+GFVCVRGFDQKTRAPRPL
Sbjct  1803  NPIDVPRSLIWNLPRRIVYFGTSVPSIFKGLSTEGVQHCFWKGFVCVRGFDQKTRAPRPL  1862

Query  182   IARLHFPASRLAKNKNE  232
              ARLHFP SRL K KNE
Sbjct  1863  KARLHFPVSRLVKTKNE  1879



>ref|XP_011032804.1| PREDICTED: transcriptional activator DEMETER-like isoform X2 
[Populus euphratica]
Length=1878

 Score =   146 bits (368),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRR VYFGTSV +IFKGLST+ +QHCFW+GFVCVRGFDQKTRAPRPL
Sbjct  1800  NPIDVPRSLIWNLPRRIVYFGTSVPSIFKGLSTEGVQHCFWKGFVCVRGFDQKTRAPRPL  1859

Query  182   IARLHFPASRLAKNKNE  232
              ARLHFP SRL K KNE
Sbjct  1860  KARLHFPVSRLVKTKNE  1876



>ref|XP_011010411.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Populus euphratica]
Length=1881

 Score =   146 bits (368),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRR VYFGTSV +IFKGLST+ +QHCFW+GFVCVRGFDQKTRAPRPL
Sbjct  1803  NPIDVPRSLIWNLPRRIVYFGTSVPSIFKGLSTEGVQHCFWKGFVCVRGFDQKTRAPRPL  1862

Query  182   IARLHFPASRLAKNKNE  232
              ARLHFP SRL K KNE
Sbjct  1863  KARLHFPVSRLVKTKNE  1879



>ref|XP_002277401.1| PREDICTED: transcriptional activator DEMETER-like [Vitis vinifera]
 ref|XP_010654037.1| PREDICTED: transcriptional activator DEMETER-like [Vitis vinifera]
Length=1942

 Score =   146 bits (368),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 66/81 (81%), Positives = 71/81 (88%), Gaps = 3/81 (4%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGLST+ IQ+CFWRGFVCVRGFDQKTRAPRPL
Sbjct  1862  NPIDVPRAWIWNLPRRTVYFGTSIPTIFKGLSTEDIQYCFWRGFVCVRGFDQKTRAPRPL  1921

Query  182   IARLHFPASRLAKNK---NEN  235
             +ARLHFPASRL + K   NEN
Sbjct  1922  MARLHFPASRLTRTKGKINEN  1942



>ref|XP_011010412.1| PREDICTED: transcriptional activator DEMETER-like isoform X2 
[Populus euphratica]
Length=1878

 Score =   146 bits (368),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/77 (83%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRR VYFGTSV +IFKGLST+ +QHCFW+GFVCVRGFDQKTRAPRPL
Sbjct  1800  NPIDVPRSLIWNLPRRIVYFGTSVPSIFKGLSTEGVQHCFWKGFVCVRGFDQKTRAPRPL  1859

Query  182   IARLHFPASRLAKNKNE  232
              ARLHFP SRL K KNE
Sbjct  1860  KARLHFPVSRLVKTKNE  1876



>ref|XP_009612084.1| PREDICTED: protein ROS1-like isoform X1 [Nicotiana tomentosiformis]
Length=1817

 Score =   145 bits (366),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRGFVCVRGFD+KTRAPRPL
Sbjct  1737  NPIDVPRDWLWNLPRRTVYFGTSIPTIFKGLTTESIQHCFWRGFVCVRGFDKKTRAPRPL  1796

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPASRL+K K +
Sbjct  1797  MARLHFPASRLSKTKGK  1813



>ref|XP_004250000.2| PREDICTED: transcriptional activator DEMETER isoform X1 [Solanum 
lycopersicum]
Length=1869

 Score =   145 bits (366),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PI VPR+L+W L +RTVYFGTSVSTIFKGLST+QIQ+CFWRGFVCVRGFD++ RAPRPL
Sbjct  1769  DPIHVPRKLLWSLSKRTVYFGTSVSTIFKGLSTEQIQYCFWRGFVCVRGFDREMRAPRPL  1828

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             IARLHFPAS++ KN++++ +K+ +AA+
Sbjct  1829  IARLHFPASKMVKNRSDDKKKEGTAAE  1855



>ref|XP_010312568.1| PREDICTED: transcriptional activator DEMETER isoform X2 [Solanum 
lycopersicum]
Length=1868

 Score =   145 bits (366),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PI VPR+L+W L +RTVYFGTSVSTIFKGLST+QIQ+CFWRGFVCVRGFD++ RAPRPL
Sbjct  1768  DPIHVPRKLLWSLSKRTVYFGTSVSTIFKGLSTEQIQYCFWRGFVCVRGFDREMRAPRPL  1827

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             IARLHFPAS++ KN++++ +K+ +AA+
Sbjct  1828  IARLHFPASKMVKNRSDDKKKEGTAAE  1854



>ref|XP_011018881.1| PREDICTED: protein ROS1 isoform X2 [Populus euphratica]
Length=1809

 Score =   145 bits (366),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRG+VCVRGFDQKTRAPRPL
Sbjct  1728  NPIDVPRAWIWNLPRRTVYFGTSIPTIFKGLTTEGIQHCFWRGYVCVRGFDQKTRAPRPL  1787

Query  182   IARLHFPASRLAKNK  226
             +ARLHFPAS+L + K
Sbjct  1788  MARLHFPASKLTQTK  1802



>ref|XP_011018880.1| PREDICTED: protein ROS1 isoform X1 [Populus euphratica]
Length=1812

 Score =   145 bits (366),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRG+VCVRGFDQKTRAPRPL
Sbjct  1731  NPIDVPRAWIWNLPRRTVYFGTSIPTIFKGLTTEGIQHCFWRGYVCVRGFDQKTRAPRPL  1790

Query  182   IARLHFPASRLAKNK  226
             +ARLHFPAS+L + K
Sbjct  1791  MARLHFPASKLTQTK  1805



>dbj|BAN14901.1| repressor of silencing 1 [Nicotiana benthamiana]
Length=1796

 Score =   145 bits (365),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRGFVCVRGFD+KTRAPRPL
Sbjct  1716  NPIDVPRDWLWNLPRRTVYFGTSIPTIFKGLTTESIQHCFWRGFVCVRGFDKKTRAPRPL  1775

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPASRL++ K +
Sbjct  1776  MARLHFPASRLSRTKGK  1792



>ref|XP_004161268.1| PREDICTED: uncharacterized protein LOC101230418 [Cucumis sativus]
Length=1768

 Score =   144 bits (364),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGLST  IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1688  NPIDVPRDWIWNLPRRTVYFGTSIPTIFKGLSTQGIQHCFWRGFVCVRGFDQKTRAPRPL  1747

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L + + +
Sbjct  1748  MARLHFPASKLNRGRGK  1764



>emb|CBI30244.3| unnamed protein product [Vitis vinifera]
Length=1470

 Score =   144 bits (364),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 66/81 (81%), Positives = 71/81 (88%), Gaps = 3/81 (4%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGLST+ IQ+CFWRGFVCVRGFDQKTRAPRPL
Sbjct  1390  NPIDVPRAWIWNLPRRTVYFGTSIPTIFKGLSTEDIQYCFWRGFVCVRGFDQKTRAPRPL  1449

Query  182   IARLHFPASRLAKNK---NEN  235
             +ARLHFPASRL + K   NEN
Sbjct  1450  MARLHFPASRLTRTKGKINEN  1470



>dbj|BAF52855.1| repressor of silencing 1 [Nicotiana tabacum]
Length=1796

 Score =   144 bits (364),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRGFVCVRGFD+KTRAPRPL
Sbjct  1716  NPIDVPRDWLWNLPRRTVYFGTSIPTIFKGLTTESIQHCFWRGFVCVRGFDKKTRAPRPL  1775

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPASRL++ K +
Sbjct  1776  MARLHFPASRLSRTKGK  1792



>ref|XP_004138006.1| PREDICTED: uncharacterized protein LOC101222935 [Cucumis sativus]
Length=1849

 Score =   144 bits (364),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGLST  IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1769  NPIDVPRDWIWNLPRRTVYFGTSIPTIFKGLSTQGIQHCFWRGFVCVRGFDQKTRAPRPL  1828

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L + + +
Sbjct  1829  MARLHFPASKLNRGRGK  1845



>gb|KGN59055.1| hypothetical protein Csa_3G748840 [Cucumis sativus]
Length=1851

 Score =   144 bits (364),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGLST  IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1771  NPIDVPRDWIWNLPRRTVYFGTSIPTIFKGLSTQGIQHCFWRGFVCVRGFDQKTRAPRPL  1830

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L + + +
Sbjct  1831  MARLHFPASKLNRGRGK  1847



>ref|XP_009791223.1| PREDICTED: protein ROS1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009791224.1| PREDICTED: protein ROS1-like isoform X1 [Nicotiana sylvestris]
Length=1796

 Score =   144 bits (364),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRGFVCVRGFD+KTRAPRPL
Sbjct  1716  NPIDVPRDWLWNLPRRTVYFGTSIPTIFKGLTTESIQHCFWRGFVCVRGFDKKTRAPRPL  1775

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPASRL++ K +
Sbjct  1776  MARLHFPASRLSRTKGK  1792



>ref|XP_008442796.1| PREDICTED: protein ROS1-like [Cucumis melo]
Length=1851

 Score =   144 bits (363),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGLST  IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1771  NPIDVPRDWIWNLPRRTVYFGTSIPTIFKGLSTQGIQHCFWRGFVCVRGFDQKTRAPRPL  1830

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L + + +
Sbjct  1831  MARLHFPASKLNRGRGK  1847



>ref|XP_006381317.1| hypothetical protein POPTR_0006s11720g [Populus trichocarpa]
 gb|ERP59114.1| hypothetical protein POPTR_0006s11720g [Populus trichocarpa]
Length=1329

 Score =   144 bits (362),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGL+T  IQHCFWRG+VCVRGFDQKTRAPRPL
Sbjct  1248  NPIDVPRAWIWNLPRRTVYFGTSIPTIFKGLTTAGIQHCFWRGYVCVRGFDQKTRAPRPL  1307

Query  182   IARLHFPASRLAKNK  226
             +ARLHFPAS+L + K
Sbjct  1308  MARLHFPASKLTQTK  1322



>gb|EEE54121.1| hypothetical protein OsJ_00892 [Oryza sativa Japonica Group]
Length=1964

 Score =   144 bits (362),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGL+T++IQHCFWRGFVCVRGFD+ +RAPRPL
Sbjct  1878  NPIDVPRSWIWNLPRRTVYFGTSIPTIFKGLTTEEIQHCFWRGFVCVRGFDRTSRAPRPL  1937

Query  182   IARLHFPASRLAKNKNENG  238
              ARLHFPAS++ +NK   G
Sbjct  1938  YARLHFPASKITRNKKSAG  1956



>gb|EEC70183.1| hypothetical protein OsI_00912 [Oryza sativa Indica Group]
Length=1952

 Score =   144 bits (362),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGL+T++IQHCFWRGFVCVRGFD+ +RAPRPL
Sbjct  1866  NPIDVPRSWIWNLPRRTVYFGTSIPTIFKGLTTEEIQHCFWRGFVCVRGFDRTSRAPRPL  1925

Query  182   IARLHFPASRLAKNKNENG  238
              ARLHFPAS++ +NK   G
Sbjct  1926  YARLHFPASKITRNKKSAG  1944



>ref|XP_006606917.1| PREDICTED: transcriptional activator DEMETER-like [Glycine max]
Length=1848

 Score =   144 bits (362),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 62/72 (86%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PID+PR  IW LPRRT YFGTSVS+IFKGLST QIQHCFWRGFVCVRGFDQK RAPRPL 
Sbjct  1774  PIDIPREWIWNLPRRTAYFGTSVSSIFKGLSTQQIQHCFWRGFVCVRGFDQKERAPRPLQ  1833

Query  185   ARLHFPASRLAK  220
             ARLHF ASRLAK
Sbjct  1834  ARLHFSASRLAK  1845



>gb|KDO39948.1| hypothetical protein CISIN_1g002245mg [Citrus sinensis]
Length=947

 Score =   142 bits (359),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
            NPIDVPR  +W LPRR VYFGTSVS+IFKGLST+ IQ CFW+GFVCVRGFDQK+RAPRPL
Sbjct  868  NPIDVPREWLWNLPRRMVYFGTSVSSIFKGLSTEGIQFCFWKGFVCVRGFDQKSRAPRPL  927

Query  182  IARLHFPASRLAKNKNEN  235
            +ARLHFPAS+L K +N+N
Sbjct  928  MARLHFPASKLVKARNKN  945



>ref|XP_006660456.1| PREDICTED: transcriptional activator DEMETER-like [Oryza brachyantha]
Length=1943

 Score =   143 bits (361),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRGFVCVRGFD+ +RAPRPL
Sbjct  1857  NPIDVPRSWIWDLPRRTVYFGTSIPTIFKGLTTEDIQHCFWRGFVCVRGFDKTSRAPRPL  1916

Query  182   IARLHFPASRLAKNKNENG  238
              ARLHFPAS++ +NK   G
Sbjct  1917  YARLHFPASKITRNKKSAG  1935



>ref|XP_006647291.1| PREDICTED: uncharacterized protein LOC102715541 isoform X2 [Oryza 
brachyantha]
Length=1983

 Score =   142 bits (359),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 5/85 (6%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIF+GL+T++IQHCFWRGFVCVRGFD+K+RAPRPL
Sbjct  1897  NPIDVPRSWIWNLPRRTVYFGTSVPTIFRGLNTEEIQHCFWRGFVCVRGFDRKSRAPRPL  1956

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
              ARLHFPAS++A+     G+K A+A
Sbjct  1957  YARLHFPASKVAR-----GKKPAAA  1976



>ref|XP_006647290.1| PREDICTED: uncharacterized protein LOC102715541 isoform X1 [Oryza 
brachyantha]
Length=2008

 Score =   142 bits (359),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 5/85 (6%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIF+GL+T++IQHCFWRGFVCVRGFD+K+RAPRPL
Sbjct  1922  NPIDVPRSWIWNLPRRTVYFGTSVPTIFRGLNTEEIQHCFWRGFVCVRGFDRKSRAPRPL  1981

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
              ARLHFPAS++A+     G+K A+A
Sbjct  1982  YARLHFPASKVAR-----GKKPAAA  2001



>ref|XP_002871102.1| hypothetical protein ARALYDRAFT_487239 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47361.1| hypothetical protein ARALYDRAFT_487239 [Arabidopsis lyrata subsp. 
lyrata]
Length=1997

 Score =   142 bits (359),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ CFW+GFVCVRGF+QKTRAPRPL
Sbjct  1922  NPIDVPRDWIWDLPRRTVYFGTSVTSIFRGLSTEQIQFCFWKGFVCVRGFEQKTRAPRPL  1981

Query  182   IARLHFPASRLAKNK  226
             +ARLHFPAS+L  NK
Sbjct  1982  MARLHFPASKLKNNK  1996



>ref|XP_004956377.1| PREDICTED: uncharacterized protein LOC101769541 isoform X1 [Setaria 
italica]
Length=1988

 Score =   142 bits (359),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPID+PR  IW LPRRTVYFGTSV TIFKGLST+ IQHCFWRGFVCVRGFD+ +RAPRPL
Sbjct  1902  NPIDIPRSSIWNLPRRTVYFGTSVPTIFKGLSTEDIQHCFWRGFVCVRGFDRTSRAPRPL  1961

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS++ +NK
Sbjct  1962  YARLHFPASKITRNK  1976



>gb|AGU16984.1| DEMETER [Citrus sinensis]
Length=1573

 Score =   142 bits (358),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRR VYFGTSVS+IFKGLST+ IQ CFW+GFVCVRGFDQK+RAPRPL
Sbjct  1494  NPIDVPREWLWNLPRRMVYFGTSVSSIFKGLSTEGIQFCFWKGFVCVRGFDQKSRAPRPL  1553

Query  182   IARLHFPASRLAKNKNEN  235
             +ARLHFPAS+L K +N+N
Sbjct  1554  MARLHFPASKLVKARNKN  1571



>gb|KDP42755.1| hypothetical protein JCGZ_23695 [Jatropha curcas]
Length=1882

 Score =   142 bits (358),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PIDVPR  IW LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRG+VCVRGFDQKTRAPRPL
Sbjct  1802  DPIDVPRSWIWNLPRRTVYFGTSIPTIFKGLTTEGIQHCFWRGYVCVRGFDQKTRAPRPL  1861

Query  182   IARLHFPASRLAKNKNEN  235
             +ARLHFPAS+L +N+  +
Sbjct  1862  MARLHFPASKLKQNRGRD  1879



>ref|XP_009371824.1| PREDICTED: transcriptional activator DEMETER-like [Pyrus x bretschneideri]
Length=2015

 Score =   142 bits (358),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSVSTIFKGLST+ IQ+CFWRG+VCVRGF++KTRAPRPL
Sbjct  1936  NPIDVPRGWIWNLPRRTVYFGTSVSTIFKGLSTEGIQYCFWRGYVCVRGFERKTRAPRPL  1995

Query  182   IARLHFPASRLAKNKNENGRK  244
             +ARLHFPAS++ K  NE G+K
Sbjct  1996  MARLHFPASKMTKTINE-GKK  2015



>ref|XP_008381296.1| PREDICTED: transcriptional activator DEMETER-like [Malus domestica]
 ref|XP_008381297.1| PREDICTED: transcriptional activator DEMETER-like [Malus domestica]
Length=2014

 Score =   142 bits (357),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSVSTIFKGLST+ IQ+CFWRG+VCVRGF++KTRAPRPL
Sbjct  1935  NPIDVPRGWIWNLPRRTVYFGTSVSTIFKGLSTEGIQYCFWRGYVCVRGFERKTRAPRPL  1994

Query  182   IARLHFPASRLAKNKNENGRK  244
             +ARLHFPAS++ K  NE G+K
Sbjct  1995  MARLHFPASKMTKTINE-GKK  2014



>gb|EPS64413.1| hypothetical protein M569_10368, partial [Genlisea aurea]
Length=1097

 Score =   141 bits (356),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PIDVPR+ +W LPRRTV+FGTS+ TIFKGLST+ IQ+CFWRGFVCVRGFD+K+RAPRPL
Sbjct  1017  SPIDVPRKWLWNLPRRTVFFGTSIPTIFKGLSTEGIQYCFWRGFVCVRGFDRKSRAPRPL  1076

Query  182   IARLHFPASRLAKNKNEN  235
             IARLHFPAS+L K K +N
Sbjct  1077  IARLHFPASKLTKAKGKN  1094



>ref|XP_008386936.1| PREDICTED: protein ROS1 isoform X2 [Malus domestica]
Length=1779

 Score =   142 bits (357),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST +IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1700  NPIDVPRAWLWKLYRRTVYFGTSIPTIFKGLSTPEIQHCFWRGFVCVRGFDQKTRAPRPL  1759

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L K K++
Sbjct  1760  MARLHFPASKLVKTKDK  1776



>ref|XP_008386935.1| PREDICTED: protein ROS1 isoform X1 [Malus domestica]
Length=1802

 Score =   142 bits (357),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST +IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1723  NPIDVPRAWLWKLYRRTVYFGTSIPTIFKGLSTPEIQHCFWRGFVCVRGFDQKTRAPRPL  1782

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L K K++
Sbjct  1783  MARLHFPASKLVKTKDK  1799



>ref|XP_011077237.1| PREDICTED: transcriptional activator DEMETER [Sesamum indicum]
Length=1949

 Score =   142 bits (357),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR LIW LPRRTV+FGTSVSTIFKG+ST+ IQ+CFW+GFVCVRGFDQKTRAPRPL
Sbjct  1874  NPIDVPRSLIWNLPRRTVFFGTSVSTIFKGMSTEDIQYCFWKGFVCVRGFDQKTRAPRPL  1933

Query  182   IARLHFPASRLAKNKNE  232
              ARLH PAS++AK +NE
Sbjct  1934  KARLHLPASKMAK-QNE  1949



>emb|CAB85564.1| putative protein [Arabidopsis thaliana]
Length=234

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
            PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  160  PIDVPRDWIWDLPRRTVYFGTSVTSIFRGLSTEQIQFCFWKGFVCVRGFEQKTRAPRPLM  219

Query  185  ARLHFPASRLAKNK  226
            ARLHFPAS+L  NK
Sbjct  220  ARLHFPASKLKNNK  233



>ref|XP_008386937.1| PREDICTED: protein ROS1 isoform X3 [Malus domestica]
Length=1778

 Score =   141 bits (356),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST +IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1699  NPIDVPRAWLWKLYRRTVYFGTSIPTIFKGLSTPEIQHCFWRGFVCVRGFDQKTRAPRPL  1758

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L K K++
Sbjct  1759  MARLHFPASKLVKTKDK  1775



>ref|XP_009361453.1| PREDICTED: transcriptional activator DEMETER-like [Pyrus x bretschneideri]
Length=1925

 Score =   141 bits (356),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSVSTIF+GLST+ IQ+CFWRG+VCVRGF++KTRAPRPL
Sbjct  1844  NPIDVPRGWIWNLPRRTVYFGTSVSTIFRGLSTEGIQYCFWRGYVCVRGFERKTRAPRPL  1903

Query  182   IARLHFPASRLAKNKNENGRKQ  247
             + RLHFPAS+L++ +NE G KQ
Sbjct  1904  MPRLHFPASKLSRTQNE-GNKQ  1924



>ref|XP_002267310.1| PREDICTED: transcriptional activator DEMETER isoform X1 [Vitis 
vinifera]
 ref|XP_010658708.1| PREDICTED: transcriptional activator DEMETER isoform X1 [Vitis 
vinifera]
Length=2198

 Score =   141 bits (356),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV++IF+GL T+ IQ+CFWRGFVCVRGFDQK+RAPRPL
Sbjct  2120  NPIDVPRAWIWNLPRRTVYFGTSVTSIFRGLPTEGIQYCFWRGFVCVRGFDQKSRAPRPL  2179

Query  182   IARLHFPASRLAKNKNEN  235
             +ARLH  A++L+K KNEN
Sbjct  2180  MARLHLSANKLSKTKNEN  2197



>ref|XP_010658709.1| PREDICTED: transcriptional activator DEMETER isoform X2 [Vitis 
vinifera]
Length=2184

 Score =   141 bits (356),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV++IF+GL T+ IQ+CFWRGFVCVRGFDQK+RAPRPL
Sbjct  2106  NPIDVPRAWIWNLPRRTVYFGTSVTSIFRGLPTEGIQYCFWRGFVCVRGFDQKSRAPRPL  2165

Query  182   IARLHFPASRLAKNKNEN  235
             +ARLH  A++L+K KNEN
Sbjct  2166  MARLHLSANKLSKTKNEN  2183



>ref|XP_006492175.1| PREDICTED: transcriptional activator DEMETER-like isoform X3 
[Citrus sinensis]
Length=1958

 Score =   141 bits (356),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRR VYFGTSVS+IFKGLST+ IQ CFW+GFVCVRGFDQK+RAPRPL
Sbjct  1879  NPIDVPREWLWNLPRRMVYFGTSVSSIFKGLSTEGIQFCFWKGFVCVRGFDQKSRAPRPL  1938

Query  182   IARLHFPASRLAKNKNEN  235
             +ARLHFPAS+L K +N+N
Sbjct  1939  MARLHFPASKLVKARNKN  1956



>ref|XP_003577140.1| PREDICTED: uncharacterized protein LOC100841571 [Brachypodium 
distachyon]
Length=1974

 Score =   141 bits (356),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIFKGL+T+ IQHCFWRGFVCVRGFD+ +RAPRPL
Sbjct  1889  NPIDVPRSWIWNLPRRTVYFGTSVPTIFKGLTTEDIQHCFWRGFVCVRGFDRISRAPRPL  1948

Query  182   IARLHFPASRLAKNKNENGRKQASAAK*DG  271
              ARLHFPAS++ +NK    +  ASAA+ D 
Sbjct  1949  YARLHFPASKITRNK----KPTASAARDDA  1974



>ref|XP_002981477.1| hypothetical protein SELMODRAFT_444885 [Selaginella moellendorffii]
 gb|EFJ17665.1| hypothetical protein SELMODRAFT_444885 [Selaginella moellendorffii]
Length=220

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 118/213 (55%), Gaps = 5/213 (2%)
 Frame = -1

Query  1225  MGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLL  1046
             M +++   R  +L   A T +P+  +IR+ ++ LS +  WLGQ+Y   K AFV F+ ++L
Sbjct  1     MALSQWKSRHAELYNKATTHHPYIVSIRNGSVDLSCYKRWLGQDYIFVK-AFVRFIGSIL  59

Query  1045  QK-ARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
              K   + S++ +  + +G    +D++ W ++EA    + L+ + P + T DY + LE ++
Sbjct  60    AKIPSNASDETLMTLLSGASALHDELQWFQKEAVVWKIGLEDLPPKKTTQDYCRFLEDMS  119

Query  868   DD--DYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
                 DY   LS  WA + VY  +FA CL  GS+TP ++ EAC +WG  + G YC  L+  
Sbjct  120   QPSVDYAVVLSTFWAIEHVYFESFAFCLEPGSKTPHQLVEACGRWGSPSFGSYCDLLRSI  179

Query  694   ADGALEK-APRDVIVKAEVTLLEFLEISVQFWN  599
             A+ A+E     +V  + E   +  L++  +FWN
Sbjct  180   AEAAVESTGSNEVKQRGEDAFVRVLQLENEFWN  212



>ref|XP_006492173.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Citrus sinensis]
 ref|XP_006492174.1| PREDICTED: transcriptional activator DEMETER-like isoform X2 
[Citrus sinensis]
Length=2029

 Score =   141 bits (355),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRR VYFGTSVS+IFKGLST+ IQ CFW+GFVCVRGFDQK+RAPRPL
Sbjct  1950  NPIDVPREWLWNLPRRMVYFGTSVSSIFKGLSTEGIQFCFWKGFVCVRGFDQKSRAPRPL  2009

Query  182   IARLHFPASRLAKNKNEN  235
             +ARLHFPAS+L K +N+N
Sbjct  2010  MARLHFPASKLVKARNKN  2027



>ref|XP_006436684.1| hypothetical protein CICLE_v10030474mg [Citrus clementina]
 gb|ESR49924.1| hypothetical protein CICLE_v10030474mg [Citrus clementina]
Length=2029

 Score =   141 bits (355),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRR VYFGTSVS+IFKGLST+ IQ CFW+GFVCVRGFDQK+RAPRPL
Sbjct  1950  NPIDVPREWLWNLPRRMVYFGTSVSSIFKGLSTEGIQFCFWKGFVCVRGFDQKSRAPRPL  2009

Query  182   IARLHFPASRLAKNKNEN  235
             +ARLHFPAS+L K +N+N
Sbjct  2010  MARLHFPASKLVKARNKN  2027



>ref|XP_009335110.1| PREDICTED: transcriptional activator DEMETER-like [Pyrus x bretschneideri]
 ref|XP_009335115.1| PREDICTED: transcriptional activator DEMETER-like [Pyrus x bretschneideri]
Length=1925

 Score =   141 bits (355),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSVSTIF+GLST+ IQ+CFWRG+VCVRGF++KTRAPRPL
Sbjct  1844  NPIDVPRGWIWNLPRRTVYFGTSVSTIFRGLSTEGIQYCFWRGYVCVRGFERKTRAPRPL  1903

Query  182   IARLHFPASRLAKNKNENGRKQ  247
             + RLHFPAS+L++ +NE G KQ
Sbjct  1904  MPRLHFPASKLSRTQNE-GNKQ  1924



>ref|XP_009365322.1| PREDICTED: protein ROS1-like isoform X1 [Pyrus x bretschneideri]
Length=1801

 Score =   141 bits (355),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST +IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1722  NPIDVPRAWLWKLYRRTVYFGTSIPTIFKGLSTPEIQHCFWRGFVCVRGFDQKTRAPRPL  1781

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L + K++
Sbjct  1782  MARLHFPASKLVRTKDK  1798



>ref|XP_009623013.1| PREDICTED: LOW QUALITY PROTEIN: protein ROS1-like [Nicotiana 
tomentosiformis]
Length=1804

 Score =   141 bits (355),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI+VPR  +W LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRGFVCVRGFD KTRAPRPL
Sbjct  1717  NPINVPRGWLWNLPRRTVYFGTSIPTIFKGLTTESIQHCFWRGFVCVRGFDHKTRAPRPL  1776

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             +ARLHFPAS+L K K +   +  +A +
Sbjct  1777  MARLHFPASKLNKTKGKTDEEHGAAHR  1803



>ref|XP_010452358.1| PREDICTED: transcriptional activator DEMETER-like isoform X2 
[Camelina sativa]
Length=1717

 Score =   141 bits (355),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ+CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  1643  PIDVPRDWIWKLPRRTVYFGTSVTSIFRGLSTEQIQYCFWKGFVCVRGFEQKTRAPRPLM  1702

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1703  ARLHFPASKLKNNK  1716



>ref|XP_010452355.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Camelina sativa]
 ref|XP_010452356.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Camelina sativa]
 ref|XP_010452357.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Camelina sativa]
 ref|XP_010452359.1| PREDICTED: transcriptional activator DEMETER-like isoform X3 
[Camelina sativa]
Length=1925

 Score =   141 bits (355),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ+CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  1851  PIDVPRDWIWKLPRRTVYFGTSVTSIFRGLSTEQIQYCFWKGFVCVRGFEQKTRAPRPLM  1910

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1911  ARLHFPASKLKNNK  1924



>ref|XP_009379777.1| PREDICTED: protein ROS1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1866

 Score =   141 bits (355),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIFKGL+T +IQ CFWRGFVCVRGFDQ+TRAP+PL
Sbjct  1782  NPIDVPREWIWNLPRRTVYFGTSVPTIFKGLTTQEIQQCFWRGFVCVRGFDQRTRAPKPL  1841

Query  182   IARLHFPASRLAKNK  226
              AR HFPAS+  +NK
Sbjct  1842  YARFHFPASKAPRNK  1856



>ref|XP_010490971.1| PREDICTED: transcriptional activator DEMETER-like [Camelina sativa]
Length=2012

 Score =   141 bits (355),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ+CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  1938  PIDVPRDWIWKLPRRTVYFGTSVTSIFRGLSTEQIQYCFWKGFVCVRGFEQKTRAPRPLM  1997

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1998  ARLHFPASKLKNNK  2011



>ref|XP_009365323.1| PREDICTED: protein ROS1-like isoform X2 [Pyrus x bretschneideri]
Length=1777

 Score =   140 bits (354),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST +IQHCFWRGFVCVRGFDQKTRAPRPL
Sbjct  1698  NPIDVPRAWLWKLYRRTVYFGTSIPTIFKGLSTPEIQHCFWRGFVCVRGFDQKTRAPRPL  1757

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L + K++
Sbjct  1758  MARLHFPASKLVRTKDK  1774



>ref|XP_002970007.1| hypothetical protein SELMODRAFT_92107 [Selaginella moellendorffii]
 gb|EFJ29131.1| hypothetical protein SELMODRAFT_92107 [Selaginella moellendorffii]
Length=220

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 118/213 (55%), Gaps = 5/213 (2%)
 Frame = -1

Query  1225  MGMTETWMRKHDLLLIAATRNPFTQAIRDATLPLSSFNNWLGQEYWLAKRAFVPFLSTLL  1046
             M +++   R  +L   A T +P+  +IR+ ++ LS +  WLGQ+Y   K AFV F+ ++L
Sbjct  1     MALSQWKSRHAELYNRATTHHPYIVSIRNGSVDLSCYKRWLGQDYIFVK-AFVRFIGSIL  59

Query  1045  QK-ARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLDSVVPYQPTIDYSKLLESLT  869
              K   + S++ +  + +G    +D++ W ++EA    + L+ + P + T DY + LE ++
Sbjct  60    AKIPSNASDETLMTLLSGASALHDELQWFQKEALVWKIGLEDLPPKKTTQDYCRFLEDMS  119

Query  868   DD--DYTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEACRKWGGDAQGDYCLSLQRT  695
                 DY   LS  WA + VY  +FA CL  GS+TP ++ EAC +WG  + G YC  L+  
Sbjct  120   QPSVDYAVVLSTFWAIEHVYFESFAFCLEPGSKTPHQLVEACGRWGSPSFGSYCDLLRSI  179

Query  694   ADGALEK-APRDVIVKAEVTLLEFLEISVQFWN  599
             A+ A+E     +V  + E   +  L++  +FWN
Sbjct  180   AEAAVESTGSNEVKQRGEDAFVRVLQLENEFWN  212



>ref|XP_006286880.1| hypothetical protein CARUB_v10000024mg [Capsella rubella]
 gb|EOA19778.1| hypothetical protein CARUB_v10000024mg [Capsella rubella]
Length=2000

 Score =   140 bits (354),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ+CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  1926  PIDVPRDWIWNLPRRTVYFGTSVTSIFRGLSTEQIQYCFWKGFVCVRGFEQKTRAPRPLM  1985

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1986  ARLHFPASKLKNNK  1999



>gb|AEF38423.1| 5-methylcytosine DNA glycosylase [Triticum aestivum]
Length=1975

 Score =   140 bits (354),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+DVPRR IW LPRRTVYFGTSV +IFKGL+T+ IQ CFWRGFVCVRGFD+ +RAPRPL
Sbjct  1890  NPVDVPRRWIWDLPRRTVYFGTSVPSIFKGLTTEDIQQCFWRGFVCVRGFDRTSRAPRPL  1949

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS++ +NK
Sbjct  1950  YARLHFPASKITRNK  1964



>ref|XP_006649962.1| PREDICTED: seed maturation protein PM36-like [Oryza brachyantha]
Length=216

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 101/176 (57%), Gaps = 4/176 (2%)
 Frame = -1

Query  1102  GQEYWLAKRAFVPFL-STLLQKARHESNDIVQVIQTGIGLQNDKISWLEREAEKLHVSLD  926
             GQ+Y   K  FV FL S LL+  R      +++I  G+   +D++SW ++EAEK  V+L 
Sbjct  41    GQDYMFVKE-FVAFLASVLLKCCRQSDGSDMEIILGGLASLSDELSWFKKEAEKWSVNLA  99

Query  925   SVVPYQPTIDYSKLLESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEA  752
              V P +   +Y + L+S ++ +  YT A++  W  +TVY  +FA C+ EG++TP E+   
Sbjct  100   EVSPLKSNTEYCRFLQSFSEPEISYTTAITTFWIIETVYQDSFAFCIEEGNKTPPELLGT  159

Query  751   CRKWGGDAQGDYCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWNNVVNK  584
             C++WG      YC SLQR AD  L  AP D +  AE   L+ LE+ + FW+   +K
Sbjct  160   CQRWGSPQFKQYCQSLQRIADHCLANAPADALKSAEEAFLQVLELEIGFWDMSSSK  215



>ref|XP_009353005.1| PREDICTED: protein ROS1-like [Pyrus x bretschneideri]
 ref|XP_009353006.1| PREDICTED: protein ROS1-like [Pyrus x bretschneideri]
 ref|XP_009353007.1| PREDICTED: protein ROS1-like [Pyrus x bretschneideri]
Length=1810

 Score =   140 bits (353),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST +IQ CFWRGFVCVRGFDQKTRAPRPL
Sbjct  1731  NPIDVPRAWLWKLNRRTVYFGTSIPTIFKGLSTPEIQQCFWRGFVCVRGFDQKTRAPRPL  1790

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+LA+ K++
Sbjct  1791  LARLHFPASKLARTKDK  1807



>emb|CAQ58412.1| putative transcriptional activator DEMETER [Hordeum vulgare subsp. 
vulgare]
Length=1981

 Score =   140 bits (353),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+DVPRR IW LPRRTVYFGTSV +IFKGL+T+ IQ CFWRGFVCVRGFD+ +RAPRPL
Sbjct  1896  NPVDVPRRWIWDLPRRTVYFGTSVPSIFKGLTTEDIQQCFWRGFVCVRGFDRTSRAPRPL  1955

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS++ +NK
Sbjct  1956  YARLHFPASKIIRNK  1970



>ref|XP_009421124.1| PREDICTED: transcriptional activator DEMETER-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421125.1| PREDICTED: transcriptional activator DEMETER-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421127.1| PREDICTED: transcriptional activator DEMETER-like [Musa acuminata 
subsp. malaccensis]
Length=2037

 Score =   140 bits (353),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 3/87 (3%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIFKGL+T++IQ CFWRGFVCVRGFD+KTRAPRPL
Sbjct  1948  NPIDVPREWIWNLPRRTVYFGTSVPTIFKGLTTEEIQLCFWRGFVCVRGFDKKTRAPRPL  2007

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
              ARLHFPAS+  +NK +   K+ S A+
Sbjct  2008  YARLHFPASKAPRNKQQ---KKTSPAR  2031



>ref|XP_006589373.1| PREDICTED: transcriptional activator DEMETER-like [Glycine max]
Length=1866

 Score =   140 bits (352),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PID+PR  IW LPRRTVYFGTSVS+IFK LST +IQHCFWRGFVCVRGFDQK RAPRPL 
Sbjct  1792  PIDIPREWIWNLPRRTVYFGTSVSSIFKDLSTQEIQHCFWRGFVCVRGFDQKERAPRPLQ  1851

Query  185   ARLHFPASRLAKNK  226
             ARLHF ASRLAK +
Sbjct  1852  ARLHFSASRLAKTE  1865



>ref|XP_003625748.1| DNA glycosylase [Medicago truncatula]
Length=497

 Score =   136 bits (342),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
            NPI VPR LIW L RRTV+FGTSV++IFKGL+T +IQ CFWRGFVCVRGF++ TRAPRPL
Sbjct  384  NPISVPRSLIWNLDRRTVHFGTSVTSIFKGLATPEIQQCFWRGFVCVRGFERSTRAPRPL  443

Query  182  IARLHFPASRLAKNKNENGRKQASA  256
            +ARLHFPASRLAKNK ++    A++
Sbjct  444  MARLHFPASRLAKNKKDSAAAAANS  468



>ref|XP_007145257.1| hypothetical protein PHAVU_007G223600g [Phaseolus vulgaris]
 gb|ESW17251.1| hypothetical protein PHAVU_007G223600g [Phaseolus vulgaris]
Length=2209

 Score =   140 bits (353),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTSV TIFKGL+T +IQ CFWRG+VCVRGFD++TRAPRPL
Sbjct  2089  NPISVPRSWIWNLNRRTVYFGTSVPTIFKGLTTQEIQQCFWRGYVCVRGFDRETRAPRPL  2148

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             +ARLHFPAS+LAK K E   K++S+AK
Sbjct  2149  MARLHFPASKLAKTK-EKTEKESSSAK  2174



>gb|AEF38425.1| 5-methylcytosine DNA glycosylase [Triticum aestivum]
Length=1981

 Score =   140 bits (352),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+DVPRR IW LPRRTVYFGTSV +IFKGL+T+ IQ CFWRGFVCVRGFD+ +RAPRPL
Sbjct  1896  NPVDVPRRWIWDLPRRTVYFGTSVPSIFKGLTTEDIQQCFWRGFVCVRGFDRTSRAPRPL  1955

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS++ +NK
Sbjct  1956  YARLHFPASKITRNK  1970



>emb|CBI40219.3| unnamed protein product [Vitis vinifera]
Length=1621

 Score =   139 bits (351),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV++IF+GL T+ IQ+CFWRGFVCVRGFDQK+RAPRPL
Sbjct  1543  NPIDVPRAWIWNLPRRTVYFGTSVTSIFRGLPTEGIQYCFWRGFVCVRGFDQKSRAPRPL  1602

Query  182   IARLHFPASRLAKNKNEN  235
             +ARLH  A++L+K KNEN
Sbjct  1603  MARLHLSANKLSKTKNEN  1620



>gb|AEF38424.1| 5-methylcytosine DNA glycosylase [Triticum aestivum]
Length=1982

 Score =   140 bits (352),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+DVPRR IW LPRRTVYFGTSV +IFKGL+T+ IQ CFWRGFVCVRGFD+ +RAPRPL
Sbjct  1897  NPVDVPRRWIWDLPRRTVYFGTSVPSIFKGLTTEDIQQCFWRGFVCVRGFDRTSRAPRPL  1956

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS++ +NK
Sbjct  1957  YARLHFPASKVTRNK  1971



>ref|XP_004496178.1| PREDICTED: transcriptional activator DEMETER-like [Cicer arietinum]
Length=1602

 Score =   139 bits (351),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PID+PR  IW LPRRTVYFGTSVS+IFKGLST +IQHCFWRGFVCVRGFDQ+ RAPRPL 
Sbjct  1528  PIDIPREWIWNLPRRTVYFGTSVSSIFKGLSTPEIQHCFWRGFVCVRGFDQQKRAPRPLF  1587

Query  185   ARLHFPASRLAKNK  226
             ARLHF  S+LAK K
Sbjct  1588  ARLHFTESKLAKTK  1601



>gb|KHF99880.1| Protein ROS1 -like protein [Gossypium arboreum]
Length=1900

 Score =   139 bits (351),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRR VYFGTS+ +IFKGL+T +IQHCFWRGFVCVRGFDQK+RAPRPL
Sbjct  1818  NPIDVPREWLWNLPRRMVYFGTSIPSIFKGLTTVEIQHCFWRGFVCVRGFDQKSRAPRPL  1877

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L + K +
Sbjct  1878  MARLHFPASKLTRGKGK  1894



>ref|NP_196076.2| transcriptional activator DEMETER [Arabidopsis thaliana]
 gb|AED90760.1| transcriptional activator DEMETER [Arabidopsis thaliana]
Length=1729

 Score =   139 bits (350),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  1655  PIDVPRDWIWDLPRRTVYFGTSVTSIFRGLSTEQIQFCFWKGFVCVRGFEQKTRAPRPLM  1714

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1715  ARLHFPASKLKNNK  1728



>gb|AAM77215.1| DEMETER protein [Arabidopsis thaliana]
Length=1729

 Score =   139 bits (350),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  1655  PIDVPRDWIWDLPRRTVYFGTSVTSIFRGLSTEQIQFCFWKGFVCVRGFEQKTRAPRPLM  1714

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1715  ARLHFPASKLKNNK  1728



>ref|XP_010423561.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Camelina sativa]
 ref|XP_010423562.1| PREDICTED: transcriptional activator DEMETER-like isoform X2 
[Camelina sativa]
 ref|XP_010423563.1| PREDICTED: transcriptional activator DEMETER-like isoform X3 
[Camelina sativa]
 ref|XP_010423564.1| PREDICTED: transcriptional activator DEMETER-like isoform X4 
[Camelina sativa]
Length=1996

 Score =   139 bits (350),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ+CFW+GFVCVRGF++KTRAPRPL+
Sbjct  1922  PIDVPRDWIWKLPRRTVYFGTSVTSIFRGLSTEQIQYCFWKGFVCVRGFEKKTRAPRPLM  1981

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1982  ARLHFPASKLKNNK  1995



>ref|NP_001078527.1| transcriptional activator DEMETER [Arabidopsis thaliana]
 sp|Q8LK56.2|DME_ARATH RecName: Full=Transcriptional activator DEMETER; AltName: Full=DNA 
glycosylase-related protein DME [Arabidopsis thaliana]
 gb|ABC61677.1| DNA glycosylase DEMETER [Arabidopsis thaliana]
 gb|AED90761.1| transcriptional activator DEMETER [Arabidopsis thaliana]
Length=1987

 Score =   139 bits (350),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  1913  PIDVPRDWIWDLPRRTVYFGTSVTSIFRGLSTEQIQFCFWKGFVCVRGFEQKTRAPRPLM  1972

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1973  ARLHFPASKLKNNK  1986



>ref|XP_006594195.1| PREDICTED: protein ROS1-like isoform X1 [Glycine max]
 ref|XP_006594196.1| PREDICTED: protein ROS1-like isoform X2 [Glycine max]
Length=1993

 Score =   139 bits (350),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTSV+TIFKGL+T +IQ CFWRG+VCVRGFD++ RAPRPL
Sbjct  1881  NPISVPRSWIWNLNRRTVYFGTSVTTIFKGLTTQEIQQCFWRGYVCVRGFDREARAPRPL  1940

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             +ARLHFPAS+LAK K    ++ +S AK
Sbjct  1941  MARLHFPASKLAKTKERTKKESSSTAK  1967



>gb|KHN48192.1| Protein ROS1 [Glycine soja]
Length=1993

 Score =   139 bits (350),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTSV+TIFKGL+T +IQ CFWRG+VCVRGFD++ RAPRPL
Sbjct  1881  NPISVPRSWIWNLNRRTVYFGTSVTTIFKGLTTQEIQQCFWRGYVCVRGFDREARAPRPL  1940

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             +ARLHFPAS+LAK K    ++ +S AK
Sbjct  1941  MARLHFPASKLAKTKERTKKESSSTAK  1967



>ref|XP_007027611.1| Repressor of gene silencing 1 isoform 1 [Theobroma cacao]
 gb|EOY08113.1| Repressor of gene silencing 1 isoform 1 [Theobroma cacao]
Length=1922

 Score =   139 bits (349),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRR VYFGTS+ +IFKGL+T+ IQHCFWRG+VCVRGFDQK+RAPRPL
Sbjct  1838  NPIDVPREWLWNLPRRMVYFGTSIPSIFKGLTTEGIQHCFWRGYVCVRGFDQKSRAPRPL  1897

Query  182   IARLHFPASRL  214
             +ARLHFPAS+L
Sbjct  1898  MARLHFPASKL  1908



>gb|KEH24122.1| HhH-GPD base excision DNA repair family protein [Medicago truncatula]
Length=1778

 Score =   139 bits (349),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR LIW L RRTV+FGTSV++IFKGL+T +IQ CFWRGFVCVRGF++ TRAPRPL
Sbjct  1665  NPISVPRSLIWNLDRRTVHFGTSVTSIFKGLATPEIQQCFWRGFVCVRGFERSTRAPRPL  1724

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
             +ARLHFPASRLAKNK ++    A++
Sbjct  1725  MARLHFPASRLAKNKKDSAAAAANS  1749



>ref|XP_011094546.1| PREDICTED: protein ROS1-like [Sesamum indicum]
Length=2005

 Score =   139 bits (349),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +P+ VPR  +W LPRRTVYFGTS+ TIFKGLST+ IQ+CFWRGFVCVRGFD+KTRAPRPL
Sbjct  1925  SPMAVPREWLWNLPRRTVYFGTSIPTIFKGLSTEGIQYCFWRGFVCVRGFDRKTRAPRPL  1984

Query  182   IARLHFPASRLAKNKNE  232
             IARLHFPAS+LAK K +
Sbjct  1985  IARLHFPASKLAKGKGK  2001



>ref|XP_010423565.1| PREDICTED: transcriptional activator DEMETER-like isoform X5 
[Camelina sativa]
Length=1791

 Score =   139 bits (349),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ+CFW+GFVCVRGF++KTRAPRPL+
Sbjct  1717  PIDVPRDWIWKLPRRTVYFGTSVTSIFRGLSTEQIQYCFWKGFVCVRGFEKKTRAPRPLM  1776

Query  185   ARLHFPASRLAKNK  226
             ARLHFPAS+L  NK
Sbjct  1777  ARLHFPASKLKNNK  1790



>ref|XP_006430302.1| hypothetical protein CICLE_v10010892mg [Citrus clementina]
 gb|ESR43542.1| hypothetical protein CICLE_v10010892mg [Citrus clementina]
Length=1807

 Score =   138 bits (348),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PI+VPR  +W LPRRTVYFGTS+ +IFKGL+T+ IQHCFWRG+VCVRGFDQK+RAPRPL+
Sbjct  1726  PINVPREWLWNLPRRTVYFGTSIPSIFKGLTTEGIQHCFWRGYVCVRGFDQKSRAPRPLM  1785

Query  185   ARLHFPASRLAK  220
             ARLHFPAS+L K
Sbjct  1786  ARLHFPASKLNK  1797



>ref|XP_006430303.1| hypothetical protein CICLE_v10010892mg [Citrus clementina]
 gb|ESR43543.1| hypothetical protein CICLE_v10010892mg [Citrus clementina]
Length=1964

 Score =   138 bits (348),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PI+VPR  +W LPRRTVYFGTS+ +IFKGL+T+ IQHCFWRG+VCVRGFDQK+RAPRPL+
Sbjct  1883  PINVPREWLWNLPRRTVYFGTSIPSIFKGLTTEGIQHCFWRGYVCVRGFDQKSRAPRPLM  1942

Query  185   ARLHFPASRLAK  220
             ARLHFPAS+L K
Sbjct  1943  ARLHFPASKLNK  1954



>ref|XP_006481896.1| PREDICTED: protein ROS1-like isoform X4 [Citrus sinensis]
Length=1965

 Score =   138 bits (348),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PI+VPR  +W LPRRTVYFGTS+ +IFKGL+T+ IQHCFWRG+VCVRGFDQK+RAPRPL+
Sbjct  1884  PINVPREWLWNLPRRTVYFGTSIPSIFKGLTTEGIQHCFWRGYVCVRGFDQKSRAPRPLM  1943

Query  185   ARLHFPASRLAK  220
             ARLHFPAS+L K
Sbjct  1944  ARLHFPASKLNK  1955



>gb|AEC12446.1| repressor of gene silencing 1 [Gossypium hirsutum]
Length=1758

 Score =   138 bits (348),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  +W LPRR VYFGTS+ +IFKGL+T+ IQHCFWRG+VCVRGFDQK+RAPRPL
Sbjct  1676  NPIAVPREWLWNLPRRMVYFGTSIPSIFKGLTTEGIQHCFWRGYVCVRGFDQKSRAPRPL  1735

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFP SRLAK K +
Sbjct  1736  MARLHFPVSRLAKAKGK  1752



>ref|XP_008462535.1| PREDICTED: protein ROS1-like [Cucumis melo]
Length=1783

 Score =   138 bits (347),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST++IQ CFW+G+VCVRGFDQKTRAPRPL
Sbjct  1700  NPIDVPRSWLWKLSRRTVYFGTSIPTIFKGLSTEEIQGCFWKGYVCVRGFDQKTRAPRPL  1759

Query  182   IARLHFPASRLAKNKNE  232
             IARLHFPAS++ + K +
Sbjct  1760  IARLHFPASKMTRIKGK  1776



>gb|KDP45028.1| hypothetical protein JCGZ_01528 [Jatropha curcas]
Length=1932

 Score =   138 bits (347),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI+VPR  IW LPRR VYFGTSVSTIFKGLST+ IQ+CFW+GFVCVRGF+QKTRAPRPL
Sbjct  1855  NPINVPRAWIWNLPRRLVYFGTSVSTIFKGLSTEGIQYCFWKGFVCVRGFEQKTRAPRPL  1914

Query  182   IARLHFPASRL  214
             IARLH+PASR+
Sbjct  1915  IARLHYPASRM  1925



>dbj|BAC42629.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63421.1| At5g04570 [Arabidopsis thaliana]
Length=416

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
            PIDVPR  IW LPRRTVYFGTSV++IF+GLST+QIQ CFW+GFVCVRGF+QKTRAPRPL+
Sbjct  342  PIDVPRDWIWDLPRRTVYFGTSVTSIFRGLSTEQIQFCFWKGFVCVRGFEQKTRAPRPLM  401

Query  185  ARLHFPASRLAKNK  226
            ARLHFPAS+L  NK
Sbjct  402  ARLHFPASKLKNNK  415



>ref|XP_008391745.1| PREDICTED: protein ROS1-like [Malus domestica]
 ref|XP_008391746.1| PREDICTED: protein ROS1-like [Malus domestica]
Length=1808

 Score =   137 bits (346),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST +IQ CFWRGFVCVRGF QKTRAPRPL
Sbjct  1729  NPIDVPRAWLWKLNRRTVYFGTSIPTIFKGLSTPEIQQCFWRGFVCVRGFHQKTRAPRPL  1788

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+LA+ K++
Sbjct  1789  LARLHFPASKLARTKDK  1805



>gb|AFW71475.1| hypothetical protein ZEAMMB73_049283 [Zea mays]
Length=1906

 Score =   137 bits (346),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIF+GL+T++IQ CFWRGFVCVRGFD+  RAPRPL
Sbjct  1823  NPIDVPRSWIWDLPRRTVYFGTSVPTIFRGLTTEEIQQCFWRGFVCVRGFDRTVRAPRPL  1882

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS++ + K
Sbjct  1883  YARLHFPASKVVRGK  1897



>ref|XP_009360014.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional activator DEMETER-like 
[Pyrus x bretschneideri]
Length=1959

 Score =   137 bits (346),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPR  VYFGTSVSTIFKGLST+ IQ+CFWRG+VCVRGF++KTRAPR L
Sbjct  1880  NPIDVPRGWIWNLPRWMVYFGTSVSTIFKGLSTEGIQYCFWRGYVCVRGFERKTRAPRSL  1939

Query  182   IARLHFPASRLAKNKNENGR  241
             +ARLHFPAS++ K KNE  +
Sbjct  1940  MARLHFPASKMTKTKNEEKK  1959



>gb|EYU19798.1| hypothetical protein MIMGU_mgv1a000238mg [Erythranthe guttata]
Length=1381

 Score =   137 bits (345),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPRRL+W LPRRTV+FGTSV++IFKGLST+ IQ+CFWRGFVCVRGFDQK RAPRPL 
Sbjct  1306  PIDVPRRLLWNLPRRTVFFGTSVTSIFKGLSTEGIQYCFWRGFVCVRGFDQKHRAPRPLK  1365

Query  185   ARLHFPASRLAKNKNE  232
             ARLH PAS++   KNE
Sbjct  1366  ARLHLPASKMMPKKNE  1381



>ref|XP_004249459.2| PREDICTED: LOW QUALITY PROTEIN: protein ROS1-like [Solanum lycopersicum]
Length=1824

 Score =   137 bits (345),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI+VPR  +W LPRRTVYFGTS+ TIFKGL+T+ IQHCFWRGFVCVRGFD KTRAPRPL
Sbjct  1739  NPINVPRDWLWNLPRRTVYFGTSIPTIFKGLNTESIQHCFWRGFVCVRGFDHKTRAPRPL  1798

Query  182   IARLHFPASRLAKNKNENGRKQASAA  259
             +AR HFPAS+L +   +    +  A+
Sbjct  1799  LARFHFPASKLNRTNGKTNEDKGVAS  1824



>ref|XP_010325938.1| PREDICTED: protein ROS1 [Solanum lycopersicum]
Length=1856

 Score =   137 bits (345),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  +W LPRRTVYFGTS+ +IFKGL+T+ IQHCFWRGFVCVRGFD+K RAPRPL+
Sbjct  1777  PIDVPRNWLWNLPRRTVYFGTSIPSIFKGLTTESIQHCFWRGFVCVRGFDKKLRAPRPLM  1836

Query  185   ARLHFPASRLAKNKNE  232
             ARLHFPAS+L + K +
Sbjct  1837  ARLHFPASKLTRTKGK  1852



>ref|NP_181190.3| protein ROS1 [Arabidopsis thaliana]
 sp|Q9SJQ6.2|ROS1_ARATH RecName: Full=Protein ROS1; AltName: Full=DEMETER-like protein 
1; AltName: Full=Repressor of silencing 1 [Arabidopsis thaliana]
 gb|AAP37178.1| ROS1 [Arabidopsis thaliana]
 gb|AEC09263.1| protein ROS1 [Arabidopsis thaliana]
Length=1393

 Score =   137 bits (344),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI+VPR LIW LPRRTVYFGTSV TIFKGLST++IQ CFW+G+VCVRGFD+KTR P+PL
Sbjct  1315  NPINVPRELIWELPRRTVYFGTSVPTIFKGLSTEKIQACFWKGYVCVRGFDRKTRGPKPL  1374

Query  182   IARLHFPASRL  214
             IARLHFPAS+L
Sbjct  1375  IARLHFPASKL  1385



>ref|XP_006341256.1| PREDICTED: protein ROS1-like [Solanum tuberosum]
Length=1913

 Score =   137 bits (344),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  +W LPRRTVYFGTS+ +IFKGL+T+ IQHCFWRGFVCVRGFD+K RAPRPL+
Sbjct  1834  PIDVPRNWLWDLPRRTVYFGTSIPSIFKGLTTESIQHCFWRGFVCVRGFDKKLRAPRPLM  1893

Query  185   ARLHFPASRLAKNKNE  232
             ARLHFPAS+L + K +
Sbjct  1894  ARLHFPASKLTRTKGK  1909



>ref|XP_008241295.1| PREDICTED: protein ROS1 [Prunus mume]
 ref|XP_008241296.1| PREDICTED: protein ROS1 [Prunus mume]
 ref|XP_008241297.1| PREDICTED: protein ROS1 [Prunus mume]
Length=1753

 Score =   137 bits (344),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+DVPR  +W L RRTVYFGTS+ TIFKGLST +IQ CFWRGFVCVRGFDQKTR PRPL
Sbjct  1674  NPLDVPRSWLWKLNRRTVYFGTSIPTIFKGLSTPEIQQCFWRGFVCVRGFDQKTRGPRPL  1733

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L++ K++
Sbjct  1734  MARLHFPASKLSRTKDK  1750



>ref|XP_006295565.1| hypothetical protein CARUB_v10024677mg [Capsella rubella]
 gb|EOA28463.1| hypothetical protein CARUB_v10024677mg [Capsella rubella]
Length=1483

 Score =   136 bits (343),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IWYLP+RTVYFGTS+ +IFKGL TD IQ CFWRG+VCVRGFD+ TR P+PL
Sbjct  1405  NPIDVPRDWIWYLPKRTVYFGTSIPSIFKGLPTDTIQQCFWRGYVCVRGFDRTTRGPKPL  1464

Query  182   IARLHFPASRL  214
             IARLHFPAS+L
Sbjct  1465  IARLHFPASKL  1475



>ref|XP_006851720.1| hypothetical protein AMTR_s00040p00215000 [Amborella trichopoda]
 gb|ERN13187.1| hypothetical protein AMTR_s00040p00215000 [Amborella trichopoda]
Length=2132

 Score =   137 bits (344),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW LPRRTVYFGTS+ TIF+GL+  +IQ+CFWRGFVCVRGFDQ++RAPRPL
Sbjct  2040  NPIAVPRSWIWNLPRRTVYFGTSIPTIFRGLTLQEIQYCFWRGFVCVRGFDQQSRAPRPL  2099

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
             ++RLH+PASRL +NKN   +K+ SA
Sbjct  2100  LSRLHYPASRLTQNKN-GPKKEVSA  2123



>ref|XP_002453864.1| hypothetical protein SORBIDRAFT_04g019820 [Sorghum bicolor]
 gb|EES06840.1| hypothetical protein SORBIDRAFT_04g019820 [Sorghum bicolor]
 gb|AEF38426.1| 5-methylcytosine DNA glycosylase [Sorghum bicolor]
Length=1891

 Score =   136 bits (343),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIF+GL+T+QIQ CFWRGFVCVRGFD+  RAPRPL
Sbjct  1808  NPIDVPRSWIWDLPRRTVYFGTSVPTIFRGLTTEQIQQCFWRGFVCVRGFDRTVRAPRPL  1867

Query  182   IARLHFPASRLAKNKNENGRKQ  247
              ARLHFPAS++ + K     ++
Sbjct  1868  YARLHFPASKVVRGKKPGAARE  1889



>ref|XP_007204687.1| hypothetical protein PRUPE_ppa000163mg [Prunus persica]
 gb|EMJ05886.1| hypothetical protein PRUPE_ppa000163mg [Prunus persica]
Length=1556

 Score =   136 bits (342),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+DVPR  +W L RRTVYFGTS+ TIFKGLST +IQ CFWRGFVCVRGFDQKTR PRPL
Sbjct  1477  NPLDVPRSWLWKLNRRTVYFGTSIPTIFKGLSTPEIQQCFWRGFVCVRGFDQKTRGPRPL  1536

Query  182   IARLHFPASRLAKNKNE  232
             +ARLHFPAS+L++ K++
Sbjct  1537  MARLHFPASKLSRTKDK  1553



>emb|CDP15361.1| unnamed protein product [Coffea canephora]
Length=1874

 Score =   136 bits (343),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLS ++IQ+CFWRGFVC+RGFD+KTRAPRPL
Sbjct  1794  NPIDVPRNWLWNLRRRTVYFGTSIPTIFKGLSQEEIQYCFWRGFVCLRGFDRKTRAPRPL  1853

Query  182   IARLHFPASRLAKNK  226
             +ARLHFPAS+L K +
Sbjct  1854  VARLHFPASKLTKKR  1868



>ref|XP_004507056.1| PREDICTED: transcriptional activator DEMETER-like [Cicer arietinum]
Length=1736

 Score =   136 bits (342),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTV+FGTS+ TIFKGLST +IQ CFWRG+VCVRGFD++TRAPRPL
Sbjct  1638  NPISVPRSWIWNLNRRTVHFGTSIPTIFKGLSTQEIQQCFWRGYVCVRGFDRQTRAPRPL  1697

Query  182   IARLHFPASRLAKNKNENGRKQASAAK*DG  271
              ARLHFPAS+LAKNK E  +K +  A   G
Sbjct  1698  KARLHFPASKLAKNK-ETTKKDSKVANSQG  1726



>ref|XP_004143374.1| PREDICTED: protein ROS1-like [Cucumis sativus]
 gb|KGN48234.1| hypothetical protein Csa_6G450390 [Cucumis sativus]
Length=1782

 Score =   136 bits (342),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RRTVYFGTS+ TIFKGLST++IQ CFW+G+VCVRGFDQ TRAPRPL
Sbjct  1699  NPIDVPRSWLWKLSRRTVYFGTSIPTIFKGLSTEEIQGCFWKGYVCVRGFDQTTRAPRPL  1758

Query  182   IARLHFPASRLAKNKNE  232
             IARLHFPAS++ + K +
Sbjct  1759  IARLHFPASKMTRIKGK  1775



>gb|EMS55066.1| hypothetical protein TRIUR3_29340 [Triticum urartu]
Length=257

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 99/171 (58%), Gaps = 4/171 (2%)
 Frame = -1

Query  1102  GQEYWLAKRAFVPFLSTLLQKARHESNDI-VQVIQTGIGLQNDKISWLEREAEKLHVSLD  926
             GQ+Y    R FV FL+++L K   ES+   ++ I  G+   +D++SW ++EA K  V L 
Sbjct  82    GQDYMFV-REFVAFLASVLLKCCKESDSSDMETILGGLASLSDELSWFKKEAAKWSVDLA  140

Query  925   SVVPYQPTIDYSKLLESLTDDD--YTAALSILWATQTVYHRTFAHCLSEGSRTPEEMKEA  752
              + P    ++Y + L+SL D +  YT A++  W  +TVY  +FA C+ EG++TP E+   
Sbjct  141   GISPLSSNMEYCRFLQSLDDPEISYTVAITTFWIIETVYQDSFAFCIEEGNKTPAELLGT  200

Query  751   CRKWGGDAQGDYCLSLQRTADGALEKAPRDVIVKAEVTLLEFLEISVQFWN  599
             C++WG      YC SLQR AD  L  AP DV+  AE   L  L++ + FW+
Sbjct  201   CQRWGSPEFKQYCQSLQRIADRCLANAPPDVVKSAEEAFLRVLKLEIGFWD  251



>gb|KDO61025.1| hypothetical protein CISIN_1g0021411mg, partial [Citrus sinensis]
 gb|KDO61026.1| hypothetical protein CISIN_1g0021411mg, partial [Citrus sinensis]
Length=340

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
            PI+VPR  +W LPRRTVYFGTS+ +IFKGL+T+ IQHCFWRG+VCVRGFDQK+RAPRPL+
Sbjct  259  PINVPREWLWNLPRRTVYFGTSIPSIFKGLTTEGIQHCFWRGYVCVRGFDQKSRAPRPLM  318

Query  185  ARLHFPASRLAK  220
            ARLHFPAS+L K
Sbjct  319  ARLHFPASKLNK  330



>gb|KHN18729.1| Protein ROS1 [Glycine soja]
Length=1764

 Score =   135 bits (341),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTS+ +IFKGLST +IQ CFWRG+VCVRGFD++ RAPRPL
Sbjct  1654  NPISVPRSWIWNLDRRTVYFGTSIPSIFKGLSTREIQQCFWRGYVCVRGFDREKRAPRPL  1713

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
             +ARLHFP SRL KN+++  ++ ASA
Sbjct  1714  LARLHFPVSRLPKNRDKTQQESASA  1738



>ref|XP_006577053.1| PREDICTED: protein ROS1-like isoform X3 [Glycine max]
Length=1742

 Score =   135 bits (341),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTS+ +IFKGLST +IQ CFWRG+VCVRGFD++ RAPRPL
Sbjct  1632  NPISVPRSWIWNLDRRTVYFGTSIPSIFKGLSTREIQQCFWRGYVCVRGFDREKRAPRPL  1691

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
             +ARLHFP SRL KN+++  ++ ASA
Sbjct  1692  LARLHFPVSRLPKNRDKTQQESASA  1716



>ref|XP_003520681.1| PREDICTED: protein ROS1-like isoform X1 [Glycine max]
Length=1764

 Score =   135 bits (341),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTS+ +IFKGLST +IQ CFWRG+VCVRGFD++ RAPRPL
Sbjct  1654  NPISVPRSWIWNLDRRTVYFGTSIPSIFKGLSTREIQQCFWRGYVCVRGFDREKRAPRPL  1713

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
             +ARLHFP SRL KN+++  ++ ASA
Sbjct  1714  LARLHFPVSRLPKNRDKTQQESASA  1738



>ref|XP_006577052.1| PREDICTED: protein ROS1-like isoform X2 [Glycine max]
Length=1765

 Score =   135 bits (341),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTS+ +IFKGLST +IQ CFWRG+VCVRGFD++ RAPRPL
Sbjct  1655  NPISVPRSWIWNLDRRTVYFGTSIPSIFKGLSTREIQQCFWRGYVCVRGFDREKRAPRPL  1714

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
             +ARLHFP SRL KN+++  ++ ASA
Sbjct  1715  LARLHFPVSRLPKNRDKTQQESASA  1739



>ref|XP_004293493.1| PREDICTED: protein ROS1-like [Fragaria vesca subsp. vesca]
Length=1685

 Score =   135 bits (340),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             P+DVPR  +W L RRTVYFGTS+ TIFKGL+T +IQHCFWRGFVCVRGFDQK+R PRPL+
Sbjct  1596  PLDVPRGWLWNLNRRTVYFGTSIPTIFKGLTTPEIQHCFWRGFVCVRGFDQKSRGPRPLM  1655

Query  185   ARLHFPASRLAKNKNENGRKQ  247
             ARLHFP SRLAK K   G+K+
Sbjct  1656  ARLHFPVSRLAKPK---GKKE  1673



>ref|XP_002443104.1| hypothetical protein SORBIDRAFT_08g008620 [Sorghum bicolor]
 gb|EES16942.1| hypothetical protein SORBIDRAFT_08g008620 [Sorghum bicolor]
Length=1856

 Score =   134 bits (338),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 69/85 (81%), Gaps = 5/85 (6%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIF+GL+T++IQ CFWRGFVCVRGFD+  RAPRPL
Sbjct  1772  NPIDVPRSWIWDLPRRTVYFGTSVPTIFRGLTTEEIQQCFWRGFVCVRGFDRTVRAPRPL  1831

Query  182   IARLHFPASRLAKNKNENGRKQASA  256
              ARLHFPAS++ +     GRK  +A
Sbjct  1832  YARLHFPASKVVR-----GRKPGAA  1851



>ref|XP_008677131.1| PREDICTED: uncharacterized protein LOC100280151 isoform X1 [Zea 
mays]
 ref|XP_008677132.1| PREDICTED: uncharacterized protein LOC100280151 isoform X1 [Zea 
mays]
 gb|AFW65705.1| hypothetical protein ZEAMMB73_319662 [Zea mays]
Length=1904

 Score =   134 bits (338),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIF+GL+T++IQ CFWRGFVCVRGFD+  RAPRPL
Sbjct  1821  NPIDVPRSWIWDLPRRTVYFGTSVPTIFRGLTTEEIQRCFWRGFVCVRGFDRTVRAPRPL  1880

Query  182   IARLHFPASRLAKNK  226
              ARLHFP S++ + K
Sbjct  1881  YARLHFPVSKVVRGK  1895



>gb|EPS65696.1| hypothetical protein M569_09081, partial [Genlisea aurea]
Length=591

 Score =   132 bits (331),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
            PIDVPR L+W LPRRTV+FGTSVSTIFKGLST+ IQ+CFW+GFVCVRGFDQK+R+PRPL+
Sbjct  517  PIDVPRSLLWNLPRRTVFFGTSVSTIFKGLSTEDIQYCFWKGFVCVRGFDQKSRSPRPLM  576

Query  185  ARLHFPASRLAKNKN  229
            ARLH PAS+ +K K 
Sbjct  577  ARLHIPASKKSKRKE  591



>ref|XP_010683880.1| PREDICTED: protein ROS1 [Beta vulgaris subsp. vulgaris]
Length=1985

 Score =   134 bits (338),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PI VPR  +W LPRRTVYFGTS+ TIF+GL+T+ IQHCFWRGFVCVRGFDQK RAPRPL
Sbjct  1904  DPIAVPRSWLWNLPRRTVYFGTSIPTIFRGLTTEDIQHCFWRGFVCVRGFDQKRRAPRPL  1963

Query  182   IARLHFPASRLAK  220
             +ARLHFPAS++ +
Sbjct  1964  MARLHFPASKMPR  1976



>ref|XP_003572540.1| PREDICTED: uncharacterized protein LOC100823274 [Brachypodium 
distachyon]
Length=1946

 Score =   134 bits (338),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDV R LIW LPRRTVYFGTS+ TIF+GL+T++IQ CFWRGFVCVRGFD+K RAPRPL
Sbjct  1867  NPIDVERSLIWNLPRRTVYFGTSIPTIFRGLTTEEIQQCFWRGFVCVRGFDRKLRAPRPL  1926

Query  182   IARLHFPASRLAKNK  226
               RLHFPAS++ ++K
Sbjct  1927  FPRLHFPASKVTRDK  1941



>ref|XP_004303030.1| PREDICTED: protein ROS1-like [Fragaria vesca subsp. vesca]
Length=1670

 Score =   134 bits (337),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             P+DVPR  +W L RRTVYFGTS+ TIFKGL+T +IQ CFWRGFVCVRGFDQK+R PRPL+
Sbjct  1592  PLDVPRGWLWNLNRRTVYFGTSIPTIFKGLTTPEIQQCFWRGFVCVRGFDQKSRGPRPLM  1651

Query  185   ARLHFPASRLAKNKNE  232
             ARLHFPASRLAK K++
Sbjct  1652  ARLHFPASRLAKPKDK  1667



>ref|XP_010516871.1| PREDICTED: protein ROS1-like [Camelina sativa]
Length=1378

 Score =   134 bits (336),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRRTV+FGTS+ TIFKGL TD+IQ CFW+G+VCVRGFD+KTR P+PL
Sbjct  1300  NPIDVPREWLWDLPRRTVFFGTSIPTIFKGLRTDKIQQCFWKGYVCVRGFDRKTRGPKPL  1359

Query  182   IARLHFPASRL  214
             IARLHFPAS++
Sbjct  1360  IARLHFPASKM  1370



>ref|XP_002881450.1| hypothetical protein ARALYDRAFT_482629 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57709.1| hypothetical protein ARALYDRAFT_482629 [Arabidopsis lyrata subsp. 
lyrata]
Length=1432

 Score =   134 bits (336),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGL T+ IQ CFW+G+VCVRGFD+ TR P+PL
Sbjct  1354  NPIDVPREWIWDLPRRTVYFGTSIPTIFKGLPTETIQQCFWKGYVCVRGFDRTTRGPKPL  1413

Query  182   IARLHFPASRLAKNK  226
             IARLHFPAS+L  N+
Sbjct  1414  IARLHFPASKLKANQ  1428



>ref|XP_004952516.1| PREDICTED: uncharacterized protein LOC101760859 [Setaria italica]
Length=1954

 Score =   134 bits (336),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTSV TIF+GL+T++IQ CFWRGFVCVRGFD+  RAPRPL
Sbjct  1871  NPIDVPRSWIWDLPRRTVYFGTSVPTIFRGLTTEEIQQCFWRGFVCVRGFDRTVRAPRPL  1930

Query  182   IARLHFPASRLAKNKNENGRKQ  247
              ARLHFPAS++ + K     ++
Sbjct  1931  YARLHFPASKVVRGKKPGAARE  1952



>ref|XP_010543600.1| PREDICTED: transcriptional activator DEMETER isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543601.1| PREDICTED: transcriptional activator DEMETER isoform X2 [Tarenaya 
hassleriana]
Length=2056

 Score =   134 bits (336),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRR VYFGTSV++IFKGLST+QIQ+CFW+GFVCVRGFDQKTRAPRPL
Sbjct  1978  NPIDVPREWIWNLPRRIVYFGTSVTSIFKGLSTEQIQYCFWKGFVCVRGFDQKTRAPRPL  2037

Query  182   IARLHF  199
             +ARLHF
Sbjct  2038  MARLHF  2043



>gb|KFK24901.1| hypothetical protein AALP_AA8G039800 [Arabis alpina]
Length=1904

 Score =   134 bits (336),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 56/73 (77%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IF+GL+T+QIQ+CFW+GFVCVRGF+QK RAPRPL+
Sbjct  1830  PIDVPRDWIWNLPRRTVYFGTSVTSIFRGLTTEQIQYCFWKGFVCVRGFEQKIRAPRPLM  1889

Query  185   ARLHFPASRLAKN  223
             ARLHF AS+L  N
Sbjct  1890  ARLHFTASKLKNN  1902



>gb|EYU35128.1| hypothetical protein MIMGU_mgv1a000089mg [Erythranthe guttata]
Length=1855

 Score =   133 bits (334),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +P+++PR+ +W LPRRTVYFGTS+ TIFKGLST+ IQ+CFWRGFVCVRGFD+K+RAPRPL
Sbjct  1772  SPMNIPRQWLWNLPRRTVYFGTSIPTIFKGLSTEGIQYCFWRGFVCVRGFDRKSRAPRPL  1831

Query  182   IARLHFPA-SRLAKNKNENGRK  244
             IARLHFPA SRL K K +   K
Sbjct  1832  IARLHFPASSRLGKGKGKVDEK  1853



>ref|XP_010509466.1| PREDICTED: protein ROS1-like [Camelina sativa]
Length=1439

 Score =   132 bits (332),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPR+TV+FGTS+ +IFKGL TD+IQ CFW+G+VCVRGFD+KTR P+PL
Sbjct  1361  NPIDVPRDWIWKLPRKTVFFGTSIPSIFKGLPTDKIQQCFWKGYVCVRGFDRKTRGPKPL  1420

Query  182   IARLHFPASRL  214
             IARLHFPAS++
Sbjct  1421  IARLHFPASKM  1431



>ref|XP_004292428.1| PREDICTED: transcriptional activator DEMETER-like [Fragaria vesca 
subsp. vesca]
Length=1959

 Score =   132 bits (333),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRR VYFGTSV++IF+GL+T+ IQ+CFWRG+VCVRGFD+ TRAP+PL
Sbjct  1882  NPIDVPRGWIWNLPRRPVYFGTSVTSIFRGLTTEGIQYCFWRGYVCVRGFDRSTRAPKPL  1941

Query  182   IARLHFPASRLAKNKNE  232
             IARLHFP S++ K ++E
Sbjct  1942  IARLHFPQSKMTKTRDE  1958



>ref|XP_010558957.1| PREDICTED: protein ROS1 isoform X1 [Tarenaya hassleriana]
Length=1681

 Score =   132 bits (332),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW L R+TVYFGTS+ +IF+GL+T++IQHCFWRG+VCVRGFD+KTRAPRPL
Sbjct  1596  NPIDVPRDWIWNLSRKTVYFGTSIPSIFRGLTTERIQHCFWRGYVCVRGFDRKTRAPRPL  1655

Query  182   IARLHFPASRLAKNKNENGRKQASAA  259
             IARLHFP S++A    +N   +ASAA
Sbjct  1656  IARLHFPVSKIAGRGRDN---RASAA  1678



>ref|XP_010558958.1| PREDICTED: protein ROS1 isoform X2 [Tarenaya hassleriana]
Length=1567

 Score =   132 bits (332),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW L R+TVYFGTS+ +IF+GL+T++IQHCFWRG+VCVRGFD+KTRAPRPL
Sbjct  1482  NPIDVPRDWIWNLSRKTVYFGTSIPSIFRGLTTERIQHCFWRGYVCVRGFDRKTRAPRPL  1541

Query  182   IARLHFPASRLAKNKNENGRKQASAA  259
             IARLHFP S++A    +N   +ASAA
Sbjct  1542  IARLHFPVSKIAGRGRDN---RASAA  1564



>ref|XP_010032106.1| PREDICTED: transcriptional activator DEMETER-like [Eucalyptus 
grandis]
 ref|XP_010032107.1| PREDICTED: transcriptional activator DEMETER-like [Eucalyptus 
grandis]
 gb|KCW51499.1| hypothetical protein EUGRSUZ_J01016 [Eucalyptus grandis]
Length=1884

 Score =   132 bits (332),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTSV+TIFKGLST++IQ+CFWRGFVCVRGFD+K RAPRPL
Sbjct  1810  NPICVPRDSIWSLRRRTVYFGTSVTTIFKGLSTEEIQYCFWRGFVCVRGFDRKFRAPRPL  1869

Query  182   IARLHFPASRLAKNKN  229
             +ARLHFPAS+ AK +N
Sbjct  1870  VARLHFPASK-AKTRN  1884



>ref|XP_010505197.1| PREDICTED: protein ROS1-like [Camelina sativa]
Length=1414

 Score =   131 bits (330),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRRTV+FGTS+ +IFKGL TD+IQ CFW+G+VCVRGFD+KTR P+PL
Sbjct  1336  NPIDVPREWLWDLPRRTVFFGTSIPSIFKGLPTDKIQQCFWKGYVCVRGFDRKTRGPKPL  1395

Query  182   IARLHFPASRL  214
             IARLHFPAS++
Sbjct  1396  IARLHFPASKM  1406



>ref|XP_008804392.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Phoenix dactylifera]
Length=2116

 Score =   131 bits (330),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVY GTS+ TIF+GL+T++IQ CFWRGFVCVRGFD+KTRAP+PL
Sbjct  2004  NPIDVPREWIWSLPRRTVYCGTSIPTIFRGLTTEEIQQCFWRGFVCVRGFDRKTRAPKPL  2063

Query  182   IARLHFPASRLAKNK  226
              ARLH PAS+  KN+
Sbjct  2064  YARLHLPASKAPKNR  2078



>ref|XP_008804393.1| PREDICTED: transcriptional activator DEMETER-like isoform X2 
[Phoenix dactylifera]
Length=2112

 Score =   131 bits (330),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVY GTS+ TIF+GL+T++IQ CFWRGFVCVRGFD+KTRAP+PL
Sbjct  2000  NPIDVPREWIWSLPRRTVYCGTSIPTIFRGLTTEEIQQCFWRGFVCVRGFDRKTRAPKPL  2059

Query  182   IARLHFPASRLAKNK  226
              ARLH PAS+  KN+
Sbjct  2060  YARLHLPASKAPKNR  2074



>ref|XP_010909158.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Elaeis guineensis]
 ref|XP_010909159.1| PREDICTED: transcriptional activator DEMETER-like isoform X1 
[Elaeis guineensis]
Length=1901

 Score =   131 bits (330),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PI VPR+ IW LPRRTVYFGTSV +IFKGL+T++ Q CFWRG++CVRGF+++TRAP+PL
Sbjct  1818  SPIHVPRKWIWNLPRRTVYFGTSVPSIFKGLTTEETQQCFWRGYICVRGFERETRAPKPL  1877

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS+  KNK
Sbjct  1878  CARLHFPASKAPKNK  1892



>ref|XP_010909161.1| PREDICTED: transcriptional activator DEMETER-like isoform X3 
[Elaeis guineensis]
Length=1857

 Score =   131 bits (329),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PI VPR+ IW LPRRTVYFGTSV +IFKGL+T++ Q CFWRG++CVRGF+++TRAP+PL
Sbjct  1774  SPIHVPRKWIWNLPRRTVYFGTSVPSIFKGLTTEETQQCFWRGYICVRGFERETRAPKPL  1833

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS+  KNK
Sbjct  1834  CARLHFPASKAPKNK  1848



>ref|XP_010909160.1| PREDICTED: transcriptional activator DEMETER-like isoform X2 
[Elaeis guineensis]
Length=1870

 Score =   131 bits (329),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PI VPR+ IW LPRRTVYFGTSV +IFKGL+T++ Q CFWRG++CVRGF+++TRAP+PL
Sbjct  1787  SPIHVPRKWIWNLPRRTVYFGTSVPSIFKGLTTEETQQCFWRGYICVRGFERETRAPKPL  1846

Query  182   IARLHFPASRLAKNK  226
              ARLHFPAS+  KNK
Sbjct  1847  CARLHFPASKAPKNK  1861



>ref|XP_010273107.1| PREDICTED: transcriptional activator DEMETER-like [Nelumbo nucifera]
Length=2069

 Score =   130 bits (328),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI+VPR  +W L RRTVYFGTS+ TIF+GLST  IQ+CFW+GFVCVRGFDQKTRAPRPL
Sbjct  1990  NPINVPRAWLWNLQRRTVYFGTSIPTIFRGLSTQDIQNCFWKGFVCVRGFDQKTRAPRPL  2049

Query  182   IARLHFPASRLAKNKNE  232
              AR H+PAS+L + K +
Sbjct  2050  QARFHYPASKLNRTKTQ  2066



>ref|XP_010912229.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional activator DEMETER-like 
[Elaeis guineensis]
Length=2130

 Score =   130 bits (328),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRR VYFG+S+ TIF+GL+T++IQ CFWRGFVCVRGFD++TRAP+PL
Sbjct  2018  NPIDVPREWIWKLPRRMVYFGSSIPTIFRGLTTEEIQQCFWRGFVCVRGFDRRTRAPKPL  2077

Query  182   IARLHFPASRLAKNK  226
              ARLH PAS+  +NK
Sbjct  2078  YARLHLPASKAPRNK  2092



>ref|XP_006410826.1| hypothetical protein EUTSA_v10016139mg [Eutrema salsugineum]
 gb|ESQ52279.1| hypothetical protein EUTSA_v10016139mg [Eutrema salsugineum]
Length=1468

 Score =   130 bits (326),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI++PR  +W LPR+TVYFGTS+ +IFKGL T++IQH FWRG+VCVRGFD+KTR P+PL
Sbjct  1388  NPINIPRDWLWKLPRKTVYFGTSIPSIFKGLPTEKIQHAFWRGYVCVRGFDRKTRGPKPL  1447

Query  182   IARLHFPASRLAKNKNEN  235
             IARLHFPASR+      N
Sbjct  1448  IARLHFPASRMKSQSQAN  1465



>ref|XP_010509464.1| PREDICTED: protein ROS1-like isoform X2 [Camelina sativa]
Length=1525

 Score =   129 bits (325),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PIDVPR  +W L RRTVYFGTS+ TIFKGL T+ IQ CFWRG+VCVRGFD+KTR P+PL
Sbjct  1442  DPIDVPREWLWDLHRRTVYFGTSIPTIFKGLPTETIQQCFWRGYVCVRGFDRKTRGPKPL  1501

Query  182   IARLHFPASRLAKNKNENGR  241
             IARLHFP S++    NE+ +
Sbjct  1502  IARLHFPVSKMKSRANESSK  1521



>ref|XP_010509463.1| PREDICTED: protein ROS1-like isoform X1 [Camelina sativa]
Length=1528

 Score =   129 bits (325),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PIDVPR  +W L RRTVYFGTS+ TIFKGL T+ IQ CFWRG+VCVRGFD+KTR P+PL
Sbjct  1445  DPIDVPREWLWDLHRRTVYFGTSIPTIFKGLPTETIQQCFWRGYVCVRGFDRKTRGPKPL  1504

Query  182   IARLHFPASRLAKNKNENGR  241
             IARLHFP S++    NE+ +
Sbjct  1505  IARLHFPVSKMKSRANESSK  1524



>ref|XP_009122582.1| PREDICTED: transcriptional activator DEMETER [Brassica rapa]
Length=1926

 Score =   129 bits (325),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IFKG+ST+QIQ+ FWRGFVCVRGF+ KTRAPRPL+
Sbjct  1852  PIDVPRDWIWDLPRRTVYFGTSVTSIFKGMSTEQIQYSFWRGFVCVRGFEPKTRAPRPLM  1911

Query  185   ARLHFPASRLAKNK  226
             ARLHF  +++ KNK
Sbjct  1912  ARLHFQKNKVKKNK  1925



>emb|CDX70214.1| BnaA10g25630D [Brassica napus]
Length=1868

 Score =   129 bits (325),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IFKG+ST+QIQ+ FWRGFVCVRGF+ KTRAPRPL+
Sbjct  1794  PIDVPRDWIWDLPRRTVYFGTSVTSIFKGMSTEQIQYSFWRGFVCVRGFEPKTRAPRPLM  1853

Query  185   ARLHFPASRLAKNK  226
             ARLHF  +++ KNK
Sbjct  1854  ARLHFQKNKVKKNK  1867



>ref|XP_010506092.1| PREDICTED: protein ROS1-like [Camelina sativa]
 ref|XP_010506093.1| PREDICTED: protein ROS1-like [Camelina sativa]
Length=1044

 Score =   129 bits (323),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR LIW LPR+TVYFGTS ++IFKGLST +IQ CFWRGFVCVRGFD++TR P+PLI
Sbjct  971   PIDVPRDLIWDLPRKTVYFGTSTTSIFKGLSTYEIQQCFWRGFVCVRGFDRRTRGPKPLI  1030

Query  185   ARLHFPASRL  214
             ARLHFP S+L
Sbjct  1031  ARLHFPGSKL  1040



>emb|CDY44867.1| BnaC09g50670D [Brassica napus]
Length=1710

 Score =   129 bits (323),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  IW LPRRTVYFGTSV++IFKG+ST+QIQ+ FWRGFVCVRGF+ KTRAPRPL+
Sbjct  1637  PIDVPRDWIWDLPRRTVYFGTSVTSIFKGMSTEQIQYSFWRGFVCVRGFEPKTRAPRPLM  1696

Query  185   ARLHFPASRLAKNK  226
             ARLHFP +++ KNK
Sbjct  1697  ARLHFPKNKV-KNK  1709



>emb|CDO99852.1| unnamed protein product [Coffea canephora]
Length=1906

 Score =   128 bits (322),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W LPRRTVYFGTSV++IF+GLST  IQ CFW+GFVCVRGFD+K+RAPRPL
Sbjct  1828  NPIDVPRDWLWQLPRRTVYFGTSVTSIFRGLSTPVIQQCFWKGFVCVRGFDRKSRAPRPL  1887

Query  182   IARLHFPASRLAKNKNE  232
               RLH  AS++ KNK++
Sbjct  1888  QRRLHETASKITKNKDK  1904



>ref|XP_010038860.1| PREDICTED: LOW QUALITY PROTEIN: protein ROS1 [Eucalyptus grandis]
Length=181

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    IDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLIA  187
            IDVPR L+W L R+TVYFGTS+ +IFKG+ T  I+ CFW GFVCVRGFD+KTRAPRPL+ 
Sbjct  102  IDVPRSLLWRLQRKTVYFGTSIPSIFKGMLTKDIKRCFWEGFVCVRGFDRKTRAPRPLVX  161

Query  188  RLHFPASRLAKNKNENGRKQ  247
            RLHFPAS+LAK K +    Q
Sbjct  162  RLHFPASKLAKRKGKKDDGQ  181



>ref|NP_001146555.1| uncharacterized protein LOC100280151 [Zea mays]
 gb|ACL54273.1| unknown [Zea mays]
Length=501

 Score =   124 bits (312),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
            NPIDVPR  IW LPRRTVYFGTSV TIF+GL+T++IQ CFWRGFVCVRGFD+  RAPRPL
Sbjct  418  NPIDVPRSWIWDLPRRTVYFGTSVPTIFRGLTTEEIQRCFWRGFVCVRGFDRTVRAPRPL  477

Query  182  IARLHFPASRLAKNK  226
             ARLHFP S++ + K
Sbjct  478  YARLHFPVSKVVRGK  492



>emb|CDY33158.1| BnaC04g08810D [Brassica napus]
Length=1324

 Score =   127 bits (320),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  +W L RRTVYFGTS+ +IFKGLST+ IQ CFWRG+VCVRGFD++TRAPRPLI
Sbjct  1246  PIDVPRDWLWDLARRTVYFGTSIPSIFKGLSTETIQQCFWRGYVCVRGFDRQTRAPRPLI  1305

Query  185   ARLHFPASRLAKNKNEN  235
             ARLHFP S++    N +
Sbjct  1306  ARLHFPKSKMKSQVNPD  1322



>ref|XP_009143581.1| PREDICTED: protein ROS1 isoform X2 [Brassica rapa]
Length=1399

 Score =   127 bits (320),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  +W L RRTVYFGTS+ +IFKGLST+ IQ CFWRG+VCVRGFD++TRAPRPLI
Sbjct  1321  PIDVPRDWLWDLARRTVYFGTSIPSIFKGLSTETIQQCFWRGYVCVRGFDRQTRAPRPLI  1380

Query  185   ARLHFPASRLAKNKNEN  235
             ARLHFP S++    N +
Sbjct  1381  ARLHFPKSKMKSQVNPD  1397



>ref|XP_009143580.1| PREDICTED: protein ROS1 isoform X1 [Brassica rapa]
Length=1400

 Score =   127 bits (320),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  +W L RRTVYFGTS+ +IFKGLST+ IQ CFWRG+VCVRGFD++TRAPRPLI
Sbjct  1322  PIDVPRDWLWDLARRTVYFGTSIPSIFKGLSTETIQQCFWRGYVCVRGFDRQTRAPRPLI  1381

Query  185   ARLHFPASRLAKNKNEN  235
             ARLHFP S++    N +
Sbjct  1382  ARLHFPKSKMKSQVNPD  1398



>gb|KEH42104.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=2841

 Score =   127 bits (319),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NP+ VPR  IW L RRTVYFGTS ++IFKGLST +IQ  FWRG++CVRGF+++TR PRPL
Sbjct  2085  NPVSVPRSWIWNLNRRTVYFGTSTTSIFKGLSTQEIQQAFWRGYICVRGFERETRTPRPL  2144

Query  182   IARLHFPASRLAKNKNENGRKQA  250
             +ARLHFPAS+LAK  NE  +K++
Sbjct  2145  MARLHFPASKLAKT-NEKTKKES  2166



>emb|CDX75034.1| BnaA05g07800D [Brassica napus]
Length=1300

 Score =   127 bits (318),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  5     PIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPLI  184
             PIDVPR  +W L RRTVYFGTS+ +IFKGLST+ IQ CFWRG+VCVRGFD++TRAPRPLI
Sbjct  1222  PIDVPRDWLWDLARRTVYFGTSIPSIFKGLSTETIQQCFWRGYVCVRGFDRQTRAPRPLI  1281

Query  185   ARLHFPASRLAKNKNEN  235
             ARLHFP S++    N +
Sbjct  1282  ARLHFPKSKMKSQVNPD  1298



>ref|XP_002881449.1| hypothetical protein ARALYDRAFT_902767 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57708.1| hypothetical protein ARALYDRAFT_902767 [Arabidopsis lyrata subsp. 
lyrata]
Length=1619

 Score =   126 bits (317),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  +W L RR VYFGTS+ TIFKGLST+ IQ CFWRG+VCVRGFD++TR P+PL
Sbjct  1533  NPIDVPRETLWDLTRRAVYFGTSIPTIFKGLSTETIQQCFWRGYVCVRGFDRETRGPKPL  1592

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             IARLHFP S++    N   +    A+K
Sbjct  1593  IARLHFPVSKMKSLANPPNQSATKASK  1619



>ref|XP_010940517.1| PREDICTED: transcriptional activator DEMETER [Elaeis guineensis]
Length=2152

 Score =   126 bits (317),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR  IW LPRRTVYFGTS+ TIFKGL+T+ IQ CFWRGFVCVRGFD+ TRAP+PL
Sbjct  2068  NPIDVPREWIWNLPRRTVYFGTSIPTIFKGLTTEGIQQCFWRGFVCVRGFDRTTRAPKPL  2127

Query  182   IARLHFP  202
              ARLHFP
Sbjct  2128  YARLHFP  2134



>ref|XP_008807513.1| PREDICTED: uncharacterized protein LOC103719855 isoform X3 [Phoenix 
dactylifera]
Length=2139

 Score =   125 bits (314),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR+ IW LPRRTVYFGTS+ TIFKGL+T+ IQ CFWRGFVCVRGFD+ TRAP+PL
Sbjct  2055  NPIDVPRQWIWNLPRRTVYFGTSMPTIFKGLTTEVIQQCFWRGFVCVRGFDRITRAPKPL  2114

Query  182   IARLHFP  202
              ARLHFP
Sbjct  2115  YARLHFP  2121



>ref|XP_008807510.1| PREDICTED: uncharacterized protein LOC103719855 isoform X1 [Phoenix 
dactylifera]
Length=2202

 Score =   125 bits (314),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR+ IW LPRRTVYFGTS+ TIFKGL+T+ IQ CFWRGFVCVRGFD+ TRAP+PL
Sbjct  2118  NPIDVPRQWIWNLPRRTVYFGTSMPTIFKGLTTEVIQQCFWRGFVCVRGFDRITRAPKPL  2177

Query  182   IARLHFP  202
              ARLHFP
Sbjct  2178  YARLHFP  2184



>ref|XP_010516874.1| PREDICTED: protein ROS1-like isoform X2 [Camelina sativa]
Length=1542

 Score =   125 bits (313),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PIDVPR  +W L RRTVYFGTS+ TIFKGL T+ IQ CFWRG+VCVRGFD+KTR P+PL
Sbjct  1463  DPIDVPREWLWDLHRRTVYFGTSIPTIFKGLPTETIQQCFWRGYVCVRGFDRKTRGPKPL  1522

Query  182   IARLHFPASRLAKNKNENGR  241
             IARLHFP  ++     E+ +
Sbjct  1523  IARLHFPVRKMKSRATESAK  1542



>ref|XP_008807511.1| PREDICTED: uncharacterized protein LOC103719855 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008807512.1| PREDICTED: uncharacterized protein LOC103719855 isoform X2 [Phoenix 
dactylifera]
Length=2163

 Score =   125 bits (313),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPIDVPR+ IW LPRRTVYFGTS+ TIFKGL+T+ IQ CFWRGFVCVRGFD+ TRAP+PL
Sbjct  2079  NPIDVPRQWIWNLPRRTVYFGTSMPTIFKGLTTEVIQQCFWRGFVCVRGFDRITRAPKPL  2138

Query  182   IARLHFP  202
              ARLHFP
Sbjct  2139  YARLHFP  2145



>ref|XP_010516872.1| PREDICTED: protein ROS1-like isoform X1 [Camelina sativa]
 ref|XP_010516873.1| PREDICTED: protein ROS1-like isoform X1 [Camelina sativa]
Length=1545

 Score =   125 bits (313),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PIDVPR  +W L RRTVYFGTS+ TIFKGL T+ IQ CFWRG+VCVRGFD+KTR P+PL
Sbjct  1466  DPIDVPREWLWDLHRRTVYFGTSIPTIFKGLPTETIQQCFWRGYVCVRGFDRKTRGPKPL  1525

Query  182   IARLHFPASRLAKNKNENGR  241
             IARLHFP  ++     E+ +
Sbjct  1526  IARLHFPVRKMKSRATESAK  1545



>ref|XP_008793977.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103710135 
[Phoenix dactylifera]
Length=1933

 Score =   124 bits (312),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             +PI VPR+ IW LPR+TVYFGTSV++IF+GL+T++IQ CF RG +CVRGF+++TRAPRPL
Sbjct  1850  SPIHVPRKWIWNLPRQTVYFGTSVTSIFRGLTTEEIQQCFKRGNICVRGFERETRAPRPL  1909

Query  182   IARLHFPASRLAKNK  226
              ARLHFPASR  KNK
Sbjct  1910  SARLHFPASRAPKNK  1924



>gb|KHN45686.1| Protein ROS1 [Glycine soja]
Length=2014

 Score =   124 bits (312),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTSV+TIFKGL+T + Q CFWRG++CVRGFD++ RAPRPL
Sbjct  1909  NPISVPRSWIWNLNRRTVYFGTSVTTIFKGLTTQETQQCFWRGYICVRGFDREARAPRPL  1968

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             +ARLHFPAS+LA    E  +K++++AK
Sbjct  1969  MARLHFPASKLAAKTKEKAKKESNSAK  1995



>ref|XP_006588820.1| PREDICTED: protein ROS1-like isoform X1 [Glycine max]
 ref|XP_006588821.1| PREDICTED: protein ROS1-like isoform X2 [Glycine max]
Length=2014

 Score =   124 bits (312),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTSV+TIFKGL+T + Q CFWRG++CVRGFD++ RAPRPL
Sbjct  1909  NPISVPRSWIWNLNRRTVYFGTSVTTIFKGLTTQETQQCFWRGYICVRGFDREARAPRPL  1968

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             +ARLHFPAS+LA    E  +K++++AK
Sbjct  1969  MARLHFPASKLAAKTKEKAKKESNSAK  1995



>ref|XP_006588823.1| PREDICTED: protein ROS1-like isoform X4 [Glycine max]
Length=1932

 Score =   124 bits (311),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     NPIDVPRRLIWYLPRRTVYFGTSVSTIFKGLSTDQIQHCFWRGFVCVRGFDQKTRAPRPL  181
             NPI VPR  IW L RRTVYFGTSV+TIFKGL+T + Q CFWRG++CVRGFD++ RAPRPL
Sbjct  1827  NPISVPRSWIWNLNRRTVYFGTSVTTIFKGLTTQETQQCFWRGYICVRGFDREARAPRPL  1886

Query  182   IARLHFPASRLAKNKNENGRKQASAAK  262
             +ARLHFPAS+LA    E  +K++++AK
Sbjct  1887  MARLHFPASKLAAKTKEKAKKESNSAK  1913



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3500367830012