BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6611_g1_i1 len=1437 path=[1:0-581 583:582-1436]

Length=1437
                                                                      Score     E

ref|XP_009615449.1|  PREDICTED: uncharacterized protein LOC104108167    548   0.0      
ref|XP_009767018.1|  PREDICTED: uncharacterized protein LOC104218270    534   0.0      
ref|XP_006344154.1|  PREDICTED: uncharacterized protein LOC102583596    523   2e-180   
ref|XP_004238911.1|  PREDICTED: uncharacterized protein LOC101249358    514   6e-177   
ref|XP_006468735.1|  PREDICTED: uncharacterized protein LOC102627900    505   3e-173   
ref|XP_011070777.1|  PREDICTED: uncharacterized protein LOC105156363    503   4e-172   
ref|XP_010265065.1|  PREDICTED: uncharacterized protein LOC104602904    492   6e-168   
ref|XP_006344302.1|  PREDICTED: uncharacterized protein LOC102604936    489   2e-167   
ref|XP_006448426.1|  hypothetical protein CICLE_v10015505mg             486   1e-165   
ref|XP_011022393.1|  PREDICTED: uncharacterized protein LOC105124187    483   8e-165   
ref|XP_011007454.1|  PREDICTED: uncharacterized protein LOC105113...    483   1e-164   
ref|XP_007044265.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    482   4e-164   
ref|XP_011007447.1|  PREDICTED: uncharacterized protein LOC105113...    479   3e-163   
ref|XP_009356238.1|  PREDICTED: uncharacterized protein LOC103947108    479   3e-163   
ref|XP_002276828.1|  PREDICTED: uncharacterized protein LOC100247520    478   7e-163   Vitis vinifera
ref|XP_002315928.1|  hypothetical protein POPTR_0010s13150g             478   8e-163   Populus trichocarpa [western balsam poplar]
ref|XP_002311468.2|  hypothetical protein POPTR_0008s12260g             478   8e-163   Populus trichocarpa [western balsam poplar]
ref|XP_010264609.1|  PREDICTED: uncharacterized protein LOC104602574    474   3e-161   
ref|XP_010663889.1|  PREDICTED: uncharacterized protein LOC100252627    471   3e-160   
gb|KEH44200.1|  core-2/I-branching enzyme                               468   1e-158   
gb|KHN06677.1|  hypothetical protein glysoja_021223                     468   3e-158   
ref|XP_003536674.1|  PREDICTED: uncharacterized protein LOC100810724    466   1e-157   
ref|XP_003614560.1|  hypothetical protein MTR_5g055480                  464   3e-157   
ref|XP_010099264.1|  hypothetical protein L484_015454                   465   4e-157   
ref|XP_006485819.1|  PREDICTED: uncharacterized protein LOC102611796    464   8e-157   
ref|XP_010644813.1|  PREDICTED: uncharacterized protein LOC100245576    463   1e-156   
ref|XP_007044266.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    461   3e-156   
ref|XP_007222895.1|  hypothetical protein PRUPE_ppa006723mg             462   3e-156   
ref|XP_006442617.1|  hypothetical protein CICLE_v10020320mg             462   3e-156   
ref|XP_004497066.1|  PREDICTED: uncharacterized protein LOC101490811    461   8e-156   
gb|KHN20747.1|  hypothetical protein glysoja_019064                     457   9e-156   
gb|EYU30001.1|  hypothetical protein MIMGU_mgv1a007596mg                458   9e-155   
ref|XP_009348209.1|  PREDICTED: uncharacterized protein LOC103939820    457   2e-154   
ref|XP_003530022.2|  PREDICTED: uncharacterized protein LOC100791882    456   2e-154   
gb|ACU18543.1|  unknown                                                 456   6e-154   Glycine max [soybeans]
ref|XP_004516650.1|  PREDICTED: uncharacterized protein LOC101496316    456   6e-154   
ref|XP_009624653.1|  PREDICTED: uncharacterized protein LOC104115679    455   1e-153   
ref|XP_003532515.1|  PREDICTED: uncharacterized protein LOC100782511    454   2e-153   
gb|KHN21596.1|  hypothetical protein glysoja_023448                     452   5e-153   
ref|XP_010926004.1|  PREDICTED: uncharacterized protein LOC105048408    453   1e-152   
ref|XP_007142937.1|  hypothetical protein PHAVU_007G029800g             453   1e-152   
gb|KHN16548.1|  hypothetical protein glysoja_002645                     451   1e-152   
ref|XP_010066702.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    454   2e-152   
ref|XP_009413609.1|  PREDICTED: uncharacterized protein LOC103994882    452   2e-152   
ref|XP_008243270.1|  PREDICTED: uncharacterized protein LOC103341513    452   3e-152   
ref|XP_003524367.1|  PREDICTED: uncharacterized protein LOC100815747    450   4e-152   
ref|XP_008374777.1|  PREDICTED: uncharacterized protein LOC103438016    451   5e-152   
emb|CBI15481.3|  unnamed protein product                                449   5e-152   
ref|XP_007160392.1|  hypothetical protein PHAVU_002G318000g             451   7e-152   
ref|XP_003555913.1|  PREDICTED: uncharacterized protein LOC100779041    451   8e-152   
ref|XP_009360137.1|  PREDICTED: uncharacterized protein LOC103950632    451   2e-151   
ref|XP_009763003.1|  PREDICTED: uncharacterized protein LOC104214...    450   2e-151   
ref|XP_010916432.1|  PREDICTED: uncharacterized protein LOC105041249    449   3e-151   
ref|XP_008393326.1|  PREDICTED: uncharacterized protein LOC103455513    450   4e-151   
ref|XP_003620433.1|  hypothetical protein MTR_6g083830                  448   1e-150   
gb|AES76651.2|  core-2/I-branching enzyme                               448   1e-150   
ref|XP_003533360.1|  PREDICTED: uncharacterized protein LOC100803748    448   3e-150   
ref|XP_008240316.1|  PREDICTED: uncharacterized protein LOC103338837    447   4e-150   
ref|XP_008812373.1|  PREDICTED: uncharacterized protein LOC103723273    446   4e-150   
ref|XP_009357077.1|  PREDICTED: uncharacterized protein LOC103947833    445   8e-150   
ref|XP_002321483.2|  hypothetical protein POPTR_0015s03850g             445   1e-149   Populus trichocarpa [western balsam poplar]
ref|XP_007152746.1|  hypothetical protein PHAVU_004G156000g             446   2e-149   
ref|XP_008339646.1|  PREDICTED: uncharacterized protein LOC103402673    444   3e-149   
ref|XP_004299046.1|  PREDICTED: uncharacterized protein LOC101307491    444   4e-149   
ref|XP_011008309.1|  PREDICTED: uncharacterized protein LOC105113714    442   8e-149   
ref|XP_008806040.1|  PREDICTED: uncharacterized protein LOC103718829    442   2e-148   
ref|XP_011072929.1|  PREDICTED: uncharacterized protein LOC105158025    441   8e-148   
ref|XP_003535134.1|  PREDICTED: uncharacterized protein LOC100811590    440   4e-147   
emb|CDO98417.1|  unnamed protein product                                439   4e-147   
ref|XP_010094729.1|  hypothetical protein L484_019938                   439   1e-146   
ref|XP_008467193.1|  PREDICTED: uncharacterized protein LOC103504601    435   6e-146   
ref|XP_004301820.1|  PREDICTED: uncharacterized protein LOC101311102    435   2e-145   
gb|KFK41255.1|  hypothetical protein AALP_AA2G105500                    433   5e-145   
ref|XP_007208909.1|  hypothetical protein PRUPE_ppa027107mg             429   6e-145   
ref|XP_010045650.1|  PREDICTED: uncharacterized protein LOC104434412    432   3e-144   
ref|XP_004299045.1|  PREDICTED: uncharacterized protein LOC101307203    431   4e-144   
emb|CBI15480.3|  unnamed protein product                                426   6e-144   
ref|XP_009768969.1|  PREDICTED: uncharacterized protein LOC104219898    431   8e-144   
emb|CDP00653.1|  unnamed protein product                                426   9e-144   
gb|KCW83891.1|  hypothetical protein EUGRSUZ_B00742                     426   1e-143   
ref|XP_009589451.1|  PREDICTED: uncharacterized protein LOC104086812    430   1e-143   
ref|XP_004147140.1|  PREDICTED: uncharacterized protein LOC101202787    428   3e-143   
ref|XP_004512994.1|  PREDICTED: uncharacterized protein LOC101496836    426   4e-142   
ref|XP_002887179.1|  hypothetical protein ARALYDRAFT_475958             424   2e-141   
emb|CBI26988.3|  unnamed protein product                                417   6e-140   
ref|XP_008812383.1|  PREDICTED: uncharacterized protein LOC103723284    418   2e-139   
ref|XP_010470788.1|  PREDICTED: uncharacterized protein LOC104750...    418   5e-139   
ref|XP_011097027.1|  PREDICTED: uncharacterized protein LOC105176048    418   6e-139   
ref|XP_010470787.1|  PREDICTED: uncharacterized protein LOC104750...    420   7e-139   
gb|AFK35806.1|  unknown                                                 417   9e-139   
ref|XP_003610779.1|  hypothetical protein MTR_5g006920                  418   1e-138   
ref|XP_010916430.1|  PREDICTED: uncharacterized protein LOC105041248    417   1e-138   
gb|KEH27363.1|  core-2/I-branching enzyme                               415   4e-138   
ref|XP_009403975.1|  PREDICTED: uncharacterized protein LOC103987406    415   6e-138   
ref|XP_007224741.1|  hypothetical protein PRUPE_ppa024535mg             414   2e-137   
ref|XP_010415458.1|  PREDICTED: uncharacterized protein LOC104701464    414   3e-137   
ref|XP_007036567.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    414   4e-137   
ref|XP_006302341.1|  hypothetical protein CARUB_v10020398mg             412   7e-137   
ref|XP_006391143.1|  hypothetical protein EUTSA_v10019817mg             412   9e-137   
ref|XP_004252429.1|  PREDICTED: uncharacterized protein LOC101255566    408   2e-136   
ref|XP_002535241.1|  conserved hypothetical protein                     407   2e-136   Ricinus communis
ref|XP_009105384.1|  PREDICTED: uncharacterized protein LOC103831252    410   8e-136   
ref|NP_177006.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    410   8e-136   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59287.1|  hypothetical protein M569_15522                         409   1e-135   
gb|AHL38887.1|  glycosyltransferase                                     409   1e-135   
emb|CDY59035.1|  BnaCnng34190D                                          409   2e-135   
ref|XP_010513660.1|  PREDICTED: uncharacterized protein LOC104789704    407   6e-135   
gb|EYU41282.1|  hypothetical protein MIMGU_mgv1a010939mg                403   1e-134   
ref|XP_009127627.1|  PREDICTED: uncharacterized protein LOC103852476    407   2e-134   
emb|CDX81507.1|  BnaC02g18110D                                          406   2e-134   
ref|XP_006353820.1|  PREDICTED: uncharacterized protein LOC102581987    403   2e-134   
ref|XP_010678016.1|  PREDICTED: uncharacterized protein LOC104893585    404   5e-134   
ref|XP_008243418.1|  PREDICTED: uncharacterized protein LOC103341652    404   2e-133   
ref|XP_008340286.1|  PREDICTED: uncharacterized protein LOC103403235    404   3e-133   
gb|KDP20145.1|  hypothetical protein JCGZ_05914                         403   3e-133   
ref|XP_004167307.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    399   1e-132   
ref|XP_009356310.1|  PREDICTED: uncharacterized protein LOC103947180    401   2e-132   
ref|XP_004300972.1|  PREDICTED: uncharacterized protein LOC101293100    400   2e-132   
ref|XP_006341708.1|  PREDICTED: uncharacterized protein LOC102599552    399   1e-131   
ref|XP_004160451.1|  PREDICTED: uncharacterized protein LOC101227205    397   3e-131   
ref|XP_004236422.2|  PREDICTED: uncharacterized protein LOC101267...    395   1e-129   
ref|XP_009356309.1|  PREDICTED: uncharacterized protein LOC103947179    394   1e-129   
ref|XP_008453432.1|  PREDICTED: uncharacterized protein LOC103494140    388   8e-129   
ref|XP_009358798.1|  PREDICTED: uncharacterized protein LOC103949407    390   1e-128   
gb|EPS62381.1|  hypothetical protein M569_12413                         390   1e-128   
ref|XP_007227633.1|  hypothetical protein PRUPE_ppa022907mg             386   7e-127   
gb|KDP29448.1|  hypothetical protein JCGZ_18369                         380   1e-126   
ref|XP_010694626.1|  PREDICTED: uncharacterized protein LOC104907403    383   6e-126   
ref|XP_006836850.1|  hypothetical protein AMTR_s00099p00078200          384   8e-126   
ref|XP_008351009.1|  PREDICTED: uncharacterized protein LOC103414400    380   2e-125   
ref|XP_010537457.1|  PREDICTED: uncharacterized protein LOC104812147    381   8e-125   
ref|XP_004137544.1|  PREDICTED: uncharacterized protein LOC101209845    378   8e-125   
ref|XP_002280674.1|  PREDICTED: uncharacterized protein LOC100244641    380   6e-124   Vitis vinifera
ref|XP_008350857.1|  PREDICTED: uncharacterized protein LOC103414237    378   2e-123   
ref|XP_009414639.1|  PREDICTED: uncharacterized protein LOC103995706    376   6e-123   
ref|XP_010108861.1|  hypothetical protein L484_027054                   377   7e-123   
ref|XP_010681643.1|  PREDICTED: uncharacterized protein LOC104896576    375   2e-122   
ref|XP_008244554.1|  PREDICTED: uncharacterized protein LOC103342693    371   1e-121   
ref|XP_002276791.2|  PREDICTED: uncharacterized protein LOC100257764    373   2e-121   Vitis vinifera
ref|XP_010693288.1|  PREDICTED: uncharacterized protein LOC104906249    371   7e-121   
ref|XP_010553652.1|  PREDICTED: uncharacterized protein LOC104823674    371   9e-121   
ref|XP_006391144.1|  hypothetical protein EUTSA_v10018660mg             370   2e-120   
emb|CBI15479.3|  unnamed protein product                                366   3e-120   
ref|XP_002315929.2|  hypothetical protein POPTR_0010s13160g             369   7e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011076478.1|  PREDICTED: uncharacterized protein LOC105160693    368   2e-119   
gb|EYU40777.1|  hypothetical protein MIMGU_mgv1a007709mg                368   2e-119   
ref|XP_010265068.1|  PREDICTED: uncharacterized protein LOC104602905    368   2e-119   
ref|XP_010927836.1|  PREDICTED: uncharacterized protein LOC105049787    367   3e-119   
ref|XP_010273586.1|  PREDICTED: uncharacterized protein LOC104609074    367   3e-119   
ref|XP_009399147.1|  PREDICTED: uncharacterized protein LOC103983624    366   6e-119   
emb|CDP02764.1|  unnamed protein product                                362   1e-118   
emb|CBI33634.3|  unnamed protein product                                362   1e-118   
ref|XP_007022850.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    365   2e-118   
ref|XP_008812747.1|  PREDICTED: uncharacterized protein LOC103723571    364   4e-118   
ref|XP_002305172.2|  hypothetical protein POPTR_0004s09690g             363   4e-118   Populus trichocarpa [western balsam poplar]
gb|KDP29447.1|  hypothetical protein JCGZ_18368                         362   5e-118   
ref|XP_006842356.1|  hypothetical protein AMTR_s00079p00179880          363   8e-118   
ref|XP_006385195.1|  hypothetical protein POPTR_0003s00960g             363   8e-118   
ref|XP_007033224.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    363   2e-117   
ref|XP_011007501.1|  PREDICTED: uncharacterized protein LOC105113...    362   3e-117   
ref|XP_007221893.1|  hypothetical protein PRUPE_ppa016090mg             362   4e-117   
emb|CDP00652.1|  unnamed protein product                                358   4e-117   
ref|XP_010065247.1|  PREDICTED: uncharacterized protein LOC104452469    361   5e-117   
ref|XP_008218660.1|  PREDICTED: uncharacterized protein LOC103318965    361   6e-117   
ref|XP_011035090.1|  PREDICTED: uncharacterized protein LOC105133011    360   6e-117   
ref|XP_009345696.1|  PREDICTED: uncharacterized protein LOC103937474    361   1e-116   
ref|XP_009615448.1|  PREDICTED: uncharacterized protein LOC104108166    360   1e-116   
ref|XP_009767015.1|  PREDICTED: uncharacterized protein LOC104218...    357   2e-116   
ref|XP_004300973.1|  PREDICTED: uncharacterized protein LOC101293399    360   2e-116   
ref|XP_003603189.1|  hypothetical protein MTR_3g104840                  360   2e-116   
ref|XP_011047853.1|  PREDICTED: uncharacterized protein LOC105142093    359   3e-116   
gb|KDP34129.1|  hypothetical protein JCGZ_07700                         359   3e-116   
ref|XP_007044267.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    359   4e-116   
ref|XP_006647208.1|  PREDICTED: uncharacterized protein LOC102715175    360   4e-116   
ref|XP_004972519.1|  PREDICTED: uncharacterized protein LOC101756391    361   4e-116   
ref|XP_006431491.1|  hypothetical protein CICLE_v10001419mg             358   5e-116   
ref|XP_009337144.1|  PREDICTED: uncharacterized protein LOC103929645    358   7e-116   
ref|XP_009767014.1|  PREDICTED: uncharacterized protein LOC104218...    358   7e-116   
ref|XP_008775897.1|  PREDICTED: uncharacterized protein LOC103696141    357   1e-115   
ref|XP_009410706.1|  PREDICTED: uncharacterized protein LOC103992641    357   1e-115   
ref|XP_008240317.1|  PREDICTED: uncharacterized protein LOC103338839    357   2e-115   
ref|XP_011007493.1|  PREDICTED: uncharacterized protein LOC105113...    358   2e-115   
ref|XP_010907977.1|  PREDICTED: uncharacterized protein LOC105034483    357   2e-115   
ref|XP_010551624.1|  PREDICTED: uncharacterized protein LOC104822176    356   3e-115   
emb|CAH67921.1|  OSIGBa0138E08-OSIGBa0161L23.2                          357   4e-115   Oryza sativa [red rice]
ref|XP_007036566.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    358   5e-115   
ref|NP_001052347.1|  Os04g0272400                                       357   5e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004238913.2|  PREDICTED: uncharacterized protein LOC101249916    354   5e-115   
ref|XP_008645560.1|  PREDICTED: uncharacterized protein LOC103626979    358   7e-115   
ref|XP_006349290.1|  PREDICTED: uncharacterized protein LOC102579219    355   1e-114   
ref|XP_009344746.1|  PREDICTED: uncharacterized protein LOC103936628    360   1e-114   
ref|XP_007208880.1|  hypothetical protein PRUPE_ppa026447mg             357   1e-114   
ref|XP_009411881.1|  PREDICTED: uncharacterized protein LOC103993515    355   1e-114   
ref|XP_002279551.2|  PREDICTED: uncharacterized protein LOC100250702    356   2e-114   Vitis vinifera
ref|XP_006598780.1|  PREDICTED: uncharacterized protein LOC100796...    355   2e-114   
ref|XP_008389264.1|  PREDICTED: uncharacterized protein LOC103451628    352   2e-114   
gb|EEC73057.1|  hypothetical protein OsI_07014                          356   2e-114   Oryza sativa Indica Group [Indian rice]
ref|NP_001046711.1|  Os02g0327500                                       356   2e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003573284.1|  PREDICTED: uncharacterized protein LOC100833185    355   2e-114   
emb|CDY31036.1|  BnaA08g25860D                                          354   2e-114   
ref|XP_010941940.1|  PREDICTED: uncharacterized protein LOC105060052    354   3e-114   
ref|XP_002516755.1|  conserved hypothetical protein                     353   4e-114   Ricinus communis
ref|XP_006344151.1|  PREDICTED: uncharacterized protein LOC102582712    350   5e-114   
ref|XP_010942037.1|  PREDICTED: uncharacterized protein LOC105060...    353   7e-114   
ref|XP_006470991.1|  PREDICTED: uncharacterized protein LOC102625...    353   7e-114   
emb|CDX94911.1|  BnaC05g07600D                                          353   8e-114   
ref|XP_010682059.1|  PREDICTED: uncharacterized protein LOC104896962    354   9e-114   
gb|KDP42488.1|  hypothetical protein JCGZ_00285                         352   1e-113   
emb|CBI26990.3|  unnamed protein product                                349   1e-113   
ref|XP_004972466.1|  PREDICTED: uncharacterized protein LOC101769924    353   2e-113   
ref|XP_007148589.1|  hypothetical protein PHAVU_006G221200g             352   2e-113   
ref|XP_010669159.1|  PREDICTED: uncharacterized protein LOC104886401    351   3e-113   
emb|CDX97139.1|  BnaC09g44860D                                          351   4e-113   
ref|XP_008796992.1|  PREDICTED: uncharacterized protein LOC103712290    351   4e-113   
ref|XP_007222675.1|  hypothetical protein PRUPE_ppa008602mg             348   4e-113   
ref|XP_006470990.1|  PREDICTED: uncharacterized protein LOC102625...    351   5e-113   
ref|XP_009144462.1|  PREDICTED: uncharacterized protein LOC103868...    351   5e-113   
ref|XP_009415010.1|  PREDICTED: uncharacterized protein LOC103995962    351   5e-113   
ref|XP_004161853.1|  PREDICTED: uncharacterized LOC101207079            351   6e-113   
dbj|BAK05476.1|  predicted protein                                      350   7e-113   
gb|KEH39949.1|  core-2/I-branching enzyme                               350   7e-113   
ref|XP_010046585.1|  PREDICTED: uncharacterized protein LOC104435558    350   1e-112   
ref|NP_001143215.1|  uncharacterized protein LOC100275720               351   1e-112   Zea mays [maize]
emb|CDX93443.1|  BnaA06g06050D                                          350   1e-112   
dbj|BAJ98037.1|  predicted protein                                      353   1e-112   
ref|NP_001143222.1|  uncharacterized protein LOC100275738               351   1e-112   Zea mays [maize]
ref|XP_004230423.1|  PREDICTED: uncharacterized protein LOC101259085    350   1e-112   
ref|XP_009360140.1|  PREDICTED: uncharacterized protein LOC103950635    349   2e-112   
ref|XP_002268014.1|  PREDICTED: uncharacterized protein LOC100250508    348   3e-112   Vitis vinifera
ref|XP_009357886.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    352   3e-112   
emb|CDX69735.1|  BnaA10g20840D                                          348   3e-112   
emb|CDX97141.1|  BnaC09g44840D                                          348   3e-112   
ref|XP_010519868.1|  PREDICTED: uncharacterized protein LOC104799181    348   4e-112   
gb|KHG05757.1|  hypothetical protein F383_31190                         348   4e-112   
emb|CBI29648.3|  unnamed protein product                                349   4e-112   
gb|KFK43315.1|  hypothetical protein AALP_AA1G108500                    349   5e-112   
ref|XP_002524909.1|  conserved hypothetical protein                     349   5e-112   Ricinus communis
ref|XP_002444900.1|  hypothetical protein SORBIDRAFT_07g001090          349   5e-112   Sorghum bicolor [broomcorn]
ref|XP_006355313.1|  PREDICTED: uncharacterized protein LOC102601627    348   6e-112   
ref|XP_008452226.1|  PREDICTED: uncharacterized protein LOC103493...    348   7e-112   
ref|XP_010475888.1|  PREDICTED: uncharacterized protein LOC104755237    348   7e-112   
emb|CDY20644.1|  BnaC08g14140D                                          348   8e-112   
ref|XP_011081713.1|  PREDICTED: uncharacterized protein LOC105164695    347   8e-112   
ref|XP_008452225.1|  PREDICTED: uncharacterized protein LOC103493...    347   1e-111   
ref|XP_006385074.1|  hypothetical protein POPTR_0004s23660g             347   1e-111   
ref|XP_010049161.1|  PREDICTED: uncharacterized protein LOC104437817    347   1e-111   
ref|XP_010536211.1|  PREDICTED: uncharacterized protein LOC104811254    347   1e-111   
ref|XP_009148352.1|  PREDICTED: uncharacterized protein LOC103871798    348   2e-111   
ref|XP_007012231.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    347   2e-111   
ref|XP_004163997.1|  PREDICTED: uncharacterized LOC101215808            347   2e-111   
ref|XP_010458365.1|  PREDICTED: uncharacterized protein LOC104739637    347   2e-111   
ref|NP_172499.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    347   3e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002516477.1|  conserved hypothetical protein                     345   3e-111   Ricinus communis
ref|XP_003540132.1|  PREDICTED: uncharacterized protein LOC100793763    346   3e-111   
ref|XP_010490863.1|  PREDICTED: uncharacterized protein LOC104768...    347   4e-111   
ref|XP_010648315.1|  PREDICTED: uncharacterized protein LOC100249300    345   5e-111   
ref|XP_009355369.1|  PREDICTED: uncharacterized protein LOC103946396    345   5e-111   
emb|CAN70606.1|  hypothetical protein VITISV_040196                     345   5e-111   Vitis vinifera
ref|XP_008459135.1|  PREDICTED: uncharacterized protein LOC103498310    346   6e-111   
ref|XP_002892557.1|  predicted protein                                  346   6e-111   
ref|XP_004245124.1|  PREDICTED: uncharacterized protein LOC101267146    345   7e-111   
ref|XP_010490870.1|  PREDICTED: uncharacterized protein LOC104768...    346   7e-111   
ref|XP_010099263.1|  hypothetical protein L484_015453                   345   7e-111   
ref|XP_008220437.1|  PREDICTED: uncharacterized protein LOC103320525    345   8e-111   
gb|AFO66494.1|  hypothetical protein                                    345   9e-111   
ref|XP_002309520.1|  hypothetical protein POPTR_0006s24970g             345   9e-111   Populus trichocarpa [western balsam poplar]
ref|XP_002321482.2|  hypothetical protein POPTR_0015s03840g             345   9e-111   Populus trichocarpa [western balsam poplar]
gb|KCW86302.1|  hypothetical protein EUGRSUZ_B02994                     342   1e-110   
ref|XP_002871492.1|  hypothetical protein ARALYDRAFT_909140             345   1e-110   
ref|XP_010318628.1|  PREDICTED: uncharacterized protein LOC101267...    340   1e-110   
dbj|BAJ98929.1|  predicted protein                                      347   1e-110   
ref|XP_006469090.1|  PREDICTED: uncharacterized protein LOC102627718    344   1e-110   
gb|AFW60050.1|  hypothetical protein ZEAMMB73_108408                    346   1e-110   
ref|XP_004291015.1|  PREDICTED: uncharacterized protein LOC101301742    344   2e-110   
ref|XP_009105383.1|  PREDICTED: uncharacterized protein LOC103831251    345   2e-110   
gb|KHG11266.1|  Insulin-degrading enzyme                                343   2e-110   
ref|XP_008663766.1|  PREDICTED: uncharacterized protein LOC103642231    346   2e-110   
ref|XP_011019540.1|  PREDICTED: uncharacterized protein LOC105122240    344   2e-110   
ref|XP_006853920.1|  hypothetical protein AMTR_s00036p00191120          342   2e-110   
ref|XP_002453631.1|  hypothetical protein SORBIDRAFT_04g009360          347   2e-110   
emb|CDX96026.1|  BnaA07g27050D                                          344   2e-110   
gb|KDO76927.1|  hypothetical protein CISIN_1g046575mg                   345   2e-110   
ref|XP_010453221.1|  PREDICTED: uncharacterized protein LOC104735185    344   2e-110   
ref|XP_006369242.1|  hypothetical protein POPTR_0001s20050g             343   2e-110   
gb|EEE59868.1|  hypothetical protein OsJ_12453                          343   2e-110   
ref|XP_010942042.1|  PREDICTED: uncharacterized protein LOC105060...    340   3e-110   
ref|XP_002872192.1|  hypothetical protein ARALYDRAFT_910666             343   3e-110   
ref|XP_007226202.1|  hypothetical protein PRUPE_ppa016185mg             344   3e-110   
gb|ABE91847.1|  Protein of unknown function DUF266, plant               345   4e-110   
ref|XP_008357658.1|  PREDICTED: uncharacterized protein LOC103421405    343   4e-110   
ref|XP_011028389.1|  PREDICTED: uncharacterized protein LOC105128426    343   4e-110   
ref|NP_196734.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    343   4e-110   
ref|XP_006448428.1|  hypothetical protein CICLE_v10017943mg             343   6e-110   
ref|XP_010999299.1|  PREDICTED: uncharacterized protein LOC105107168    343   6e-110   
ref|XP_003550286.1|  PREDICTED: uncharacterized protein LOC100785919    342   7e-110   
ref|XP_009144461.1|  PREDICTED: uncharacterized protein LOC103868...    343   7e-110   
gb|KHN37013.1|  hypothetical protein glysoja_009041                     340   7e-110   
ref|XP_010491917.1|  PREDICTED: uncharacterized protein LOC104769408    342   7e-110   
ref|XP_006430742.1|  hypothetical protein CICLE_v10013811mg             340   9e-110   
gb|KFK25431.1|  hypothetical protein AALP_AA8G114400                    342   1e-109   
ref|XP_009772023.1|  PREDICTED: uncharacterized protein LOC104222493    342   1e-109   
ref|XP_006286517.1|  hypothetical protein CARUB_v10001158mg             342   1e-109   
ref|XP_009601239.1|  PREDICTED: uncharacterized protein LOC104096562    342   1e-109   
gb|KHN11046.1|  hypothetical protein glysoja_044070                     339   1e-109   
ref|XP_010099779.1|  hypothetical protein L484_010966                   342   2e-109   
ref|XP_006417483.1|  hypothetical protein EUTSA_v10007760mg             342   2e-109   
ref|XP_004503748.1|  PREDICTED: uncharacterized protein LOC101509...    343   2e-109   
ref|XP_006450782.1|  hypothetical protein CICLE_v10008613mg             341   2e-109   
ref|XP_010230469.1|  PREDICTED: uncharacterized protein LOC100843610    341   3e-109   
ref|XP_008812111.1|  PREDICTED: uncharacterized protein LOC103723082    341   3e-109   
ref|XP_006659748.1|  PREDICTED: uncharacterized protein LOC102714034    340   3e-109   
ref|XP_009131226.1|  PREDICTED: uncharacterized protein LOC103855927    341   3e-109   
emb|CDX97140.1|  BnaC09g44850D                                          342   4e-109   
gb|KHG10617.1|  Putative non-structural 4                               340   4e-109   
gb|ADE76813.1|  unknown                                                 339   5e-109   
ref|XP_003545368.1|  PREDICTED: uncharacterized protein LOC100819890    340   5e-109   
gb|EAZ05353.1|  hypothetical protein OsI_27557                          341   6e-109   
ref|XP_006286838.1|  hypothetical protein CARUB_v10003837mg             340   7e-109   
ref|XP_010227722.1|  PREDICTED: uncharacterized protein LOC104581568    341   7e-109   
ref|XP_004981886.1|  PREDICTED: uncharacterized protein LOC101780921    340   8e-109   
ref|XP_007160978.1|  hypothetical protein PHAVU_001G033200g             340   8e-109   
ref|XP_004241946.1|  PREDICTED: uncharacterized protein LOC101261829    339   9e-109   
ref|XP_006399687.1|  hypothetical protein EUTSA_v10013787mg             340   9e-109   
ref|NP_001060819.1|  Os08g0110400                                       340   1e-108   
gb|KDO59065.1|  hypothetical protein CISIN_1g042794mg                   337   1e-108   
ref|XP_008393663.1|  PREDICTED: uncharacterized protein LOC103455...    340   1e-108   
ref|XP_008393665.1|  PREDICTED: uncharacterized protein LOC103455...    340   1e-108   
ref|XP_010244357.1|  PREDICTED: uncharacterized protein LOC104588211    339   1e-108   
ref|XP_011100115.1|  PREDICTED: uncharacterized protein LOC105178347    340   1e-108   
emb|CDX78439.1|  BnaA03g03510D                                          340   2e-108   
ref|XP_010097098.1|  hypothetical protein L484_019537                   339   2e-108   
ref|XP_004134258.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    339   2e-108   
ref|XP_009106038.1|  PREDICTED: uncharacterized protein LOC103831856    340   2e-108   
emb|CDO98418.1|  unnamed protein product                                335   2e-108   
ref|XP_006303228.1|  hypothetical protein CARUB_v10012092mg             340   2e-108   
gb|ACU18530.1|  unknown                                                 338   2e-108   
ref|XP_009361651.1|  PREDICTED: uncharacterized protein LOC103951891    338   3e-108   
gb|AAT77886.1|  expressed protein                                       338   3e-108   
ref|XP_006394845.1|  hypothetical protein EUTSA_v10004382mg             338   4e-108   
gb|EMS61782.1|  hypothetical protein TRIUR3_23279                       335   4e-108   
ref|NP_001143764.1|  uncharacterized protein LOC100276526               338   5e-108   
ref|XP_008459241.1|  PREDICTED: uncharacterized protein LOC103498396    338   5e-108   
ref|XP_002447391.1|  hypothetical protein SORBIDRAFT_06g034240          340   6e-108   
ref|XP_008447582.1|  PREDICTED: uncharacterized protein LOC103489998    338   6e-108   
ref|XP_002872191.1|  hypothetical protein ARALYDRAFT_351610             337   6e-108   
ref|XP_004301567.1|  PREDICTED: uncharacterized protein LOC101308879    338   6e-108   
ref|XP_010419754.1|  PREDICTED: uncharacterized protein LOC104705440    337   7e-108   
ref|XP_006645101.1|  PREDICTED: uncharacterized protein LOC102713419    337   8e-108   
ref|XP_006651782.1|  PREDICTED: uncharacterized protein LOC102702183    335   8e-108   
ref|XP_006357367.1|  PREDICTED: uncharacterized protein LOC102582902    337   8e-108   
ref|XP_006482399.1|  PREDICTED: uncharacterized protein LOC102630459    335   8e-108   
emb|CDY19328.1|  BnaC05g08370D                                          337   8e-108   
tpg|DAA51164.1|  TPA: hypothetical protein ZEAMMB73_778026              337   9e-108   
ref|XP_008790242.1|  PREDICTED: uncharacterized protein LOC103707505    337   9e-108   
ref|XP_006392995.1|  hypothetical protein EUTSA_v10012322mg             337   1e-107   
ref|XP_004498923.1|  PREDICTED: uncharacterized protein LOC101515236    337   1e-107   
ref|XP_004959909.1|  PREDICTED: uncharacterized protein LOC101775358    338   1e-107   
ref|XP_009800325.1|  PREDICTED: uncharacterized protein LOC104246...    337   1e-107   
ref|XP_004161852.1|  PREDICTED: uncharacterized LOC101207320            337   1e-107   
ref|XP_006466159.1|  PREDICTED: uncharacterized protein LOC102619633    337   1e-107   
ref|XP_010267069.1|  PREDICTED: uncharacterized protein LOC104604...    337   1e-107   
gb|KDO58674.1|  hypothetical protein CISIN_1g040146mg                   336   2e-107   
gb|AFO66521.1|  putative clathrin binding protein                       350   2e-107   
ref|XP_008393325.1|  PREDICTED: uncharacterized protein LOC103455512    337   3e-107   
emb|CDX70416.1|  BnaC03g05000D                                          338   3e-107   
ref|XP_002883297.1|  hypothetical protein ARALYDRAFT_479651             335   4e-107   
ref|NP_177005.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    336   4e-107   
ref|XP_002888660.1|  hypothetical protein ARALYDRAFT_475957             336   4e-107   
gb|EAZ41277.1|  hypothetical protein OsJ_25784                          332   4e-107   
ref|XP_009402165.1|  PREDICTED: uncharacterized protein LOC103986...    335   5e-107   
gb|EYU44621.1|  hypothetical protein MIMGU_mgv1a022423mg                332   5e-107   
gb|ABK28713.1|  unknown                                                 335   5e-107   
ref|NP_197969.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    335   5e-107   
ref|XP_008452696.1|  PREDICTED: uncharacterized protein LOC103493641    335   8e-107   
ref|XP_002466520.1|  hypothetical protein SORBIDRAFT_01g009220          335   8e-107   
ref|XP_004301821.1|  PREDICTED: uncharacterized protein LOC101311681    335   9e-107   
gb|EMS55277.1|  hypothetical protein TRIUR3_33067                       337   1e-106   
gb|EYU21409.1|  hypothetical protein MIMGU_mgv1a007990mg                335   1e-106   
ref|XP_006343019.1|  PREDICTED: uncharacterized protein LOC102599337    334   1e-106   
dbj|BAF00442.1|  hypothetical protein                                   334   1e-106   
ref|XP_006390505.1|  hypothetical protein EUTSA_v10018603mg             335   1e-106   
ref|XP_004154808.1|  PREDICTED: uncharacterized protein LOC101228236    334   2e-106   
gb|AAM63616.1|  unknown                                                 334   2e-106   
gb|AAD40142.1|AF149413_23  contains similarity to several Arabido...    336   2e-106   
ref|XP_004236394.1|  PREDICTED: uncharacterized protein LOC101257059    334   2e-106   
ref|XP_004146835.1|  PREDICTED: uncharacterized protein LOC101208492    334   2e-106   
ref|XP_011014143.1|  PREDICTED: uncharacterized protein LOC105118003    333   2e-106   
ref|XP_002466519.1|  hypothetical protein SORBIDRAFT_01g009210          334   2e-106   
ref|NP_566682.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    333   2e-106   
ref|XP_010466367.1|  PREDICTED: uncharacterized protein LOC104746558    333   2e-106   
ref|XP_003567325.1|  PREDICTED: uncharacterized protein LOC100845991    333   3e-106   
ref|XP_009151114.1|  PREDICTED: uncharacterized protein LOC103874440    333   4e-106   
ref|NP_177522.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    334   4e-106   
ref|NP_001044966.1|  Os01g0875800                                       333   5e-106   
ref|XP_006299117.1|  hypothetical protein CARUB_v10015258mg             332   5e-106   
ref|XP_008786442.1|  PREDICTED: uncharacterized protein LOC103704784    329   5e-106   
emb|CDM85189.1|  unnamed protein product                                332   6e-106   
dbj|BAD82090.1|  unknown protein                                        332   7e-106   
ref|XP_002891661.1|  hypothetical protein ARALYDRAFT_337332             333   7e-106   
ref|XP_010471453.1|  PREDICTED: uncharacterized protein LOC104751239    333   7e-106   
ref|XP_010428318.1|  PREDICTED: uncharacterized protein LOC104712...    333   8e-106   
emb|CDX87842.1|  BnaC06g09040D                                          332   9e-106   
ref|XP_010682058.1|  PREDICTED: uncharacterized protein LOC104896961    333   1e-105   
ref|XP_011011841.1|  PREDICTED: uncharacterized protein LOC105116265    332   1e-105   
dbj|BAB86235.1|  P0648C09.24                                            335   1e-105   
ref|XP_004141306.1|  PREDICTED: uncharacterized protein LOC101205668    331   2e-105   
gb|EAY76682.1|  hypothetical protein OsI_04637                          331   2e-105   
ref|XP_009800326.1|  PREDICTED: uncharacterized protein LOC104246...    331   2e-105   
ref|XP_011092268.1|  PREDICTED: uncharacterized protein LOC105172507    334   3e-105   
gb|EPS68648.1|  hypothetical protein M569_06120                         330   3e-105   
ref|XP_007024391.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    331   3e-105   
ref|XP_002466518.1|  hypothetical protein SORBIDRAFT_01g009200          330   3e-105   
ref|XP_010533932.1|  PREDICTED: uncharacterized protein LOC104809...    330   4e-105   
ref|XP_009144879.1|  PREDICTED: uncharacterized protein LOC103868547    330   5e-105   
ref|XP_009122883.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin int...    347   5e-105   
gb|AAL38356.1|  unknown protein                                         331   6e-105   
ref|XP_009393005.1|  PREDICTED: uncharacterized protein LOC103978798    330   6e-105   
emb|CAN60261.1|  hypothetical protein VITISV_020168                     331   7e-105   
ref|XP_011072465.1|  PREDICTED: uncharacterized protein LOC105157713    330   7e-105   
gb|AFW65878.1|  hypothetical protein ZEAMMB73_865081                    332   7e-105   
emb|CDO97644.1|  unnamed protein product                                330   7e-105   
ref|XP_011095814.1|  PREDICTED: uncharacterized protein LOC105175...    328   8e-105   
ref|XP_002888947.1|  DNA binding protein                                331   8e-105   
ref|XP_009625225.1|  PREDICTED: uncharacterized protein LOC104116132    329   1e-104   
ref|XP_009145487.1|  PREDICTED: uncharacterized protein LOC103869...    328   2e-104   
ref|XP_009786387.1|  PREDICTED: uncharacterized protein LOC104234513    329   2e-104   
ref|XP_010488146.1|  PREDICTED: uncharacterized protein LOC104766030    328   2e-104   
ref|NP_001169393.1|  uncharacterized protein LOC100383262               329   2e-104   
emb|CDY51451.1|  BnaA05g36680D                                          328   2e-104   
ref|XP_010500763.1|  PREDICTED: uncharacterized protein LOC104778093    329   2e-104   
ref|XP_002324745.2|  hypothetical protein POPTR_0018s04680g             328   2e-104   
ref|XP_004165595.1|  PREDICTED: uncharacterized protein LOC101231487    328   2e-104   
gb|ACF85887.1|  unknown                                                 327   2e-104   
ref|XP_010510112.1|  PREDICTED: uncharacterized protein LOC104786396    328   2e-104   
ref|XP_009630467.1|  PREDICTED: uncharacterized protein LOC104120416    328   3e-104   
ref|XP_002442608.1|  hypothetical protein SORBIDRAFT_08g022900          328   3e-104   
ref|XP_011095742.1|  PREDICTED: uncharacterized protein LOC105175...    328   3e-104   
ref|NP_175588.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    328   4e-104   
ref|XP_009778079.1|  PREDICTED: uncharacterized protein LOC104227520    328   4e-104   
ref|XP_010094730.1|  hypothetical protein L484_019940                   327   4e-104   
gb|AAG50880.1|AC025294_18  hypothetical protein                         328   4e-104   
ref|XP_010479681.1|  PREDICTED: uncharacterized protein LOC104758496    328   4e-104   
emb|CDY56916.1|  BnaCnng31370D                                          327   4e-104   
ref|XP_006406285.1|  hypothetical protein EUTSA_v10021956mg             327   6e-104   
ref|XP_011097225.1|  PREDICTED: uncharacterized protein LOC105176192    324   9e-104   
ref|XP_002977635.1|  hypothetical protein SELMODRAFT_107168             325   9e-104   
ref|XP_009341368.1|  PREDICTED: uncharacterized protein LOC103933398    327   9e-104   
ref|NP_001130080.1|  uncharacterized protein LOC100191173               326   1e-103   
dbj|BAK04145.1|  predicted protein                                      327   1e-103   
gb|EPS73540.1|  hypothetical protein M569_01216                         329   1e-103   
ref|XP_006302252.1|  hypothetical protein CARUB_v10020289mg             328   2e-103   
gb|KDP40817.1|  hypothetical protein JCGZ_24816                         326   2e-103   
ref|XP_010936142.1|  PREDICTED: uncharacterized protein LOC105055840    326   2e-103   
ref|XP_010062561.1|  PREDICTED: uncharacterized protein LOC104449935    326   2e-103   
gb|EYU45841.1|  hypothetical protein MIMGU_mgv1a018710mg                326   2e-103   
ref|XP_008244747.1|  PREDICTED: uncharacterized protein LOC103342870    326   3e-103   
ref|XP_010524350.1|  PREDICTED: uncharacterized protein LOC104802437    326   3e-103   
ref|XP_002975225.1|  hypothetical protein SELMODRAFT_102845             323   4e-103   
ref|XP_003571226.1|  PREDICTED: uncharacterized protein LOC100832462    327   4e-103   
ref|XP_007215514.1|  hypothetical protein PRUPE_ppa007018mg             324   1e-102   
ref|XP_009780294.1|  PREDICTED: uncharacterized protein LOC104229...    322   1e-102   
emb|CDX73016.1|  BnaC06g34640D                                          322   1e-102   
ref|XP_008795296.1|  PREDICTED: uncharacterized protein LOC103711078    323   2e-102   
gb|KFK35824.1|  hypothetical protein AALP_AA4G041900                    324   2e-102   
ref|XP_004297621.1|  PREDICTED: uncharacterized protein LOC101304278    323   2e-102   
ref|XP_010493855.1|  PREDICTED: uncharacterized protein LOC104771079    323   2e-102   
gb|EYU33292.1|  hypothetical protein MIMGU_mgv1a007588mg                323   2e-102   
ref|XP_009780287.1|  PREDICTED: uncharacterized protein LOC104229...    323   3e-102   
ref|XP_002515894.1|  conserved hypothetical protein                     323   4e-102   
ref|XP_006417407.1|  hypothetical protein EUTSA_v10009677mg             322   4e-102   
ref|XP_010535201.1|  PREDICTED: uncharacterized protein LOC104810555    322   5e-102   
ref|XP_009601484.1|  PREDICTED: uncharacterized protein LOC104096770    323   5e-102   
emb|CDO97949.1|  unnamed protein product                                322   8e-102   
ref|NP_001143261.1|  uncharacterized protein LOC100275790               324   1e-101   
ref|XP_010912680.1|  PREDICTED: uncharacterized protein LOC105038537    321   1e-101   
ref|XP_011081610.1|  PREDICTED: uncharacterized protein LOC105164614    321   1e-101   
ref|XP_010421452.1|  PREDICTED: uncharacterized protein LOC104706914    321   1e-101   
ref|XP_003560217.1|  PREDICTED: uncharacterized protein LOC100835983    321   2e-101   
ref|XP_010930512.1|  PREDICTED: uncharacterized protein LOC105051676    320   2e-101   
ref|XP_010106109.1|  hypothetical protein L484_003112                   320   2e-101   
ref|XP_009601960.1|  PREDICTED: uncharacterized protein LOC104097139    320   3e-101   
ref|XP_009791972.1|  PREDICTED: uncharacterized protein LOC104239130    320   6e-101   
gb|EYU44620.1|  hypothetical protein MIMGU_mgv1a022082mg                317   7e-101   
ref|XP_010681644.1|  PREDICTED: uncharacterized protein LOC104896577    319   9e-101   
emb|CDP08214.1|  unnamed protein product                                315   1e-100   
ref|XP_001765972.1|  predicted protein                                  316   2e-100   
ref|XP_008380827.1|  PREDICTED: uncharacterized protein LOC103443716    318   2e-100   
ref|XP_009415632.1|  PREDICTED: uncharacterized protein LOC103996435    315   3e-100   
ref|XP_008381486.1|  PREDICTED: uncharacterized protein LOC103444326    334   4e-100   
ref|XP_004986256.1|  PREDICTED: uncharacterized protein LOC101760830    318   5e-100   
ref|XP_008461555.1|  PREDICTED: uncharacterized protein LOC103500127    318   5e-100   
ref|XP_010690090.1|  PREDICTED: uncharacterized protein LOC104903696    317   8e-100   
gb|EEC76912.1|  hypothetical protein OsI_15153                          317   1e-99    
ref|XP_004141671.1|  PREDICTED: uncharacterized protein LOC101216165    317   1e-99    
ref|XP_008391294.1|  PREDICTED: uncharacterized protein LOC103453537    315   2e-99    
gb|KHG14930.1|  Putative DNA helicase ino80                             315   2e-99    
gb|KHN24919.1|  hypothetical protein glysoja_027033                     313   3e-99    
ref|XP_009367505.1|  PREDICTED: uncharacterized protein LOC103957137    315   3e-99    
ref|XP_009338135.1|  PREDICTED: uncharacterized protein LOC103930517    315   4e-99    
ref|XP_002276490.2|  PREDICTED: uncharacterized protein LOC100266878    315   4e-99    



>ref|XP_009615449.1| PREDICTED: uncharacterized protein LOC104108167 [Nicotiana tomentosiformis]
Length=408

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/401 (69%), Positives = 326/401 (81%), Gaps = 11/401 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSF-SLNLQLI  218
             MKNQ+ N+   +  +IKL+N PLN++NLLS+F FFACGLTCG+IF+ YFK+F SLNLQ+I
Sbjct  10    MKNQDQNS---IAMAIKLFNTPLNILNLLSSFFFFACGLTCGIIFTFYFKNFYSLNLQVI  66

Query  219   TAA-------AADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVP  377
              +        +       PP  P R+P   VGL E++KPP    HDMSD+ELLWRASMVP
Sbjct  67    NSQILSYSSSSQPFSPPPPPSPPPRSPPPRVGLNEYIKPPSLLQHDMSDKELLWRASMVP  126

Query  378   KIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVF  557
             KI+E+PF RVPKVAFMFLTRG V L+PLWEMFF+GNEGFYSIYVHSDPS N+S PE  +F
Sbjct  127   KIQEFPFKRVPKVAFMFLTRGPVLLSPLWEMFFKGNEGFYSIYVHSDPSYNQSQPESPIF  186

Query  558   HGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNS  737
             HGRRIPS+EV+WG VNM+EAE+RLLANALLD SNQRFVLLSE+CIPLFNF TIY+YLMNS
Sbjct  187   HGRRIPSKEVEWGKVNMVEAEKRLLANALLDISNQRFVLLSEACIPLFNFSTIYTYLMNS  246

Query  738   TTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQ  917
             T NF+E YDLPG  GRGRY+H+MSP I ++QW KGSQWFEMDR+LAIEVISD  YF  FQ
Sbjct  247   TKNFVETYDLPGPVGRGRYRHQMSPTINIQQWMKGSQWFEMDRNLAIEVISDKTYFPAFQ  306

Query  918   YYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR  1097
              YC GSCYADEHYLPTFV+++FG+ NS R+LTWVDWS GG HP R+ R DVTV FLE LR
Sbjct  307   KYCTGSCYADEHYLPTFVSMKFGKMNSGRTLTWVDWSKGGPHPTRFHRSDVTVEFLEKLR  366

Query  1098  TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             +  +C YNGE+TNVCYLFARKF+ H+L+RLL FAPK+M F+
Sbjct  367   SESQCVYNGEKTNVCYLFARKFTTHALSRLLIFAPKVMHFN  407



>ref|XP_009767018.1| PREDICTED: uncharacterized protein LOC104218270 [Nicotiana sylvestris]
Length=411

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/404 (68%), Positives = 325/404 (80%), Gaps = 14/404 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSF-SLNLQLI  218
             MKNQ+ N+   +  +IKL+N PLN++NL S+F FFACGLTCG+IF+ YFK+F SLNLQ+I
Sbjct  10    MKNQDQNS---IAMAIKLFNTPLNILNLFSSFFFFACGLTCGIIFTFYFKNFYSLNLQVI  66

Query  219   TAA----------AADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRAS  368
              +            +      PP  P  +P   VGL E++KPP    HDMSDEELLWRAS
Sbjct  67    NSQILSYSSSSQSFSPPSPPPPPSSPPLSPPPRVGLNEYIKPPSLLQHDMSDEELLWRAS  126

Query  369   MVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEG  548
             MVPKI+E+PF +VPKVAFMFLTRG V L+PLWEMFF+GNEGFYSIYVHSDPS N+S PE 
Sbjct  127   MVPKIQEFPFKKVPKVAFMFLTRGPVLLSPLWEMFFKGNEGFYSIYVHSDPSYNQSQPES  186

Query  549   SVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYL  728
              +FHGRRIPS+EV+WG VNM+EAE+RLLANALLD SNQRFVLLSE+CIPLFNF TIY+Y+
Sbjct  187   PIFHGRRIPSKEVEWGKVNMVEAEKRLLANALLDISNQRFVLLSEACIPLFNFSTIYTYV  246

Query  729   MNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFS  908
             MNST +F+E YDLPG  GRGRY+ +MSP IK +QW KGSQWFEMDRDLAIEVISD  YF 
Sbjct  247   MNSTKSFVETYDLPGPVGRGRYRPQMSPTIKSQQWMKGSQWFEMDRDLAIEVISDKTYFP  306

Query  909   LFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLE  1088
             LFQ YC GSCYADEHYLPTFV+++FG+ NS R+LTWVDWS GG HPAR+ R DVTV FLE
Sbjct  307   LFQKYCTGSCYADEHYLPTFVSMKFGKRNSGRTLTWVDWSKGGPHPARFHRSDVTVEFLE  366

Query  1089  TLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              LR+  +C YNGE+TNVCYLFARKF+ H+L+RLL FAPK+M F+
Sbjct  367   KLRSESQCVYNGEKTNVCYLFARKFTTHALSRLLIFAPKVMHFN  410



>ref|XP_006344154.1| PREDICTED: uncharacterized protein LOC102583596 [Solanum tuberosum]
Length=395

 Score =   523 bits (1347),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 258/398 (65%), Positives = 322/398 (81%), Gaps = 9/398 (2%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MKNQN N+   +  +IK +N P+N+INLLS+F  FACG+TCG+IF+ YFK+FS+NLQ+I 
Sbjct  1     MKNQNQNS---IAMAIKSFNTPINIINLLSSFFLFACGITCGIIFTFYFKNFSVNLQVIN  57

Query  222   AAAADqplllpp----pqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKE  389
                 +   L       P   R+ +  +GL E++KP  N  HDMSDEEL WR+SMVPK+KE
Sbjct  58    GQILNYSSLNSHPLSPPPSPRSIIPRLGLNEYIKPI-NVEHDMSDEELFWRSSMVPKVKE  116

Query  390   YPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNES-APEGSVFHGR  566
             +PF RVPKVAFMFLTRG + L+PLWE+FF+GNEGFYSIY+HSDPS N+S   E S+FHGR
Sbjct  117   FPFKRVPKVAFMFLTRGPILLSPLWELFFKGNEGFYSIYIHSDPSYNQSHIDESSIFHGR  176

Query  567   RIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTN  746
             RIPS+EV+WG +NM+EAE+RLLANALLD SNQRFVLLSE+CIPLFNF TIY++LMNST N
Sbjct  177   RIPSKEVEWGKINMVEAEKRLLANALLDISNQRFVLLSEACIPLFNFSTIYTHLMNSTKN  236

Query  747   FIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYC  926
             F+E YD PG  GRGRY  +MSP IKL QWRKGSQWFEMDRDLA+EV+SD  YFS+F+ +C
Sbjct  237   FVETYDQPGPVGRGRYHPQMSPTIKLPQWRKGSQWFEMDRDLALEVVSDQTYFSVFKKHC  296

Query  927   KGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD  1106
             KGSCYADEH+LPTFV+++F + N+ R+LTWVDWS GG HP RY R D++V FL+ LR+  
Sbjct  297   KGSCYADEHFLPTFVSMKFEKRNTGRTLTWVDWSKGGPHPTRYYRSDISVEFLKKLRSES  356

Query  1107  KCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              CEYNGE+T+VC+LFARKF+ H+L+RLL FAPK+M+F+
Sbjct  357   SCEYNGEKTSVCHLFARKFTPHALSRLLIFAPKVMQFN  394



>ref|XP_004238911.1| PREDICTED: uncharacterized protein LOC101249358 [Solanum lycopersicum]
Length=400

 Score =   514 bits (1325),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 250/403 (62%), Positives = 318/403 (79%), Gaps = 14/403 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK QN N+   +  +IK +N P+N+INL S+F  FACG+TCG+IF+ YFK+FS+NLQ+I 
Sbjct  1     MKKQNQNS---IAMAIKSFNTPINIINLFSSFFLFACGITCGIIFTFYFKNFSVNLQVIN  57

Query  222   AAAADqplllppp---------qpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMV  374
                 +                    R+ +  +GL E++KP  N  HDMSDEELLWR+SMV
Sbjct  58    GQILNFSSFNSQSLSPPPPPASSSSRSIIPRLGLNEYIKPI-NVEHDMSDEELLWRSSMV  116

Query  375   PKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNES-APEGS  551
             PK+K++PF   PKVAFMFLTRG + L+PLWE+FF+GNEGFYSIY+HS+PS N+S   E S
Sbjct  117   PKVKDFPFKIQPKVAFMFLTRGPILLSPLWELFFKGNEGFYSIYIHSNPSYNQSQVDESS  176

Query  552   VFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLM  731
             +FHGRRIPS+EV+WG +NM+EAE+RLLANAL+D SNQRFVLLSE+CIPLFNF TIY++LM
Sbjct  177   IFHGRRIPSKEVEWGKINMVEAEKRLLANALVDISNQRFVLLSEACIPLFNFSTIYTHLM  236

Query  732   NSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSL  911
             NST NF+E YDLPG  GRGRY  RMSP IKL QWRKGSQWFEMDRDLA+EV+SD  YFS+
Sbjct  237   NSTKNFVETYDLPGPVGRGRYHPRMSPTIKLAQWRKGSQWFEMDRDLALEVVSDQTYFSV  296

Query  912   FQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLET  1091
             F+ +CKGSCYADEH+LPTFV+++F + N+ R+LTWVDWS GG HP R+ R D++V FL+ 
Sbjct  297   FKKHCKGSCYADEHFLPTFVSMKFEKRNTGRTLTWVDWSKGGPHPTRFYRSDISVEFLKK  356

Query  1092  LRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             LR+   CEYNGE+T++C+LFARKF+ H+L+RLL FAPK+M+F+
Sbjct  357   LRSESSCEYNGEKTSICHLFARKFTPHALSRLLIFAPKVMQFN  399



>ref|XP_006468735.1| PREDICTED: uncharacterized protein LOC102627900 [Citrus sinensis]
 gb|KDO76925.1| hypothetical protein CISIN_1g015876mg [Citrus sinensis]
Length=399

 Score =   505 bits (1300),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 253/378 (67%), Positives = 300/378 (79%), Gaps = 5/378 (1%)
 Frame = +3

Query  90    KLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL--ITAAAADqplllpppq  263
             KL+NA L++ NLLS F+FF CGL  G++ S   K FS NL +   + +     + +    
Sbjct  20    KLFNAQLHIFNLLSFFIFFGCGLIFGIVLSFSLKDFSFNLHITQFSLSPPSTSIKVAASS  79

Query  264   pERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGA  443
              + +  + VGL EFLKPP N  HDM D ELLWRAS+VPKI EYPF RVPKVAF+FLTRG 
Sbjct  80    QKLSNSSRVGLAEFLKPP-NTTHDMEDAELLWRASVVPKIPEYPFKRVPKVAFLFLTRGP  138

Query  444   VTLAPLWEMFFQGNEGFYSIYVHSDPSCNES--APEGSVFHGRRIPSQEVKWGDVNMIea  617
             V LAPLWE FF+G+EGFYSIYVHS PS N+S   PEGSVF+GRRIPS+EVKWG VNMIEA
Sbjct  139   VLLAPLWEKFFKGHEGFYSIYVHSSPSFNQSDAEPEGSVFYGRRIPSREVKWGGVNMIEA  198

Query  618   errllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYK  797
             ERRLLANALLDFSN+RFVLLSESCIPLFNF  IYS+LMNST NF+EVYDL G  GRGRY 
Sbjct  199   ERRLLANALLDFSNERFVLLSESCIPLFNFSVIYSHLMNSTQNFVEVYDLEGPVGRGRYS  258

Query  798   HRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNI  977
              RM+P IK+ QWRKGSQWF+MDR+LA EV+SD  YF LFQ YCKGSCYADEHYLPTFVN+
Sbjct  259   FRMAPKIKIFQWRKGSQWFQMDRNLATEVVSDTTYFPLFQKYCKGSCYADEHYLPTFVNM  318

Query  978   RFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFAR  1157
             +FG  N+NR+LTWVDWSHGG HP R++R  +TV FL+ LR+G +CEYNG+ TN+C+LFAR
Sbjct  319   KFGAKNANRTLTWVDWSHGGPHPTRFVRSSITVQFLQKLRSGSRCEYNGKRTNICHLFAR  378

Query  1158  KFSLHSLTRLLRFAPKLM  1211
             KF  ++L RLLR+AP ++
Sbjct  379   KFLPNTLDRLLRYAPTVL  396



>ref|XP_011070777.1| PREDICTED: uncharacterized protein LOC105156363 [Sesamum indicum]
Length=408

 Score =   503 bits (1294),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 257/407 (63%), Positives = 307/407 (75%), Gaps = 18/407 (4%)
 Frame = +3

Query  51    QNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAA  230
             +N+  +P    + KL N P  L+NLLS   FF  GLT G+IF  +++SFS NLQ+     
Sbjct  2     KNNGQSPFSSVAGKLMNTPFPLLNLLSYLFFFIFGLTFGIIFCFHYRSFSFNLQVTNGQF  61

Query  231   ADqplllpppqpERTPVAA-----------------VGLQEFLKPPENAMHDMSDEELLW  359
             +         QP  T                     V   EFL+PP   MH+M+D+ELLW
Sbjct  62    SIFTSQSILDQPPTTTTPTFSSSTPEIKNTSKTSDMVRWAEFLQPP-TVMHEMTDQELLW  120

Query  360   RASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESA  539
             RASM PKI+E+PF RVPKVAFMFLTRG V LAPLWE FF+G++G YS+YVHSDPS N S 
Sbjct  121   RASMAPKIQEFPFKRVPKVAFMFLTRGPVVLAPLWEKFFKGHDGLYSVYVHSDPSFNGSE  180

Query  540   PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIY  719
             PEGSVFHGRRIPS+EV+WG+VNMIEAERRLLANALLDFSNQ FVLLSESCIPL+NF TIY
Sbjct  181   PEGSVFHGRRIPSKEVQWGNVNMIEAERRLLANALLDFSNQHFVLLSESCIPLYNFSTIY  240

Query  720   SYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDR  899
             SYL+NST NF+E YDLPG  GRGRY H+M P+IKL QWRKGSQWF MDRDLA+EVI+D  
Sbjct  241   SYLINSTQNFVEAYDLPGPVGRGRYSHQMGPMIKLEQWRKGSQWFGMDRDLALEVIADKN  300

Query  900   YFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVS  1079
             YF +FQ+YC GSCYADEHYLPTFV+++FG  NSNR+LTWVDWS GG HP++++R DVT  
Sbjct  301   YFPVFQHYCNGSCYADEHYLPTFVSMKFGERNSNRTLTWVDWSRGGPHPSKFIRTDVTPE  360

Query  1080  FLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             FLE LR G  CEYNG++TNVC LFARKF+ ++L RLLRFAP++M+F+
Sbjct  361   FLEKLRRGGSCEYNGKKTNVCVLFARKFTYNALDRLLRFAPQVMQFN  407



>ref|XP_010265065.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265066.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265067.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
Length=411

 Score =   492 bits (1267),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 253/414 (61%), Positives = 302/414 (73%), Gaps = 24/414 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSI-KLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI  218
             MKNQ     PP  TSI KL+NA LNLI LL+ F+FF  GL  G+I +SY K+FS N Q+ 
Sbjct  1     MKNQQQQQRPP--TSIAKLFNAQLNLITLLNLFIFFTLGLALGVIVNSYLKNFSFNFQIT  58

Query  219   --------------------TAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDM  338
                                         +     Q E      +GL+E+LKPP   MHDM
Sbjct  59    HFSISSSSSPPLAPPPPPLLPPPQPSLSVSSSVHQQESNKTDRIGLKEYLKPP-TVMHDM  117

Query  339   SDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSD  518
             +D+ELLWRASMVP+I E+P+ RVPKVAFMFLTRG + LAPLWE FF+G+EG YSIYVHS 
Sbjct  118   NDDELLWRASMVPRIHEFPYKRVPKVAFMFLTRGRLALAPLWEKFFKGHEGLYSIYVHSS  177

Query  519   PSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPL  698
             PS N++ PE  VF GRRIPS++V+WG  +MIEAERRLLANALLDFSNQRFVLLS++CIPL
Sbjct  178   PSFNDTEPESPVFQGRRIPSKDVQWGKFSMIEAERRLLANALLDFSNQRFVLLSDACIPL  237

Query  699   FNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAI  878
             FNF T+Y+YL+ ST +F+E YD PG  GRGRY  RM P IKL QWRKGSQWFEMDRDLAI
Sbjct  238   FNFSTVYNYLIGSTKSFVEAYDEPGPVGRGRYSPRMKPDIKLSQWRKGSQWFEMDRDLAI  297

Query  879   EVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYL  1058
             E+ SD +YFSLF  YCK SCY+DEHY+PT V+++F   NSNRSLTWVDWS GG HP R++
Sbjct  298   EIASDRKYFSLFGRYCKPSCYSDEHYIPTLVSLKFWEKNSNRSLTWVDWSRGGPHPTRFM  357

Query  1059  RHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             R DVTV  LE +R+G  CEYNG+ TNVC LFARKF  ++L RLLRFAPK+M+F+
Sbjct  358   RTDVTVELLERMRSGRTCEYNGKTTNVCSLFARKFYPNTLDRLLRFAPKVMKFN  411



>ref|XP_006344302.1| PREDICTED: uncharacterized protein LOC102604936 [Solanum tuberosum]
Length=376

 Score =   489 bits (1260),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/376 (65%), Positives = 302/376 (80%), Gaps = 8/376 (2%)
 Frame = +3

Query  114   LINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITA-----AAADqplllpppqpERTP  278
             +I LLS F FFACG++CG+IF+SYF  FS+NLQ+I       ++ +   L P P   R+ 
Sbjct  1     MIYLLSFFFFFACGISCGIIFTSYFNDFSVNLQVINGQILNYSSFNSQPLSPSPSSPRSI  60

Query  279   VAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAP  458
             +  +GL E++KP  N  HDMSDEELLWR+SMVPK+KE PF   PKVAFMFLT+G V L+P
Sbjct  61    IPRLGLNEYIKPI-NVEHDMSDEELLWRSSMVPKVKELPFKIQPKVAFMFLTKGPVLLSP  119

Query  459   LWEMFFQGNEGFYSIYVHSDPSCNESA--PEGSVFHGRRIPSQEVKWGDVNMIeaerrll  632
             LWE+FF+G+EGFYSIYVHS PS N  +   E  +FHGRRIPS+EV WG VNM+EAE+RLL
Sbjct  120   LWELFFKGHEGFYSIYVHSHPSYNNKSNIDESFIFHGRRIPSKEVDWGKVNMVEAEKRLL  179

Query  633   anallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSP  812
             ANALLD SNQRFVLLSE+CIPLFNF TIY++LMNS  NF+E YD PG  GRGRY+ +MSP
Sbjct  180   ANALLDSSNQRFVLLSEACIPLFNFSTIYTHLMNSNENFVETYDQPGPLGRGRYRPQMSP  239

Query  813   VIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRG  992
             +IKL QWRKGSQWFEMDRDLA+EV+SD  YFS+FQ YCKGSCYADEHYLPTFVN++F   
Sbjct  240   MIKLSQWRKGSQWFEMDRDLALEVVSDKTYFSIFQKYCKGSCYADEHYLPTFVNMKFKNR  299

Query  993   NSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLH  1172
             NS R+LTWVDWS GG+HPAR+ R D+T  FL+ LR+   CEYNG++T++C+LFARKF+ H
Sbjct  300   NSGRTLTWVDWSKGGAHPARFNRQDITKEFLKKLRSESSCEYNGKKTSICHLFARKFTSH  359

Query  1173  SLTRLLRFAPKLMRFD  1220
             +L+RLL FAPK+M+F+
Sbjct  360   ALSRLLMFAPKVMQFN  375



>ref|XP_006448426.1| hypothetical protein CICLE_v10015505mg [Citrus clementina]
 gb|ESR61666.1| hypothetical protein CICLE_v10015505mg [Citrus clementina]
Length=397

 Score =   486 bits (1250),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 299/378 (79%), Gaps = 5/378 (1%)
 Frame = +3

Query  90    KLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL--ITAAAADqplllpppq  263
             KL+NA L++ NLLS FLFF CGL  G++ S   K FS NL +   + +     + +    
Sbjct  18    KLFNAQLHIFNLLSFFLFFGCGLIFGIVLSFSLKDFSFNLHITQFSLSPPSTSIKVAASS  77

Query  264   pERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGA  443
              + +  + VGL EFLKPP N  HDM D ELLWRAS+VPKI EYPF RVPKVAF+FLTRG 
Sbjct  78    QKLSNSSRVGLAEFLKPP-NTTHDMEDAELLWRASVVPKIPEYPFKRVPKVAFLFLTRGP  136

Query  444   VTLAPLWEMFFQGNEGFYSIYVHSDPSCNES--APEGSVFHGRRIPSQEVKWGDVNMIea  617
             V LAPLWE FF+G+ GFYSIYVHS PS N+S   PEGSVF+GRRIPS+EVKWG VNMIEA
Sbjct  137   VLLAPLWEKFFKGHGGFYSIYVHSSPSFNQSDAEPEGSVFYGRRIPSREVKWGGVNMIEA  196

Query  618   errllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYK  797
             ERRLLANALLDFSN+RFVLLSESCIPLFNF  IYS+LMNST NF+EVYDL G  GRGRY 
Sbjct  197   ERRLLANALLDFSNERFVLLSESCIPLFNFSVIYSHLMNSTQNFVEVYDLEGPVGRGRYS  256

Query  798   HRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNI  977
              RM+P IK+ QWRKGSQWF+MDR+LA EV+SD  YF LFQ YCKGSCYADEHYLPTFVN+
Sbjct  257   FRMAPKIKIFQWRKGSQWFQMDRNLATEVVSDRTYFPLFQKYCKGSCYADEHYLPTFVNM  316

Query  978   RFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFAR  1157
             +FG  N+NR+LTWVDWSHGG HP R+LR  +TV FL+ LR+G +CEYNG+ TN+C+LFAR
Sbjct  317   KFGAKNANRTLTWVDWSHGGPHPTRFLRSSITVQFLQKLRSGSRCEYNGKSTNICHLFAR  376

Query  1158  KFSLHSLTRLLRFAPKLM  1211
             KF  ++L RLLR+AP ++
Sbjct  377   KFLPNTLDRLLRYAPTVL  394



>ref|XP_011022393.1| PREDICTED: uncharacterized protein LOC105124187 [Populus euphratica]
Length=391

 Score =   483 bits (1244),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 244/381 (64%), Positives = 290/381 (76%), Gaps = 2/381 (1%)
 Frame = +3

Query  81    TSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllppp  260
             T  KL+NA L L+N+LS F  F CGL  G++ SSY K+ S NL +   + +       P 
Sbjct  11    TFTKLFNAQLQLVNVLSFFFLFGCGLATGVVLSSYLKNVSFNLHVSQFSVSTTTTTPVPL  70

Query  261   qpERT-PVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTR  437
                 T  +  +GL+E LK P+   HDM ++ELLWRASM P+I+EYPF RVPKVAFMFLT+
Sbjct  71    ATLPTFKLPRIGLKEHLKVPD-VKHDMDEKELLWRASMTPRIREYPFDRVPKVAFMFLTK  129

Query  438   GAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIea  617
             G V +APLWE FFQG+EG YSIYVHS PS NES PE  VFHGRRIPS++V+WG+ N+IEA
Sbjct  130   GPVLMAPLWERFFQGHEGLYSIYVHSSPSYNESEPESPVFHGRRIPSKDVQWGNTNIIEA  189

Query  618   errllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYK  797
             ERRLLANALLD SNQRFVLLSESCIP+F+F T+Y+YLMNST N +E Y L G  G GRY 
Sbjct  190   ERRLLANALLDISNQRFVLLSESCIPIFDFSTVYTYLMNSTKNHVESYVLDGPVGNGRYN  249

Query  798   HRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNI  977
              RM PVIK+ QWRKGSQWFEMDRDLAIEV+SD  YF +FQ YCKG CYADEHYLPTFV++
Sbjct  250   PRMRPVIKIEQWRKGSQWFEMDRDLAIEVVSDQEYFPVFQKYCKGQCYADEHYLPTFVSM  309

Query  978   RFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFAR  1157
             +    NSNRSLTWVDWS GG+HPA++LR +VTV FLE +R+G KC YNG  TN C+LFAR
Sbjct  310   KHSERNSNRSLTWVDWSRGGAHPAKFLRREVTVEFLERMRSGSKCVYNGNSTNTCFLFAR  369

Query  1158  KFSLHSLTRLLRFAPKLMRFD  1220
             KF   +L RLLRFAP +M F+
Sbjct  370   KFWPTALERLLRFAPNVMHFN  390



>ref|XP_011007454.1| PREDICTED: uncharacterized protein LOC105113114 isoform X2 [Populus 
euphratica]
Length=387

 Score =   483 bits (1242),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/393 (62%), Positives = 294/393 (75%), Gaps = 7/393 (2%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK Q  N N  + T  KL+NA L LIN+LS F  F CGL  G+I SSY  S S NLQ+  
Sbjct  1     MKGQTQNQNL-VTTFTKLFNAQLQLINVLSLFFLFGCGLATGVILSSYLNSISFNLQVSH  59

Query  222   AAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFS  401
              + +          P R     VGL+E+LK P+   HDM ++ELLWRAS+ P I+E+PF 
Sbjct  60    FSFSTTTASPTFKLPPR-----VGLKEYLKVPD-VKHDMDEKELLWRASVTPNIREFPFD  113

Query  402   RVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQ  581
             RVPKVAFMFLT+G V +APLWE FF+G++G YSIYVHS PS NES PE  VFHGRRIPS+
Sbjct  114   RVPKVAFMFLTKGLVLMAPLWEKFFKGHKGLYSIYVHSSPSYNESEPESPVFHGRRIPSK  173

Query  582   EVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVY  761
             EV+WG+ NMIEAERRLLANALLD +NQRFVLLSESCIP+FNF T+YSYLMNST + +E Y
Sbjct  174   EVQWGNANMIEAERRLLANALLDIANQRFVLLSESCIPIFNFSTVYSYLMNSTKSHVESY  233

Query  762   DLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCY  941
              L G  G GRY  RM P IK+ QWRKGSQWFE+DRDLAIE++SD +YF LFQ YC G CY
Sbjct  234   VLEGPVGNGRYSPRMRPGIKIDQWRKGSQWFEIDRDLAIEIVSDRKYFPLFQKYCTGQCY  293

Query  942   ADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYN  1121
             ADEHYLPTFV ++  + NSNR+LTWVDWS GG HPA++ R +VT+ FL+ +R+G KC YN
Sbjct  294   ADEHYLPTFVTMKHSKRNSNRTLTWVDWSRGGPHPAKFSRTEVTIEFLQRMRSGSKCVYN  353

Query  1122  GEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             G  TN C+LFARKF  ++L RLLRFAPK+M F+
Sbjct  354   GNHTNTCFLFARKFWPNALDRLLRFAPKIMHFN  386



>ref|XP_007044265.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOY00097.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=399

 Score =   482 bits (1240),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 252/403 (63%), Positives = 308/403 (76%), Gaps = 13/403 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI-  218
             MK +N+N   P  +  KL+NA L+  N+LS  L F   L+ G+I S + K+FS++L +  
Sbjct  1     MKGENNN---PSTSFAKLFNAHLHFFNVLSCVLLFGSLLSLGIILSFHLKNFSIDLHITQ  57

Query  219   --------TAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMV  374
                     +A     P     P  + + VA +GL EFLKPP+  MH M D+ELLWRASMV
Sbjct  58    LSLTTRSASAPPPPPPPQSFTPAAKTSNVAGIGLTEFLKPPD-VMHGMDDKELLWRASMV  116

Query  375   PKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSV  554
             P+I +YPF RVPKVAFMFLT+G + LAPLWE FF+G+EG YSIYVHS+PS N S P+ SV
Sbjct  117   PRIPQYPFDRVPKVAFMFLTKGPLLLAPLWEKFFEGHEGMYSIYVHSNPSFNLSDPKSSV  176

Query  555   FHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMN  734
             F+GRRIPS+EV+WG VNMIEAERRLLANALLDFSNQRFVLLSESCIP+FNF T+YSYL+N
Sbjct  177   FYGRRIPSKEVEWGKVNMIEAERRLLANALLDFSNQRFVLLSESCIPIFNFSTVYSYLIN  236

Query  735   STTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLF  914
             S+ +F+E YDL G  GRGRY  RMSP + L QWRKG+QWFEMDR+LAI V+SD  YF +F
Sbjct  237   SSQSFVESYDLEGPVGRGRYSRRMSPRVTLDQWRKGAQWFEMDRELAIGVVSDQEYFPVF  296

Query  915   QYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETL  1094
             Q YCKG+CYADEHYLPTFV ++FG  NSNR+LTWVDWS GG HPA++LR +VTV FLE L
Sbjct  297   QKYCKGACYADEHYLPTFVTMKFGHKNSNRTLTWVDWSKGGPHPAKFLRTEVTVEFLERL  356

Query  1095  RTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
             R+G +C+YNG  T++C+LFARKFS  +L RLL+FAPKLM F E
Sbjct  357   RSGSQCQYNGNTTDICHLFARKFSPDALYRLLKFAPKLMHFHE  399



>ref|XP_011007447.1| PREDICTED: uncharacterized protein LOC105113114 isoform X1 [Populus 
euphratica]
Length=387

 Score =   479 bits (1233),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 293/393 (75%), Gaps = 7/393 (2%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK Q  N N  + T  KL+NA L LIN+LS F  F CGL  G+I SSY  S S NLQ+  
Sbjct  1     MKGQTQNQNL-VTTFTKLFNAQLQLINVLSLFFLFGCGLATGVILSSYLNSISFNLQVSH  59

Query  222   AAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFS  401
              + +          P R     VGL+E+LK P+   HDM ++ELLWRAS+ P I+E+PF 
Sbjct  60    FSFSTTTASPTFKLPPR-----VGLKEYLKVPD-VKHDMDEKELLWRASVTPNIREFPFD  113

Query  402   RVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQ  581
             RVPKVAFMFLT+G V +APLWE FF+G++G YSIYVHS PS NES PE  VFHGRRIPS+
Sbjct  114   RVPKVAFMFLTKGLVLMAPLWEKFFKGHKGLYSIYVHSSPSYNESEPESPVFHGRRIPSK  173

Query  582   EVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVY  761
              ++WG+ NMIEAERRLLANALLD +NQRFVLLSESCIP+FNF T+YSYLMNST + +E Y
Sbjct  174   VIQWGNANMIEAERRLLANALLDIANQRFVLLSESCIPIFNFSTVYSYLMNSTKSHVESY  233

Query  762   DLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCY  941
              L G  G GRY  RM P IK+ QWRKGSQWFE+DRDLAIE++SD +YF LFQ YC G CY
Sbjct  234   VLEGPVGNGRYSPRMRPGIKIDQWRKGSQWFEIDRDLAIEIVSDRKYFPLFQKYCTGQCY  293

Query  942   ADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYN  1121
             ADEHYLPTFV ++  + NSNR+LTWVDWS GG HPA++ R +VT+ FL+ +R+G KC YN
Sbjct  294   ADEHYLPTFVTMKHSKRNSNRTLTWVDWSRGGPHPAKFSRTEVTIEFLQRMRSGSKCVYN  353

Query  1122  GEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             G  TN C+LFARKF  ++L RLLRFAPK+M F+
Sbjct  354   GNHTNTCFLFARKFWPNALDRLLRFAPKIMHFN  386



>ref|XP_009356238.1| PREDICTED: uncharacterized protein LOC103947108 [Pyrus x bretschneideri]
Length=400

 Score =   479 bits (1234),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 253/406 (62%), Positives = 295/406 (73%), Gaps = 18/406 (4%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK  N N   PL    KL+N PL+ +NLL  FL F  GLT G++ S Y K F ++LQL  
Sbjct  1     MKGPNQN---PLNFFSKLFNVPLHFLNLLFYFLVFGGGLTLGMVLSFYMKDFFVSLQLAQ  57

Query  222   AAAA------------DqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRA  365
              + +                 + P    R P   VGL+E+LKPPE   HDM D ELLWRA
Sbjct  58    FSFSTSTSASNPHNLMPNVKAVEPNTSHRRP--HVGLKEYLKPPE-VFHDMDDVELLWRA  114

Query  366   SMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPE  545
             SM P+I EYPF RVPKVAFMFL +G V LAPLWE FF+G++G YSIYVHS+PS N S PE
Sbjct  115   SMSPQISEYPFPRVPKVAFMFLVKGPVFLAPLWEKFFKGHKGLYSIYVHSNPSYNGSHPE  174

Query  546   GSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSY  725
               VFHGRRIPSQEV+WG VNMIEAERRLLANALLD SNQRF+LLSESC+PL NFPT+Y+Y
Sbjct  175   SPVFHGRRIPSQEVEWGKVNMIEAERRLLANALLDISNQRFILLSESCVPLHNFPTVYNY  234

Query  726   LMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYF  905
             L+ S   F+ VYD P S GRGRY   M P I L QWRKGSQWFE+DR LAIEV+SD +YF
Sbjct  235   LIRSNETFVGVYDDPSSVGRGRYSSHMYPQISLSQWRKGSQWFEIDRSLAIEVVSDKKYF  294

Query  906   SLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFL  1085
              +FQ YC+GSCYADEHYLPT+VNI+F + NSNRSLTWVDWS GG+HPA++ R DVTV  L
Sbjct  295   PVFQTYCRGSCYADEHYLPTYVNIKFAQKNSNRSLTWVDWSRGGAHPAKFTRTDVTVEVL  354

Query  1086  ETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
             ++LR G  C YNG  +NVC+LFARKF   +L RLLRFAPKLMRF+ 
Sbjct  355   KSLRNGTACIYNGRVSNVCFLFARKFGPGTLERLLRFAPKLMRFNR  400



>ref|XP_002276828.1| PREDICTED: uncharacterized protein LOC100247520 [Vitis vinifera]
Length=390

 Score =   478 bits (1231),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 246/395 (62%), Positives = 295/395 (75%), Gaps = 11/395 (3%)
 Frame = +3

Query  51    QNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL----I  218
             +N     P  +S K++N P  L NL+S FLFF  GL  GLI S     FSLN+QL    +
Sbjct  2     KNGKEESPAPSSAKIFNTPTPLFNLMSYFLFFGLGLAIGLIIS-----FSLNIQLKQFFV  56

Query  219   TAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPF  398
                      L  P   E   +  +GL+E+LKPP+ A HDM+DEELLWRASMVP++  +PF
Sbjct  57    PTPDQTTSPLPIPIANETKKINRIGLKEYLKPPKVA-HDMTDEELLWRASMVPRVGGFPF  115

Query  399   SRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNES-APEGSVFHGRRIP  575
              RVPKVAF+FLTRG + LAP WE+FF+G+EG YSIYVHS PS N +  P+ SVFHGRRIP
Sbjct  116   KRVPKVAFLFLTRGPLPLAPFWELFFKGHEGRYSIYVHSHPSFNATLVPQSSVFHGRRIP  175

Query  576   SQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIE  755
             S+EV+WG  NM+EAERRLLANALLD SNQRFVLLSESCIPL+NF TIYSYLM S  +F+E
Sbjct  176   SKEVQWGKFNMVEAERRLLANALLDISNQRFVLLSESCIPLYNFSTIYSYLMGSKKSFVE  235

Query  756   VYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGS  935
              YDLPG  GRGRY  RM P+IK+ QWRKGSQWFEMDR LAI+VISD +YF +FQ +C   
Sbjct  236   SYDLPGPVGRGRYNPRMKPLIKMEQWRKGSQWFEMDRGLAIQVISDRKYFPVFQKFCTPP  295

Query  936   CYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCE  1115
             CYADEHYLPT V+++F R NSNRSLTWVDWSHGG+HPAR+ R  VTV FL+ LR G  C 
Sbjct  296   CYADEHYLPTLVSVKFWRRNSNRSLTWVDWSHGGAHPARFWRVAVTVDFLKKLRNGSHCH  355

Query  1116  YNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             YNG+ +N C++FARKF  ++L RLLRF PKLM+F+
Sbjct  356   YNGKSSNTCFMFARKFLPNALDRLLRFGPKLMKFN  390



>ref|XP_002315928.1| hypothetical protein POPTR_0010s13150g [Populus trichocarpa]
 gb|EEF02099.1| hypothetical protein POPTR_0010s13150g [Populus trichocarpa]
Length=389

 Score =   478 bits (1230),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 244/394 (62%), Positives = 296/394 (75%), Gaps = 7/394 (2%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTS-IKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI  218
             MK Q  N N  L+T+  KL+NA L LIN+LS F  F CGL  G+I SSY  + S NLQ+ 
Sbjct  1     MKGQTQNQN--LVTAFTKLFNAQLQLINVLSLFFLFGCGLATGVILSSYLNNISFNLQV-  57

Query  219   TAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPF  398
              +  +            + P   VGL+E+LK P+   HDM ++ELLWRAS+ P I+E+PF
Sbjct  58    -SHFSFSTTTTTASPTFKLP-PRVGLKEYLKVPD-VKHDMDEKELLWRASVTPNIREFPF  114

Query  399   SRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPS  578
              RVPKVAFMFLT+G V +APLWE FF+G++G YSIYVHS PS NES PE  VFHGRRIPS
Sbjct  115   DRVPKVAFMFLTKGPVLMAPLWEKFFKGHDGLYSIYVHSSPSYNESEPESPVFHGRRIPS  174

Query  579   QEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEV  758
             + V+WG+ NMIEAERRLLANALLD +NQRFVLLSESCIPLFNF T+Y+YLMNST + +E 
Sbjct  175   KVVQWGNANMIEAERRLLANALLDIANQRFVLLSESCIPLFNFSTVYTYLMNSTKSHVES  234

Query  759   YDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSC  938
             Y L G  G GRY  RM P IK+ QWRKGSQWFE+DRDLAIE++SD +YF LFQ YC G C
Sbjct  235   YVLEGPVGNGRYSPRMRPGIKIDQWRKGSQWFEIDRDLAIEIVSDRKYFPLFQKYCTGQC  294

Query  939   YADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEY  1118
             Y+DEHYLPTFV ++  + NSNR+LTWVDWS GG HPA++LR +VT+ FLE +R+G KC Y
Sbjct  295   YSDEHYLPTFVTMKHSKRNSNRTLTWVDWSRGGPHPAKFLRTEVTIEFLERMRSGSKCVY  354

Query  1119  NGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             NG  TN C+LFARKF  ++L RLLRFAPK+M F+
Sbjct  355   NGNHTNTCFLFARKFWPNALDRLLRFAPKIMHFN  388



>ref|XP_002311468.2| hypothetical protein POPTR_0008s12260g [Populus trichocarpa]
 gb|EEE88835.2| hypothetical protein POPTR_0008s12260g [Populus trichocarpa]
Length=391

 Score =   478 bits (1231),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 245/394 (62%), Positives = 291/394 (74%), Gaps = 5/394 (1%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK Q  N      TS KL+NA L LIN+LS    F CGL  G++ SSY K  S NL +  
Sbjct  1     MKGQKQNLP---TTSTKLFNAQLQLINVLSFLFLFGCGLVTGVVLSSYLKHVSCNLHVSQ  57

Query  222   -AAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPF  398
              + +      +P        +  VGL+E LK P+   HDM ++ELLWRASM P+I+EYPF
Sbjct  58    FSVSTTTTTTVPLATLPAFKLPRVGLKEHLKVPD-VKHDMDEKELLWRASMTPRIREYPF  116

Query  399   SRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPS  578
              RVPKVAFMFLT+G V +APLWE FFQG+EG YSIYVHS PS NES PE  VFHGRRIPS
Sbjct  117   DRVPKVAFMFLTKGPVLMAPLWERFFQGHEGLYSIYVHSSPSYNESEPESPVFHGRRIPS  176

Query  579   QEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEV  758
             ++V+WG+ N+IEAERRLLANALLD SNQRFVLLSESCIP+F+F T+Y+YLMNST N ++ 
Sbjct  177   KDVQWGNTNIIEAERRLLANALLDISNQRFVLLSESCIPIFDFSTVYTYLMNSTKNHVDS  236

Query  759   YDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSC  938
             Y L G  G GRY  RM PVIK+  WRKGSQWFEMDRDLAIEV+SD  YF +FQ YCKG C
Sbjct  237   YVLDGPVGNGRYNPRMRPVIKIEHWRKGSQWFEMDRDLAIEVVSDQEYFPVFQKYCKGHC  296

Query  939   YADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEY  1118
             YADEHYLPTFV+++    NSNRSLTWVDWS GG+HPA++L  +VT+ FLE +R+G KC Y
Sbjct  297   YADEHYLPTFVSMKHSERNSNRSLTWVDWSRGGAHPAKFLSREVTIEFLERMRSGSKCVY  356

Query  1119  NGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             N   TN C+LFARKF   +L RLLRFAPK+M F+
Sbjct  357   NANSTNTCFLFARKFWPPALERLLRFAPKVMHFN  390



>ref|XP_010264609.1| PREDICTED: uncharacterized protein LOC104602574 [Nelumbo nucifera]
Length=404

 Score =   474 bits (1221),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 234/381 (61%), Positives = 289/381 (76%), Gaps = 5/381 (1%)
 Frame = +3

Query  90    KLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqp-  266
             KL++A L ++N LS F+FF  GL  G++     K    N Q+     +  P  L      
Sbjct  24    KLFSARLQILNPLSYFVFFGLGLALGVVVGFSLKDSPFNFQVSLFPVSSSPSSLSVLPLV  83

Query  267   -ERTPVAA--VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTR  437
              ++ P +A  +GL+E+LKPP   MHDM DEELLW+ASM P +++YP+ RVPKVAFMFLTR
Sbjct  84    PQKQPSSAARIGLKEYLKPP-TVMHDMDDEELLWKASMTPGVRKYPYKRVPKVAFMFLTR  142

Query  438   GAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIea  617
             G + +APLWEMFF+G+EG YSIYVHS+P+ NES  E  VF GRRIPS+EV+WG  NMI+A
Sbjct  143   GRLAMAPLWEMFFKGHEGLYSIYVHSNPNFNESEAESPVFQGRRIPSKEVQWGKFNMIQA  202

Query  618   errllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYK  797
             ERRLLANALLDFSNQRF+LLSE+CIPLFNF T+Y+YL+ S   F+E YD PG  GRGRY 
Sbjct  203   ERRLLANALLDFSNQRFILLSEACIPLFNFSTVYNYLIGSNMTFVEAYDEPGPVGRGRYN  262

Query  798   HRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNI  977
             HRM P+I L QWRKG+QWFEMDRDLAIE++SD +YFS+F  YCKGSCY+DEHY+PTFV++
Sbjct  263   HRMKPLITLDQWRKGAQWFEMDRDLAIEIVSDVKYFSVFGKYCKGSCYSDEHYIPTFVSV  322

Query  978   RFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFAR  1157
              F   NSNR+LTWVDWS GG HP R++R DVT+  LE +RT   C+YNG  TN+CYLFAR
Sbjct  323   NFWEKNSNRTLTWVDWSRGGPHPTRFIRTDVTIELLEMMRTATTCKYNGNTTNICYLFAR  382

Query  1158  KFSLHSLTRLLRFAPKLMRFD  1220
             KF  +SL RLLRFAPK+M F+
Sbjct  383   KFYPNSLDRLLRFAPKVMMFN  403



>ref|XP_010663889.1| PREDICTED: uncharacterized protein LOC100252627 [Vitis vinifera]
Length=380

 Score =   471 bits (1213),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 238/372 (64%), Positives = 289/372 (78%), Gaps = 9/372 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA  287
             L+L NL+  FLFF  GL  GL  S Y + FS N+QL   +          P   RT  ++
Sbjct  17    LSLFNLMCFFLFFGSGLAIGLTVSFYLQDFSFNIQLKQFSTP-------IPTTNRTEKSS  69

Query  288   -VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
              +GL+E++KPP N +HDM D ELLWRASMVP++ E+PF RVPK+AF+FLTRG++ LAPLW
Sbjct  70    RIGLKEYVKPP-NVIHDMKDAELLWRASMVPRVGEFPFKRVPKIAFLFLTRGSLPLAPLW  128

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             EMFF+G+E  YSIYVHSDPS N + P+ SVF+GR IPSQEV+WG+ +M+EAERRLLANAL
Sbjct  129   EMFFRGHEALYSIYVHSDPSFNRTVPKSSVFYGRSIPSQEVQWGNFSMLEAERRLLANAL  188

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SN RFVLLSESCIPLFNF TIYSYLM ST +FIE YDLPG  GR RY HRM P++ +
Sbjct  189   LDISNHRFVLLSESCIPLFNFSTIYSYLMASTKSFIEAYDLPGPVGRARYDHRMKPIVTI  248

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKGSQWFEMDR LAIEVISD +YF++F+  C+ SCYADEHYLPT V+I F R N+NR
Sbjct  249   GQWRKGSQWFEMDRGLAIEVISDRKYFAVFRECCEASCYADEHYLPTLVSIEFWRRNANR  308

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             SLTWVDWS+GG+HPA + R DVTV FL++LRT   C+YNG  T++C+LFARKF   +L R
Sbjct  309   SLTWVDWSNGGAHPAGFWRRDVTVEFLQSLRTESHCQYNGNNTDICFLFARKFLPGTLNR  368

Query  1185  LLRFAPKLMRFD  1220
             LLR APKLM+F+
Sbjct  369   LLRVAPKLMKFN  380



>gb|KEH44200.1| core-2/I-branching enzyme [Medicago truncatula]
Length=411

 Score =   468 bits (1204),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 245/393 (62%), Positives = 291/393 (74%), Gaps = 3/393 (1%)
 Frame = +3

Query  45    KNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITA  224
             K +  NN    +   K++   L+ IN L+  L    GLT G+I S Y K  + +LQ    
Sbjct  4     KMKGSNNQYQSIPISKIFKIQLHFINFLTYLLVLVFGLTLGIIISFYLKECTFSLQFTQL  63

Query  225   AAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSR  404
             + +  P       P       VGL++FLKPP   MHDM DEELLWRASM  KI EYPF R
Sbjct  64    SLSSLPRTQHLSPPIAVKQERVGLKDFLKPPP-IMHDMDDEELLWRASMTAKIAEYPFER  122

Query  405   VPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQE  584
             VPKVAFMFLTRGAV LAPLWE FF+G+E +YSIYVHS+PS N S PE  VFHGRRIPS+E
Sbjct  123   VPKVAFMFLTRGAVFLAPLWEQFFKGHEVYYSIYVHSNPSYNGSHPESPVFHGRRIPSKE  182

Query  585   VKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYD  764
             V+WG+VNMIEAERRLL+NALLD SNQRFVL+SESCIPLFNF TIYSYL+NST N++  YD
Sbjct  183   VEWGNVNMIEAERRLLSNALLDISNQRFVLISESCIPLFNFSTIYSYLINSTQNYVMSYD  242

Query  765   LPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYA  944
              P S GRGRY  +M P + L +WRKGSQWFE+DR+LA+ V+SD  YF +FQ YCKGSCYA
Sbjct  243   DPSSVGRGRYNIQMLPEVSLNEWRKGSQWFEIDRELALGVVSDRIYFPVFQEYCKGSCYA  302

Query  945   DEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEY-N  1121
             DEHYLPT V+I+FG GNSNRSLTWVDWS GG HPA +LR DV V FLE LR+  KC+Y N
Sbjct  303   DEHYLPTLVSIKFGEGNSNRSLTWVDWSRGGPHPAHFLRSDVNVKFLERLRS-KKCKYNN  361

Query  1122  GEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             GE TN C+LFARKF   +L++LL+ APK+M+F+
Sbjct  362   GESTNACFLFARKFLPSTLSKLLKIAPKVMQFE  394



>gb|KHN06677.1| hypothetical protein glysoja_021223 [Glycine soja]
Length=415

 Score =   468 bits (1203),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 248/419 (59%), Positives = 294/419 (70%), Gaps = 31/419 (7%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK QN  N  PL +  K +NA  + I  L+  L    G+T G+IFS Y K  + +LQ   
Sbjct  1     MKGQN--NQYPLNSVSKFFNAQFHFIQFLTYILILGFGITIGVIFSFYLKDCNFSLQFTQ  58

Query  222   AAAAD---------------------------qplllpppqpERTPVAAVGLQEFLKPPE  320
              + +                                +       T  + VGL+EFLKPP 
Sbjct  59    LSLSSFPRTPPLPPPTAKPEISNQSQPRTQIQAQTQIQTETQMETENSHVGLKEFLKPPP  118

Query  321   NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
               +HDM DEELLWRASM  KI +YPF RVPKVAFMFLTRG V LAPLWE FF+G+EGFYS
Sbjct  119   -VVHDMDDEELLWRASMTAKIPDYPFDRVPKVAFMFLTRGPVFLAPLWEQFFKGHEGFYS  177

Query  501   IYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             IYVHS+PS N S PE  VF GRRIPS+EV+WG+VNMIEAERRLLANAL+D SNQRFVLLS
Sbjct  178   IYVHSNPSYNGSRPESPVFKGRRIPSKEVEWGNVNMIEAERRLLANALVDISNQRFVLLS  237

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIPLFNF TIY+YLMNST N++  +D P S GRGRY  +M P I L QWRKGSQWFEM
Sbjct  238   ESCIPLFNFSTIYTYLMNSTQNYVMAFDDPSSVGRGRYSIQMLPEISLNQWRKGSQWFEM  297

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
             DRDLA+EV+SD +YF +FQ YCKGSCYADEHYLPT+V+I+F  GNSNRSLTWVDWS GG 
Sbjct  298   DRDLALEVVSDRKYFPVFQDYCKGSCYADEHYLPTYVSIKFWEGNSNRSLTWVDWSKGGP  357

Query  1041  HPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             HP ++LR ++TV FLE+LR   KCEYNG+  NVC+LFARKF+  SL++L + AP +M F
Sbjct  358   HPTKFLRSEITVKFLESLR-DQKCEYNGDSINVCFLFARKFAPGSLSKLTKIAPMVMHF  415



>ref|XP_003536674.1| PREDICTED: uncharacterized protein LOC100810724 [Glycine max]
Length=415

 Score =   466 bits (1198),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 246/419 (59%), Positives = 294/419 (70%), Gaps = 31/419 (7%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK QN  N  PL +  K +NA  + I  L+  L    G+T G+IFS Y K  + +LQ   
Sbjct  1     MKGQN--NQYPLNSVSKFFNAQFHFIQFLTYILILGFGITIGVIFSFYLKDCNFSLQFTQ  58

Query  222   AAAAD---------------------------qplllpppqpERTPVAAVGLQEFLKPPE  320
              + +                                +       T  + VGL+EFLKPP 
Sbjct  59    LSLSSFPRTPPLPPPTAKPEISNQSQPRTQIQAQTQIQTETQMETENSHVGLKEFLKPPP  118

Query  321   NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
               +HDM DEE+LWRASM  KI +YPF RVPKVAFMFLTRG V LAPLWE FF+G+EGFYS
Sbjct  119   -VVHDMDDEEMLWRASMTAKIPDYPFDRVPKVAFMFLTRGPVFLAPLWEQFFKGHEGFYS  177

Query  501   IYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             IYVHS+PS N S PE  VF GRRIPS+EV+WG+VNMIEAERRLLANAL+D SNQRFVLLS
Sbjct  178   IYVHSNPSYNGSRPESPVFKGRRIPSKEVEWGNVNMIEAERRLLANALVDISNQRFVLLS  237

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIPLFNF TIY+YLMNST N++  +D P S GRGRY  +M P I L QWRKGSQWFEM
Sbjct  238   ESCIPLFNFSTIYTYLMNSTQNYVMAFDDPSSVGRGRYSIQMLPEISLNQWRKGSQWFEM  297

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
             DRDLA+EV+SD +YF +FQ YCKGSCYADEHYLPT+V+I+F  GNSNRSLTWVDWS GG 
Sbjct  298   DRDLALEVVSDRKYFPVFQDYCKGSCYADEHYLPTYVSIKFWEGNSNRSLTWVDWSKGGP  357

Query  1041  HPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             HP ++LR ++TV FLE+LR   KCEYNG+  NVC+LFARKF+  S+++L + AP +M F
Sbjct  358   HPTKFLRSEITVKFLESLR-DQKCEYNGDSINVCFLFARKFAPGSVSKLTKIAPMVMHF  415



>ref|XP_003614560.1| hypothetical protein MTR_5g055480 [Medicago truncatula]
 gb|AES97518.1| core-2/I-branching enzyme [Medicago truncatula]
Length=390

 Score =   464 bits (1193),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 293/395 (74%), Gaps = 16/395 (4%)
 Frame = +3

Query  51    QNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAA  230
             +N NN   L T  + +N+ L+LI  L+  L  ACG+T G+I S Y KS + NL     + 
Sbjct  2     KNSNNQHSLNTISRNFNSHLHLIRFLTYLLLLACGITLGIIISFYLKSLNFNLHFTQLSQ  61

Query  231   ADqplllpppqpERTPV--------AAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIK  386
                 L L      R P+        +  GL++F++P +  +HD+SDEELLWRAS+ PKI 
Sbjct  62    KTTLLPL------RQPIVFDSSLNGSHEGLKKFIEPSQ-VVHDLSDEELLWRASLSPKIN  114

Query  387   EYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGR  566
             EYPF RVPKVAF+FL RG V LAPLWE FF+G++G+YSIYVHS+PS N S  E  VFHGR
Sbjct  115   EYPFDRVPKVAFLFLVRGPVPLAPLWEKFFKGHKGYYSIYVHSNPSYNGSEVESPVFHGR  174

Query  567   RIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTN  746
             RIPS++V+WG  NMIEAERRLLANALLDFSNQRFVL+SESCIPLFNF T+YSYLMNST +
Sbjct  175   RIPSKKVEWGKFNMIEAERRLLANALLDFSNQRFVLISESCIPLFNFSTVYSYLMNSTKS  234

Query  747   FIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYC  926
             ++  YD   S GRGRY+ +MSP IKLR+WRKGSQWFEMDR+LA+EVISD  Y+ +F  YC
Sbjct  235   YVMAYDQASSVGRGRYRIKMSPTIKLREWRKGSQWFEMDRNLALEVISDRTYYPVFGKYC  294

Query  927   KGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD  1106
              GSCYADEHYLPT V+I+F + N+NRSLTWVDWS GG HP +Y+R +VT  FLE LR   
Sbjct  295   NGSCYADEHYLPTLVSIKFWKSNTNRSLTWVDWSKGGPHPVKYVRPEVTCEFLENLR-NQ  353

Query  1107  KCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLM  1211
              C+YNG  TNVCYLFARKF   SLTRL+RFAPK+M
Sbjct  354   TCKYNGNSTNVCYLFARKFLPTSLTRLMRFAPKVM  388



>ref|XP_010099264.1| hypothetical protein L484_015454 [Morus notabilis]
 gb|EXB77528.1| hypothetical protein L484_015454 [Morus notabilis]
Length=423

 Score =   465 bits (1196),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 241/424 (57%), Positives = 299/424 (71%), Gaps = 31/424 (7%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNA-PLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI  218
             MK     N  PL    KL NA  L+ +N+LS FL F CGLT G+I ++Y K FS NLQ  
Sbjct  1     MKGIQSQNQKPLNLLSKLSNAFQLHFLNMLSYFLLFGCGLTLGIIITTYMKDFSFNLQFT  60

Query  219   T-------------AAAADqplllpppqpERTPVAAV---------------GLQEFLKP  314
                           +++            ++ P  +V               GL+E+LKP
Sbjct  61    QFSISTSSPSSSSLSSSLSSSSTTSQTLEKQIPTVSVTEETETKSNISNQILGLEEYLKP  120

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             P + MH+M+D+ELLWRASMVP+I  YPF+RVPKVAFMFL RG V ++PLWE FF+G+EG 
Sbjct  121   P-SVMHNMTDKELLWRASMVPRIPAYPFNRVPKVAFMFLVRGHVFMSPLWEQFFKGHEGL  179

Query  495   YSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             YSIYVHS+PS N SAPE  VFHGRRIPS+EV WG VNMIEAERRLL NALLD SN+RF+L
Sbjct  180   YSIYVHSNPSYNGSAPESPVFHGRRIPSKEVGWGKVNMIEAERRLLTNALLDVSNERFIL  239

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSE+CIPL+NF TIY+YL+N+T N +  YD PG  GRGRY + M P I L+QWRKGSQWF
Sbjct  240   LSEACIPLYNFKTIYNYLINATKNHVMAYDEPGVVGRGRYNYHMYPDISLKQWRKGSQWF  299

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             EM+R+LAIEV+SD +YF +FQ YC+G+CY+DEHYLPT V+I+F  GNSNRSLTWVDWS G
Sbjct  300   EMNRELAIEVVSDSKYFPIFQKYCRGNCYSDEHYLPTLVSIKFWEGNSNRSLTWVDWSKG  359

Query  1035  GSHPARYLRHDVTVSFLETLRTGDK-CEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLM  1211
             G HPAR+ R DVT+  L ++R  +  C YN   TN+CYLFARKF   ++ RLL+FAPK+M
Sbjct  360   GPHPARFWRTDVTLELLRSMRRNNTGCAYNENSTNLCYLFARKFLPSTVDRLLKFAPKIM  419

Query  1212  RFDE  1223
              F++
Sbjct  420   HFND  423



>ref|XP_006485819.1| PREDICTED: uncharacterized protein LOC102611796 [Citrus sinensis]
Length=419

 Score =   464 bits (1194),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 243/419 (58%), Positives = 294/419 (70%), Gaps = 44/419 (11%)
 Frame = +3

Query  66    NPPLLTSIKLY-NAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSL-------------  203
             +PP  +  KL+ N  ++L NL S F+ F  G+  G+  S + K+ SL             
Sbjct  11    HPPPFSITKLFLNLQMHLPNLFSYFVIFGFGVALGIALSFHLKNISLFSFDDQLHQLSSS  70

Query  204   -----------------NLQLITAAAADqplllpppqpERTPVAAVGLQEF--LKPPEN-  323
                               L L+T       +               GL ++  L+P  N 
Sbjct  71    SSSSSSSPPPNIQPSSPTLHLVTTTGNQTTVN----------TTRTGLNDYVSLRPNNNN  120

Query  324   AMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSI  503
             AMHDM++EELLWRASM P+I EYPF RVPKVAF+FLTRGAVTLAPLWE FF G+EG YSI
Sbjct  121   AMHDMTEEELLWRASMAPRIHEYPFKRVPKVAFLFLTRGAVTLAPLWEKFFHGHEGLYSI  180

Query  504   YVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSE  683
             YVHS PS NE+ P+ SVFHGRRIPS+EV+WG  +M+EAERRLLANALLD +NQRFVLLSE
Sbjct  181   YVHSSPSFNETVPQSSVFHGRRIPSKEVQWGKFSMLEAERRLLANALLDITNQRFVLLSE  240

Query  684   SCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMD  863
             SCIPLFNF TIY+YL+NS+  F+E YDLPG  GRGRY  RM PVI+L QWRKGSQWFEMD
Sbjct  241   SCIPLFNFSTIYNYLINSSKAFVEAYDLPGPVGRGRYNRRMRPVIRLEQWRKGSQWFEMD  300

Query  864   RDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSH  1043
             R LA+EVISD +YF  F+ +CK SCYADEHYLPTFV+ +F + NSNRSLTWVDWS GG H
Sbjct  301   RALALEVISDKKYFVTFKRHCKASCYADEHYLPTFVSAKFWKRNSNRSLTWVDWSKGGPH  360

Query  1044  PARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             PA++ R DVT+ FL+ LR+G  CEYNG+ TN+C+LFARKF  ++L RLLRFAPK+M F+
Sbjct  361   PAKFQRRDVTIEFLKRLRSGSHCEYNGKRTNICFLFARKFLPNALDRLLRFAPKVMGFN  419



>ref|XP_010644813.1| PREDICTED: uncharacterized protein LOC100245576 [Vitis vinifera]
Length=405

 Score =   463 bits (1191),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 246/408 (60%), Positives = 299/408 (73%), Gaps = 19/408 (5%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK+QN N+   L T+I L  +  N ++L S F FFA GLT G+I S   K+FS NLQ+  
Sbjct  1     MKSQNQNS---LATTINLLGSRWNPLHLFSCFFFFAFGLTFGIILSFNLKNFSFNLQVTQ  57

Query  222   AAAADqpll-------------lpppqpERTPVAA--VGLQEFLKPPENAMHDMSDEELL  356
             ++ +                          T  A   +GL E++KPP NAMHDM DEEL 
Sbjct  58    SSPSPSASASAPPPSPLVSPLPASTYPTNETSKAGRRIGLSEYMKPP-NAMHDMDDEELP  116

Query  357   WRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNES  536
             WRASM P+I+E+PF RVPKVAFMFLT+G + LAPLWE+FF+G+EG YSIYVHS PS NE+
Sbjct  117   WRASMAPQIREFPFKRVPKVAFMFLTKGPLPLAPLWELFFKGHEGLYSIYVHSHPSFNET  176

Query  537   APEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTI  716
              PE SVFH RRIPS+EV+WG  NMIEAERRLLANALLDFSN  FVLLSESCIPLFNF TI
Sbjct  177   EPENSVFHDRRIPSKEVQWGKFNMIEAERRLLANALLDFSNYHFVLLSESCIPLFNFSTI  236

Query  717   YSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDD  896
             YSYLMNST N+++ YD PG  GRGRYK +M P I + QWRKGSQWF +DR+LA E+ISD 
Sbjct  237   YSYLMNSTRNYVQTYDFPGPVGRGRYKEQMYPTITIEQWRKGSQWFAVDRNLATEIISDQ  296

Query  897   RYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTV  1076
              YF +FQ +CK SCYADEHYLPTFV I+F   ++NRSLTWVDWS GG+HPAR++R DVT+
Sbjct  297   TYFPIFQKHCKSSCYADEHYLPTFVGIKFWERSANRSLTWVDWSRGGAHPARFMRWDVTI  356

Query  1077  SFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
               L+ LR+  +C+YNG+ TN+C+LFARK    +L RLLRFAPK+M F+
Sbjct  357   ESLKRLRSEGRCDYNGKSTNICFLFARKVMPSALERLLRFAPKVMHFN  404



>ref|XP_007044266.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 2 [Theobroma cacao]
 gb|EOY00098.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 2 [Theobroma cacao]
Length=394

 Score =   461 bits (1187),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 242/391 (62%), Positives = 297/391 (76%), Gaps = 13/391 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI-  218
             MK +N+N   P  +  KL+NA L+  N+LS  L F   L+ G+I S + K+FS++L +  
Sbjct  1     MKGENNN---PSTSFAKLFNAHLHFFNVLSCVLLFGSLLSLGIILSFHLKNFSIDLHITQ  57

Query  219   --------TAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMV  374
                     +A     P     P  + + VA +GL EFLKPP+  MH M D+ELLWRASMV
Sbjct  58    LSLTTRSASAPPPPPPPQSFTPAAKTSNVAGIGLTEFLKPPD-VMHGMDDKELLWRASMV  116

Query  375   PKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSV  554
             P+I +YPF RVPKVAFMFLT+G + LAPLWE FF+G+EG YSIYVHS+PS N S P+ SV
Sbjct  117   PRIPQYPFDRVPKVAFMFLTKGPLLLAPLWEKFFEGHEGMYSIYVHSNPSFNLSDPKSSV  176

Query  555   FHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMN  734
             F+GRRIPS+EV+WG VNMIEAERRLLANALLDFSNQRFVLLSESCIP+FNF T+YSYL+N
Sbjct  177   FYGRRIPSKEVEWGKVNMIEAERRLLANALLDFSNQRFVLLSESCIPIFNFSTVYSYLIN  236

Query  735   STTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLF  914
             S+ +F+E YDL G  GRGRY  RMSP + L QWRKG+QWFEMDR+LAI V+SD  YF +F
Sbjct  237   SSQSFVESYDLEGPVGRGRYSRRMSPRVTLDQWRKGAQWFEMDRELAIGVVSDQEYFPVF  296

Query  915   QYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETL  1094
             Q YCKG+CYADEHYLPTFV ++FG  NSNR+LTWVDWS GG HPA++LR +VTV FLE L
Sbjct  297   QKYCKGACYADEHYLPTFVTMKFGHKNSNRTLTWVDWSKGGPHPAKFLRTEVTVEFLERL  356

Query  1095  RTGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             R+G +C+YNG  T++C+LFARKFS  +L R 
Sbjct  357   RSGSQCQYNGNTTDICHLFARKFSPDALYRF  387



>ref|XP_007222895.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
 gb|EMJ24094.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
Length=398

 Score =   462 bits (1188),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 251/402 (62%), Positives = 291/402 (72%), Gaps = 12/402 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI-  218
             MK QN N   PL    KL+NA L+++ LL  FL F  GLT G++ S Y K  S++LQL  
Sbjct  1     MKGQNQN---PLNLFSKLFNAQLHILKLLFYFLLFGGGLTLGMVLSFYLKDISISLQLAQ  57

Query  219   -------TAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVP  377
                    + +     +              +GL+E+LKPP N +HDM D+ELLWRASM+P
Sbjct  58    FSFSTSQSPSNQHTLMPNVKAFEANATKPHIGLKEYLKPP-NVLHDMDDQELLWRASMIP  116

Query  378   KIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVF  557
             +I EYPF RVPKVAFMFLT+G V LAPLWE FF+G+ G YSIYVHS+PS N S PE  VF
Sbjct  117   RIPEYPFRRVPKVAFMFLTKGPVLLAPLWEKFFKGHRGLYSIYVHSNPSYNGSDPESPVF  176

Query  558   HGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNS  737
             H RRIPS+EV+WG+VNMIEAERRLLANALLD SNQRFVLLSESCIPL NF T+YSYL+ S
Sbjct  177   HDRRIPSREVEWGNVNMIEAERRLLANALLDISNQRFVLLSESCIPLHNFSTVYSYLVRS  236

Query  738   TTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQ  917
               +F++VYD P S GRGRY   M P I L QWRKGSQWFEMDR  AIE++SD +YF  FQ
Sbjct  237   RESFVQVYDDPSSVGRGRYNSHMYPKISLSQWRKGSQWFEMDRRHAIEIVSDKKYFPAFQ  296

Query  918   YYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR  1097
              YC+GSCYADEHYLPTF NI FG  NSNRSLTWVDWS GG HPA++ R DVTV  L  LR
Sbjct  297   KYCRGSCYADEHYLPTFANINFGAKNSNRSLTWVDWSRGGPHPAKFTRTDVTVELLSRLR  356

Query  1098  TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
              G  C YNG+ TNVC+LFARKF   +L RLLRFAPKLMRF+ 
Sbjct  357   NGTACVYNGKSTNVCFLFARKFGPDTLERLLRFAPKLMRFNR  398



>ref|XP_006442617.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
 gb|ESR55857.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
Length=419

 Score =   462 bits (1189),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 246/409 (60%), Positives = 298/409 (73%), Gaps = 24/409 (6%)
 Frame = +3

Query  66    NPPLLTSIKLY-NAPLNLINLLSAFLFFACGLTCGLIFSSYFKS---FSLNLQL------  215
             +PP  +  KL+ N  ++L NL S F+ F  G+  G+  S + K+   FS + QL      
Sbjct  11    HPPPFSITKLFLNLQMHLPNLFSYFVIFGFGVALGIALSFHLKNISLFSFDDQLHQLSSS  70

Query  216   ---------ITAAAADqplllpppqpERTPV--AAVGLQEF--LKPPEN-AMHDMSDEEL  353
                           +   L L      +T V     GL ++  L+P  N AMHDM++EEL
Sbjct  71    SSSSSSSPPPNIQPSSPSLHLVTTTGNQTTVNTTRTGLNDYVSLRPNNNNAMHDMTEEEL  130

Query  354   LWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNE  533
             LWRASM P+I EYPF RVPKVAF+FLTRGAVTLAPLWE FF G+EG YSIYVHS PS NE
Sbjct  131   LWRASMAPRIHEYPFKRVPKVAFLFLTRGAVTLAPLWEKFFHGHEGLYSIYVHSSPSFNE  190

Query  534   SAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPT  713
             + P+ SVFHGRRIPS+EV+WG  +M+EAERRLLANALLD +NQRFVLLSESCIPLFNF T
Sbjct  191   TVPQSSVFHGRRIPSKEVQWGKFSMLEAERRLLANALLDITNQRFVLLSESCIPLFNFST  250

Query  714   IYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISD  893
             IY+YL+NS+  FIE YDLPG  GRGRY   M PVI+L QWRKGSQWFEMDR LA+EVISD
Sbjct  251   IYNYLINSSKAFIEAYDLPGPVGRGRYNRPMRPVIRLEQWRKGSQWFEMDRALALEVISD  310

Query  894   DRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVT  1073
              +YF  F+ +CK SCYADEHYLPTFV+++F + NSNRSLTWVDWS GG HPA++ R DVT
Sbjct  311   KKYFVTFKRHCKASCYADEHYLPTFVSVKFWKRNSNRSLTWVDWSKGGPHPAKFQRRDVT  370

Query  1074  VSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             + FL+ LR+G  CEYNG+ TN+C+LFARKF  ++L RLLRFAPK+M F+
Sbjct  371   IEFLKRLRSGSHCEYNGKSTNICFLFARKFLPNALDRLLRFAPKVMGFN  419



>ref|XP_004497066.1| PREDICTED: uncharacterized protein LOC101490811 [Cicer arietinum]
Length=406

 Score =   461 bits (1186),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 244/378 (65%), Positives = 285/378 (75%), Gaps = 4/378 (1%)
 Frame = +3

Query  90    KLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpE  269
             K++N  L+ INLL+  L    GLT G+I S Y K  + +LQ  T  +       PP  P 
Sbjct  15    KIFNVQLHFINLLTYLLILVFGLTLGIIISFYLKECTFSLQF-TQLSLSSLPRTPPLPPP  73

Query  270   RTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
                   VGL++FLKPP   +HDM DEELLWRASM  KI EYPF RVPKVAFMFLTRG V 
Sbjct  74    VAKQERVGLKDFLKPPP-IVHDMDDEELLWRASMTAKINEYPFERVPKVAFMFLTRGPVF  132

Query  450   LAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrl  629
             LAPLWE FF+G+EG+YSIYVHS+PS N S PE  VF GRRIPS+EV WG+VNMIEAERRL
Sbjct  133   LAPLWEQFFKGHEGYYSIYVHSNPSYNGSYPETPVFSGRRIPSKEVAWGNVNMIEAERRL  192

Query  630   lanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMS  809
             L+NALLD SNQRFVLLSESCIPLFNF TIYSYL+NST N++  +D P   GRGRY  +M 
Sbjct  193   LSNALLDISNQRFVLLSESCIPLFNFSTIYSYLINSTENYVMAFDDPSGVGRGRYSIQML  252

Query  810   PVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGR  989
             P + L+QWRKG QWFEMDR+LA+ V+SD  YF +FQ YCKGSCYADEHYLPTFV+I+F  
Sbjct  253   PEVSLKQWRKGFQWFEMDRELALGVVSDRIYFPVFQQYCKGSCYADEHYLPTFVSIKFWE  312

Query  990   GNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEY-NGEETNVCYLFARKFS  1166
             GNSNRSLTWVDWS GG HPA +LR DVTV FLE LR   KC+Y NG  TN C+LFARKF 
Sbjct  313   GNSNRSLTWVDWSKGGPHPAHFLRSDVTVEFLERLRN-KKCKYNNGNSTNACFLFARKFL  371

Query  1167  LHSLTRLLRFAPKLMRFD  1220
               +L+RLL+ AP++M+F+
Sbjct  372   PSTLSRLLKIAPQVMQFE  389



>gb|KHN20747.1| hypothetical protein glysoja_019064 [Glycine soja]
Length=315

 Score =   457 bits (1176),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 220/311 (71%), Positives = 261/311 (84%), Gaps = 1/311 (0%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             VGL+EFLKPP  AMHDMSDEELLWRASMVP + + PF + PK+AFMFLT+G V LAPLW+
Sbjct  6     VGLREFLKPPM-AMHDMSDEELLWRASMVPMVHKLPFKQTPKIAFMFLTKGPVLLAPLWQ  64

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+GNEG YSIYVHS PS NE+ PE SVFHGR IPSQEV+WG+ +MIEAERRLLANAL+
Sbjct  65    RFFKGNEGLYSIYVHSYPSFNETVPESSVFHGRNIPSQEVRWGENSMIEAERRLLANALV  124

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DF+NQRFVLLSESCIPLFNF TIY+YLMNST  F+E YDLPG  GRGRY  +M P I+L 
Sbjct  125   DFTNQRFVLLSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGRGRYSPQMRPQIRLS  184

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
             QWRKGSQWF++DR LA++++SD +YFS+F+ YCK SCY+DEHYLPT V+I+F + NSNR+
Sbjct  185   QWRKGSQWFQIDRSLALQIVSDHQYFSVFKKYCKPSCYSDEHYLPTLVSIKFWKRNSNRT  244

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             LTWVDWS GG HP+RY R DVT+ F   LR G  CEYNG  TN+C+LFARKF+ H+L RL
Sbjct  245   LTWVDWSRGGPHPSRYFRTDVTIEFFNKLRFGRSCEYNGRTTNICHLFARKFTPHALDRL  304

Query  1188  LRFAPKLMRFD  1220
             LRFAPK+M+F+
Sbjct  305   LRFAPKIMQFN  315



>gb|EYU30001.1| hypothetical protein MIMGU_mgv1a007596mg [Erythranthe guttata]
Length=402

 Score =   458 bits (1178),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 248/395 (63%), Positives = 292/395 (74%), Gaps = 11/395 (3%)
 Frame = +3

Query  72    PLLTSIKLYN-APLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAA---Dq  239
             P+  + KL N +P  L+NLLS   FF  GLT G+I   ++KSFS NLQ+     +    +
Sbjct  8     PISVAGKLINYSPHPLLNLLSYVFFFVFGLTFGIILCFHYKSFSFNLQVTNGQFSIFTSR  67

Query  240   plllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVA  419
              LL  PP     P          K  +  +H MS+ EL+WRASM PKIKE+PF R PKVA
Sbjct  68    SLLNQPPPINTPPPPPSKKPTAPKTHDEVLHGMSERELMWRASMAPKIKEFPFERAPKVA  127

Query  420   FMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPE-GSVFHGRRIPSQEVKWG  596
             FMFLTRG V LAPLWE FF+G+ G YSIYVHSDPS N S P+  S+FHGRRIPS+ V+WG
Sbjct  128   FMFLTRGPVILAPLWERFFRGHRGLYSIYVHSDPSFNGSEPDRDSIFHGRRIPSKVVQWG  187

Query  597   DVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGS  776
             +VNMIEAERRLLANALLDFSNQRFVL+SESCIPL+NF TIYSYL+NST NF+E YDL G 
Sbjct  188   NVNMIEAERRLLANALLDFSNQRFVLISESCIPLYNFSTIYSYLINSTQNFVESYDLAGP  247

Query  777   TGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHY  956
              GRGRY H+M P +KL  WRKGSQWF +DR LA+EVISD  YF +FQ YC GSCYADEHY
Sbjct  248   VGRGRYSHKMGPTVKLHDWRKGSQWFGIDRSLALEVISDTSYFPVFQKYCDGSCYADEHY  307

Query  957   LPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRT------GDKCEY  1118
             LPTFV+++FG  NSNR+LTWVDWS GG HPA+++R DVT  FLE LR+      G  CEY
Sbjct  308   LPTFVSMKFGGRNSNRTLTWVDWSRGGPHPAKFVRTDVTPEFLERLRSGGGGGGGGGCEY  367

Query  1119  NGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
             NGE TNVCYLFARKF+ ++L RLLRFAPK+M F+ 
Sbjct  368   NGERTNVCYLFARKFTYNALDRLLRFAPKVMHFNR  402



>ref|XP_009348209.1| PREDICTED: uncharacterized protein LOC103939820 [Pyrus x bretschneideri]
Length=410

 Score =   457 bits (1177),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/411 (55%), Positives = 292/411 (71%), Gaps = 19/411 (5%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSF--------  197
             MK      +PP       +NA ++L  ++S FL FA G+  G   + Y K F        
Sbjct  1     MKTTQQQQHPPPSFPKHFFNAQIHLHKIISNFLIFAFGVALGASLNIYLKDFPFQLYSTQ  60

Query  198   ------SLNLQLITAAAADqplllpppqpERT----PVAAVGLQEFLKPPENAMHDMSDE  347
                   S N    ++       +       +T    P   +GL+E+ K P N +H+M D+
Sbjct  61    NKYSHLSTNNPPSSSPPPQSLNIPTNQTKAKTSAAGPAPPIGLKEYTKSP-NILHEMDDD  119

Query  348   ELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSC  527
             ELLWRAS+VP+ +  PF R PKVAFMFLTRG + LAPLWEMFF+G+EG YSIYVH++P  
Sbjct  120   ELLWRASLVPRRRGLPFKRTPKVAFMFLTRGRLALAPLWEMFFKGHEGLYSIYVHANPGF  179

Query  528   NESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNF  707
             N++ PE SVF+GRR+PS+ V WG+ NM++AERRLLANALLDFSNQRFVLLSESCIPLFNF
Sbjct  180   NDTMPENSVFYGRRVPSKNVTWGEPNMVKAERRLLANALLDFSNQRFVLLSESCIPLFNF  239

Query  708   PTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVI  887
               +YSYLM+S   F+E YDLPG  GR RY+H+M P I L QWRKGSQWFE+DR++A EV+
Sbjct  240   NVVYSYLMDSNQTFVEAYDLPGPVGRERYRHKMRPQITLDQWRKGSQWFEVDREIATEVV  299

Query  888   SDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHD  1067
             SD++YF +F  YC  SCY+DEHYLPT+V+I+F + NSNR+LTWVDWS GG HP++++R D
Sbjct  300   SDEKYFPVFTKYCTPSCYSDEHYLPTYVSIKFWKKNSNRTLTWVDWSKGGPHPSKFMRTD  359

Query  1068  VTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             VT+ FL+ LR G KCEYNG+ TN+CYLFARKF  +SL RLLRFAPK+M+F+
Sbjct  360   VTIDFLKKLRHGSKCEYNGKRTNICYLFARKFLPNSLDRLLRFAPKIMKFN  410



>ref|XP_003530022.2| PREDICTED: uncharacterized protein LOC100791882 [Glycine max]
Length=377

 Score =   456 bits (1173),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 260/311 (84%), Gaps = 1/311 (0%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             VGL+EFLKPP  AMHDMSDEELLWRASMVP + + PF + PK+AFMFLT+G V LAPLW+
Sbjct  68    VGLREFLKPPM-AMHDMSDEELLWRASMVPMVHKLPFKQTPKIAFMFLTKGPVLLAPLWQ  126

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+GNEG YS+YVHS PS NE+ PE SVFHGR IPSQEV+WG+ +MIEAERRLLANAL+
Sbjct  127   RFFKGNEGLYSMYVHSYPSFNETVPESSVFHGRNIPSQEVRWGENSMIEAERRLLANALV  186

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DF+NQRFVLLSESCIPLFNF TIY+YLMNST  F+E YDLPG  G GRY  +M P I+L 
Sbjct  187   DFTNQRFVLLSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGHGRYSPQMRPQIRLS  246

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
             QWRKGSQWF++DR LA++++SD +YFS+F+ YCK SCY+DEHYLPT V+I+F + NSNR+
Sbjct  247   QWRKGSQWFQIDRSLALQIVSDHQYFSVFKKYCKPSCYSDEHYLPTLVSIKFWKRNSNRT  306

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             LTWVDWS GG HP+RY R DVT+ F   LR G  CEYNG  TN+C+LFARKF+ H+L RL
Sbjct  307   LTWVDWSRGGPHPSRYFRTDVTIEFFNKLRFGRSCEYNGRTTNICHLFARKFTPHALDRL  366

Query  1188  LRFAPKLMRFD  1220
             LRFAPK+M+F+
Sbjct  367   LRFAPKIMQFN  377



>gb|ACU18543.1| unknown [Glycine max]
Length=415

 Score =   456 bits (1174),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 243/419 (58%), Positives = 291/419 (69%), Gaps = 31/419 (7%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK QN  N  PL +  K +NA  + I  L+  L    G+T G+IFS Y K  + +LQ   
Sbjct  1     MKGQN--NQYPLNSVSKFFNAQFHFIQFLTYILILGFGITIGVIFSFYLKDCNFSLQFTQ  58

Query  222   AAAAD---------------------------qplllpppqpERTPVAAVGLQEFLKPPE  320
              + +                                +       T  + VGL+ FLKPP 
Sbjct  59    LSLSSFPRTPPLPPPTAKPEISNQSQPRTQIQAQTQIQTETQMETENSHVGLKGFLKPPP  118

Query  321   NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
               +HDM DEE+LWRASM  KI +YPF RVPKVAFMFLTRG V LAPLWE FF+G+EGFYS
Sbjct  119   -VVHDMDDEEMLWRASMTAKIPDYPFDRVPKVAFMFLTRGPVFLAPLWEQFFKGHEGFYS  177

Query  501   IYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             IYVHS+PS N S PE  VF GRRIPS+EV+WG+VN IEAERRLLANAL+D SNQRFVLLS
Sbjct  178   IYVHSNPSYNGSRPESPVFKGRRIPSKEVEWGNVNTIEAERRLLANALVDISNQRFVLLS  237

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIPLFNF TIY+YLMNST N++  +D P S GRGRY  +M P I L QWRKGSQWFEM
Sbjct  238   ESCIPLFNFSTIYTYLMNSTQNYVMAFDDPSSVGRGRYSIQMLPEISLNQWRKGSQWFEM  297

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
             DRDLA+EV+SD +YF +FQ  CKGSCYADEHYLPT+V+I+F  GNSNRSLTWVDWS GG 
Sbjct  298   DRDLALEVVSDRKYFPVFQDCCKGSCYADEHYLPTYVSIKFWEGNSNRSLTWVDWSKGGP  357

Query  1041  HPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             HP ++LR ++TV FLE+LR   KCEYNG+  NVC+LFARKF+  S+++L + AP +M F
Sbjct  358   HPTKFLRSEITVKFLESLR-DQKCEYNGDSINVCFLFARKFAPGSVSKLTKIAPMVMHF  415



>ref|XP_004516650.1| PREDICTED: uncharacterized protein LOC101496316 [Cicer arietinum]
Length=392

 Score =   456 bits (1172),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 299/399 (75%), Gaps = 18/399 (5%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK+ N+ ++   ++S   +N+ ++LI  LS  L  ACG+T G+I S Y KS + +LQ   
Sbjct  1     MKSSNNQHSLNYISS--HFNSRVHLIRFLSYLLLLACGVTIGIIISFYLKSCTFSLQFTQ  58

Query  222   AAAADqplllpppqpERTPVAA---------VGLQEFLKPPENAMHDMSDEELLWRASMV  374
              + +  P  L      +TP+           VGL+ F++P  + +HD++DEEL+WRAS+ 
Sbjct  59    LSLSTPPPPLI-----KTPIVPNNSDLVINRVGLKNFIEP-SHVVHDLTDEELMWRASLT  112

Query  375   PKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSV  554
             PKI EYPF RVPKVAFMFL RG+V LAPLW+ FF+G++G+Y+IY+HS+PS N S  E  V
Sbjct  113   PKIDEYPFDRVPKVAFMFLVRGSVPLAPLWQKFFKGHKGYYTIYIHSNPSYNGSEVESPV  172

Query  555   FHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMN  734
             F GRRIPS++V+WG  NMIEAERRLLANALLDFSNQRFVL+SESCIPLFNF T+YSYLMN
Sbjct  173   FRGRRIPSKKVEWGKFNMIEAERRLLANALLDFSNQRFVLISESCIPLFNFSTVYSYLMN  232

Query  735   STTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLF  914
             ST + +  YD   S GRGRY+ +MSP IKL+QWRKGSQWFEM R+LA+EVISD  YF +F
Sbjct  233   STQSHVMAYDEASSVGRGRYRIKMSPKIKLKQWRKGSQWFEMHRELALEVISDRTYFPIF  292

Query  915   QYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETL  1094
             + YCKGSCYADEHYLPTFV+I+F   NSNRSLTWVDWS GG HPA+++R +VT   LE L
Sbjct  293   EKYCKGSCYADEHYLPTFVSIKFWEKNSNRSLTWVDWSKGGPHPAKFVRPEVTSELLENL  352

Query  1095  RTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLM  1211
             R   +CEYNG  TNVC+LFARKF   SLTRL+RFAP++M
Sbjct  353   R-NQRCEYNGNSTNVCFLFARKFLQSSLTRLMRFAPRVM  390



>ref|XP_009624653.1| PREDICTED: uncharacterized protein LOC104115679 [Nicotiana tomentosiformis]
Length=408

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 232/410 (57%), Positives = 290/410 (71%), Gaps = 21/410 (5%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQ---  212
             MKN+ HN    L  + KL+N+ + L NL++ F+ F  GL  G+  S Y K     LQ   
Sbjct  1     MKNEQHNQ---LFFTSKLFNSQMYLHNLVAYFILFGSGLIIGISLSFYLKDLPNTLQNKL  57

Query  213   -----------LITAAA---ADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEE  350
                        LI ++     +  L       E   V  +GL+++LKPP++  HDM DEE
Sbjct  58    FYPQSPPQQPPLIISSPPQIPNLVLSDNSINSETKSVGRIGLRDYLKPPKSCKHDMKDEE  117

Query  351   LLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCN  530
             L+WRASMVP+++  PF R PK+AFMFLTRG++ LAPLWE FF+G EG YSIY+HS PS N
Sbjct  118   LIWRASMVPRVRVLPFKRTPKIAFMFLTRGSLPLAPLWERFFRGYEGLYSIYIHSQPSFN  177

Query  531   ESAP-EGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNF  707
              +AP EG +FHGRRIPS+ V+WG  NM+EAERRLLANALLD SN+RFVLLSESCIPL+NF
Sbjct  178   GNAPEEGPIFHGRRIPSKRVEWGKFNMVEAERRLLANALLDLSNERFVLLSESCIPLYNF  237

Query  708   PTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVI  887
              TIY+Y+MNST  F+E YDLP   GRGRY  +M P I L QWRKGSQWFE+DR++AI++I
Sbjct  238   TTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMRPWITLDQWRKGSQWFEVDREMAIDII  297

Query  888   SDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHD  1067
             SD +YF LF+ YCK +CY+DEHYLPT   +R+   N NR+LTWVDWS GG HP R++R +
Sbjct  298   SDQKYFQLFKRYCKPACYSDEHYLPTVATMRYWWKNGNRTLTWVDWSKGGPHPTRFIRTE  357

Query  1068  VTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             VT   L  +R G KCEYNGE TN+CYLFARKF   +L RLLRFAPK+M+F
Sbjct  358   VTADLLNRMRNGTKCEYNGEPTNMCYLFARKFLPSTLDRLLRFAPKIMKF  407



>ref|XP_003532515.1| PREDICTED: uncharacterized protein LOC100782511 [Glycine max]
Length=390

 Score =   454 bits (1168),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 291/399 (73%), Gaps = 15/399 (4%)
 Frame = +3

Query  42    MKNQNHNNNP-PLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSY-FKSFSLNLQL  215
             MKN NH      L    ++++         S  L FA GL  G+   ++ FK+ SLN Q 
Sbjct  1     MKNNNHQQQERSLAAQSQMFSF------FFSHVLVFASGLLIGITLITFSFKNLSLNFQF  54

Query  216   ----ITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKI  383
                 + + +     +L      +T V    +   L+P + AMHDM++EELLWRASMVP I
Sbjct  55    HQLFLPSLSPHSDPILISALNNQTKVT---IHSILRPTKAAMHDMTEEELLWRASMVPMI  111

Query  384   KEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHG  563
             KE P++  PKVAFMFLT+G+V LAPLWE FF+GNE FYSIYVHS PS N++ P+ SVFHG
Sbjct  112   KELPYNHTPKVAFMFLTKGSVLLAPLWERFFKGNEAFYSIYVHSLPSFNDTVPQTSVFHG  171

Query  564   RRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTT  743
             RRIPS+EV+WGD N++ AERRLLANALLDFSNQ FVLLSESCIPLFNF TIY+YLMNST 
Sbjct  172   RRIPSKEVRWGDFNIVGAERRLLANALLDFSNQHFVLLSESCIPLFNFSTIYNYLMNSTK  231

Query  744   NFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYY  923
              F+E YD+PG+ GRGRY  RM P++ L QW+KGSQWF++DR LAI+++SD +YF LF  Y
Sbjct  232   TFVEAYDMPGAVGRGRYSPRMRPLVNLSQWKKGSQWFQIDRALAIDIVSDQQYFPLFNKY  291

Query  924   CKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTG  1103
             CK  CY DEHYLPTFV+IRF + NSNR+LT+VDWS GG+HPAR++R  VTV FL+ LR G
Sbjct  292   CKNRCYGDEHYLPTFVSIRFWKRNSNRTLTFVDWSRGGAHPARFMRQHVTVDFLKRLRHG  351

Query  1104  DKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
               C YNG+ TN+C+LFARKF   +L RLLRFAP++M+F+
Sbjct  352   RTCLYNGKTTNICHLFARKFMPQALDRLLRFAPRIMQFN  390



>gb|KHN21596.1| hypothetical protein glysoja_023448 [Glycine soja]
Length=376

 Score =   452 bits (1164),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 223/366 (61%), Positives = 276/366 (75%), Gaps = 18/366 (5%)
 Frame = +3

Query  126   LSAFLFFACGLTCGLIFSSY-FKSFSLNLQLITAAAADqplllpppqpERTPVAAVGLQE  302
             +S  L FA GL  G+  +++ FK+ SLN     +                 P++ +  Q 
Sbjct  28    VSHVLVFASGLLIGITLTTFSFKNLSLNFLPSLSTP--------------IPISTLNNQT  73

Query  303   FLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQG  482
              +     AMHDM++EELLWRASMVP IKE P+   PKVAFMFLT+G V L PLWE FF+G
Sbjct  74    QVT---KAMHDMTEEELLWRASMVPTIKEMPYKHTPKVAFMFLTKGPVLLGPLWERFFKG  130

Query  483   NEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQ  662
             NEGFYSIYVHS PS N++ P+ SVFH RRIPS+EV+WGD N++ AERRLLANALLDFSNQ
Sbjct  131   NEGFYSIYVHSHPSFNDTVPQSSVFHRRRIPSKEVRWGDFNIVGAERRLLANALLDFSNQ  190

Query  663   RFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKG  842
             RFVLLSESCIPLFNF TIY+YLMNST NF+E YD+PG+ GRGRY  RM P++ L QWRKG
Sbjct  191   RFVLLSESCIPLFNFSTIYNYLMNSTENFVEAYDMPGAVGRGRYSPRMRPLVNLSQWRKG  250

Query  843   SQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVD  1022
             SQWF++DR LAIE++SD +YF +F+ YC+  CY DEHYLPTFV+I F + NSNR+LTWVD
Sbjct  251   SQWFQIDRALAIEIVSDQQYFPVFKKYCRNGCYGDEHYLPTFVSIMFWKRNSNRTLTWVD  310

Query  1023  WSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAP  1202
             WS GG HPAR++R DVT+ FL+ LR G  C+YNG+ TN+C+LFARKF+   L RLLRFAP
Sbjct  311   WSRGGPHPARFMRQDVTIDFLKRLRHGRTCQYNGKSTNICHLFARKFNPQGLDRLLRFAP  370

Query  1203  KLMRFD  1220
             ++M+F+
Sbjct  371   RIMQFN  376



>ref|XP_010926004.1| PREDICTED: uncharacterized protein LOC105048408 [Elaeis guineensis]
Length=407

 Score =   453 bits (1165),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 223/313 (71%), Positives = 262/313 (84%), Gaps = 1/313 (0%)
 Frame = +3

Query  273   TPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTL  452
             T    VGL+ +++P E AMHDM+DEELLWRASMVP+IK YPF RVPKVAF+FLTR A+  
Sbjct  92    TASERVGLKGYVEPVE-AMHDMTDEELLWRASMVPRIKGYPFDRVPKVAFLFLTRKALHF  150

Query  453   APLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrll  632
             APLWE FFQG+EG YSIYVH+DPS NESAPEGSVFHGRR+PS+ VKWG ++M+EAERRLL
Sbjct  151   APLWEKFFQGHEGLYSIYVHADPSFNESAPEGSVFHGRRVPSKPVKWGQLSMMEAERRLL  210

Query  633   anallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSP  812
             ANALLDFSNQRFVLLSESCIPLFNFPTIYSYL+NST  ++  YD PG  GRGRY+ +M P
Sbjct  211   ANALLDFSNQRFVLLSESCIPLFNFPTIYSYLINSTKTYVSSYDDPGPNGRGRYRIKMRP  270

Query  813   VIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRG  992
              ++L+QWRKGSQWFE+DR+LAIE+ISD++YF +F+ YCK SCY DEHYL TFV+I F   
Sbjct  271   YLELQQWRKGSQWFEVDRNLAIEIISDEKYFPVFKKYCKPSCYVDEHYLSTFVSISFWGR  330

Query  993   NSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLH  1172
             N+NRSLTWVDWS GG HPAR+ R DVT+  LE LR G  C+YNG  TN+C+LFARKF  +
Sbjct  331   NANRSLTWVDWSKGGPHPARFGRLDVTIELLERLRNGSTCDYNGRTTNICFLFARKFLPN  390

Query  1173  SLTRLLRFAPKLM  1211
             SLTR LRFAPK+M
Sbjct  391   SLTRFLRFAPKVM  403



>ref|XP_007142937.1| hypothetical protein PHAVU_007G029800g [Phaseolus vulgaris]
 gb|ESW14931.1| hypothetical protein PHAVU_007G029800g [Phaseolus vulgaris]
Length=418

 Score =   453 bits (1166),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 241/422 (57%), Positives = 296/422 (70%), Gaps = 34/422 (8%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK QN  N  PL +  K +NA  + +  L+  L    G+T G+IFS Y K  + +LQ   
Sbjct  1     MKGQN--NQYPLNSVSKFFNAQFHFVRFLAYILILGFGITIGVIFSFYLKECNFSLQFTQ  58

Query  222   AAAAD------------------------------qplllpppqpERTPVAAVGLQEFLK  311
              + +                               +       + ++T  + VGL++FL+
Sbjct  59    LSLSSFPRTPTLPTPTTKPEISNQTQIQTQVQTQTEIQTQTQTEIQQTESSHVGLKDFLQ  118

Query  312   PPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEG  491
             PP + +HDM DEELLWRASM  KI +YPF RVPKVAFMFLTRG V LAPLWE FFQGNEG
Sbjct  119   PP-HVVHDMDDEELLWRASMTAKIPDYPFDRVPKVAFMFLTRGPVFLAPLWEKFFQGNEG  177

Query  492   FYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFV  671
              YSIYVHS+PS N S PE  VF GRRIPS+EV+WG+VNMIEAERRLLANALLD  NQRFV
Sbjct  178   LYSIYVHSNPSYNGSRPESPVFEGRRIPSKEVEWGNVNMIEAERRLLANALLDIQNQRFV  237

Query  672   LLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQW  851
             LLSESCIPLFNF TIY+YL+NST N +  +D P S GRGRY  +M P I + QWRKGSQW
Sbjct  238   LLSESCIPLFNFSTIYTYLINSTQNNVMAFDDPSSVGRGRYSIQMLPDISINQWRKGSQW  297

Query  852   FEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSH  1031
             FEMDR+LA+EV+SD +YF +FQ YCKGSCYADEHYLPT+V+I+F  GNSNRSLTWVDWS 
Sbjct  298   FEMDRELALEVVSDRKYFPVFQEYCKGSCYADEHYLPTYVSIKFWEGNSNRSLTWVDWSK  357

Query  1032  GGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLM  1211
             GG HPA++LR ++TV FLE+LR   KC+YNG+  NVC+LFARKF+  ++++L + AP +M
Sbjct  358   GGPHPAKFLRSEITVQFLESLRN-QKCKYNGDSINVCFLFARKFAPSTVSKLTKIAPMVM  416

Query  1212  RF  1217
              F
Sbjct  417   HF  418



>gb|KHN16548.1| hypothetical protein glysoja_002645 [Glycine soja]
Length=372

 Score =   451 bits (1161),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 225/369 (61%), Positives = 281/369 (76%), Gaps = 8/369 (2%)
 Frame = +3

Query  129   SAFLFFACGLTCGLIFSSY-FKSFSLNLQL----ITAAAADqplllpppqpERTPVAAVG  293
             S  L FA GL  G+   ++ FK+ SLN Q     + + +     +L      +T V    
Sbjct  7     SHVLVFASGLLIGITLITFSFKNLSLNFQFHQLFLPSLSPHSDPILISALNNQTKVT---  63

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             +   L+P + AMHDM++EELLWRASMVP IKE P++  PKVAFMFLT+G+V LAPLWE F
Sbjct  64    IHSILRPTKAAMHDMTEEELLWRASMVPMIKELPYNHTPKVAFMFLTKGSVLLAPLWERF  123

Query  474   FQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF  653
             F+GNE FYSIYVHS PS N++ P+ SVFHGRRIPS+EV+WGD N++ AERRLLANALLDF
Sbjct  124   FKGNEAFYSIYVHSLPSFNDTVPQTSVFHGRRIPSKEVRWGDFNIVGAERRLLANALLDF  183

Query  654   SNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQW  833
             SNQ FVLLSESCIPLFNF TIY+YLMNST  F+E YD+PG+ GRGRY  RM P++ L QW
Sbjct  184   SNQHFVLLSESCIPLFNFSTIYNYLMNSTKTFVEAYDMPGAVGRGRYSPRMRPLVNLSQW  243

Query  834   RKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             +KGSQWF++DR LAI+++SD +YF LF  YCK  CY DEHYLPTFV+I+F + NSNR+LT
Sbjct  244   KKGSQWFQIDRALAIDIVSDQQYFPLFNKYCKNRCYGDEHYLPTFVSIKFWKRNSNRTLT  303

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             +VDWS GG+HPAR++R  VTV FL+ LR G  C YNG+ TN+C+LFARKF   +L RLLR
Sbjct  304   FVDWSRGGAHPARFMRQHVTVDFLKRLRHGRTCLYNGKTTNICHLFARKFMPQALDRLLR  363

Query  1194  FAPKLMRFD  1220
             FAP++M+F+
Sbjct  364   FAPRIMQFN  372



>ref|XP_010066702.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104453777 
[Eucalyptus grandis]
Length=451

 Score =   454 bits (1168),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 288/392 (73%), Gaps = 7/392 (2%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL--  215
             MK+Q + N P   +  K + + L   N+LS  + F CGLT G++ + + ++ S NL    
Sbjct  1     MKSQQNQNLP--TSMFKPFYSHLQFTNVLSCIIIFGCGLTLGVVLTFHLQNLSFNLDFTR  58

Query  216   ITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYP  395
             +  +        PP      P   VGL E+LKP     HDM D+ELLWRASM P+I+EYP
Sbjct  59    LDFSPTQSLQPPPPAPQPAPPAIRVGLAEYLKPAP-VTHDMEDDELLWRASMSPRIREYP  117

Query  396   FSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIP  575
             F R PKVAF+FL +G V LAPLWE FF+G EG YS+YVHS+P  NE+ PE SVFHGRRIP
Sbjct  118   FERTPKVAFLFLAKGPVPLAPLWEKFFKGQEGLYSVYVHSNPPWNETEPEDSVFHGRRIP  177

Query  576   SQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIE  755
             S+ V WG+VNMIEAERRLLANALLD +N+RFVL+SE+CIPLFNF T+YSYL+NST  F++
Sbjct  178   SKGVSWGNVNMIEAERRLLANALLDVANERFVLVSETCIPLFNFSTVYSYLVNSTQTFVQ  237

Query  756   VYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGS  935
              YDLPG  GRGRY   MSP IK+  WRKG+QWFEMDR LAIEV+SD  YF LFQ +C+ +
Sbjct  238   SYDLPGPVGRGRYSSGMSPHIKIHHWRKGAQWFEMDRRLAIEVVSDRTYFPLFQRHCRHN  297

Query  936   CYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD--K  1109
             CYADEHYLPT VN++FG  NSNR+LTWVDWS GG HP R++R+++TV FLE LR G+  +
Sbjct  298   CYADEHYLPTLVNMKFGASNSNRTLTWVDWSKGGPHPNRFVRNEITVEFLERLRDGNGMR  357

Query  1110  CEYNGEETNVCYLFARKFSLHSLTRLLRFAPK  1205
             CEYNG+ T+VCYLFARKF   SL RLLRFAP+
Sbjct  358   CEYNGKATSVCYLFARKFLPSSLDRLLRFAPQ  389



>ref|XP_009413609.1| PREDICTED: uncharacterized protein LOC103994882 [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   452 bits (1163),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 230/358 (64%), Positives = 281/358 (78%), Gaps = 8/358 (2%)
 Frame = +3

Query  171   IFSSYF---KSFSLNL-QLITAAAADqplllpppqpERTPVAA--VGLQEFLKPPENAMH  332
             IFSS++     FSL++ QL+   +A     +    P R+  A   +GL+EF++P +  +H
Sbjct  40    IFSSFYLQTTPFSLSMAQLLLQPSAPSQSAVSASSPPRSVSAKPRIGLKEFVEP-DVILH  98

Query  333   DMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVH  512
             DM+DEELLWRASM+PKI++ PFSR PKVAF+FLT+G + LAPLWE FF+GNEGFYSIYVH
Sbjct  99    DMTDEELLWRASMIPKIQKRPFSRPPKVAFLFLTKGHLPLAPLWEKFFEGNEGFYSIYVH  158

Query  513   SDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCI  692
             + P  N SAP+GSVFHGRR+PS+ V+WG +NM+EAERRLLANALLD SNQRFVLLSE+CI
Sbjct  159   ASP-LNGSAPKGSVFHGRRVPSKAVQWGGMNMMEAERRLLANALLDVSNQRFVLLSEACI  217

Query  693   PLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDL  872
             PLFNFPTIYSYL+NST  +++ YDLPG TGRGRY  +M P++KL QWRKGSQWFE+DR L
Sbjct  218   PLFNFPTIYSYLINSTKIYVQAYDLPGPTGRGRYMKKMKPLLKLEQWRKGSQWFEVDRSL  277

Query  873   AIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPAR  1052
             AIEVISDD YF LFQ +C  SC+ADEHYL T V++RF    +NRSLTWVDWS GG HPAR
Sbjct  278   AIEVISDDEYFPLFQRHCTSSCFADEHYLATHVSVRFPGRTANRSLTWVDWSKGGPHPAR  337

Query  1053  YLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDEK  1226
             +LR DVTV  LE +R G  C YNG  T +C+LFARKF  +SL RL+RFAPKLM F ++
Sbjct  338   FLRRDVTVELLERMRNGSSCRYNGRSTRICFLFARKFLPNSLVRLMRFAPKLMDFKQR  395



>ref|XP_008243270.1| PREDICTED: uncharacterized protein LOC103341513 [Prunus mume]
Length=398

 Score =   452 bits (1162),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 247/402 (61%), Positives = 290/402 (72%), Gaps = 12/402 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI-  218
             MK QN N   PL    KL+NA L+++ LL  FL F  GLT G++ S Y K  S++LQL  
Sbjct  1     MKGQNQN---PLNLFSKLFNAQLHILKLLFYFLLFGGGLTLGMVLSFYMKDISISLQLAQ  57

Query  219   -------TAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVP  377
                    + +     +              +GL+E+LKPP N +HDM D+ELLWRASM+P
Sbjct  58    FSFSTSQSPSNQHTLMPNVKAFEANGTKPHIGLKEYLKPP-NVLHDMDDQELLWRASMIP  116

Query  378   KIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVF  557
             +I EYPF RVPKVAFMFLT+G V LAPLWE FF+G++G YSIYVHS+PS N S PE  VF
Sbjct  117   RITEYPFRRVPKVAFMFLTKGPVLLAPLWEKFFKGHQGLYSIYVHSNPSYNGSYPESPVF  176

Query  558   HGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNS  737
               RRIPS+EV WG+VNMIEAERRLLANALLD SN+RFVLLSESCIPL NF T+YSYL++S
Sbjct  177   RDRRIPSREVGWGNVNMIEAERRLLANALLDISNERFVLLSESCIPLHNFSTVYSYLVHS  236

Query  738   TTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQ  917
               +F++VYD P S GRGRY   M P I L QWRKGSQWFEM R  AI+++SD +YF  FQ
Sbjct  237   RESFVQVYDDPSSVGRGRYNSHMYPKISLSQWRKGSQWFEMHRRHAIDIVSDKKYFPAFQ  296

Query  918   YYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR  1097
              YC+GSCYADEHYLPTF NI FG  NSNRSLTWVDWS GG HPA++ R DVTV  L  LR
Sbjct  297   KYCRGSCYADEHYLPTFANINFGAKNSNRSLTWVDWSRGGPHPAKFTRTDVTVEVLSRLR  356

Query  1098  TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
              G  C YNG+ TNVC+LFARKF   +L RLLRFAPKLMRF+ 
Sbjct  357   NGTACVYNGKSTNVCFLFARKFGPDTLERLLRFAPKLMRFNR  398



>ref|XP_003524367.1| PREDICTED: uncharacterized protein LOC100815747 [Glycine max]
Length=376

 Score =   450 bits (1158),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 222/366 (61%), Positives = 275/366 (75%), Gaps = 18/366 (5%)
 Frame = +3

Query  126   LSAFLFFACGLTCGLIFSSY-FKSFSLNLQLITAAAADqplllpppqpERTPVAAVGLQE  302
             +S  L FA GL  G+  +++ FK+ SLN     +                 P++ +  Q 
Sbjct  28    VSHVLVFASGLLIGITLTTFSFKNLSLNFLPSLSTP--------------IPISTLNNQT  73

Query  303   FLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQG  482
              +     AMHDM++EELLWRASMVP IKE P+   PKVAFMFLT+G V L PLWE FF+G
Sbjct  74    QVT---KAMHDMTEEELLWRASMVPTIKEMPYKHTPKVAFMFLTKGPVLLGPLWERFFKG  130

Query  483   NEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQ  662
             NEGFYSIYVHS PS N++ P+ SVFH RRIPS+EV+WGD N++ AERRLLANALLDFSNQ
Sbjct  131   NEGFYSIYVHSHPSFNDTVPQSSVFHRRRIPSKEVRWGDFNIVGAERRLLANALLDFSNQ  190

Query  663   RFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKG  842
             RFVLLSESCIPLFNF TIY+YLMNST  F+E YD+PG+ GRGRY  RM P++ L QWRKG
Sbjct  191   RFVLLSESCIPLFNFSTIYNYLMNSTETFVEAYDMPGAVGRGRYSPRMRPLVNLSQWRKG  250

Query  843   SQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVD  1022
             SQWF++DR LAIE++SD +YF +F+ YC+  CY DEHYLPTFV+I F + NSNR+LTWVD
Sbjct  251   SQWFQIDRALAIEIVSDQQYFPVFKKYCRNGCYGDEHYLPTFVSIMFWKRNSNRTLTWVD  310

Query  1023  WSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAP  1202
             WS GG HPAR++R DVT+ FL+ LR G  C+YNG+ TN+C+LFARKF+   L RLLRFAP
Sbjct  311   WSRGGPHPARFMRQDVTIDFLKRLRHGRTCQYNGKSTNICHLFARKFNPQGLDRLLRFAP  370

Query  1203  KLMRFD  1220
             ++M+F+
Sbjct  371   RIMQFN  376



>ref|XP_008374777.1| PREDICTED: uncharacterized protein LOC103438016 [Malus domestica]
Length=410

 Score =   451 bits (1161),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 226/411 (55%), Positives = 290/411 (71%), Gaps = 19/411 (5%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSF--------  197
             MK     ++PP        NA ++L  ++S FL FA GL  G   + Y K F        
Sbjct  1     MKTTQQQHHPPPSFPKHFLNAQIHLHKMISNFLIFAFGLALGASLNIYLKDFPFQLYSTQ  60

Query  198   ------SLNLQLITAAAADqplllpppqpERT----PVAAVGLQEFLKPPENAMHDMSDE  347
                   S N    ++               +T    P   +GL+E+ K P N +H+M D+
Sbjct  61    NKYSHLSTNNPSSSSPPPQSLNXPTNQTKAKTSAAGPAPPIGLKEYTKSP-NILHEMDDD  119

Query  348   ELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSC  527
             ELLWRAS+VP+ +  PF R PKVAFMFLTRG + LAPLWEMFF+G+EG YS+YVH++P  
Sbjct  120   ELLWRASLVPRRRGLPFKRTPKVAFMFLTRGRLALAPLWEMFFKGHEGMYSVYVHANPDF  179

Query  528   NESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNF  707
             N++ PE SVF+GRR+PS+ V WG+ NM++AERRLLANALLDFSNQRFVLLSESCIPLFNF
Sbjct  180   NDTMPENSVFYGRRVPSKNVTWGEPNMVQAERRLLANALLDFSNQRFVLLSESCIPLFNF  239

Query  708   PTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVI  887
               +YSYLM+S   F+E YDLPG  GR RY+ +M P I L +WRKGSQWFE+DR++A EV+
Sbjct  240   NVVYSYLMDSNQTFVEAYDLPGPVGRERYRDKMRPQITLDKWRKGSQWFEVDREIATEVV  299

Query  888   SDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHD  1067
             SD++YF +F  YC  SCY+DEHYLPT+V+I+F + NSNR+LTWVDWS GG HP++++R D
Sbjct  300   SDEKYFPVFTKYCTPSCYSDEHYLPTYVSIKFWKKNSNRTLTWVDWSKGGPHPSKFMRTD  359

Query  1068  VTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             VT+ FL+ LR G KCEYNG+ TN+CYLFARKF  +SL RLLRFAPK+M+F+
Sbjct  360   VTIDFLKKLRHGSKCEYNGKRTNICYLFARKFLPNSLDRLLRFAPKIMKFN  410



>emb|CBI15481.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   449 bits (1156),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 275/360 (76%), Gaps = 11/360 (3%)
 Frame = +3

Query  156   LTCGLIFSSYFKSFSLNLQL----ITAAAADqplllpppqpERTPVAAVGLQEFLKPPEN  323
             L  GLI S     FSLN+QL    +         L  P   E   +  +GL+E+LKPP+ 
Sbjct  12    LAIGLIIS-----FSLNIQLKQFFVPTPDQTTSPLPIPIANETKKINRIGLKEYLKPPKV  66

Query  324   AMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSI  503
             A HDM+DEELLWRASMVP++  +PF RVPKVAF+FLTRG + LAP WE+FF+G+EG YSI
Sbjct  67    A-HDMTDEELLWRASMVPRVGGFPFKRVPKVAFLFLTRGPLPLAPFWELFFKGHEGRYSI  125

Query  504   YVHSDPSCNES-APEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             YVHS PS N +  P+ SVFHGRRIPS+EV+WG  NM+EAERRLLANALLD SNQRFVLLS
Sbjct  126   YVHSHPSFNATLVPQSSVFHGRRIPSKEVQWGKFNMVEAERRLLANALLDISNQRFVLLS  185

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIPL+NF TIYSYLM S  +F+E YDLPG  GRGRY  RM P+IK+ QWRKGSQWFEM
Sbjct  186   ESCIPLYNFSTIYSYLMGSKKSFVESYDLPGPVGRGRYNPRMKPLIKMEQWRKGSQWFEM  245

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
             DR LAI+VISD +YF +FQ +C   CYADEHYLPT V+++F R NSNRSLTWVDWSHGG+
Sbjct  246   DRGLAIQVISDRKYFPVFQKFCTPPCYADEHYLPTLVSVKFWRRNSNRSLTWVDWSHGGA  305

Query  1041  HPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             HPAR+ R  VTV FL+ LR G  C YNG+ +N C++FARKF  ++L RLLRF PKLM+F+
Sbjct  306   HPARFWRVAVTVDFLKKLRNGSHCHYNGKSSNTCFMFARKFLPNALDRLLRFGPKLMKFN  365



>ref|XP_007160392.1| hypothetical protein PHAVU_002G318000g [Phaseolus vulgaris]
 gb|ESW32386.1| hypothetical protein PHAVU_002G318000g [Phaseolus vulgaris]
Length=397

 Score =   451 bits (1159),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 283/389 (73%), Gaps = 9/389 (2%)
 Frame = +3

Query  78    LTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSY-FKSFSLNLQL----ITAAAADqp  242
             L +    N   +L N+ S  L FA GL  G+   ++  KSFSLN Q     + +  A   
Sbjct  10    LAAANFLNTQSHLFNIFSHVLAFASGLFIGITIITFSLKSFSLNFQFHHLSLPSLPAPPS  69

Query  243   lllpppqpERTPVAAVGLQE---FLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPK  413
                       T V      E   FL+P   AMH M++EELLWRASMVP+I+E P+ + PK
Sbjct  70    SASISTSHNETKVTIFTPNESRGFLRP-TMAMHGMTEEELLWRASMVPRIEELPYKQTPK  128

Query  414   VAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKW  593
             VAFMFLT+G V L PLWE FF+GNEGFYSIYVHS PS N++ P+ SVF+GRRIPS+E +W
Sbjct  129   VAFMFLTKGPVFLGPLWERFFKGNEGFYSIYVHSHPSFNDTLPQSSVFYGRRIPSKEARW  188

Query  594   GDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPG  773
             G+ N++ AERRLLANALLDFSNQRFVLLSESCIPLFNF T+YSYLMNST  F+E YDLPG
Sbjct  189   GEFNIVGAERRLLANALLDFSNQRFVLLSESCIPLFNFSTVYSYLMNSTKTFVEAYDLPG  248

Query  774   STGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEH  953
             + GRGRY  RM P+++L QWRKGSQWF++DR LA E++SD  YF LF  +CK  CY DEH
Sbjct  249   AVGRGRYSPRMRPLVRLSQWRKGSQWFQIDRALATEIVSDQLYFPLFNKHCKNGCYGDEH  308

Query  954   YLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEET  1133
             YLPTFV+I+F + NS+R+LTWVDWS GG HP R++R +VT+ FL+ LR G  C+YNG+ T
Sbjct  309   YLPTFVSIKFWQNNSDRTLTWVDWSKGGPHPTRFMRRNVTIEFLKRLRHGRTCQYNGKST  368

Query  1134  NVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             N+C+LFARKF   +L RLLRFAP++M+F+
Sbjct  369   NICHLFARKFMPQALDRLLRFAPQIMQFN  397



>ref|XP_003555913.1| PREDICTED: uncharacterized protein LOC100779041 [Glycine max]
 gb|KHN11397.1| hypothetical protein glysoja_015292 [Glycine soja]
Length=421

 Score =   451 bits (1161),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 245/425 (58%), Positives = 294/425 (69%), Gaps = 37/425 (9%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK QN  N   L +  K +NA  + I  LS  L    G++ G+IFS Y K  + +LQ   
Sbjct  1     MKGQN--NQYSLNSVSKFFNAQFHFIQFLSYILILGFGISIGVIFSFYLKDCNFSLQFTQ  58

Query  222   AAAADqplllpppqpERTPVAA---------------------------------VGLQE  302
              + +  P   P P     P  +                                 VGL+E
Sbjct  59    LSLSSFPRTPPLPPTTAKPEISNQTQTQTQSQIQTQTQMQTQTQIETQTQIENSHVGLKE  118

Query  303   FLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQG  482
             FLKPP   +HDM DEELLWRAS+  KI +YPF RVPKVAF+FLTRG V LAPLWE FF+G
Sbjct  119   FLKPPP-VVHDMDDEELLWRASVTAKIPDYPFDRVPKVAFLFLTRGPVFLAPLWEQFFKG  177

Query  483   NEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQ  662
             +EGFYSIYVHS+PS N S PE  VF GRRIPS+EV+WG+VNMIEAERRLLANALLD SNQ
Sbjct  178   HEGFYSIYVHSNPSYNGSRPESPVFKGRRIPSKEVEWGNVNMIEAERRLLANALLDISNQ  237

Query  663   RFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKG  842
             RFVLLSESCIPLFNF TIY+YLMNST N++  +D P S GRGRY  +M P I + QWRKG
Sbjct  238   RFVLLSESCIPLFNFSTIYTYLMNSTQNYVMAFDDPSSVGRGRYSIQMLPKISVNQWRKG  297

Query  843   SQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVD  1022
             SQWFEMDR+LA EV+SD +YF +FQ YCKGSCYADEHYLPT+V+I+F  GNSNRSLTWVD
Sbjct  298   SQWFEMDRELAQEVVSDKKYFPVFQEYCKGSCYADEHYLPTYVSIKFWEGNSNRSLTWVD  357

Query  1023  WSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAP  1202
             WS GG HP ++LR ++TV FLE+LR   KCEYNG+  NVC+LFARKF+  ++++L + AP
Sbjct  358   WSKGGPHPTKFLRSEITVKFLESLR-DQKCEYNGDSINVCFLFARKFAPSTVSKLTKIAP  416

Query  1203  KLMRF  1217
              +M F
Sbjct  417   MVMHF  421



>ref|XP_009360137.1| PREDICTED: uncharacterized protein LOC103950632 [Pyrus x bretschneideri]
 ref|XP_009345486.1| PREDICTED: uncharacterized protein LOC103937283 [Pyrus x bretschneideri]
Length=429

 Score =   451 bits (1160),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/430 (54%), Positives = 294/430 (68%), Gaps = 38/430 (9%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNL----  209
             M N++  + PP        NA ++L  ++S+FL FA GL  G   S Y K F   L    
Sbjct  1     MMNKHQQHQPPPSFPKHFLNAQIHLHKIVSSFLIFAFGLALGASLSIYLKDFPFQLYSTQ  60

Query  210   --------QLITAAAADqplllpppqpERT-------------------------PVAAV  290
                       +T ++   P  L  P   RT                         PV  +
Sbjct  61    NKYSHLSTNNLTFSSPPPPQSLNIPTNNRTSSSPPPPQSLNIPTNQTRAKTSAASPVPPI  120

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL+E+ K P N +H+M D+ELLWRAS+VP  +  PF R PKVAFMFLTRG++ +APLWEM
Sbjct  121   GLKEYTKSP-NILHEMDDDELLWRASLVPLRQGLPFKRTPKVAFMFLTRGSLAMAPLWEM  179

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+EG YSIYVH++P  N++ PE SVF+GRR+PS+ V WG  NM++AERRLLANALLD
Sbjct  180   FFKGHEGLYSIYVHANPDFNDTMPENSVFYGRRVPSKNVTWGQPNMVQAERRLLANALLD  239

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
             FSNQRFVLLSESCIPLFNF  +Y+YL +S   F+E YDLPG  GR RY+H+M P I L Q
Sbjct  240   FSNQRFVLLSESCIPLFNFNIVYNYLKDSNQTFVEAYDLPGPVGRDRYRHKMRPHIILDQ  299

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGSQWFE+DR++A  ++SDD+YF LF  YCK  CY+DEHYLPT+V+I+F + NSNR+L
Sbjct  300   WRKGSQWFEVDREIATAMVSDDKYFPLFTRYCKPPCYSDEHYLPTYVSIKFWKKNSNRTL  359

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLL  1190
             TWVDWS GG HP++++R DVT+ FL+ LR G  CEYNG+ TN+CYLFARKF  HSL RLL
Sbjct  360   TWVDWSRGGPHPSKFMRTDVTIDFLKKLRHGSNCEYNGKPTNICYLFARKFLPHSLDRLL  419

Query  1191  RFAPKLMRFD  1220
             RFAPK+MRF+
Sbjct  420   RFAPKIMRFN  429



>ref|XP_009763003.1| PREDICTED: uncharacterized protein LOC104214963 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   450 bits (1158),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 226/411 (55%), Positives = 289/411 (70%), Gaps = 22/411 (5%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQ---  212
             MKN+ +N    L ++ KL+ +   L NL++ F+ F  GL  G+  S Y K     LQ   
Sbjct  1     MKNEQNNQ---LFSTTKLFCSQRYLHNLVAYFILFGSGLIIGISLSFYLKDLPNTLQNKL  57

Query  213   ---------------LITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDE  347
                            + ++      L       E   +  +GL+++LKPP++  HDM DE
Sbjct  58    FYPQSPPQQPTYTPIITSSPQIPLVLNDNSINSETKSLGRIGLRDYLKPPKSCKHDMKDE  117

Query  348   ELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSC  527
             EL+WRASMVP+++  PF R PK+AFMFLTRG++ LAPLWE FF+G EG YSIY+HS PS 
Sbjct  118   ELIWRASMVPRVRVLPFKRTPKIAFMFLTRGSLPLAPLWERFFRGYEGLYSIYIHSQPSF  177

Query  528   NESAP-EGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFN  704
             N +AP EG +FHGRRIPS+ V+WG  NM+EAERRLLANALLD SN+RFVLLSESCIPL+N
Sbjct  178   NGNAPEEGPIFHGRRIPSKRVEWGKFNMVEAERRLLANALLDLSNERFVLLSESCIPLYN  237

Query  705   FPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEV  884
             F TIY+Y+MNST  F+E YDLP   GRGRY  +M P I L QWRKGSQWFE+DR++AI++
Sbjct  238   FTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMQPWITLDQWRKGSQWFEVDREIAIDI  297

Query  885   ISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRH  1064
             I+D +YF LF+ YCK +CY+DEHYLPTFV +R+   N NR+LTWVDW+ GG HP R++R 
Sbjct  298   ITDQKYFQLFKRYCKPACYSDEHYLPTFVTMRYWWKNGNRTLTWVDWTKGGPHPTRFIRT  357

Query  1065  DVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             DVT   L  +R G +CEYNG+ TN+CYLFARKF   +L RLLRFAPK+M+F
Sbjct  358   DVTADLLNRMRNGTQCEYNGDPTNMCYLFARKFLPSTLDRLLRFAPKIMKF  408



>ref|XP_010916432.1| PREDICTED: uncharacterized protein LOC105041249 [Elaeis guineensis]
Length=399

 Score =   449 bits (1155),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/374 (62%), Positives = 282/374 (75%), Gaps = 10/374 (3%)
 Frame = +3

Query  126   LSAFLFFACGLTCGLIFSSYFKSFSLNLQ-------LITAAAADqplllpppqpERTPVA  284
             LS FL F  GL  G I S Y K+    LQ           +    P    P  P  T VA
Sbjct  26    LSNFLLFGLGLAVGFISSFYLKAIPFPLQASKISFLSSPPSPVLPPPSPQPVVPNVTSVA  85

Query  285   A--VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAP  458
                VGL+ +++P +  MHDM+DEELLWRASMVP+IK +P+ RVPKVAF+FLTRG +  +P
Sbjct  86    KERVGLKGYVEPIK-VMHDMTDEELLWRASMVPRIKSHPYRRVPKVAFLFLTRGPLAFSP  144

Query  459   LWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllan  638
             LWEMFF+G+EGFYSIYVH+DPS NESAPEGSVFHGRR+PS+ VKWG ++M+EAERRLLAN
Sbjct  145   LWEMFFKGHEGFYSIYVHADPSFNESAPEGSVFHGRRVPSKVVKWGQLSMMEAERRLLAN  204

Query  639   allDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVI  818
             ALLD+SNQRF+LLSESCIPLFNF TIYSYL+NST  ++  YD PG  GRGRY  RM P +
Sbjct  205   ALLDYSNQRFILLSESCIPLFNFSTIYSYLINSTQTYVSSYDDPGPNGRGRYNIRMKPRV  264

Query  819   KLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNS  998
             KL++WRKGSQWFE+DR LAIE+ISD++YF +F+ YC+ SCY DEHYL TFV++RF   N+
Sbjct  265   KLQEWRKGSQWFEVDRALAIEIISDEKYFPVFKKYCRPSCYVDEHYLSTFVSMRFWWRNA  324

Query  999   NRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSL  1178
             NRSLTWVDWS GG HPAR+ R DVT   LE +R G  C YNG  T+VC+LFARKF  +SL
Sbjct  325   NRSLTWVDWSKGGPHPARFGRLDVTTELLERMRNGSTCNYNGRTTSVCFLFARKFLPNSL  384

Query  1179  TRLLRFAPKLMRFD  1220
             TRL+RFAP+++ F 
Sbjct  385   TRLMRFAPRVLGFQ  398



>ref|XP_008393326.1| PREDICTED: uncharacterized protein LOC103455513 [Malus domestica]
Length=430

 Score =   450 bits (1157),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 232/431 (54%), Positives = 296/431 (69%), Gaps = 39/431 (9%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNL----  209
             M N++  ++PP        NA ++L  ++S+FL FA GL  G   S Y K F   L    
Sbjct  1     MMNKHQQHHPPPSFPKHFLNAQIHLHKIVSSFLIFAFGLALGASLSIYLKDFPFQLYSTQ  60

Query  210   --------QLITAAAADqplllpppqpERT--------------------------PVAA  287
                       +T ++   P  L  P   RT                          PV  
Sbjct  61    NKYSHLSTNNLTFSSPPPPQSLNIPTNNRTSSSPPPPPQSLNIPTNQTRAKTSAASPVPP  120

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             +GL+E+ K P N +H+M D+ELLWRAS+VP  +  PF R PKVAFMFLTRG++ +APLWE
Sbjct  121   IGLKEYTKSP-NILHEMDDDELLWRASLVPLRRGLPFKRTPKVAFMFLTRGSLAMAPLWE  179

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
             MFF+G+EG YSIYVH++P  N++ PE SVF+GRR+PS+ V WG  NM++AERRLLANALL
Sbjct  180   MFFKGHEGLYSIYVHANPDFNDTIPENSVFYGRRVPSKNVTWGQPNMVQAERRLLANALL  239

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DFSNQRFVLLSESCIPLFNF  +Y+YLM+S   F+E YDLPG  GR RY+H+M P I L 
Sbjct  240   DFSNQRFVLLSESCIPLFNFNXVYNYLMDSNQTFVEAYDLPGPVGRDRYRHKMRPHIILD  299

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
             QWRKGSQWFE+DR++A  ++SD++YF LF  YCK  CY+DEHYLPT+V+I+F + NSNR+
Sbjct  300   QWRKGSQWFEVDREIATAMVSDEKYFPLFTRYCKPPCYSDEHYLPTYVSIKFWKKNSNRT  359

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             LTWVDWS GG HP++++R DVT+ FL+ LR G  CEYNG+ TN+C+LFARKF  HSL RL
Sbjct  360   LTWVDWSRGGPHPSKFMRTDVTIDFLKKLRHGSNCEYNGKPTNICFLFARKFLPHSLDRL  419

Query  1188  LRFAPKLMRFD  1220
             LRFAPK+MRF+
Sbjct  420   LRFAPKIMRFN  430



>ref|XP_003620433.1| hypothetical protein MTR_6g083830 [Medicago truncatula]
Length=418

 Score =   448 bits (1153),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 233/419 (56%), Positives = 290/419 (69%), Gaps = 27/419 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKS---------  194
             MKN  H      L  +K +NA L  IN     L F  GL  G+  +   K+         
Sbjct  1     MKNNKHQQGTIALPYLKFFNAQLYFINFFGHILVFGLGLLIGITLTFCLKNVSFNFQFQQ  60

Query  195   -----FSLNLQL-----------ITAAAADqplllpppqpERTPVAAVGLQEFLKPPENA  326
                  FS N              ++  + D          +   + + GL+EFLK P  A
Sbjct  61    FQDPPFSFNPSSHFSHSPPISSNLSNPSNDHNQTNISINEKSLVITSNGLEEFLKIPM-A  119

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             MHDM++EEL WRASM+P I + PF ++PKVAFMFLT+G V LAPLWE FF+GNEG YSIY
Sbjct  120   MHDMNEEELFWRASMIPMIHKPPFKQIPKVAFMFLTKGHVLLAPLWEKFFKGNEGLYSIY  179

Query  507   VHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSE  683
             +H +PS NE+   + SVFHGRRIPS+EVKWG+ +MIEAERRLLANALLDFSNQRFVLLSE
Sbjct  180   IHPNPSFNETVYDQSSVFHGRRIPSKEVKWGENSMIEAERRLLANALLDFSNQRFVLLSE  239

Query  684   SCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMD  863
             SCIPLFNF TIY+YLMNS   F+E YDL G+ GRGRY ++MSP+IKL QWRKGSQWF++D
Sbjct  240   SCIPLFNFSTIYTYLMNSEKTFVEAYDLEGAVGRGRYNYKMSPLIKLSQWRKGSQWFQID  299

Query  864   RDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSH  1043
             R LA+ ++SD  YFS+F+ YC   CY+DEHY+PT V+I+F + NSNR+LTWVDWS GG H
Sbjct  300   RSLALHIVSDKLYFSMFKNYCDPPCYSDEHYMPTMVSIKFWKRNSNRTLTWVDWSKGGPH  359

Query  1044  PARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             P+++ R  +T+ FLE LR G  CEYNG+  NVC+LFARKF+ H+L RLLRFAPKLM+F+
Sbjct  360   PSKFFRQHLTIDFLERLRFGSTCEYNGKTINVCHLFARKFTPHALDRLLRFAPKLMQFN  418



>gb|AES76651.2| core-2/I-branching enzyme [Medicago truncatula]
Length=420

 Score =   448 bits (1153),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 233/419 (56%), Positives = 290/419 (69%), Gaps = 27/419 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKS---------  194
             MKN  H      L  +K +NA L  IN     L F  GL  G+  +   K+         
Sbjct  3     MKNNKHQQGTIALPYLKFFNAQLYFINFFGHILVFGLGLLIGITLTFCLKNVSFNFQFQQ  62

Query  195   -----FSLNLQL-----------ITAAAADqplllpppqpERTPVAAVGLQEFLKPPENA  326
                  FS N              ++  + D          +   + + GL+EFLK P  A
Sbjct  63    FQDPPFSFNPSSHFSHSPPISSNLSNPSNDHNQTNISINEKSLVITSNGLEEFLKIPM-A  121

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             MHDM++EEL WRASM+P I + PF ++PKVAFMFLT+G V LAPLWE FF+GNEG YSIY
Sbjct  122   MHDMNEEELFWRASMIPMIHKPPFKQIPKVAFMFLTKGHVLLAPLWEKFFKGNEGLYSIY  181

Query  507   VHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSE  683
             +H +PS NE+   + SVFHGRRIPS+EVKWG+ +MIEAERRLLANALLDFSNQRFVLLSE
Sbjct  182   IHPNPSFNETVYDQSSVFHGRRIPSKEVKWGENSMIEAERRLLANALLDFSNQRFVLLSE  241

Query  684   SCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMD  863
             SCIPLFNF TIY+YLMNS   F+E YDL G+ GRGRY ++MSP+IKL QWRKGSQWF++D
Sbjct  242   SCIPLFNFSTIYTYLMNSEKTFVEAYDLEGAVGRGRYNYKMSPLIKLSQWRKGSQWFQID  301

Query  864   RDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSH  1043
             R LA+ ++SD  YFS+F+ YC   CY+DEHY+PT V+I+F + NSNR+LTWVDWS GG H
Sbjct  302   RSLALHIVSDKLYFSMFKNYCDPPCYSDEHYMPTMVSIKFWKRNSNRTLTWVDWSKGGPH  361

Query  1044  PARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             P+++ R  +T+ FLE LR G  CEYNG+  NVC+LFARKF+ H+L RLLRFAPKLM+F+
Sbjct  362   PSKFFRQHLTIDFLERLRFGSTCEYNGKTINVCHLFARKFTPHALDRLLRFAPKLMQFN  420



>ref|XP_003533360.1| PREDICTED: uncharacterized protein LOC100803748 [Glycine max]
 gb|KHN42531.1| hypothetical protein glysoja_047605 [Glycine soja]
Length=451

 Score =   448 bits (1153),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/312 (71%), Positives = 257/312 (82%), Gaps = 2/312 (1%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRV-PKVAFMFLTRGAVTLAPLW  464
             VGL+EFLKPP  AMHDMSDEELLWRASMVP + + PF +   KVAFMFLT+G V LAPLW
Sbjct  141   VGLREFLKPPM-AMHDMSDEELLWRASMVPMVHKLPFKQTTAKVAFMFLTKGPVLLAPLW  199

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             E FF+GNE  YSIYVHS+PS NE+ PE SVFHGR IPSQEV+WG+ +MIEAERRLLANAL
Sbjct  200   ERFFKGNERLYSIYVHSNPSFNETVPESSVFHGRNIPSQEVRWGENSMIEAERRLLANAL  259

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LDFSNQRFVL+SESCIPLFNF TIY+YLMNST  F+E YDLPG  GRGRY   M P I+L
Sbjct  260   LDFSNQRFVLVSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGRGRYTPHMRPHIRL  319

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKGSQWF++DR LA+++ISD +YF +F+ YC  SC  DEHYLPTFV+I+F + NSNR
Sbjct  320   SQWRKGSQWFQIDRYLALQIISDHQYFPVFKKYCNPSCSCDEHYLPTFVSIKFWKRNSNR  379

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             +LTWVDWS GG HP+RY R DVT+ FL  LR G  CEYNG  TN+C+LFARKF+ H+L R
Sbjct  380   TLTWVDWSRGGPHPSRYFRTDVTIEFLNKLRYGSSCEYNGRTTNICHLFARKFTPHALDR  439

Query  1185  LLRFAPKLMRFD  1220
             LLRFAPK+M+F+
Sbjct  440   LLRFAPKIMQFN  451



>ref|XP_008240316.1| PREDICTED: uncharacterized protein LOC103338837 [Prunus mume]
Length=411

 Score =   447 bits (1149),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 257/315 (82%), Gaps = 1/315 (0%)
 Frame = +3

Query  276   PVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLA  455
             P   +GL+E+ KPP N MHDM D ELLWRAS+VP+    PF R PKVAFMFLTRG + LA
Sbjct  98    PPPPIGLKEYTKPP-NIMHDMDDAELLWRASLVPRRPGLPFKRTPKVAFMFLTRGPLALA  156

Query  456   PLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             P WEMFF+G+EG YSIYVH++P  N++ P+ SVF+GRR+PS+ V WG+ NM++AERRLLA
Sbjct  157   PFWEMFFKGHEGLYSIYVHANPDFNDTMPQNSVFYGRRVPSKNVTWGEPNMVQAERRLLA  216

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSNQRFVLLSESCIPLFNF  IY+YLM ST  F+EVYDLPG  GR RY+ +MSP 
Sbjct  217   NALLDFSNQRFVLLSESCIPLFNFSVIYNYLMGSTQTFVEVYDLPGPVGRDRYRPKMSPQ  276

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             I L QWRKGSQWFE+DR +A+E++SD +YF LF  YCK SCY+DEHYLPT+VNI+F   N
Sbjct  277   ITLGQWRKGSQWFEVDRVIAVEMVSDQKYFPLFTKYCKPSCYSDEHYLPTYVNIKFRNKN  336

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHS  1175
             SNR+LTWVDWS GG HP++++R DVTV FLE LR G KCEYNG+ T+VC+LFARKF  ++
Sbjct  337   SNRTLTWVDWSRGGPHPSKFMRTDVTVEFLEKLRHGTKCEYNGKSTDVCHLFARKFLPNT  396

Query  1176  LTRLLRFAPKLMRFD  1220
             L RLLRF PKLM+F+
Sbjct  397   LDRLLRFGPKLMKFN  411



>ref|XP_008812373.1| PREDICTED: uncharacterized protein LOC103723273 [Phoenix dactylifera]
Length=406

 Score =   446 bits (1148),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 235/377 (62%), Positives = 280/377 (74%), Gaps = 16/377 (4%)
 Frame = +3

Query  135   FLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA---------  287
             FL F  GL  G I S Y K+    L+  T +    P   PPP P                
Sbjct  30    FLVFGLGLALGYISSFYLKTIPFPLRTSTISFISSPPSPPPPPPPLQLPPPSPQPILNLT  89

Query  288   ------VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
                   VGL  +++P E AMHDM+DEELLWRASMVP+IK +PF RVPKVAF+FLTRG + 
Sbjct  90    FMANERVGLNGYVEPIE-AMHDMTDEELLWRASMVPRIKNHPFHRVPKVAFLFLTRGPLA  148

Query  450   LAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrl  629
              +PLWE FF+G+EG Y+IYVH+DPS NESAPEGSVFHGRR+PS+ VKWG ++M+EAERRL
Sbjct  149   FSPLWEKFFKGHEGLYTIYVHADPSFNESAPEGSVFHGRRVPSKVVKWGQLSMMEAERRL  208

Query  630   lanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMS  809
             LANALLDFSNQRF+LLSESCIPLFNF TIYSYL+NST  ++  +D  G  GRGRY  RM 
Sbjct  209   LANALLDFSNQRFILLSESCIPLFNFSTIYSYLINSTKTYVSSFDDRGPNGRGRYNIRMK  268

Query  810   PVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGR  989
             P +KL++WRKGSQW E+DRDLAIE+ISD++YF +F+ YCK SCY DEHYLPTFV++RF  
Sbjct  269   PQVKLQEWRKGSQWLEVDRDLAIEIISDEKYFPVFKKYCKRSCYVDEHYLPTFVSMRFWW  328

Query  990   GNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSL  1169
              NSNRSLTWVDWS GG HPAR+ R DVT+  LE +R G  C+YNG  TNVC+LFARKF  
Sbjct  329   SNSNRSLTWVDWSKGGPHPARFGRLDVTIELLERMRNGSTCKYNGRTTNVCFLFARKFLP  388

Query  1170  HSLTRLLRFAPKLMRFD  1220
             +SLTRL+RFAPK+M F 
Sbjct  389   NSLTRLMRFAPKVMGFQ  405



>ref|XP_009357077.1| PREDICTED: uncharacterized protein LOC103947833 [Pyrus x bretschneideri]
Length=400

 Score =   445 bits (1145),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 229/361 (63%), Positives = 269/361 (75%), Gaps = 11/361 (3%)
 Frame = +3

Query  168   LIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA----------VGLQEFLKPP  317
             ++ S Y K FS +LQL   + +       P     T  A           +GL+E+LKPP
Sbjct  40    MVLSFYMKDFSFSLQLAQFSFSTSTSASNPHNLMPTVKAVQPNESYRPPRIGLKEYLKPP  99

Query  318   ENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFY  497
             E   HDM D ELLWRASM P+I +YPF RVPKVAF+FL +G V LAPLWE FF+G++G Y
Sbjct  100   E-VFHDMDDVELLWRASMSPRISDYPFPRVPKVAFLFLVKGPVLLAPLWEKFFKGHQGLY  158

Query  498   SIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLL  677
             SIYVHS+PS N S PE  VFHGRRIPSQEV+WG+VNMIEAERRLLANALLD SN+RFVLL
Sbjct  159   SIYVHSNPSYNGSHPETPVFHGRRIPSQEVEWGNVNMIEAERRLLANALLDISNERFVLL  218

Query  678   SESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFE  857
             SE+CIPL NF T+Y+Y++ S   F++VYD P S GRGRY   M P + L QWRKGSQWFE
Sbjct  219   SEACIPLHNFSTVYNYVIRSNETFVQVYDDPSSVGRGRYSFNMYPQVWLNQWRKGSQWFE  278

Query  858   MDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGG  1037
             MDR LAIEV+SD +YF +FQ YCKGSCYADEHYLPTFVN++FG+ NSNRSLTWVDWS GG
Sbjct  279   MDRSLAIEVVSDRKYFPVFQSYCKGSCYADEHYLPTFVNMKFGKKNSNRSLTWVDWSRGG  338

Query  1038  SHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              HPA++ R DVTV  L +LR G  C YNG  +NVCYLFARKF   +L RLL+FAPKLM F
Sbjct  339   PHPAKFTRTDVTVDVLNSLRNGTSCIYNGRVSNVCYLFARKFGPETLERLLKFAPKLMGF  398

Query  1218  D  1220
             +
Sbjct  399   N  399



>ref|XP_002321483.2| hypothetical protein POPTR_0015s03850g [Populus trichocarpa]
 gb|EEF05610.2| hypothetical protein POPTR_0015s03850g [Populus trichocarpa]
Length=396

 Score =   445 bits (1144),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 229/379 (60%), Positives = 283/379 (75%), Gaps = 10/379 (3%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL-------ITAAAADqplllpppqp  266
             ++L N +   L F CGL  G+  +SY +  S N QL          + ++     P    
Sbjct  19    VHLQNFIFYLLVFGCGLAFGIARTSYIRDISFNFQLDQFSNNRTNTSLSNSSSSPPFITI  78

Query  267   ERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAV  446
             +R     +GL+EFL+ P N  HDM++EELLWRASMVP++  YPF  VPKVAF+FLT+G +
Sbjct  79    DRNRTGRIGLEEFLRAP-NVSHDMNEEELLWRASMVPRLPNYPFQLVPKVAFLFLTKGPL  137

Query  447   TLAPLWEMFFQGNEGFYSIYVHSDPS--CNESAPEGSVFHGRRIPSQEVKWGDVNMIeae  620
              LAPLW++FF+G++G YSI+VHS+PS   N +  E SVF GR+IPS+EV+WG  +M+EAE
Sbjct  138   PLAPLWDLFFKGHQGLYSIFVHSNPSFNGNYTEEEDSVFRGRKIPSKEVQWGKFSMVEAE  197

Query  621   rrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKH  800
             RRLLANALLDFSNQRFVLLSESCIPLFNF TIYSYLM STT FIEVYDLPG  GRGRY H
Sbjct  198   RRLLANALLDFSNQRFVLLSESCIPLFNFSTIYSYLMGSTTTFIEVYDLPGPVGRGRYNH  257

Query  801   RMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR  980
             RM PVI+L +WRKGSQW EMDR LA+EV+SD +YF  F+ +CK SCY+DEHYLPTFVN++
Sbjct  258   RMRPVIQLDKWRKGSQWVEMDRQLAVEVVSDRKYFPTFRKFCKVSCYSDEHYLPTFVNMK  317

Query  981   FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARK  1160
               + NSNRSLTWVDWS GG HP ++ R D+TV FLE LR   +CE NG  TN+CYLFARK
Sbjct  318   SRKKNSNRSLTWVDWSRGGPHPRKFGRLDITVDFLERLRKWRRCENNGRWTNICYLFARK  377

Query  1161  FSLHSLTRLLRFAPKLMRF  1217
             F+  +L RL+RFAPK+M+F
Sbjct  378   FTPAALDRLMRFAPKVMQF  396



>ref|XP_007152746.1| hypothetical protein PHAVU_004G156000g [Phaseolus vulgaris]
 gb|ESW24740.1| hypothetical protein PHAVU_004G156000g [Phaseolus vulgaris]
Length=449

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/311 (70%), Positives = 257/311 (83%), Gaps = 1/311 (0%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             +GL EFLK P  AMHDMSDEELLW+ASMVP I + PF + PKVAFMFLT+G V LAPLWE
Sbjct  140   IGLSEFLKSPM-AMHDMSDEELLWKASMVPMIHKLPFKQTPKVAFMFLTKGPVLLAPLWE  198

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+GNEG YSIYVHS PS NE+ P+ SVFHGR IPS+EV+WG+ +MIEAERRLLANALL
Sbjct  199   RFFKGNEGLYSIYVHSYPSSNETVPKNSVFHGRNIPSKEVRWGENSMIEAERRLLANALL  258

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DFSNQRFVLLSESCIPLFNF TIY+YLMNST  F+E YDLPG  GRGRY+ +M P I+L 
Sbjct  259   DFSNQRFVLLSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGRGRYRTQMRPQIRLS  318

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
             QWRKGSQWF++DR LA++ +SD  YF +F  YC  +CY+DEHYLPTFV+I+F + NSNR+
Sbjct  319   QWRKGSQWFQIDRFLALQTVSDYHYFPVFLKYCNPNCYSDEHYLPTFVSIKFWKRNSNRT  378

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             LTWVDW+ GG+HP+RY R+DV   FL  LR G  C+YNG  TN+C+LFARKF+ H+L RL
Sbjct  379   LTWVDWAKGGAHPSRYYRNDVNNEFLNKLRFGTSCDYNGHTTNICHLFARKFTTHALDRL  438

Query  1188  LRFAPKLMRFD  1220
             LRFAPKLM+F+
Sbjct  439   LRFAPKLMQFN  449



>ref|XP_008339646.1| PREDICTED: uncharacterized protein LOC103402673 [Malus domestica]
Length=400

 Score =   444 bits (1142),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 227/360 (63%), Positives = 267/360 (74%), Gaps = 11/360 (3%)
 Frame = +3

Query  168   LIFSSYFKSFSLNLQLITAAAADqpl----------llpppqpERTPVAAVGLQEFLKPP  317
             ++ S Y K FSL+LQL   + +              +      E      +GL+E+LKPP
Sbjct  40    MVLSFYMKDFSLSLQLAQFSFSTSTSASNPHXLMPNVKAVQPNESYRPPRIGLKEYLKPP  99

Query  318   ENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFY  497
             E   HDM D ELLWRASM P+I EYPF R PKVAF+FL +G V LAPLWE FF+G++G Y
Sbjct  100   E-VFHDMDDVELLWRASMSPRISEYPFPRXPKVAFLFLVKGPVLLAPLWEKFFKGHQGLY  158

Query  498   SIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLL  677
             SIYVHS+PS N S PE  VFHGRRIPSQEV+WG+VNMIEAERRLLANALLD SN+RFVLL
Sbjct  159   SIYVHSNPSYNGSHPETPVFHGRRIPSQEVEWGNVNMIEAERRLLANALLDISNERFVLL  218

Query  678   SESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFE  857
             SESCIPL NF T+Y+Y++ S   F++VYD P S GRGRY   M P + L QWRKGSQWFE
Sbjct  219   SESCIPLHNFSTVYNYIIRSNETFVQVYDDPSSVGRGRYSFNMYPQVWLNQWRKGSQWFE  278

Query  858   MDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGG  1037
             MDR LAIEV+SD +YF +FQ YCKGSCYADEHYLPTFVN++FG+ NSNR+LTWVDWS GG
Sbjct  279   MDRSLAIEVVSDRKYFPVFQSYCKGSCYADEHYLPTFVNMKFGKKNSNRTLTWVDWSRGG  338

Query  1038  SHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              HPA++ R DVT+  L +LR G  C YNG  +NVCYLFARKF   +L RLL+FAPKLM F
Sbjct  339   PHPAKFTRTDVTIDVLNSLRNGTSCIYNGRVSNVCYLFARKFGPETLERLLKFAPKLMGF  398



>ref|XP_004299046.1| PREDICTED: uncharacterized protein LOC101307491 [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   444 bits (1141),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 231/379 (61%), Positives = 286/379 (75%), Gaps = 9/379 (2%)
 Frame = +3

Query  111   NLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL----ITAAAADqplllpppqpERTP  278
             +L+N+LS FL F  G+T G+  + Y K FS +LQL     T ++++Q +++P     +T 
Sbjct  25    HLVNVLSYFLLFGVGITLGMFLTVYLKDFSFSLQLAQFSFTTSSSNQNMIMPSVTAAQTN  84

Query  279   VAA---VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
             ++    +GL++FLKPP   +HDM D+ELLWRAS+ P+I EYPF RVPKVAF+FLT+G V 
Sbjct  85    LSHPQHIGLEKFLKPPM-ILHDMDDDELLWRASLAPRISEYPFHRVPKVAFLFLTKGPVY  143

Query  450   LAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrl  629
             LAPLWE FF+G+ G YSIYVHS+PS N S PE  VF GRRIPSQEV+WG+VNMIEAERRL
Sbjct  144   LAPLWETFFKGHRGLYSIYVHSNPSYNGSHPESPVFQGRRIPSQEVEWGNVNMIEAERRL  203

Query  630   lanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMS  809
             LANALLD SN+RFVLLSESCIPL NF TIY +L+NS  +F+EVYD P S GRGRY   M 
Sbjct  204   LANALLDISNERFVLLSESCIPLHNFNTIYHHLVNSNKSFVEVYDDPSSVGRGRYNSHMY  263

Query  810   PVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGR  989
             P I L QWRKGSQWFEM+RDLAIEV++D +YF LF+ YC+GSCYADEHYLPTFV ++F  
Sbjct  264   PRITLSQWRKGSQWFEMNRDLAIEVVADKKYFPLFKKYCRGSCYADEHYLPTFVQMKFAA  323

Query  990   GNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVC-YLFARKFS  1166
              NSN++LTW D+S GG HPA + R DVTV  L +LR G KC       N C +LFARKF+
Sbjct  324   KNSNKTLTWYDFSKGGPHPATFTRTDVTVDMLNSLRNGTKCLDYLMTGNTCHHLFARKFT  383

Query  1167  LHSLTRLLRFAPKLMRFDE  1223
               +L RL+RFAPKLM+F+ 
Sbjct  384   PGTLERLMRFAPKLMQFNR  402



>ref|XP_011008309.1| PREDICTED: uncharacterized protein LOC105113714 [Populus euphratica]
Length=396

 Score =   442 bits (1138),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 228/378 (60%), Positives = 283/378 (75%), Gaps = 10/378 (3%)
 Frame = +3

Query  111   NLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL-------ITAAAADqplllpppqpE  269
             +L N +   L F CGL  G+  +SY +  S N QL          + ++     P    +
Sbjct  20    HLHNFIFYSLVFGCGLAFGIARTSYIRDISFNFQLDQFSNNPTNTSLSNSSSSSPFITTD  79

Query  270   RTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
             R     +GL+EFL+ P N  HDM++EELLWRASM P++  YPF RVPKVAF+FLT+G + 
Sbjct  80    RNRTGRLGLEEFLRAP-NVSHDMNEEELLWRASMAPRLPNYPFQRVPKVAFLFLTKGPLP  138

Query  450   LAPLWEMFFQGNEGFYSIYVHSDPS--CNESAPEGSVFHGRRIPSQEVKWGDVNMIeaer  623
             LAPLW++FF+G++G YSI+VHS+PS   N +  E SVF GR+IPS+EV+WG  +M+EAER
Sbjct  139   LAPLWDLFFRGHQGLYSIFVHSNPSFNGNYTEEEDSVFRGRKIPSKEVQWGKFSMVEAER  198

Query  624   rllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHR  803
             RLLANALLDFSNQRFVLLSESCIPLFNF TIYSYLM STT FIEVYDLPG  GRGRY HR
Sbjct  199   RLLANALLDFSNQRFVLLSESCIPLFNFSTIYSYLMGSTTTFIEVYDLPGPVGRGRYNHR  258

Query  804   MSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRF  983
             M PVI+L +WRKGSQW EMDR LA+EV+SD +YF  F+ +CK SCY+DEHYLPTFVN++ 
Sbjct  259   MRPVIQLDKWRKGSQWVEMDRQLAVEVVSDRKYFPTFRKFCKVSCYSDEHYLPTFVNMKS  318

Query  984   GRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKF  1163
              + NSNRSLTWVDWS GG HP ++ R D+TV+FLE LR    C+ NG  T++CYLFARKF
Sbjct  319   RKKNSNRSLTWVDWSRGGPHPRKFGRLDITVNFLERLRKWSHCKNNGRWTDICYLFARKF  378

Query  1164  SLHSLTRLLRFAPKLMRF  1217
             +L +L RL+RFAPK+M+F
Sbjct  379   TLDALDRLMRFAPKVMQF  396



>ref|XP_008806040.1| PREDICTED: uncharacterized protein LOC103718829 [Phoenix dactylifera]
Length=397

 Score =   442 bits (1136),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 214/308 (69%), Positives = 261/308 (85%), Gaps = 1/308 (0%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             VGL+ +++P + AMHDM++EELLWRASMVP+IK+YPF RVPKVAF+FL RG++  APLWE
Sbjct  87    VGLKGYVEPAK-AMHDMTEEELLWRASMVPRIKDYPFDRVPKVAFLFLARGSLAFAPLWE  145

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+G+EG YSIYVH+DPS NESAPEGSVFHGRR+PS+ V+WG ++M+EAERRLLANALL
Sbjct  146   KFFKGHEGLYSIYVHADPSFNESAPEGSVFHGRRVPSKLVRWGQLSMMEAERRLLANALL  205

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DFSNQRF+LLSESCIPLFNF TIYSYL+NST  ++  YD PG  GRGRY  RM P +KL+
Sbjct  206   DFSNQRFILLSESCIPLFNFSTIYSYLINSTKTYVSSYDDPGPNGRGRYNIRMKPHVKLQ  265

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
             QWRKGSQWFE+DR+LAIE+ISDD+YF +F+ YCK SCY DEHYL TFV++RF   N+NRS
Sbjct  266   QWRKGSQWFEVDRNLAIEIISDDKYFPVFKRYCKPSCYVDEHYLSTFVSMRFWWRNANRS  325

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             LTWVDWS  G HPAR+ R DVT+  L+ +R G  C+YNG  T++C+LFARKF  +SLTRL
Sbjct  326   LTWVDWSKRGPHPARFGRLDVTIELLKGMRNGSTCDYNGRTTSICFLFARKFLPNSLTRL  385

Query  1188  LRFAPKLM  1211
             +RFAPK+M
Sbjct  386   MRFAPKVM  393



>ref|XP_011072929.1| PREDICTED: uncharacterized protein LOC105158025 [Sesamum indicum]
Length=425

 Score =   441 bits (1134),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 230/425 (54%), Positives = 293/425 (69%), Gaps = 33/425 (8%)
 Frame = +3

Query  39    MMKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI  218
             M K+Q H     L+ S+KL ++   L N +  FLFF  GL  G+  SSY K     +QL 
Sbjct  1     MKKDQQHEVQQELIPSLKLLHSQSYLHNFIVYFLFFGSGLVIGITLSSYLKDAPQTMQLK  60

Query  219   TAAAADqplllpppqpER------------------------------TP--VAAVGLQE  302
               + +      P P P                                TP     +GL++
Sbjct  61    QLSTSILMQAPPSPPPPPPSPPPPPPPSDEHPPPSPPLPWQSLSPALPTPPFTGRIGLRQ  120

Query  303   FLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQG  482
             +L+PP  AMHDM++EELLWRASMVPKI+EYPF R+PK+AFMFLT+G + +APLWE FF+G
Sbjct  121   YLRPPR-AMHDMTEEELLWRASMVPKIQEYPFRRIPKIAFMFLTKGDLPMAPLWERFFKG  179

Query  483   NEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQ  662
             +EG YSIYVHS PS N + P+ SVF+ R+IPS+EV WG+ NM+EAERRLLANALLDF+NQ
Sbjct  180   HEGLYSIYVHSQPSHNITTPKTSVFYRRQIPSKEVAWGEFNMVEAERRLLANALLDFANQ  239

Query  663   RFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKG  842
             RF+LLSE+CIPLFNF TIY+YL  STT+FIE YD  G  GRGRY   M P + L QWRKG
Sbjct  240   RFILLSEACIPLFNFNTIYNYLTRSTTSFIESYDQWGPVGRGRYNKNMEPHVTLDQWRKG  299

Query  843   SQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVD  1022
             +QWFE++R+LA+EV+SD +Y++LF+ YCK  CY+DEHYLPTFV ++F   N NR+LTWVD
Sbjct  300   AQWFEVNRELAVEVVSDQKYYNLFKEYCKPECYSDEHYLPTFVTMKFPWMNGNRTLTWVD  359

Query  1023  WSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAP  1202
             WS GG HP ++LR DVTV  L+ +RTG  C YNG+ TN+C+LFARKF+ + L RLLR AP
Sbjct  360   WSKGGPHPTQFLRSDVTVDRLKRMRTGTTCLYNGKPTNICFLFARKFTANGLDRLLRLAP  419

Query  1203  KLMRF  1217
             ++M F
Sbjct  420   QIMHF  424



>ref|XP_003535134.1| PREDICTED: uncharacterized protein LOC100811590 [Glycine max]
Length=437

 Score =   440 bits (1131),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 246/433 (57%), Positives = 290/433 (67%), Gaps = 52/433 (12%)
 Frame = +3

Query  60    NNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSL-NLQLITAAAAD  236
             NN  PL +  K +N  L L+  L   LF A G+T G+I S Y KSFSL + Q + ++++ 
Sbjct  5     NNQHPLNSVSKHFN--LQLVRFLPYLLFLAFGVTIGIIISFYLKSFSLQHTQFLHSSSSQ  62

Query  237   qplllpppq-------------------pERTPVAAV--GLQEFLKP-------------  314
                  P                       E TP + V    QE ++P             
Sbjct  63    INAPPPNTMPPPIEKPEVSDSNLNQEGPEEFTPPSNVVHNTQESIQPSIVVHDTKKFIQP  122

Query  315   -------------PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLA  455
                          P N +HDMSDEELLWRASM PKI+EYPF RV KVAFMFL RG V LA
Sbjct  123   SNHVVHNMKEFIHPSNVVHDMSDEELLWRASMTPKIREYPFDRVAKVAFMFLVRGPVPLA  182

Query  456   PLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
               WE FF+G+EG+YSIYVHS+PS N S PE SVFHGRRIPS+ V+WG  NMIEAERRLLA
Sbjct  183   IFWERFFKGHEGYYSIYVHSNPSYNGSDPESSVFHGRRIPSKIVEWGKFNMIEAERRLLA  242

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSNQRF+L+SESCIPLFNF TIYSYLMNST +++  YD     GRGRY  RMSP+
Sbjct  243   NALLDFSNQRFILISESCIPLFNFSTIYSYLMNSTQSYVMAYDEDSLVGRGRYNPRMSPM  302

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             + L+QWRKGSQWFEMDR+LA+EV+SD  YF +FQ +C   CYADEHYLPTFVNI F   N
Sbjct  303   VTLKQWRKGSQWFEMDRELALEVVSDKTYFPIFQEHCTRPCYADEHYLPTFVNIMFPEKN  362

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEE-TNVCYLFARKFSLH  1172
             SNRSLTWVDWS GG HP +Y+R +VTV+FLE LR   KCEYNG+  TN C+LFARKF   
Sbjct  363   SNRSLTWVDWSKGGLHPTKYVRPEVTVAFLENLR-NQKCEYNGQAYTNACFLFARKFLPT  421

Query  1173  SLTRLLRFAPKLM  1211
             SLTRL+RF+P +M
Sbjct  422   SLTRLMRFSPSVM  434



>emb|CDO98417.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   439 bits (1128),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 227/378 (60%), Positives = 274/378 (72%), Gaps = 9/378 (2%)
 Frame = +3

Query  114   LINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAAVG  293
             L NL+  F+FF  GL  G+  S Y      NLQ    + +   L LPPP P         
Sbjct  28    LHNLVLYFMFFGTGLVIGVSLSFYLAENPFNLQFKLFSTSQSTLPLPPPPPPSPSPPPPP  87

Query  294   LQEF---------LKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAV  446
                             P+N  H M+DE+LLWRASMVP+I EYPF R PKVAFMFL RG +
Sbjct  88    PPVLCPAPAPVPDFTTPKNLTHQMTDEQLLWRASMVPRINEYPFKRTPKVAFMFLVRGEL  147

Query  447   TLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerr  626
              LA LWE FF+G+EG YSIY+HS PS N + P+GSVFHGR IPS++V+WG VNMIEAERR
Sbjct  148   PLARLWERFFKGHEGLYSIYIHSSPSYNGTTPDGSVFHGRNIPSKDVEWGKVNMIEAERR  207

Query  627   llanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRM  806
             LLANALLDFSNQRFVLLSESCIPLFNF TIYSYL+NST  F++ YDLPG TG+GRY  +M
Sbjct  208   LLANALLDFSNQRFVLLSESCIPLFNFSTIYSYLINSTETFVDSYDLPGPTGQGRYNKKM  267

Query  807   SPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFG  986
              PVI    WRKG+QWFEMDR+LAI+V+SD  YF LF+ +CK SCYADEHYLPTFV +++G
Sbjct  268   KPVINKSDWRKGAQWFEMDRELAIQVVSDRIYFPLFKRHCKSSCYADEHYLPTFVGMKYG  327

Query  987   RGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFS  1166
             R NS+R+LTWVDWS GG+HP R+ R+++T  FL  +R G  CEYNG +TN+C+LFARKFS
Sbjct  328   RKNSDRTLTWVDWSKGGAHPHRFSRYEITPDFLNRMRNGQTCEYNGRKTNICHLFARKFS  387

Query  1167  LHSLTRLLRFAPKLMRFD  1220
               +L RLL +APK+M F+
Sbjct  388   WTALDRLLMYAPKVMEFN  405



>ref|XP_010094729.1| hypothetical protein L484_019938 [Morus notabilis]
 gb|EXB56894.1| hypothetical protein L484_019938 [Morus notabilis]
Length=437

 Score =   439 bits (1128),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 286/438 (65%), Gaps = 44/438 (10%)
 Frame = +3

Query  39    MMKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNL---  209
             M   Q  +N P + +  KL    +++  L+  FL F  GL  G+ FSSY + F   L   
Sbjct  1     MAIKQQKHNLPFVASCPKLLTLQMHIHRLIFHFLIFGSGLAIGITFSSYLQDFPFTLYQF  60

Query  210   ---QLITAAAADqplllpppqpERTPVAA-------------------------------  287
                Q    A++           E  P+                                 
Sbjct  61    KDHQTNITASSSNLYNNLSTSHESKPIPIMSSLPNSPPPPLEILSSPSPETIAEDVSDTS  120

Query  288   ------VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
                   +GL EFLKPP    HDM DEELLWRASMVPK    P    PK+AF+FL RG VT
Sbjct  121   TSTSTRIGLIEFLKPP-TVRHDMDDEELLWRASMVPKAGRVPLEFTPKIAFLFLARGDVT  179

Query  450   LAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrl  629
             +APLW+ FF+GNEGF+S+YVHS+ S N +  + S F+GR IPSQ+V+WG+ NM+EAERRL
Sbjct  180   MAPLWDRFFKGNEGFFSVYVHSNLSFNATVSQDSAFYGRWIPSQDVRWGNPNMVEAERRL  239

Query  630   lanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMS  809
             LANALLDF+N+RFVLLSE+CIPLFNF T+Y YLM ST +F+E YDL G  GRGRY  RM 
Sbjct  240   LANALLDFTNERFVLLSEACIPLFNFSTVYEYLMGSTKSFVEAYDLIGPVGRGRYSSRMR  299

Query  810   PVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGR  989
             P IKL QWRKGSQWFEMDR LAIEV++D +YF +F+ +C+ SCY DEHYLPTFV+I+F +
Sbjct  300   PQIKLDQWRKGSQWFEMDRALAIEVVADQKYFPIFRRFCRSSCYTDEHYLPTFVSIKFWK  359

Query  990   GNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSL  1169
              NSNR+LTWVDWS GG HP +++R DVT+  LE LR G  CEYNG+ TN+C+LFARKF  
Sbjct  360   KNSNRTLTWVDWSKGGPHPTKFMRQDVTIELLEKLRHGHSCEYNGKRTNICHLFARKFLP  419

Query  1170  HSLTRLLRFAPKLMRFDE  1223
             ++L RLLRFAPKLM+F++
Sbjct  420   NTLGRLLRFAPKLMQFNK  437



>ref|XP_008467193.1| PREDICTED: uncharacterized protein LOC103504601 [Cucumis melo]
Length=379

 Score =   435 bits (1118),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 226/383 (59%), Positives = 279/383 (73%), Gaps = 17/383 (4%)
 Frame = +3

Query  84    SIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppq  263
             S KL +  L   N++   L F  G++ G+  + Y  +FS++L L    ++D         
Sbjct  7     SPKLIHIHLTFFNVVPYILLFTVGISAGVFLTFYLSNFSISLNLTQIPSSDFF-------  59

Query  264   pERTPVAA--VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTR  437
                 PV    VGL+EFLKPPE  MHDM DEELLWRASM   IK++PF RVPK+AFMFLT+
Sbjct  60    ----PVTGGRVGLEEFLKPPE-VMHDMDDEELLWRASMTAGIKKFPFQRVPKIAFMFLTK  114

Query  438   GAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIea  617
             G V LAPLWE FF+GNE  YS+YVHSDPS N S+PE  VFHGRRIPS++V WG VNMIEA
Sbjct  115   GPVYLAPLWEEFFKGNERLYSVYVHSDPSYNHSSPESPVFHGRRIPSKKVGWGKVNMIEA  174

Query  618   errllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNST-TNFIEVYDLPGSTGRGRY  794
             ERRL++NALLD SN+RFVLLSESCIPLFNF T+YS+L+NST  +FI  YD PG+ GRGRY
Sbjct  175   ERRLISNALLDISNERFVLLSESCIPLFNFSTVYSFLINSTMKSFIMSYDEPGNVGRGRY  234

Query  795   KHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVN  974
             +++M P I L+QWRKGSQWFEMDRD A+ V+SD +YF +FQ YCKG CY+DEHYLPT VN
Sbjct  235   RNKMFPPISLKQWRKGSQWFEMDRDTAVAVVSDKKYFPVFQNYCKGQCYSDEHYLPTLVN  294

Query  975   IRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR--TGDKCEYNGEETNVCYL  1148
             +     N+NRSLTWVDWS GG HPAR+ R D+ V  ++ LR  TG+  +   E T VC+L
Sbjct  295   VLGWDRNANRSLTWVDWSKGGPHPARFSRSDIHVELIQRLRNQTGECRKSKMEGTGVCFL  354

Query  1149  FARKFSLHSLTRLLRFAPKLMRF  1217
             FARKF+ ++L RL++ APK M F
Sbjct  355   FARKFAPNTLERLMKIAPKAMYF  377



>ref|XP_004301820.1| PREDICTED: uncharacterized protein LOC101311102 [Fragaria vesca 
subsp. vesca]
Length=426

 Score =   435 bits (1119),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/429 (53%), Positives = 282/429 (66%), Gaps = 39/429 (9%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MKN+ H N PP        NA + +  +++ FL F  GL  G+  S Y K   L++    
Sbjct  1     MKNKQHQNPPPCFLK-HFVNAQIQINKIITVFLIFVSGLALGITLSFYIKDTPLHIYTAL  59

Query  222   AAAADqplllppp-------------qpERTPVAAVGL--------------------QE  302
             A A                           T +A V L                      
Sbjct  60    AQAKTSLDSTVYKLVPVDNSPPPPPSPVNETKIATVPLASPPPRHPSPPQPSPPPPSKAA  119

Query  303   FLKPPENAMHDMSDEELLWRASMVPKIK-EYPFSR--VPKVAFMFLTRGAVTLAPLWEMF  473
             ++KP  +AMHDM D ELLWRASMVPK    YPF     PKVAFMFLTRG + LAPLWE F
Sbjct  120   YVKP--SAMHDMEDSELLWRASMVPKRSGAYPFKNDTKPKVAFMFLTRGDLALAPLWERF  177

Query  474   FQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF  653
             F+G+EG YSIY+H++P   E  PE SVFHGRR+PS+ V WG+ NM++AERRLLANALLD 
Sbjct  178   FKGHEGLYSIYIHANPDSGEPMPENSVFHGRRVPSKNVTWGEPNMVQAERRLLANALLDL  237

Query  654   SNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQW  833
             +NQRF+LLSESCIPLFNF T+Y+Y+M+ST  F+E YDLPG+ GR RY+ +MSP IKL QW
Sbjct  238   TNQRFILLSESCIPLFNFKTVYNYVMDSTQTFVEAYDLPGAVGRDRYRKKMSPTIKLEQW  297

Query  834   RKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             RKGSQWFE+DR LA+ V+SD  YF LF+ YC  SCY+DEHYLPT+V+IRF + NSNR+L 
Sbjct  298   RKGSQWFEVDRQLALGVVSDTSYFPLFEKYCVPSCYSDEHYLPTYVSIRFWKKNSNRTLH  357

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             WVDWS GG HP+RY R DVT  FL  +R G  CEYNG+ TN+C++FARKF  ++L RLLR
Sbjct  358   WVDWSRGGPHPSRYQRTDVTYEFLNKMRFGTTCEYNGKSTNMCHMFARKFMPNTLDRLLR  417

Query  1194  FAPKLMRFD  1220
             FAPKLM+F+
Sbjct  418   FAPKLMQFN  426



>gb|KFK41255.1| hypothetical protein AALP_AA2G105500 [Arabis alpina]
Length=406

 Score =   433 bits (1114),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 235/406 (58%), Positives = 283/406 (70%), Gaps = 14/406 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLN-LINLLSAFLFFACGLTCGLIFSSYFKSFS----LN  206
             MKNQ   N+     + KL NA  +  +NLLS  L   CG+  G++  S  + FS    L+
Sbjct  1     MKNQKEQNSSSSYLAAKLLNAQYHHFLNLLSYSLILCCGVIIGILLHSSLQDFSSTSSLS  60

Query  207   LQLITAAAADqplllpppqpERTPV---AAVGLQEFLKPPENAMHDMSDEELLWRASMVP  377
             LQ I+       L  PPP     P       GL  FLKPPE  MHDM D+ELLWRASM P
Sbjct  61    LQRISELLLVSSLPPPPPPSPPPPPYEPEHEGLDGFLKPPEKIMHDMEDDELLWRASMTP  120

Query  378   KIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVF  557
             KIK YPF R PKVAFMFLT+G + LAPLWE FFQG+EG +SIY+HSDPS N++ PEGSVF
Sbjct  121   KIKNYPFLRTPKVAFMFLTKGHLPLAPLWERFFQGHEGLFSIYIHSDPSYNKTDPEGSVF  180

Query  558   HGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNS  737
             HGR+IPS+ V WG+ NMIEAE+RLLANALLD SN+RFVLLSESCIPLFNF T+YSYL  S
Sbjct  181   HGRQIPSKRVDWGNANMIEAEQRLLANALLDISNERFVLLSESCIPLFNFSTVYSYLTLS  240

Query  738   TTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQ  917
             T   +E YD  G  GRGRY   M P I+LR WRKGSQWFE+DR +A+E+ISD  Y+ LF 
Sbjct  241   TQTHVESYDQLGGVGRGRYSPEMRPRIQLRHWRKGSQWFELDRAMALEIISDTLYWPLFY  300

Query  918   YYCKGSCYADEHYLPTFVNIR--FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLET  1091
              YC   CY+DEHY+PT +NI+      NSNR+LTWVDWS GG HP R++RH+VT  FLE 
Sbjct  301   RYCHHGCYSDEHYIPTLLNIKPSLAHRNSNRTLTWVDWSKGGPHPNRFIRHEVTPEFLER  360

Query  1092  LRTG----DKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             LR+G     +C +NGE+TN+CYLFARKF   +L RL+R AP ++ F
Sbjct  361   LRSGGDENKECFHNGEKTNICYLFARKFLPTALGRLIRLAPTVLYF  406



>ref|XP_007208909.1| hypothetical protein PRUPE_ppa027107mg [Prunus persica]
 gb|EMJ10108.1| hypothetical protein PRUPE_ppa027107mg [Prunus persica]
Length=298

 Score =   429 bits (1103),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 247/298 (83%), Gaps = 0/298 (0%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             MHDM D ELLWRAS+VP+ +  PF R PKVAFMFLTRG + LAP WEMFF+G+EG YSIY
Sbjct  1     MHDMDDAELLWRASLVPRRRGLPFKRTPKVAFMFLTRGPLALAPFWEMFFKGHEGLYSIY  60

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VH++P  N++ P+ SVF+GRR+PS+ V WG+ NM++AERRLLANALLDFSNQRFVLLSES
Sbjct  61    VHANPDFNDTMPQNSVFYGRRVPSKNVTWGEPNMVQAERRLLANALLDFSNQRFVLLSES  120

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF  IY YLM ST  F+EVYDLPG  GR RY+ +MSP I L QWRKGSQWFE+DR
Sbjct  121   CIPLFNFKVIYDYLMGSTQTFVEVYDLPGPVGRDRYRPKMSPQITLGQWRKGSQWFEVDR  180

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
              +A+EV+SD +YF LF  +CK SCY+DEHYLPT+VNI+F + NSNR+LTWVDWS GG HP
Sbjct  181   VIAVEVVSDQKYFPLFTKHCKPSCYSDEHYLPTYVNIKFRKKNSNRTLTWVDWSRGGPHP  240

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             ++++R DVTV FLE LR G KCEYNG+ T+VC+LFARKF  ++L RLLRF PKLM+F+
Sbjct  241   SKFMRTDVTVEFLEKLRHGTKCEYNGKTTDVCHLFARKFLPNTLDRLLRFGPKLMKFN  298



>ref|XP_010045650.1| PREDICTED: uncharacterized protein LOC104434412 [Eucalyptus grandis]
Length=412

 Score =   432 bits (1110),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 219/313 (70%), Positives = 255/313 (81%), Gaps = 6/313 (2%)
 Frame = +3

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             + +FL PP   MHDM D ELLWRASM PKI++YPF RVPKVAF+FLTRG + LAPLWE F
Sbjct  101   VSDFLDPP-TPMHDMDDRELLWRASMAPKIRQYPFKRVPKVAFLFLTRGPLPLAPLWERF  159

Query  474   FQGNEGFYSIYVHSDPSCNESA----PEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
             F+G+EG +SIYVHS P+ N +A     EGSVFHGRRIPS+EV+WG+ NM+EAERRLLANA
Sbjct  160   FRGHEGLFSIYVHSHPAFNATAGGGESEGSVFHGRRIPSKEVQWGNFNMVEAERRLLANA  219

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLD SNQRFVLLSESCIPLFNF TIYSYL+ ST +FIE YD PG  GRGRY  RM PVI+
Sbjct  220   LLDISNQRFVLLSESCIPLFNFTTIYSYLVGSTRSFIEAYDKPGPVGRGRYNLRMRPVIQ  279

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
             + QWRKGSQWFEMDR LA+EV+SD +Y S+F+ +CKGSCY+DEHYLPT V+I+F R NSN
Sbjct  280   IGQWRKGSQWFEMDRGLAVEVVSDMKYISVFRRFCKGSCYSDEHYLPTLVSIKFWRRNSN  339

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYNGEETNVCYLFARKFSLHSL  1178
             RSLTWVDWS GG HP R+ R  VTV  L+ LR G  KCEYNG+ T+VC+LFARKF  ++L
Sbjct  340   RSLTWVDWSKGGPHPTRFGRWQVTVELLKRLRGGSRKCEYNGKSTSVCFLFARKFLPNAL  399

Query  1179  TRLLRFAPKLMRF  1217
              RLLRFAPK+M F
Sbjct  400   DRLLRFAPKVMEF  412



>ref|XP_004299045.1| PREDICTED: uncharacterized protein LOC101307203 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   431 bits (1109),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 231/417 (55%), Positives = 278/417 (67%), Gaps = 30/417 (7%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSS-YFKSFSLNLQLI  218
             MK QN N +       K +   +N + +LS FL F  GL  G++  S Y K  S +LQ+ 
Sbjct  1     MKAQNQNPS-------KFFTKQIN-VQVLSYFLIFGGGLVLGIVLGSFYLKDSSFSLQIA  52

Query  219   TAAAADqplllpppqpER-------------------TPVAAVGLQEFLKPPENAMHDMS  341
               + +  P        +                    T V    L+EFLKPP+   HDM 
Sbjct  53    EMSFSSSPSSSASSPSDNANISHMLVSPNDTVTMSNITEVHIGALEEFLKPPK-VWHDMD  111

Query  342   DEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDP  521
             DEELLWRASM P+I +YPF RVPKVAFMFLTRG + LAPLWE FFQG++G YSIY+HSD 
Sbjct  112   DEELLWRASMAPRILQYPFKRVPKVAFMFLTRGPIHLAPLWEKFFQGHQGLYSIYIHSDM  171

Query  522   SCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPL  698
               NES+ PE  +F GRRIPSQ V WG VN+IEAE RL+ANALLD SNQRFVLLSE+CIPL
Sbjct  172   YYNESSHPESPIFRGRRIPSQRVDWGRVNLIEAESRLIANALLDVSNQRFVLLSEACIPL  231

Query  699   FNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAI  878
             FNF T+YSYL+N+   F++VYD P   GRGRY     P I L QWRKGSQW E+DRD+AI
Sbjct  232   FNFSTVYSYLINTHQTFVQVYDDPSGVGRGRYNESYYPQITLDQWRKGSQWVEIDRDIAI  291

Query  879   EVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYL  1058
             EV+SD +Y++ FQ  C+G C+ADEHYLPTF+NIRF   NSNRS+TWVDWS GG HP  Y 
Sbjct  292   EVVSDQKYYTTFQKLCRGYCFADEHYLPTFMNIRFPTKNSNRSVTWVDWSTGGPHPVEYE  351

Query  1059  RHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDEKL  1229
               DVTV  L  LR G  CEYNG  TNVC+LFARKF L SL  LL+ AP++M+F+  +
Sbjct  352   STDVTVELLNKLRHGSWCEYNGRGTNVCFLFARKFPLSSLDTLLKIAPQVMQFNTDI  408



>emb|CBI15480.3| unnamed protein product [Vitis vinifera]
Length=295

 Score =   426 bits (1096),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 246/295 (83%), Gaps = 0/295 (0%)
 Frame = +3

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             M D ELLWRASMVP++ E+PF RVPK+AF+FLTRG++ LAPLWEMFF+G+E  YSIYVHS
Sbjct  1     MKDAELLWRASMVPRVGEFPFKRVPKIAFLFLTRGSLPLAPLWEMFFRGHEALYSIYVHS  60

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
             DPS N + P+ SVF+GR IPSQEV+WG+ +M+EAERRLLANALLD SN RFVLLSESCIP
Sbjct  61    DPSFNRTVPKSSVFYGRSIPSQEVQWGNFSMLEAERRLLANALLDISNHRFVLLSESCIP  120

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF TIYSYLM ST +FIE YDLPG  GR RY HRM P++ + QWRKGSQWFEMDR LA
Sbjct  121   LFNFSTIYSYLMASTKSFIEAYDLPGPVGRARYDHRMKPIVTIGQWRKGSQWFEMDRGLA  180

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
             IEVISD +YF++F+  C+ SCYADEHYLPT V+I F R N+NRSLTWVDWS+GG+HPA +
Sbjct  181   IEVISDRKYFAVFRECCEASCYADEHYLPTLVSIEFWRRNANRSLTWVDWSNGGAHPAGF  240

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              R DVTV FL++LRT   C+YNG  T++C+LFARKF   +L RLLR APKLM+F+
Sbjct  241   WRRDVTVEFLQSLRTESHCQYNGNNTDICFLFARKFLPGTLNRLLRVAPKLMKFN  295



>ref|XP_009768969.1| PREDICTED: uncharacterized protein LOC104219898 [Nicotiana sylvestris]
Length=421

 Score =   431 bits (1108),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 220/424 (52%), Positives = 291/424 (69%), Gaps = 36/424 (8%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQ---  212
             MK++ H N     TS KL+N+   + +L+  FLFF  GL  G+  S Y K   + L+   
Sbjct  1     MKHETHQNQ---FTSAKLFNSQRYIHSLIVYFLFFGSGLVIGISVSFYLKDVPITLKKKL  57

Query  213   --------LITAAAADqplllpppqpERTP--------------------VAAVGLQEFL  308
                     ++T      P         + P                    V  +GL +++
Sbjct  58    FSFQPSPLIVTPKLNPPPSQPLNLPSNQQPQQRVQLNNDRRVENNIKTKRVGRIGLTDYI  117

Query  309   KPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNE  488
             KPPE AMHDM+DEEL+WRASMVPK++ +PF R PK+AFMFL RG++ LAPLWE FF+GNE
Sbjct  118   KPPE-AMHDMNDEELIWRASMVPKVRNFPFKRTPKIAFMFLARGSLPLAPLWERFFKGNE  176

Query  489   GFYSIYVHSDPSCNESAPE-GSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQR  665
             G YSIY+HS PS N  APE G +FHGRR+PS+ V WG+ +M+EAERRLLANALLD SN+R
Sbjct  177   GRYSIYIHSQPSFNGIAPEEGPIFHGRRVPSKRVDWGEFSMVEAERRLLANALLDMSNER  236

Query  666   FVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGS  845
             FVLLSE+CIPL+NF  IY+Y+MNST  F+E YD  G  GRGRY  +M+P + + QWRKGS
Sbjct  237   FVLLSEACIPLYNFTAIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVTIEQWRKGS  296

Query  846   QWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDW  1025
             QWFE+DR++A++VI++ +YF+LF+ +C+ +CY+DEHYLPTFV +R+   N NR+LTWVDW
Sbjct  297   QWFELDREIAVDVITEPKYFNLFKEFCRPACYSDEHYLPTFVTMRYWWKNGNRTLTWVDW  356

Query  1026  SHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPK  1205
             + GG HP ++ R +VT   L  +R+G +CEYNGE T++CYLFARKF   SL RLL+FAPK
Sbjct  357   TKGGPHPTKFARTEVTKELLNQMRSGIQCEYNGEPTSMCYLFARKFLPSSLDRLLKFAPK  416

Query  1206  LMRF  1217
             +M F
Sbjct  417   VMMF  420



>emb|CDP00653.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   426 bits (1095),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 207/296 (70%), Positives = 243/296 (82%), Gaps = 0/296 (0%)
 Frame = +3

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             M+DEELLW+ASM PKI+E+PF RVPKVAFMFLTRG V+LAPLWE FF+G++G YSIYVH 
Sbjct  1     MNDEELLWKASMTPKIQEFPFKRVPKVAFMFLTRGPVSLAPLWEKFFKGHKGLYSIYVHP  60

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
             +PS N S PEGSVFHGRRIPS+EV+WG+VNMIEAERRLLANALLD SNQRFVL+SE+CIP
Sbjct  61    NPSYNGSEPEGSVFHGRRIPSKEVQWGNVNMIEAERRLLANALLDVSNQRFVLVSEACIP  120

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF  +Y+YLMNST + +EVYD  G  GRGRY  +M P+IKL  WRKGSQWFEMDRDLA
Sbjct  121   LFNFSIVYNYLMNSTLSHVEVYDQAGPVGRGRYSRQMQPLIKLEDWRKGSQWFEMDRDLA  180

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
             +EVISD  YF  FQ+YCKGSCYADEHYLPTFVN++FG+  S R+LT VDWS GG HP  +
Sbjct  181   LEVISDKTYFPAFQHYCKGSCYADEHYLPTFVNMKFGKKTSKRTLTHVDWSKGGPHPMSF  240

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
              R  VT   LE +R+G  C +NG + + C+LFARKF   SL RL+RFAPKLM F++
Sbjct  241   YRDRVTAELLEKMRSGSNCVHNGSKNDTCHLFARKFPPQSLDRLVRFAPKLMHFNQ  296



>gb|KCW83891.1| hypothetical protein EUGRSUZ_B00742 [Eucalyptus grandis]
Length=302

 Score =   426 bits (1095),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 215/302 (71%), Positives = 249/302 (82%), Gaps = 5/302 (2%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             MHDM D ELLWRASM PKI++YPF RVPKVAF+FLTRG + LAPLWE FF+G+EG +SIY
Sbjct  1     MHDMDDRELLWRASMAPKIRQYPFKRVPKVAFLFLTRGPLPLAPLWERFFRGHEGLFSIY  60

Query  507   VHSDPSCNESA----PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             VHS P+ N +A     EGSVFHGRRIPS+EV+WG+ NM+EAERRLLANALLD SNQRFVL
Sbjct  61    VHSHPAFNATAGGGESEGSVFHGRRIPSKEVQWGNFNMVEAERRLLANALLDISNQRFVL  120

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSESCIPLFNF TIYSYL+ ST +FIE YD PG  GRGRY  RM PVI++ QWRKGSQWF
Sbjct  121   LSESCIPLFNFTTIYSYLVGSTRSFIEAYDKPGPVGRGRYNLRMRPVIQIGQWRKGSQWF  180

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             EMDR LA+EV+SD +Y S+F+ +CKGSCY+DEHYLPT V+I+F R NSNRSLTWVDWS G
Sbjct  181   EMDRGLAVEVVSDMKYISVFRRFCKGSCYSDEHYLPTLVSIKFWRRNSNRSLTWVDWSKG  240

Query  1035  GSHPARYLRHDVTVSFLETLRTGD-KCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLM  1211
             G HP R+ R  VTV  L+ LR G  KCEYNG+ T+VC+LFARKF  ++L RLLRFAPK+M
Sbjct  241   GPHPTRFGRWQVTVELLKRLRGGSRKCEYNGKSTSVCFLFARKFLPNALDRLLRFAPKVM  300

Query  1212  RF  1217
              F
Sbjct  301   EF  302



>ref|XP_009589451.1| PREDICTED: uncharacterized protein LOC104086812 [Nicotiana tomentosiformis]
Length=421

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/424 (52%), Positives = 292/424 (69%), Gaps = 36/424 (8%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQ---  212
             MK++ H N+     S KL+N+   + +L+  FLFF  GL  G+  S Y K   + L+   
Sbjct  1     MKHETHQNH---FISAKLFNSQRYIHSLIVYFLFFGSGLVIGISVSFYLKDVPITLKKKL  57

Query  213   --------LITAAAADqplllpppqpERTP--------------------VAAVGLQEFL  308
                     +IT      P         + P                    V  +GL++++
Sbjct  58    FSFQPSPLIITPKLNPPPSQSLNLPLNQQPHQRVQVNNDRRVENNNKRKRVGRIGLKDYI  117

Query  309   KPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNE  488
             KPPE AMHDM+DEEL+WRASMVPK++ +PF R PK+AFMFL RG++ LAPLWE FF+GNE
Sbjct  118   KPPE-AMHDMNDEELIWRASMVPKVRNFPFKRTPKIAFMFLARGSLPLAPLWERFFKGNE  176

Query  489   GFYSIYVHSDPSCNESAPE-GSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQR  665
             G YSIY+HS PS    APE G +FHGRR+PS+ V WG+ +M+EAERRLLANALLD SN+R
Sbjct  177   GRYSIYIHSQPSFKGIAPEEGPIFHGRRVPSKRVDWGEFSMVEAERRLLANALLDMSNER  236

Query  666   FVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGS  845
             FVLLSE+CIPL+NF TIY+Y+MNST  F+E YD  G  GRGRY  +M+P + + QWRKGS
Sbjct  237   FVLLSEACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVTIEQWRKGS  296

Query  846   QWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDW  1025
             QWFE+DR++A++VI+D +YF+LF+ +C+ +CY+DEHYLPTFV +R+   N NR+LTWVDW
Sbjct  297   QWFELDREIAVDVITDPKYFNLFKEFCRPACYSDEHYLPTFVTMRYWWKNGNRTLTWVDW  356

Query  1026  SHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPK  1205
             + GG HP ++ R +VT   L  +R+G +CEYNGE T++CYLFARKF   +L RLL+FAPK
Sbjct  357   TKGGPHPTKFARTEVTKELLNQMRSGIQCEYNGEPTSMCYLFARKFLPSTLDRLLKFAPK  416

Query  1206  LMRF  1217
             +M F
Sbjct  417   VMMF  420



>ref|XP_004147140.1| PREDICTED: uncharacterized protein LOC101202787 [Cucumis sativus]
 gb|KGN51542.1| hypothetical protein Csa_5G576840 [Cucumis sativus]
Length=379

 Score =   428 bits (1100),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/383 (58%), Positives = 277/383 (72%), Gaps = 17/383 (4%)
 Frame = +3

Query  84    SIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppq  263
             S KL +  L   +++   L F  G+T G+  + Y  +F ++L L   +++D         
Sbjct  7     SPKLIHIHLTFFHVVPYILLFTVGITAGVFLTFYLSNFFISLNLTQISSSDFF-------  59

Query  264   pERTPVAA--VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTR  437
                 PV    VGL+EFLKPPE  MHDM DEELLWRASM+ +IK++PF RVPK+AFMFLT+
Sbjct  60    ----PVTGGRVGLEEFLKPPE-VMHDMDDEELLWRASMMARIKKFPFQRVPKIAFMFLTK  114

Query  438   GAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIea  617
             G V LAPLWE FF+GNEG YS+YVHSDPS N S+PE   FHGRRIPS++V WG VNMIEA
Sbjct  115   GPVYLAPLWEEFFKGNEGLYSVYVHSDPSYNHSSPEPPAFHGRRIPSKKVGWGKVNMIEA  174

Query  618   errllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNST-TNFIEVYDLPGSTGRGRY  794
             ERRL++NALLD SN+RFVLLSESCIPLFNF T+YS+L+NST  +FI  YD P + GRGRY
Sbjct  175   ERRLISNALLDISNERFVLLSESCIPLFNFSTVYSFLINSTMKSFIMSYDEPSNVGRGRY  234

Query  795   KHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVN  974
             +++M P I L+QWRKGSQWFE+DRD A+ V+SD +YF +FQ YCKG CY+DEHYLPT VN
Sbjct  235   RNKMFPPISLKQWRKGSQWFEIDRDTAVAVVSDKKYFPVFQNYCKGQCYSDEHYLPTLVN  294

Query  975   IRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR--TGDKCEYNGEETNVCYL  1148
             +     N NRSLTWVDWS GG HPARY R D+ V  ++ LR  TG+  +   E   VC+L
Sbjct  295   VLGWDRNGNRSLTWVDWSKGGPHPARYSRSDIHVELIQRLRNQTGECRKSKMEGKGVCFL  354

Query  1149  FARKFSLHSLTRLLRFAPKLMRF  1217
             FARKF+ ++L RL+  APK M F
Sbjct  355   FARKFAPNALERLVNIAPKAMYF  377



>ref|XP_004512994.1| PREDICTED: uncharacterized protein LOC101496836 [Cicer arietinum]
Length=417

 Score =   426 bits (1096),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/420 (54%), Positives = 284/420 (68%), Gaps = 31/420 (7%)
 Frame = +3

Query  39    MMKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSL-----  203
             MMKN          +  KL+NA + L+N     L F CGL  G+  + +    S      
Sbjct  3     MMKNNKDEQGIITSSYQKLFNAQICLLNFFGHILVFGCGLLIGITLTLFLNKISFQFQIQ  62

Query  204   --------------------NLQLITAAAADqplllpppqpERTPVAAVGLQEFLKPPEN  323
                                 N+Q  T     +   +       + V    L++FLK P +
Sbjct  63    QFQNPFFPTPPITPNISNPSNIQNQTKIFIKEENFVITNNISSSNV----LEDFLKIP-S  117

Query  324   AMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSI  503
             AMHDM+++EL WRAS+ P I + PF +  KVAFMFLT+G V LAPLWE FF+GNEG +SI
Sbjct  118   AMHDMNEKELFWRASLAPMIHKIPFKQTSKVAFMFLTKGPVLLAPLWEKFFKGNEGLFSI  177

Query  504   YVHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             Y+H +PS NE+   + SVFHGRRIPS++V WG+ +MIEAERRLLANALLDFSN RFVLLS
Sbjct  178   YIHPNPSFNETIYDQSSVFHGRRIPSKKVHWGENSMIEAERRLLANALLDFSNTRFVLLS  237

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIPLFNF TIY+YLMNS   ++E YDL  S GRGRY  +M P+I + QWRKGSQWF++
Sbjct  238   ESCIPLFNFSTIYNYLMNSKKTYVEAYDLASSVGRGRYSKKMMPLINISQWRKGSQWFQI  297

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
             DR LA++VISD  YFS+++ +C   CY+DEHYLPT V+I+F + NSNR+LTWVDWS GG 
Sbjct  298   DRYLALQVISDKSYFSIYKKHCNPPCYSDEHYLPTLVSIKFWKRNSNRTLTWVDWSKGGP  357

Query  1041  HPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             HPA+++R  VT+ FLE LR G  CEYNG+ TNVCYLFARKF+ H+L RLLRFAPKLM+F+
Sbjct  358   HPAKFVRPHVTIDFLEKLRFGSTCEYNGKTTNVCYLFARKFTRHALGRLLRFAPKLMQFN  417



>ref|XP_002887179.1| hypothetical protein ARALYDRAFT_475958 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63438.1| hypothetical protein ARALYDRAFT_475958 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   424 bits (1090),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 282/405 (70%), Gaps = 13/405 (3%)
 Frame = +3

Query  42    MKNQNHNNNPPLLT-----SIKLYNAPLN-LINLLSAFLFFACGLTCGLIFSSYFKSFS-  200
             MKNQ   N+    +     + KL NA  +  +NLLS  L   CG+  G++  S  + FS 
Sbjct  1     MKNQKDQNSSSFSSSSPSLTTKLLNAQYHHFLNLLSYSLILCCGIIFGILLHSSLQDFSS  60

Query  201   ---LNLQLITAA-AADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRAS  368
                L++Q I+     +     PPP    + +   GL+ F+KPPE  MHDM DEELLWRAS
Sbjct  61    TSSLSIQRISQLFLVNSLPPPPPPPSPPSELELDGLERFIKPPEKLMHDMEDEELLWRAS  120

Query  369   MVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEG  548
             M PKIK YPF R PKVAFMF+T+G + LA LWE FF+G+E  ++IYVHS PS N+S PE 
Sbjct  121   MAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWERFFRGHEHLFTIYVHSYPSYNQSDPED  180

Query  549   SVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYL  728
             SVFHGR IPS+ V WG VNM+EAE+RLLANALLD SN+RFVLLSESCIPLFNF T+YSYL
Sbjct  181   SVFHGRHIPSKRVDWGYVNMVEAEQRLLANALLDISNERFVLLSESCIPLFNFTTVYSYL  240

Query  729   MNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFS  908
             +NST   +E YD  G  GRGRY   M P ++L  WRKGSQWFE+DRD+A+E+ISD  Y+ 
Sbjct  241   INSTQTHVESYDQLGGVGRGRYSPLMQPHVQLHHWRKGSQWFEVDRDMALEIISDRIYWP  300

Query  909   LFQYYCKGSCYADEHYLPTFVNIR--FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSF  1082
             LF  YC   CYADEHY+PT +NI+      NSNR+LTWVDWS GG HP R++RH+VT  F
Sbjct  301   LFYSYCHHGCYADEHYIPTLLNIKSSLNHRNSNRTLTWVDWSKGGPHPNRFIRHEVTAEF  360

Query  1083  LETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             +E LR+G +C YNGEETN+CYLFARKF   +L RLLR +  ++ F
Sbjct  361   MENLRSGGECLYNGEETNICYLFARKFLPTALDRLLRLSRTVLYF  405



>emb|CBI26988.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   417 bits (1071),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 203/290 (70%), Positives = 239/290 (82%), Gaps = 0/290 (0%)
 Frame = +3

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             M DEEL WRASM P+I+E+PF RVPKVAFMFLT+G + LAPLWE+FF+G+EG YSIYVHS
Sbjct  1     MDDEELPWRASMAPQIREFPFKRVPKVAFMFLTKGPLPLAPLWELFFKGHEGLYSIYVHS  60

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
              PS NE+ PE SVFH RRIPS+EV+WG  NMIEAERRLLANALLDFSN  FVLLSESCIP
Sbjct  61    HPSFNETEPENSVFHDRRIPSKEVQWGKFNMIEAERRLLANALLDFSNYHFVLLSESCIP  120

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF TIYSYLMNST N+++ YD PG  GRGRYK +M P I + QWRKGSQWF +DR+LA
Sbjct  121   LFNFSTIYSYLMNSTRNYVQTYDFPGPVGRGRYKEQMYPTITIEQWRKGSQWFAVDRNLA  180

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
              E+ISD  YF +FQ +CK SCYADEHYLPTFV I+F   ++NRSLTWVDWS GG+HPAR+
Sbjct  181   TEIISDQTYFPIFQKHCKSSCYADEHYLPTFVGIKFWERSANRSLTWVDWSRGGAHPARF  240

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPK  1205
             +R DVT+  L+ LR+  +C+YNG+ TN+C+LFARK    +L RLLRFAPK
Sbjct  241   MRWDVTIESLKRLRSEGRCDYNGKSTNICFLFARKVMPSALERLLRFAPK  290



>ref|XP_008812383.1| PREDICTED: uncharacterized protein LOC103723284 [Phoenix dactylifera]
Length=384

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 272/383 (71%), Gaps = 15/383 (4%)
 Frame = +3

Query  114   LINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL-------------ITAAAADqplllp  254
             +I LLS+F+ F  G   G+I S Y K+    +Q+                +         
Sbjct  1     MIQLLSSFILFGFGFALGIISSLYLKTIPSAVQIPRLSFLPSLPPSSAPPSPPLLSPPPA  60

Query  255   ppqpERTPVAA--VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMF  428
             PP    T VA   VG + +++P +  MHDMSDEELLWRASMVPKI+ +P++R+PKVAF+F
Sbjct  61    PPALNHTVVATEIVGRKGYIEPSKVIMHDMSDEELLWRASMVPKIEAFPYNRIPKVAFLF  120

Query  429   LTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNM  608
             L +GA+ LAP+WE FF+GNEG YSIYVH  PS  +SAPE SVFHGRR+PS+ V+WG  +M
Sbjct  121   LIKGALPLAPVWEKFFKGNEGLYSIYVHPHPSYKDSAPEDSVFHGRRVPSKVVQWGQPSM  180

Query  609   IeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRG  788
             +EAERRLLANALLD+SNQRFVLLSESCIP+FNF TIYSYL+NST  +I  YD  G  GRG
Sbjct  181   VEAERRLLANALLDYSNQRFVLLSESCIPIFNFSTIYSYLINSTETYIHSYDDLGPGGRG  240

Query  789   RYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTF  968
             RYK  MSP +KL QWRKGSQW E+DR+LA+E+ISD+ YF LF  +C+ SC  DEHYLPTF
Sbjct  241   RYKIAMSPQLKLEQWRKGSQWVEVDRNLAVEIISDETYFPLFLKHCRTSCITDEHYLPTF  300

Query  969   VNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYL  1148
             V+++FG  N+NRSLTW +W+   SHPA Y   DVT+  LE +R G  C YNG  T VC+L
Sbjct  301   VSVKFGWKNANRSLTWTEWAPRQSHPALYQGSDVTIQLLERMRNGTTCNYNGGTTRVCFL  360

Query  1149  FARKFSLHSLTRLLRFAPKLMRF  1217
             FARKFS +SL +LL  APK+M F
Sbjct  361   FARKFSPNSLDQLLMLAPKIMGF  383



>ref|XP_010470788.1| PREDICTED: uncharacterized protein LOC104750657 isoform X2 [Camelina 
sativa]
Length=416

 Score =   418 bits (1075),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 232/416 (56%), Positives = 281/416 (68%), Gaps = 24/416 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLT----SIKLYNAPLN-LINLLSAFLFFACGLTCGLIFSSYFKSFS--  200
             MKNQ   N+    +    + KL NA  +  +NLLS  L    G+  G++  S  + FS  
Sbjct  1     MKNQKDQNSSLPSSSPSLTAKLLNAQYHHFLNLLSYSLILCSGIIVGILLHSSLQDFSST  60

Query  201   --LNLQLITA-------------AAADqplllpppqpERTPVAAVGLQEFLKPPENAMHD  335
               L++Q I+                   P   PPP P        GL+ F+KPPE  MHD
Sbjct  61    SSLSIQRISQLFVVSSLPLPPPSPPPPSPPSPPPPSPPSDEPEHDGLEHFIKPPEKLMHD  120

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             M DEELLWRASM PKIK YPF R PKVAFMF+T+G + LA LWE FF+G+EG +SIYVHS
Sbjct  121   MEDEELLWRASMEPKIKSYPFPRTPKVAFMFMTKGHLPLARLWERFFRGHEGHFSIYVHS  180

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
              PS N+S PE SVFHGR IPS+ V WG VNM+EAE+RLLANALLD SN+RFVLLSESCIP
Sbjct  181   YPSYNQSDPENSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALLDLSNERFVLLSESCIP  240

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF T+YSYL+NST   +E YD  G  GRGRY   M P ++L  WRKGSQWFEMDR +A
Sbjct  241   LFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLHHWRKGSQWFEMDRAMA  300

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSNRSLTWVDWSHGGSHPA  1049
             +E+ISD  Y+ LF  +C   CYADEHY+PT +NI+    R NSNR+LTWVDWS GG HP 
Sbjct  301   LEIISDRIYWPLFYSFCHHGCYADEHYIPTLLNIKSSLKRRNSNRTLTWVDWSKGGPHPN  360

Query  1050  RYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             R++RH+VT  F+E LR+G +C YNGEETNVCYLFARKF   +L RLLR +  ++ F
Sbjct  361   RFIRHEVTAEFMENLRSGGQCLYNGEETNVCYLFARKFLPTALDRLLRLSRTVLYF  416



>ref|XP_011097027.1| PREDICTED: uncharacterized protein LOC105176048 [Sesamum indicum]
Length=420

 Score =   418 bits (1075),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 272/406 (67%), Gaps = 25/406 (6%)
 Frame = +3

Query  75    LLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL-------------  215
             L  S K + +  +L  L+  FLFF  GL  G+  S Y       LQL             
Sbjct  15    LFHSAKFHTSQPHLQTLIIYFLFFGSGLMIGITLSFYLTDTPPALQLRQFISTVLPPPPP  74

Query  216   ------------ITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLW  359
                                Q    PPP P         LQ       N MH+M D+ELLW
Sbjct  75    PAVVEPLPSPPSPPPPTPIQQPPPPPPPPTPVLAPPPPLQWVPAAGTNLMHEMGDKELLW  134

Query  360   RASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESA  539
             RASM PKI EYPF R PKVAFMFL R  + LAPLWEMFF+G+EG YSIYVHS PS N S 
Sbjct  135   RASMKPKIGEYPFKRTPKVAFMFLARRELPLAPLWEMFFRGHEGLYSIYVHSLPSYNGSE  194

Query  540   PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIY  719
             PEGSVFHGRR+PS+EVKWG+ +M+EAERRLLANALLD+SN+RFVLLSE+CIPLFNF TIY
Sbjct  195   PEGSVFHGRRVPSKEVKWGEFSMVEAERRLLANALLDYSNERFVLLSEACIPLFNFTTIY  254

Query  720   SYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDR  899
              YL+ STT F+E YDL G  GRGRY   M P IKL++WRKG+QWFE+DR+LA+EVISD  
Sbjct  255   DYLIKSTTTFVESYDLAGPVGRGRYDKHMRPHIKLKEWRKGAQWFEIDRELALEVISDRL  314

Query  900   YFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVS  1079
             Y  LF+ YCK +CY+DEHYLPTFV  +F   NSNR+LTWVDWS GG HP R++R DV+ +
Sbjct  315   YSFLFKKYCKPACYSDEHYLPTFVTKKFPWKNSNRTLTWVDWSKGGPHPLRFVRSDVSSA  374

Query  1080  FLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
                 LR+  +C YNG  T++CYLFARKF++ +L RLLRFAPK+M+F
Sbjct  375   LRNQLRSSSECVYNGRPTDICYLFARKFTVGTLDRLLRFAPKVMQF  420



>ref|XP_010470787.1| PREDICTED: uncharacterized protein LOC104750657 isoform X1 [Camelina 
sativa]
Length=465

 Score =   420 bits (1079),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 233/416 (56%), Positives = 283/416 (68%), Gaps = 24/416 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLT----SIKLYNAPLN-LINLLSAFLFFACGLTCGLIFSSYFKSFS--  200
             MKNQ   N+    +    + KL NA  +  +NLLS  L    G+  G++  S  + FS  
Sbjct  50    MKNQKDQNSSLPSSSPSLTAKLLNAQYHHFLNLLSYSLILCSGIIVGILLHSSLQDFSST  109

Query  201   --LNLQLITAAAADqplllpppqpERTPVAAV-------------GLQEFLKPPENAMHD  335
               L++Q I+       L LPPP P      +              GL+ F+KPPE  MHD
Sbjct  110   SSLSIQRISQLFVVSSLPLPPPSPPPPSPPSPPPPSPPSDEPEHDGLEHFIKPPEKLMHD  169

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             M DEELLWRASM PKIK YPF R PKVAFMF+T+G + LA LWE FF+G+EG +SIYVHS
Sbjct  170   MEDEELLWRASMEPKIKSYPFPRTPKVAFMFMTKGHLPLARLWERFFRGHEGHFSIYVHS  229

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
              PS N+S PE SVFHGR IPS+ V WG VNM+EAE+RLLANALLD SN+RFVLLSESCIP
Sbjct  230   YPSYNQSDPENSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALLDLSNERFVLLSESCIP  289

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF T+YSYL+NST   +E YD  G  GRGRY   M P ++L  WRKGSQWFEMDR +A
Sbjct  290   LFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLHHWRKGSQWFEMDRAMA  349

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSNRSLTWVDWSHGGSHPA  1049
             +E+ISD  Y+ LF  +C   CYADEHY+PT +NI+    R NSNR+LTWVDWS GG HP 
Sbjct  350   LEIISDRIYWPLFYSFCHHGCYADEHYIPTLLNIKSSLKRRNSNRTLTWVDWSKGGPHPN  409

Query  1050  RYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             R++RH+VT  F+E LR+G +C YNGEETNVCYLFARKF   +L RLLR +  ++ F
Sbjct  410   RFIRHEVTAEFMENLRSGGQCLYNGEETNVCYLFARKFLPTALDRLLRLSRTVLYF  465



>gb|AFK35806.1| unknown [Lotus japonicus]
Length=401

 Score =   417 bits (1072),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 228/366 (62%), Positives = 280/366 (77%), Gaps = 17/366 (5%)
 Frame = +3

Query  156   LTCGLIFSSYFKSFSLNLQL--ITAAAADqplllpppq------pERTPVAAV----GLQ  299
             +T G+I S Y+KS +++LQ    + +A+ +P  + PP        +R  V+ V    GL+
Sbjct  37    VTIGMIISFYYKSCTISLQFSQFSLSASQKPPPVSPPPPPILQPIKRLKVSHVSHIAGLK  96

Query  300   EFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQ  479
             EFL+P  + +HDMSDEELLWRASM PKI +YPF RVPKVAF+FL R  V LAPLWE+FF+
Sbjct  97    EFLQP-SHVIHDMSDEELLWRASMTPKIHDYPFRRVPKVAFLFLVRSNVPLAPLWEVFFR  155

Query  480   GNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSN  659
             G+EG++SIYVHS PS N S  +  +F GRRIPS+ V+WG VNM+EAERRLLANALLDFSN
Sbjct  156   GHEGYFSIYVHSHPSYNGSD-KSPLFRGRRIPSKIVEWGRVNMMEAERRLLANALLDFSN  214

Query  660   QRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRK  839
             QRFVL+SESCIPLFNF TIY YLMNST N++   D P + GRGRYK +MSP I LRQW K
Sbjct  215   QRFVLISESCIPLFNFSTIYFYLMNSTQNYVMAVDEPSAAGRGRYKIQMSPEITLRQWGK  274

Query  840   GSQWFEMDRDLAIEVISDDRYFSLFQYYCK--GSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             GSQWFEMDR+LA+EV+SD +YF +FQ YC    SC ADEHYL TFV+I+F + N+NRSLT
Sbjct  275   GSQWFEMDRELALEVVSDRKYFPVFQKYCNSGSSCCADEHYLQTFVSIKFWKRNANRSLT  334

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             WVDWS GG HPA+++R +VTV FLE+LR    C+YNG   NVCYLFARKF   SLTRL+R
Sbjct  335   WVDWSKGGPHPAKFVRPEVTVEFLESLR-NQTCKYNGNSKNVCYLFARKFLHTSLTRLMR  393

Query  1194  FAPKLM  1211
             FAP++M
Sbjct  394   FAPQVM  399



>ref|XP_003610779.1| hypothetical protein MTR_5g006920 [Medicago truncatula]
 gb|AES93737.1| core-2/I-branching enzyme [Medicago truncatula]
Length=422

 Score =   418 bits (1074),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 220/407 (54%), Positives = 275/407 (68%), Gaps = 32/407 (8%)
 Frame = +3

Query  93    LYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL-------------------  215
              + A L+L+N  +  L F+ GL  G+  +   K FS N Q+                   
Sbjct  17    FFKAQLHLLNFFTYALIFSFGLLIGMTLTFCVKDFSFNFQIQNFQDPSLSLNPPPHFSYS  76

Query  216   -------ITAAAADqplllpppqpERTP----VAAVGLQEFLKPPENAMHDMSDEELLWR  362
                    I+  + D          +  P    + + GL+E LK P+ AMHDM+++EL WR
Sbjct  77    PPILLSNISKTSYDHDNQTNISIKQNCPATHNLTSNGLEELLKIPK-AMHDMNEDELFWR  135

Query  363   ASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAP  542
             AS+ P I + PF + PKVAFMFLT+G V LAPLWE FF+GNEG YSIYVH  PS NE+  
Sbjct  136   ASLAPMIHKTPFKQTPKVAFMFLTKGPVLLAPLWEKFFKGNEGLYSIYVHPSPSFNETVY  195

Query  543   EGS-VFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIY  719
               S VFHGRRIPS++VKWG+ +MIEAERRLLANALLDFSNQRFVLLSE CIPLFNF TIY
Sbjct  196   NQSLVFHGRRIPSKKVKWGENSMIEAERRLLANALLDFSNQRFVLLSEHCIPLFNFFTIY  255

Query  720   SYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDR  899
             +YLM S   F+E  D+PG  GR RY  RM P+I+L QWRKG+QWF++DR LA+ ++SD  
Sbjct  256   TYLMKSKQTFVEANDIPGRVGRVRYNRRMCPLIQLSQWRKGAQWFQIDRYLAVRIVSDKP  315

Query  900   YFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVS  1079
             YFS+F+ YC   C +DEHYLPT V+I+F + NSNR+LTWVDWS GG+HPA++   DVT+ 
Sbjct  316   YFSMFKKYCHPRCISDEHYLPTLVSIKFWKRNSNRTLTWVDWSKGGAHPAKFSSKDVTID  375

Query  1080  FLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             FLE LR G  CEYNG+ TNVC+LFARKF   +L  LL FAPKLM+F+
Sbjct  376   FLERLRFGSTCEYNGKTTNVCHLFARKFGTQALDGLLTFAPKLMQFN  422



>ref|XP_010916430.1| PREDICTED: uncharacterized protein LOC105041248 [Elaeis guineensis]
 ref|XP_010916431.1| PREDICTED: uncharacterized protein LOC105041248 [Elaeis guineensis]
Length=402

 Score =   417 bits (1071),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 227/381 (60%), Positives = 269/381 (71%), Gaps = 13/381 (3%)
 Frame = +3

Query  111   NLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAA----------AADqplllppp  260
             ++I L S FL F  G   G+I S Y K+   + Q+                  PLL PPP
Sbjct  22    HMIKLFSRFLLFGLGFALGIISSFYLKTIPSSSQITEPTLLRSLTPSPEPPSPPLLSPPP  81

Query  261   qpERTPVAA--VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLT  434
                 T VA   VGL+ F++P +  MHDMSDEELLWRASMVPK++ +P+ R+PKVAF+FLT
Sbjct  82    ALNHTVVATERVGLKGFMEPGK-VMHDMSDEELLWRASMVPKMEAFPYKRIPKVAFLFLT  140

Query  435   RGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIe  614
             +GA+  APLWE FF+GNEG YSIYVH  PS  ES PE SVFHGRR+PS+ V+WG  NM+E
Sbjct  141   KGALPFAPLWEKFFKGNEGLYSIYVHPHPSYKESVPEDSVFHGRRVPSKVVRWGQPNMVE  200

Query  615   aerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRY  794
             AERRLLANALLD SNQRFVLLSESCIP+FNF TIYS+L+NST  FI  YD  G  GRGRY
Sbjct  201   AERRLLANALLDHSNQRFVLLSESCIPVFNFSTIYSHLINSTKTFIHSYDDLGPGGRGRY  260

Query  795   KHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVN  974
             K  MSP +KL QWRKGSQW E+DR+LAIE+ISD+ YF LF  YC+ SC  DEHYLPTFV+
Sbjct  261   KIAMSPQLKLEQWRKGSQWVEVDRNLAIEIISDETYFPLFLKYCRSSCLTDEHYLPTFVS  320

Query  975   IRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFA  1154
             ++FG  N+NRSLTW +WS   SHP  Y    VT+  LE +R G  C YN   T VC+LFA
Sbjct  321   MKFGWKNANRSLTWTEWSPHQSHPTLYQGSHVTIQLLERMRNGTTCSYNDRTTRVCFLFA  380

Query  1155  RKFSLHSLTRLLRFAPKLMRF  1217
             RKFS +SL RLL  APK+M F
Sbjct  381   RKFSPNSLDRLLTLAPKIMGF  401



>gb|KEH27363.1| core-2/I-branching enzyme [Medicago truncatula]
Length=387

 Score =   415 bits (1066),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 250/315 (79%), Gaps = 2/315 (1%)
 Frame = +3

Query  279   VAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAP  458
             + + GL+E LK P+ AMHDM+++EL WRAS+ P I + PF + PKVAFMFLT+G + LAP
Sbjct  74    LTSNGLEELLKIPK-AMHDMNEDELFWRASLAPMIHKTPFKQTPKVAFMFLTKGPILLAP  132

Query  459   LWEMFFQGNEGFYSIYVHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             LWE FF+GNEG YSIYVH  PS NE+   + SVF+GRRIPS+EVKWG+ +MIEAERRLLA
Sbjct  133   LWEKFFKGNEGLYSIYVHPSPSFNETVYNQSSVFYGRRIPSKEVKWGENSMIEAERRLLA  192

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSNQRFVLLSE CIPLFNF TIY+YLMNS   F+E  D+P   GRGRY  RM P+
Sbjct  193   NALLDFSNQRFVLLSEHCIPLFNFSTIYTYLMNSKQTFVEAIDIPSDVGRGRYNRRMRPL  252

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             I+L QWRKG+QWF++DR LA+ ++SD  YFS+F+ YC   CY+DEHYLPT V+I+F + N
Sbjct  253   IQLSQWRKGAQWFQIDRYLAVCIVSDKPYFSVFKKYCHPGCYSDEHYLPTLVSIKFWKRN  312

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHS  1175
             SNR+LTWVDWS GG+HPA++   DVT+ FLE LR G  CEYNG+ TNVC+LFARKF   +
Sbjct  313   SNRTLTWVDWSRGGAHPAKFSSKDVTIDFLERLRFGSTCEYNGKTTNVCHLFARKFGTQA  372

Query  1176  LTRLLRFAPKLMRFD  1220
             L  LL FAPKLM+F+
Sbjct  373   LDGLLTFAPKLMQFN  387



>ref|XP_009403975.1| PREDICTED: uncharacterized protein LOC103987406 [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   415 bits (1066),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 245/311 (79%), Gaps = 1/311 (0%)
 Frame = +3

Query  285   AVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
              +G   ++KP  N MHDM DEELLWRASMVP+I++ PF    KVAF+FLTRG + LAPLW
Sbjct  86    GIGQNGYVKP-RNFMHDMEDEELLWRASMVPRIRKLPFKHAQKVAFLFLTRGNLPLAPLW  144

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             E FF+GNEG YSIYVH+DPS + S P+ SVF+GRRIPSQ V+WG ++M++AERRLLANAL
Sbjct  145   EEFFKGNEGSYSIYVHTDPSFDWSVPKSSVFYGRRIPSQVVRWGTISMLDAERRLLANAL  204

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LDFSN+RFVLLSESCIPLFNFPT+YSYL+NST  F+EVYD PG  GRGRYK  + P I+ 
Sbjct  205   LDFSNRRFVLLSESCIPLFNFPTVYSYLINSTEVFVEVYDDPGPNGRGRYKSTLKPGIEF  264

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
             +QWRKGSQWF +DR LA+E++SD++YF LFQ YC+ SC ADEHYLPT +N+R   G +NR
Sbjct  265   KQWRKGSQWFAVDRGLAMEIVSDEKYFPLFQRYCRPSCLADEHYLPTLMNVRSFWGTANR  324

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             SLTW DWS GG HPAR  R+++T   L+ +R G  C YNG  T +CYLF RKF  +SL R
Sbjct  325   SLTWADWSKGGPHPARIGRNEITAELLQRMRNGSACSYNGRTTRICYLFGRKFLPNSLNR  384

Query  1185  LLRFAPKLMRF  1217
             L+R APKLM F
Sbjct  385   LVRLAPKLMDF  395



>ref|XP_007224741.1| hypothetical protein PRUPE_ppa024535mg [Prunus persica]
 gb|EMJ25940.1| hypothetical protein PRUPE_ppa024535mg [Prunus persica]
Length=410

 Score =   414 bits (1064),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 233/412 (57%), Positives = 286/412 (69%), Gaps = 25/412 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK Q+ N   P     K++N   +L+NLLS  L F  GLT G++  +  K FS  LQ   
Sbjct  1     MKAQDPN---PGSVFPKVFNVQRHLLNLLSYVLLFVGGLTLGVVLVN-LKDFSFGLQFAQ  56

Query  222   AAAADqp---------------lllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELL  356
             +  +                     P      TP   +GL+E+LKPP+   HDM+D ELL
Sbjct  57    SPFSTLSSPPPSNHSQILIMPNATAPTTSMSLTPDPRIGLKEYLKPPK-VFHDMNDTELL  115

Query  357   WRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNES  536
             WRASM P+I EYPF  VPK+AFMFL RG V LAPLWE FF+G++GFYSIYVHS+PS N+S
Sbjct  116   WRASMSPRIPEYPFHLVPKIAFMFLARGPVLLAPLWEKFFEGHQGFYSIYVHSEPSHNQS  175

Query  537   APEG-SVFHGRRIPSQ-EVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFP  710
             +  G SVFHGRRIPS  +VKWG V++IEAER LLANALLD SNQRFVLLSE+CIPL+NF 
Sbjct  176   SYAGSSVFHGRRIPSDLKVKWGTVSLIEAERLLLANALLDISNQRFVLLSEACIPLYNFS  235

Query  711   TIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVIS  890
             T+YSYL+NS   F+EVYD P + GRGRY     P I + QWRKGSQWFE+DRDLAIEV+S
Sbjct  236   TVYSYLINSKETFVEVYDDPSAVGRGRYYFVQYPGISVEQWRKGSQWFEIDRDLAIEVVS  295

Query  891   DDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDV  1070
             D +YF +++  C+G C+ADEHYLPTFVNI+FG  N+NR+LTWVDW+ GG HP  Y+  +V
Sbjct  296   DRKYFPVYR-RCRGECFADEHYLPTFVNIKFGAKNANRTLTWVDWAKGGPHPTEYMSLNV  354

Query  1071  TVSFLETLRT--GDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             TV  L  LRT  G +CEYNG  T+VC+LFARKF   +L  LLR APK+M F+
Sbjct  355   TVELLNGLRTGYGRRCEYNGRSTHVCFLFARKFPPSALDSLLRIAPKIMHFN  406



>ref|XP_010415458.1| PREDICTED: uncharacterized protein LOC104701464 [Camelina sativa]
Length=412

 Score =   414 bits (1063),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 204/311 (66%), Positives = 243/311 (78%), Gaps = 2/311 (1%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL+ F+KPPE  MHDM DEELLWRASM PKIK YPF R+PKVAFMF+T+G + LA LWE 
Sbjct  102   GLENFIKPPEKLMHDMEDEELLWRASMAPKIKSYPFPRIPKVAFMFMTKGHLPLARLWER  161

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+EG +SIYVHS PS N+S PE SVFHGR IPS+ V WG VNM+EAE+RLLANALLD
Sbjct  162   FFRGHEGLFSIYVHSYPSYNQSDPENSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALLD  221

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+RFVLLSESCIPLFNF T+YSYL+NST   +E YD  G  GRGRY   M P ++L  
Sbjct  222   ISNERFVLLSESCIPLFNFTTVYSYLINSTHTHVESYDQLGGVGRGRYSPLMQPHVQLHH  281

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFG--RGNSNR  1004
             WRKGSQWFEMDR +A+E+ISD  Y+ LF  YC   CYADEHY+PT +NI+ G  R NS R
Sbjct  282   WRKGSQWFEMDRAMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSGLNRRNSKR  341

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             +LTWVDWS GG HP R++RH+VT  F+ETLR+G +C YNG+ TN+CYLFARKF   +L R
Sbjct  342   TLTWVDWSKGGPHPNRFIRHEVTAEFMETLRSGGQCLYNGKVTNICYLFARKFLPTALDR  401

Query  1185  LLRFAPKLMRF  1217
             LLR +  ++ F
Sbjct  402   LLRLSRTVLYF  412



>ref|XP_007036567.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein, putative [Theobroma cacao]
 gb|EOY21068.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein, putative [Theobroma cacao]
Length=429

 Score =   414 bits (1064),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 199/308 (65%), Positives = 241/308 (78%), Gaps = 1/308 (0%)
 Frame = +3

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             ++EF +PPE  MHDM D+EL WRASM PKI+EYP  RVPK+AF+FLTRG V LAP+WE F
Sbjct  123   IEEFFQPPEITMHDMKDKELFWRASMAPKIQEYPIERVPKLAFLFLTRGKVLLAPIWEKF  182

Query  474   FQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF  653
             FQG++G YSIYVHS PS NE+ P+GSVF+GR+IPS+ V WG++NM+ AERRLLANALLD 
Sbjct  183   FQGHQGLYSIYVHSSPSFNETVPQGSVFYGRQIPSKNVSWGEMNMVAAERRLLANALLDI  242

Query  654   SNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQW  833
             SN+RFVL+SESCIPLFNF TIY YL++S  + +E +D+PG  GRGRY   M PV+ + QW
Sbjct  243   SNERFVLVSESCIPLFNFTTIYKYLIHSEKSHVESFDVPGPVGRGRYSSEMEPVVTIEQW  302

Query  834   RKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             RKGSQWFEMDR LAIEVISD  YF +F  +CK +CY DEHYLPTFV I F   N NR+LT
Sbjct  303   RKGSQWFEMDRFLAIEVISDQTYFPVFNLFCKDACYGDEHYLPTFVGINFLERNLNRTLT  362

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             +VDWS GG HP  +   DVT  FLE LR    C YNGE+ ++CYLFARKF+ ++L RLL 
Sbjct  363   YVDWSKGGPHPYTFESSDVTKEFLEKLRNS-SCYYNGEKADICYLFARKFAANTLDRLLS  421

Query  1194  FAPKLMRF  1217
             FAP++M F
Sbjct  422   FAPEVMYF  429



>ref|XP_006302341.1| hypothetical protein CARUB_v10020398mg [Capsella rubella]
 gb|EOA35239.1| hypothetical protein CARUB_v10020398mg [Capsella rubella]
Length=405

 Score =   412 bits (1060),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 204/311 (66%), Positives = 242/311 (78%), Gaps = 2/311 (1%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL+ F+KPPE  MHDM DEELLWRASM PKIK YPF R PKVAFMF+T+G + LA LW+ 
Sbjct  95    GLERFIKPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWDR  154

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+EG +SIYVHS PS N+S PE SVF GR +PS+ V WG VNM+EAE+RLLANALLD
Sbjct  155   FFRGHEGLFSIYVHSYPSYNQSDPEDSVFQGRHVPSKRVDWGYVNMVEAEQRLLANALLD  214

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+RFVLLSESCIPLFNF T+YSYLMNST   +E YD  G  GRGRY   M P ++L  
Sbjct  215   ISNERFVLLSESCIPLFNFTTVYSYLMNSTQTHVESYDQLGGVGRGRYSPLMQPHVQLHH  274

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSNR  1004
             WRKGSQWFEMDR +A+EVISD  Y+ LF  YC   CYADEHY+PT +NI+    R NSNR
Sbjct  275   WRKGSQWFEMDRAMALEVISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKTNLNRRNSNR  334

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             +LTWVDWS GG HP R++RH+VT  F+E LR+G +C YNGE+TN+CYLFARKF   +L R
Sbjct  335   TLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGECLYNGEKTNMCYLFARKFLPTALDR  394

Query  1185  LLRFAPKLMRF  1217
             LLRF+  ++ F
Sbjct  395   LLRFSRIVLHF  405



>ref|XP_006391143.1| hypothetical protein EUTSA_v10019817mg [Eutrema salsugineum]
 gb|ESQ28429.1| hypothetical protein EUTSA_v10019817mg [Eutrema salsugineum]
Length=415

 Score =   412 bits (1060),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 242/315 (77%), Gaps = 6/315 (2%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL+ FL+PPEN MHDM DEEL WRASM PKI  YPF R PKVAFMFLT+G + LAPLWE 
Sbjct  101   GLKRFLRPPENIMHDMEDEELFWRASMAPKITNYPFPRTPKVAFMFLTKGHLPLAPLWER  160

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+EG +SIYVHS PS N+S PEGSVFHGR+IPS+ V WG VNM+EAE+RLLANALLD
Sbjct  161   FFRGHEGLFSIYVHSYPSYNQSDPEGSVFHGRQIPSKRVDWGYVNMVEAEQRLLANALLD  220

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+RF+LLSESCIPLFNF T+YSYL NST   +E YD PG  GRGRY   M P ++LR 
Sbjct  221   ISNERFLLLSESCIPLFNFTTVYSYLTNSTQTHVESYDQPGGVGRGRYSPEMRPRVQLRH  280

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSNR  1004
             WRKGSQWFE++R LA+E+ISD  Y+ LF  YC   CYADEHY+PT +NI    G  N+NR
Sbjct  281   WRKGSQWFELNRALALEIISDKTYWPLFYRYCHHGCYADEHYIPTLLNINPSLGSRNTNR  340

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD----KCEYNGEETNVCYLFARKFSLH  1172
             +LTWVDWS GG HP R++R++VT  FLE LR G     KC YN E+TN CYLFARKF   
Sbjct  341   TLTWVDWSKGGPHPNRFIRYEVTKEFLEKLRGGGDENRKCFYNAEKTNNCYLFARKFLPT  400

Query  1173  SLTRLLRFAPKLMRF  1217
             +L RLLR AP ++ F
Sbjct  401   ALGRLLRLAPSVLYF  415



>ref|XP_004252429.1| PREDICTED: uncharacterized protein LOC101255566 [Solanum lycopersicum]
Length=324

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 252/314 (80%), Gaps = 2/314 (1%)
 Frame = +3

Query  279   VAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAP  458
             V  +GL +++KPPE AMHDM D+EL+WRASM+PK K +PF+R PKVAFMFL RG++ LAP
Sbjct  12    VGRIGLTDYIKPPE-AMHDMLDDELIWRASMIPKAKIFPFNRTPKVAFMFLARGSLPLAP  70

Query  459   LWEMFFQGNEGFYSIYVHSDPSCNESAPE-GSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             LWE FF+G+EG YSIY+HS PS    APE G +FHGRR+PS+ V WG+ +M++AERRLLA
Sbjct  71    LWERFFRGHEGHYSIYIHSQPSFKGDAPEEGPIFHGRRVPSKRVDWGEFSMVDAERRLLA  130

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLD SN+RFVLLSE+CIPL+NF TIY+Y+MNST  F+E YD  G  GRGRY  +M+P 
Sbjct  131   NALLDMSNERFVLLSEACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPW  190

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             + + QWRKGSQWFE+DR++A+++I+D +YF+LF+ +C+ +CY+DEHYLPTFV +R+   N
Sbjct  191   VTIEQWRKGSQWFELDREIALDMITDQKYFNLFKDFCRPACYSDEHYLPTFVTMRYWWKN  250

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHS  1175
              NR+LTWVDW+ GG HP ++ R +VT   L  +RTG +C YNGE TN+CYLFARKF   +
Sbjct  251   GNRTLTWVDWTKGGPHPTKFARTEVTKELLHQMRTGIQCMYNGEPTNMCYLFARKFLPSA  310

Query  1176  LTRLLRFAPKLMRF  1217
             L RLL+FAPK+M F
Sbjct  311   LDRLLKFAPKVMMF  324



>ref|XP_002535241.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27143.1| conserved hypothetical protein [Ricinus communis]
Length=286

 Score =   407 bits (1045),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 232/285 (81%), Gaps = 1/285 (0%)
 Frame = +3

Query  369   MVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEG  548
             M P+I +YPF RVPKVAFMFLTRG V +APLWE FF+G+EG YSIYVHS+PS NES PE 
Sbjct  1     MAPRIPQYPFERVPKVAFMFLTRGPVLMAPLWEKFFKGHEGLYSIYVHSNPSYNESEPES  60

Query  549   SVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYL  728
              VF+ RRIPS+EVKWG+VNMIEAERRLLANALLD SNQRFVLLSESCIPLFNF T+YSYL
Sbjct  61    PVFNSRRIPSKEVKWGNVNMIEAERRLLANALLDISNQRFVLLSESCIPLFNFSTVYSYL  120

Query  729   MNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFS  908
             MNS  NF+E YDL    GRGRY   MSP I + QWRKGSQWFEMDR+LA+EV+SD +YF 
Sbjct  121   MNSNKNFVEAYDLDNPVGRGRYNSHMSPEITIDQWRKGSQWFEMDRELAVEVVSDQKYFP  180

Query  909   LFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLE  1088
             +FQ YC+G+CYADEHYLPTFV+I+    NSNR+LTWVDWS GG HP R++R +VTV FLE
Sbjct  181   IFQKYCRGNCYADEHYLPTFVSIKHWERNSNRTLTWVDWSRGGPHPTRFIRTEVTVEFLE  240

Query  1089  TLRTGDKCEYNG-EETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              +R+  KC YNG   T  C+LFARKF   +L RLLRFAPK+M F+
Sbjct  241   NMRSSSKCLYNGNSSTTTCFLFARKFLPTALDRLLRFAPKVMHFN  285



>ref|XP_009105384.1| PREDICTED: uncharacterized protein LOC103831252 [Brassica rapa]
 emb|CDX96025.1| BnaA07g27060D [Brassica napus]
Length=416

 Score =   410 bits (1054),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 245/316 (78%), Gaps = 6/316 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             +GL++FL+PP+  MHDM +EELLWRASM PKIK YPF R PKVAFMFLT+G + LAPLWE
Sbjct  101   IGLEQFLRPPKKIMHDMEEEELLWRASMTPKIKNYPFRRTPKVAFMFLTKGHLPLAPLWE  160

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+G+EG +SIYVHS PS N++ PEGSVFHGR+IPS+ V WG VNM+EAE+RLLANALL
Sbjct  161   RFFRGHEGLFSIYVHSYPSYNQTDPEGSVFHGRQIPSKRVDWGYVNMVEAEQRLLANALL  220

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             D SN+RFVLLSESCIPLFNF T+YSYL  S    ++ YD  G  GRGRY   M P I+LR
Sbjct  221   DISNERFVLLSESCIPLFNFTTVYSYLTKSIQTHVQSYDELGGVGRGRYSPEMKPRIQLR  280

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSN  1001
              WRKGSQWFE+DR +A+E+ISD  Y+ LF  YC   CY DEHY+PT +NI+   GR NSN
Sbjct  281   HWRKGSQWFELDRAMALEIISDKIYWPLFYRYCHHGCYTDEHYIPTLLNIKSSLGRRNSN  340

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD----KCEYNGEETNVCYLFARKFSL  1169
             R+LTWVDWS GG HP R++R++VT  FL  LR+G     +C +NGE+TN+CYLFARKF  
Sbjct  341   RTLTWVDWSKGGPHPNRFIRYEVTEEFLVKLRSGGEENRQCYHNGEKTNICYLFARKFLP  400

Query  1170  HSLTRLLRFAPKLMRF  1217
              +L RLLR AP ++ F
Sbjct  401   TALGRLLRLAPTVLYF  416



>ref|NP_177006.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AAF26043.1|AC015986_6 hypothetical protein; 24280-21634 [Arabidopsis thaliana]
 gb|AAU44423.1| hypothetical protein AT1G68390 [Arabidopsis thaliana]
 gb|AAX23796.1| hypothetical protein At1g68390 [Arabidopsis thaliana]
 gb|AEE34788.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
Length=408

 Score =   410 bits (1053),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 201/311 (65%), Positives = 241/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL+ F++PPE  MHDM DEELLWRASM PKIK YPF R PKVAFMF+T+G + LA LWE 
Sbjct  98    GLKSFIEPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWER  157

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+EG ++IYVHS PS N+S PE SVF GR IPS+ V WG VNM+EAE+RLLANALLD
Sbjct  158   FFRGHEGLFTIYVHSYPSYNQSDPEDSVFRGRHIPSKRVDWGYVNMVEAEQRLLANALLD  217

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+RFVLLSESCIPLFNF T+YSYL+NST   +E YD  G  GRGRY   M P ++LR 
Sbjct  218   ISNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLRH  277

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSNR  1004
             WRKGSQW E+DR +A+E+ISD  Y+ LF  YC   CYADEHY+PT +NI+    R NSNR
Sbjct  278   WRKGSQWIEVDRAMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSSLKRRNSNR  337

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             +LTWVDWS GG HP R++RH+VT  F+E LR+G +C YNGEETN+CYLFARKF   +L R
Sbjct  338   TLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGECLYNGEETNICYLFARKFLPTALDR  397

Query  1185  LLRFAPKLMRF  1217
             LLR +  ++ F
Sbjct  398   LLRLSRTVLHF  408



>gb|EPS59287.1| hypothetical protein M569_15522 [Genlisea aurea]
Length=387

 Score =   409 bits (1050),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 219/392 (56%), Positives = 271/392 (69%), Gaps = 25/392 (6%)
 Frame = +3

Query  99    NAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTP  278
               P  ++ + S   FFA GL+ G+IF   +K+FS NLQ +T           P + ER P
Sbjct  2     GCPHQILTVFSFLAFFAFGLSIGIIFCINYKTFSFNLQ-VTNGQFSIVTAKLPQELERPP  60

Query  279   VAAVGL-----------------QEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRV  407
                + +                 +E+L    +   +M+  E+  RAS +  + +  F  V
Sbjct  61    TVPIPIPDETSHSNATESDGDRRREYL----DETREMNYAEIFRRASRI--LPDSDFREV  114

Query  408   PKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEV  587
             PKVAFMFLT+G V LAPLWE FF+G  G YS+YVH DP  N S PEGSVF GRRI SQ V
Sbjct  115   PKVAFMFLTKGPVILAPLWEEFFKGYRGLYSVYVHCDPGYNGSEPEGSVFRGRRIHSQRV  174

Query  588   KWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDL  767
              WG VNM+EAERRLLANALLD SNQRFVLLSESCIPL+NF T+YSYL+NS+  F+E+YDL
Sbjct  175   DWGKVNMVEAERRLLANALLDSSNQRFVLLSESCIPLYNFSTVYSYLLNSSQTFVELYDL  234

Query  768   PGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYAD  947
             PG+ GRGRY  +MSP I++ QWRKGSQWF  DR LAIE+ISD  Y+ +F+ YC GSCYAD
Sbjct  235   PGAVGRGRYNPKMSPTIRIHQWRKGSQWFAADRRLAIEIISDRTYWPVFRRYCNGSCYAD  294

Query  948   EHYLPTFVNIR-FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNG  1124
             EHYLPTFV +R FGR N+NR+LTWVDWS GG HPA+++R DVT  FL+ LR   +CEYNG
Sbjct  295   EHYLPTFVLMREFGRRNANRTLTWVDWSRGGPHPAKFIRTDVTPEFLQRLRAAGECEYNG  354

Query  1125  EETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              +  VC+LFARKF+  +LTRLLRFAP++M FD
Sbjct  355   RKGGVCFLFARKFTESTLTRLLRFAPRVMMFD  386



>gb|AHL38887.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=408

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/311 (65%), Positives = 240/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL+ F++PPE  MHDM DEELLWRASM PKIK YPF R PKVAFMF+T+G + LA LWE 
Sbjct  98    GLKSFIEPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWER  157

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+EG ++IYVHS PS N+S PE SVF GR IPS+ V WG VNM+EAE+RLLANALLD
Sbjct  158   FFRGHEGLFTIYVHSYPSYNQSDPEDSVFRGRHIPSKRVDWGYVNMVEAEQRLLANALLD  217

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+RFVLLSESCIPLFNF T+YSYL+NST   +E YD  G  GRGRY   M P ++LR 
Sbjct  218   ISNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLRH  277

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSNR  1004
             WRKGSQW E DR +A+E+ISD  Y+ LF  YC   CYADEHY+PT +NI+    R NSNR
Sbjct  278   WRKGSQWIEADRAMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSSLKRRNSNR  337

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             +LTWVDWS GG HP R++RH+VT  F+E LR+G +C YNGEETN+CYLFARKF   +L R
Sbjct  338   TLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGECLYNGEETNICYLFARKFLPTALDR  397

Query  1185  LLRFAPKLMRF  1217
             LLR +  ++ F
Sbjct  398   LLRLSRTVLHF  408



>emb|CDY59035.1| BnaCnng34190D [Brassica napus]
Length=421

 Score =   409 bits (1051),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 244/316 (77%), Gaps = 6/316 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             +GL++FL+PP+  MHDM +EELLWRASM PKIK YPF R PKVAFMFLT+G + LAPLWE
Sbjct  106   IGLEQFLRPPKKIMHDMEEEELLWRASMTPKIKNYPFPRTPKVAFMFLTKGHLPLAPLWE  165

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+G+EG +SIYVHS PS N++ PEGSVFHGR IPS+ V WG VNM+EAE+RLLANALL
Sbjct  166   RFFRGHEGLFSIYVHSYPSYNQTDPEGSVFHGRLIPSKRVDWGYVNMVEAEQRLLANALL  225

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             D SN+RFVLLSESCIPLFNF T+YSYL  ST   +E YD     GRGRY   M P I+LR
Sbjct  226   DISNERFVLLSESCIPLFNFTTVYSYLTKSTQTHVESYDELSGVGRGRYSPEMKPRIQLR  285

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSN  1001
              WRKGSQWFE+DR +A+E+ISD  Y+ LF  YC   CY DEHY+PT +NI+   GR NSN
Sbjct  286   HWRKGSQWFELDRAMALEIISDKIYWPLFYRYCHHGCYTDEHYIPTLLNIKSSLGRRNSN  345

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD----KCEYNGEETNVCYLFARKFSL  1169
             R+LTWVDWS GG HP R++R++VT  FL  LR+G     +C +NGE+TN+CYLFARKF  
Sbjct  346   RTLTWVDWSKGGPHPNRFIRYEVTEEFLLKLRSGGEENRQCYHNGEKTNICYLFARKFLP  405

Query  1170  HSLTRLLRFAPKLMRF  1217
              +L RLLR AP ++ F
Sbjct  406   TALGRLLRLAPTVLYF  421



>ref|XP_010513660.1| PREDICTED: uncharacterized protein LOC104789704 [Camelina sativa]
Length=407

 Score =   407 bits (1047),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 240/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL+ F+KPPE  MHDM DEELLWRASM PKIK YPF R PKVAFMF+T+G + LA LWE 
Sbjct  97    GLEHFIKPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWER  156

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+E  +SIYVHS PS  +S PE SVFHGR IPS+ V WG VNM+EAE+RLLANALLD
Sbjct  157   FFRGHEDLFSIYVHSYPSYYQSDPENSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALLD  216

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+RFVLLSESCIPLFNF T+YSYL+NST   +E YD  G  GRGRY   M P ++L  
Sbjct  217   LSNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLHH  276

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFG--RGNSNR  1004
             WRKGSQWFEMDR +A+E+ISD  Y+ LF  YC   CYADEHY+PT +NI+ G  R NS R
Sbjct  277   WRKGSQWFEMDRAMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSGLNRRNSKR  336

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             +LTWVDWS GG HP R++RH+VT  F+ETLR+G +C YNG+ TN+CYLFARKF   +L R
Sbjct  337   TLTWVDWSKGGPHPNRFIRHEVTAEFMETLRSGGQCLYNGKVTNICYLFARKFLPTALDR  396

Query  1185  LLRFAPKLMRF  1217
             LLR +  ++ F
Sbjct  397   LLRLSRTVLYF  407



>gb|EYU41282.1| hypothetical protein MIMGU_mgv1a010939mg [Erythranthe guttata]
Length=297

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 239/297 (80%), Gaps = 0/297 (0%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             MHDM +EEL+WRASM PK++EYPF R PKVAFMFL +  + +APLWE+FF+G++G +SIY
Sbjct  1     MHDMKEEELIWRASMKPKVREYPFRRTPKVAFMFLAKRDLPMAPLWELFFRGHQGLFSIY  60

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VHS PS N + P  SVF+GRRIPS+EV WG+ +MIEAERRLLANALLD SNQRFVLLSE+
Sbjct  61    VHSQPSYNATVPPDSVFYGRRIPSKEVAWGEFSMIEAERRLLANALLDVSNQRFVLLSEA  120

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF TIY+YLM STT+F+E YDL G  GRGRY   M P + L  WRKG+QWFEMDR
Sbjct  121   CIPLFNFKTIYNYLMESTTSFVESYDLLGPVGRGRYDSHMMPYVTLEDWRKGAQWFEMDR  180

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
             +LA+EVI+D  Y+S+F+ YCK +CY+DEHYLPT +  +F   N+NR+LTWVDWS GG HP
Sbjct  181   ELAVEVIADRIYYSVFKKYCKPACYSDEHYLPTMITKKFPTKNANRTLTWVDWSRGGPHP  240

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              +++R D++   L  +RTG +C YNG  TNVCYLFARKF++++L RLLRFAP +M F
Sbjct  241   LKFIRTDISPDMLYRMRTGKQCLYNGNPTNVCYLFARKFTVNALDRLLRFAPMVMHF  297



>ref|XP_009127627.1| PREDICTED: uncharacterized protein LOC103852476 [Brassica rapa]
 emb|CDY44904.1| BnaA02g13780D [Brassica napus]
Length=410

 Score =   407 bits (1045),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 243/316 (77%), Gaps = 6/316 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             VGL+ FL+ P+  MHDM DEELLWRASM PKI+ YPF R PKVAFMFLT+G + LAPLWE
Sbjct  95    VGLKGFLRSPKKIMHDMEDEELLWRASMAPKIRSYPFYRTPKVAFMFLTKGHLPLAPLWE  154

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+G+E  ++IYVHS PS NES PEGSVFHGR+IPS+ V WG VNM+EAE+RLLANALL
Sbjct  155   KFFKGHEELFNIYVHSYPSNNESYPEGSVFHGRQIPSKRVDWGYVNMVEAEQRLLANALL  214

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             D SN+RFVLLSESCIPLFNF T+YSYL  ST   +E YD  G  GRGRY   M P ++LR
Sbjct  215   DISNERFVLLSESCIPLFNFTTVYSYLTTSTQTHVESYDQLGGVGRGRYSPEMKPRVQLR  274

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSN  1001
              WRKGSQWFE+DR +A+E+ISD  Y+ LF  YC   CYADEHY+PT +NI+   G  NSN
Sbjct  275   HWRKGSQWFELDRAMALEIISDTTYWPLFYRYCHHGCYADEHYIPTLLNIKSSLGGRNSN  334

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD----KCEYNGEETNVCYLFARKFSL  1169
             R+LTWVDW++GG HP R++R++VT   L  LR GD    +C +NGE+TNVCYLFARKF  
Sbjct  335   RTLTWVDWTNGGPHPTRFIRYEVTEELLVKLRNGDDKNRQCYHNGEKTNVCYLFARKFLP  394

Query  1170  HSLTRLLRFAPKLMRF  1217
              +L RLLR AP ++ F
Sbjct  395   TALGRLLRLAPSVLYF  410



>emb|CDX81507.1| BnaC02g18110D [Brassica napus]
Length=410

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 243/316 (77%), Gaps = 6/316 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             VGL+ FL+ P+  MHDM DEELLWRASM PKI+ YPF R PKVAFMFLT+G + LAPLWE
Sbjct  95    VGLKVFLRSPKKIMHDMEDEELLWRASMAPKIRSYPFYRTPKVAFMFLTKGYLPLAPLWE  154

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+G+E  ++IYVHS PS NES PEGSVFHGR+IPS+ V+WG VNM+EAE+RLLANALL
Sbjct  155   KFFRGHEDLFNIYVHSYPSNNESYPEGSVFHGRQIPSKRVEWGYVNMVEAEQRLLANALL  214

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             D SN+RFVLLSESCIPLFNF T+YSYL  ST   +E YD  G  GRGRY   M P ++LR
Sbjct  215   DISNERFVLLSESCIPLFNFTTVYSYLTTSTQTHVESYDQLGGVGRGRYSPEMKPGVQLR  274

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR--FGRGNSN  1001
              WRKGSQWFE+DR +A+E+ISD  Y+ LF  YC   CYADEHY+PT +NI+   GR NSN
Sbjct  275   HWRKGSQWFELDRAMALEIISDTTYWPLFYRYCHHGCYADEHYIPTLLNIKSSLGRRNSN  334

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD----KCEYNGEETNVCYLFARKFSL  1169
             R+LTWVDW +GG HP R++R++VT   L  LR G     +C +NGE+TNVCYLFARKF  
Sbjct  335   RTLTWVDWRNGGPHPTRFIRYEVTEELLVKLRNGGGENRQCYHNGEKTNVCYLFARKFLP  394

Query  1170  HSLTRLLRFAPKLMRF  1217
              +L RLLR AP ++ F
Sbjct  395   TALGRLLRLAPSVLYF  410



>ref|XP_006353820.1| PREDICTED: uncharacterized protein LOC102581987 [Solanum tuberosum]
Length=325

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 251/314 (80%), Gaps = 2/314 (1%)
 Frame = +3

Query  279   VAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAP  458
             V  +GL +++KPPE AMHDM D+EL+WRASMVPK K +PF+R PKVAFMFL RG++ LAP
Sbjct  12    VGRIGLTDYIKPPE-AMHDMMDDELIWRASMVPKAKIFPFNRTPKVAFMFLARGSLPLAP  70

Query  459   LWEMFFQGNEGFYSIYVHSDPSCNESAPE-GSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             LWE FF+G+EG YSIY+HS PS    APE G +FH RR+PS+ V WG+ +M++AERRLLA
Sbjct  71    LWERFFKGHEGRYSIYIHSQPSFKGDAPEEGPIFHARRVPSKRVDWGEFSMVDAERRLLA  130

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLD SN+RFVLLSE+CIPL+NF TIY+Y+MNST  F+E YD  G  GRGRY  +M+P 
Sbjct  131   NALLDMSNERFVLLSEACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPW  190

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             + + QWRKGSQWFE+DR++A+++I+D ++F+LF+ +C+ +CY+DEHYLPTFV +R+   N
Sbjct  191   VTIEQWRKGSQWFELDREIALDMITDTKFFNLFKDFCRPACYSDEHYLPTFVTMRYWWKN  250

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHS  1175
              NR+LTWVDW+ GG HP ++ R +VT   L  +RTG +C YNGE T++CYLFARKF   +
Sbjct  251   GNRTLTWVDWTKGGPHPTKFARTEVTRELLHQMRTGIQCMYNGEPTSMCYLFARKFLPSA  310

Query  1176  LTRLLRFAPKLMRF  1217
             L RLL+FAPK+M F
Sbjct  311   LDRLLKFAPKVMMF  324



>ref|XP_010678016.1| PREDICTED: uncharacterized protein LOC104893585 [Beta vulgaris 
subsp. vulgaris]
Length=389

 Score =   404 bits (1039),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 221/398 (56%), Positives = 273/398 (69%), Gaps = 22/398 (6%)
 Frame = +3

Query  60    NNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADq  239
             NN P   ++ KL N  +NL +L+S  + FA GLT G  F  +  S S    L+T      
Sbjct  3     NNIPTNSSTYKLLNVHINLNHLISYLVIFAFGLTIGSSFLRHDFSPSYTPPLMTLKLLSV  62

Query  240   plllpppqpERTPVAAVGLQEF--------LKPPENAMHDMSDEELLWRASMVPKIKEYP  395
                        TP ++  L +F             N MH+M DEELLWRASMVPKI    
Sbjct  63    -----------TPSSSSTLDQFNVSSSSMSNSTKINYMHEMEDEELLWRASMVPKIGGEN  111

Query  396   FSR---VPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGR  566
             +S      K+AF+FL RG++ LAPLWEMFF+G+  +Y+IYVHS PS NES P  SVFHGR
Sbjct  112   YSSKFVTNKIAFLFLVRGSLPLAPLWEMFFKGHGDYYTIYVHSLPSYNESYPTNSVFHGR  171

Query  567   RIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTN  746
             RIPS+EV+WG  NM+EAERRLLANALLD SNQRF+LLSESCIPLFNF TIYSYL+NS  +
Sbjct  172   RIPSKEVEWGKFNMVEAERRLLANALLDVSNQRFILLSESCIPLFNFSTIYSYLINSKKS  231

Query  747   FIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYC  926
             ++E YD   STGRGRY + M P ++L QWRKGSQWFEMDR +A++VISD+ YF+LFQ +C
Sbjct  232   YVEAYDSDSSTGRGRYSYHMMPQVRLSQWRKGSQWFEMDRAVAVKVISDEEYFTLFQKFC  291

Query  927   KGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD  1106
                CY DEHYLPTF++I F   NSNRSLTWVDWS  G HP  + R  VT   L++LR+  
Sbjct  292   TRGCYGDEHYLPTFLSIEFWWRNSNRSLTWVDWSKTGPHPGVFQRPQVTPQLLQSLRSNG  351

Query  1107  KCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              CEYNG +T++C+LFARKF   +LTRLLRFAP +M+F+
Sbjct  352   TCEYNGGKTHICFLFARKFMPGTLTRLLRFAPPIMKFN  389



>ref|XP_008243418.1| PREDICTED: uncharacterized protein LOC103341652 [Prunus mume]
Length=410

 Score =   404 bits (1037),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 281/413 (68%), Gaps = 25/413 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLIT  221
             MK Q+ N   P     K++N   +L+NLLS  L F  GLT G++  +  K FS  LQ   
Sbjct  1     MKAQDPN---PGSVFPKVFNVQRHLLNLLSYVLLFVGGLTLGVVIVN-LKDFSFGLQFAQ  56

Query  222   AAAADqplllpppqpE---------------RTPVAAVGLQEFLKPPENAMHDMSDEELL  356
             +  +      P    +                TP   +GL E+LKP     HDM+D ELL
Sbjct  57    SPFSTLSSPPPSNHSQILIMPNATAPTTSMILTPDHRIGLTEYLKP-LKVFHDMNDTELL  115

Query  357   WRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNES  536
             WRASM P+I EYPF  +PK+AFMFL RG V LAPLWE FF+G++GFYSIYVHS+PS N+ 
Sbjct  116   WRASMSPRIPEYPFHLIPKIAFMFLARGPVLLAPLWEKFFEGHQGFYSIYVHSEPSHNQP  175

Query  537   APEGS-VFHGRRIPSQ-EVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFP  710
             +  GS VFHGRRIPS  +VKWG V++IEAER LLANALLD SNQRFVLLSE+CIPL+NF 
Sbjct  176   SYAGSSVFHGRRIPSDLKVKWGTVSLIEAERLLLANALLDISNQRFVLLSEACIPLYNFS  235

Query  711   TIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVIS  890
             T+YSYL+NS   F+EVYD P + GRGRY     P I + QWRKGSQWFE+DRDLAIEV+S
Sbjct  236   TVYSYLINSKETFVEVYDDPSAVGRGRYYFVQYPGISVDQWRKGSQWFEIDRDLAIEVVS  295

Query  891   DDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDV  1070
             D +YF ++ + C+G C+ADEHYLPTFVNI+FG  N+NR+LTWVDW+  G HP  Y+   V
Sbjct  296   DRKYFPVY-FRCRGECFADEHYLPTFVNIKFGAKNANRTLTWVDWAKSGPHPTEYMSSTV  354

Query  1071  TVSFLETLRT--GDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
             TV  L  LRT  G +CEYNG  T+VC+LFARKF   +L  LLR APK+M F+ 
Sbjct  355   TVELLNGLRTGYGRRCEYNGRSTHVCFLFARKFPPSALDSLLRIAPKIMHFNH  407



>ref|XP_008340286.1| PREDICTED: uncharacterized protein LOC103403235 [Malus domestica]
Length=412

 Score =   404 bits (1037),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 272/401 (68%), Gaps = 27/401 (7%)
 Frame = +3

Query  90    KLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFS---------------------LN  206
             K +N   +L NLLS FL F  GLT G++ S+  K FS                     ++
Sbjct  14    KSFNLQRHLRNLLSHFLLFVFGLTLGVVHSN-LKEFSFGSLQFAQFPFSPMSPPPPSNIS  72

Query  207   LQLITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIK  386
               L+  A +    ++       +    +GL+++LKPP+ A HDM++ ELLWRASM P+I 
Sbjct  73    KTLMPNATSPTISVVATNTSASSSPPRIGLKDYLKPPK-AFHDMNNSELLWRASMTPRIP  131

Query  387   EYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESA-PEGSVFHG  563
             EYPF  VPKVAFMFLTRG V LAPLWE FF G++GFYSIYVHS PS N S+  E  VF G
Sbjct  132   EYPFHLVPKVAFMFLTRGPVVLAPLWEKFFAGHQGFYSIYVHSSPSYNHSSYTETPVFRG  191

Query  564   RRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTT  743
             RRIPSQEV+WG V++IEAERRLLANALLD SNQRFVLLSE+CIPL+NF T+YSYLMNST 
Sbjct  192   RRIPSQEVEWGKVSLIEAERRLLANALLDISNQRFVLLSEACIPLYNFSTVYSYLMNSTQ  251

Query  744   NFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYY  923
              F+EVYD P   GRGRY+    P I + QWRKGSQWF+ DRDLA+E +SD +YF +F   
Sbjct  252   TFVEVYDDPSGVGRGRYELSDYPGITIDQWRKGSQWFQADRDLALEFVSDRKYFPVFM-K  310

Query  924   CKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRT-  1100
             CK  C+ADEHYLPTFV ++FG  N+NR+LTWVDW  GG HP  Y   +VT   L  LR  
Sbjct  311   CKDYCFADEHYLPTFVYMKFGAKNANRTLTWVDWEKGGPHPTEYKSENVTAELLSDLRNG  370

Query  1101  -GDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              G KCEYNG  T+VC+LFARKF   +L  LL+FA + + F+
Sbjct  371   FGRKCEYNGRSTDVCFLFARKFPPTALDNLLKFARESIHFN  411



>gb|KDP20145.1| hypothetical protein JCGZ_05914 [Jatropha curcas]
Length=404

 Score =   403 bits (1036),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 215/411 (52%), Positives = 274/411 (67%), Gaps = 26/411 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQL--  215
             MKN +H           +    L+L  L   FL   C L   L  S Y K+ S N Q   
Sbjct  1     MKNIDHQTK-------LIKGGQLHLHYLFIYFLALGCSLGFVLTVSFYLKNISFNCQFNQ  53

Query  216   ---------------ITAAAADqplllpppqpERTPVAAVGL--QEFLKPPENAMHDMSD  344
                            I+              PE   V+  GL   + +   +  +H+M+D
Sbjct  54    ISIESQITISPPPPTISLFLPISNKATAGIVPEDETVSLTGLISNQTIPRTDYVLHNMAD  113

Query  345   EELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPS  524
             +ELLWRASMV ++ E+PF   PKVAF+FLT+G++ LAPLWE+FF+G+EG YSIYVH  PS
Sbjct  114   KELLWRASMVARVSEFPFKLTPKVAFLFLTKGSLPLAPLWELFFKGHEGLYSIYVHYSPS  173

Query  525   CNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFN  704
              N + P  SVF+GRRIPS+E +WG+  ++EAERRLLA+ALLDFSNQ F+LLSESCIPLFN
Sbjct  174   FNGTVPVDSVFYGRRIPSKETRWGEFTIVEAERRLLASALLDFSNQYFILLSESCIPLFN  233

Query  705   FPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEV  884
             F TIY+YLM S  +F++ +DL G  GR RY  RMSP I L QWRKGSQWF+M R++AIEV
Sbjct  234   FSTIYNYLMGSEKSFVQSFDLRGPDGRYRYNPRMSPTIMLDQWRKGSQWFQMKRNIAIEV  293

Query  885   ISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRH  1064
             +SD +YF +FQ +CKG CYADEHYLPTFV I+F +  SNR+LTW+DW   G HP+ Y R 
Sbjct  294   VSDRKYFPVFQRFCKGYCYADEHYLPTFVGIKFLKKTSNRTLTWIDWPKRGPHPSHYGRM  353

Query  1065  DVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             DVTV+FLE+LR    C+YNG+E ++C+LFARKF  ++L RLLRFAPKLM+F
Sbjct  354   DVTVNFLESLRNKGPCDYNGKENSICFLFARKFVPNALPRLLRFAPKLMKF  404



>ref|XP_004167307.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223507, 
partial [Cucumis sativus]
Length=333

 Score =   399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 244/314 (78%), Gaps = 5/314 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             VGL+EFLKPPE  MHDM DEELLWRASM+ +IK++PF RVPK+AFMFLT+G V LAPLWE
Sbjct  19    VGLEEFLKPPE-VMHDMDDEELLWRASMMARIKKFPFQRVPKIAFMFLTKGPVYLAPLWE  77

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKW-GDVNMIeaerrllanal  644
              FF+GNEG YS+YVHSDPS N S+PE   FHGRRIPS+   W G VNMIEAERRL++NAL
Sbjct  78    EFFKGNEGLYSVYVHSDPSYNHSSPEPPAFHGRRIPSKVKSWMGKVNMIEAERRLISNAL  137

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNST-TNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LD SN+RFVLLSESCIPLFNF T+YS+L+NST  +FI  YD P + GRGRY+++M P I 
Sbjct  138   LDISNERFVLLSESCIPLFNFSTVYSFLINSTMKSFIMSYDEPSNVGRGRYRNKMFPPIS  197

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
             L+QWRKGSQWFE+D   A+ V+SD +YF +FQ YCKG CY+DEHYLPT VN+     N N
Sbjct  198   LKQWRKGSQWFEIDETXAVAVVSDKKYFPVFQNYCKGQCYSDEHYLPTLVNVLGWDRNGN  257

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLR--TGDKCEYNGEETNVCYLFARKFSLHS  1175
             RSLTWVDWS GG HPARY R D+ V  ++ LR  TG+  +   E   VC+LFARKF+ ++
Sbjct  258   RSLTWVDWSKGGPHPARYSRSDIHVELIQRLRNQTGECRKSKMEGKGVCFLFARKFAPNA  317

Query  1176  LTRLLRFAPKLMRF  1217
             L RL+  APK M F
Sbjct  318   LERLVNIAPKAMYF  331



>ref|XP_009356310.1| PREDICTED: uncharacterized protein LOC103947180 [Pyrus x bretschneideri]
Length=412

 Score =   401 bits (1031),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 217/399 (54%), Positives = 271/399 (68%), Gaps = 27/399 (7%)
 Frame = +3

Query  96    YNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSL-NLQ--------------------  212
             +N   +L+N LS FL F  GLT G++ S+  K  S  +LQ                    
Sbjct  16    FNLQRHLLNYLSYFLLFVFGLTLGVVLSN-LKDLSFGSLQFPQIPFSPVSPPPPSNITEI  74

Query  213   LITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEY  392
             L+  A +    ++       +    +GL+++LKPP+ A HDM++ ELLWRASM P+I E+
Sbjct  75    LMPNATSPTTSVVATNTSVSSSPPRIGLKDYLKPPK-AFHDMNNAELLWRASMTPRIPEH  133

Query  393   PFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESA-PEGSVFHGRR  569
             PF  VPKVAFMFLTRG V LAPLWE FF G+ G YSIYVHS PS N S+  E  VF GRR
Sbjct  134   PFRLVPKVAFMFLTRGPVVLAPLWEKFFAGHHGLYSIYVHSSPSYNHSSYTETPVFRGRR  193

Query  570   IPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNF  749
             IPSQEV+WG V++IEAER +LANALLD SNQRFVLLSE+CIPL+NF T+YSYL+NST  F
Sbjct  194   IPSQEVEWGTVSLIEAERLVLANALLDISNQRFVLLSEACIPLYNFSTVYSYLINSTQTF  253

Query  750   IEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCK  929
             +EVYD P   GRGRY     P I + QWRKGSQWF+ DRDLA+E +SD +YF +F   CK
Sbjct  254   VEVYDNPNGDGRGRYGLSDYPGITIDQWRKGSQWFQADRDLALEFVSDQKYFPVFM-KCK  312

Query  930   GSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRT--G  1103
             G C++DEHYLPTFV+++FG  N+NR+LTWVDW  GG HP  Y   +VT   L +LR   G
Sbjct  313   GYCFSDEHYLPTFVSMKFGAKNANRTLTWVDWEKGGPHPTEYASENVTAELLSSLRNGFG  372

Query  1104  DKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              KCEY G  T+VC+LFARKF   +L  LL+FAP++M F+
Sbjct  373   RKCEYGGRSTDVCFLFARKFPPTALDYLLKFAPEIMHFN  411



>ref|XP_004300972.1| PREDICTED: uncharacterized protein LOC101293100 [Fragaria vesca 
subsp. vesca]
Length=371

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 223/382 (58%), Positives = 267/382 (70%), Gaps = 22/382 (6%)
 Frame = +3

Query  90    KLYNAPLNLINLLSAFLFFACGLTCG-LIFSSYFKSFSLNLQLITAAAADqplllpppqp  266
             K++N  L+L+NL+S FLFF  G T G L+ SSY ++ SL LQ    + A   L       
Sbjct  4     KVFNVKLHLLNLVSYFLFFIGGFTLGVLLTSSYLRNTSLTLQTDQFSVAKSYLSH-----  58

Query  267   ERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAV  446
                     GL+ +L+PP N MHDM+DEELLWRASM P+I   PF RVPKVAFMFLT+G V
Sbjct  59    -----VPTGLKAYLEPP-NVMHDMNDEELLWRASMAPRI---PFHRVPKVAFMFLTKGPV  109

Query  447   TLAPLWEMFFQGNEGFYSIYVHSDPSCNESA--PEGSVFHGRRIPSQEVKWGDVNMIeae  620
              LAPLWE FF+G++G YSIYVH DPS N S+  PE  +F GRRIPSQ VKW  VN+IEAE
Sbjct  110   HLAPLWEKFFKGHQGLYSIYVHPDPSYNASSSHPESPIFQGRRIPSQIVKWAQVNVIEAE  169

Query  621   rrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKH  800
             RRL+ANALLD SN RFVLLSE+CIPL+NF TIYSYL+NS   F+EV+D P S GRGRY  
Sbjct  170   RRLIANALLDISNLRFVLLSEACIPLYNFSTIYSYLLNSQEIFVEVFDDPSSVGRGRYNS  229

Query  801   RMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR  980
                P+I L QWRKGSQW E+DRD+A EVISD  YF  F+   + SC+ADEHYLPTFVN +
Sbjct  230   SYYPMITLDQWRKGSQWVEIDRDIATEVISDRTYFPAFRLGNR-SCFADEHYLPTFVNQK  288

Query  981   FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD--KCEYNGEETNVCYLFA  1154
             F   NSNRSLTWVDWS  G HP  Y  +  T   L+ LR G+  +C YN   +N+C+LFA
Sbjct  289   FSAKNSNRSLTWVDWSTHGPHPVEY--NSTTAELLDILRNGNGTRCLYNQRTSNICFLFA  346

Query  1155  RKFSLHSLTRLLRFAPKLMRFD  1220
             RKF   +L  LLR APK+M F+
Sbjct  347   RKFLPPALHSLLRLAPKIMHFN  368



>ref|XP_006341708.1| PREDICTED: uncharacterized protein LOC102599552 [Solanum tuberosum]
Length=414

 Score =   399 bits (1026),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 211/417 (51%), Positives = 282/417 (68%), Gaps = 29/417 (7%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLN-LINLLSAFLFFACGLTCGLIFSSYFKSFSLNL---  209
             MKN+         T+ KL++     L NL+S F+ F  GL  G+    Y +    N    
Sbjct  1     MKNEQQYQ----FTTTKLFSISQRYLHNLVSYFILFGSGLVIGITLFFYLQDLIPNTLQN  56

Query  210   -----QLI--TAAAADqplllpppqpERTPV-----------AAVGLQEFLKPPE--NAM  329
                  Q+I  T+     P        ++ P+           + +GL++F+K P+     
Sbjct  57    KLFFPQIIQLTSPPPPPPPPSLSQPQQQIPLVLNNENKILDPSRIGLKDFMKIPKLSTPK  116

Query  330   HDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYV  509
             HDM DEEL+ RA MVP++ + PF R PK+AFMFL RG++ LAPLWE FFQG+EG YSIY+
Sbjct  117   HDMKDEELISRAMMVPRVSDLPFKRKPKIAFMFLARGSLPLAPLWERFFQGHEGLYSIYI  176

Query  510   HSDPSCNESAP-EGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             HS PS N +AP EG +FHGRR+ S++V+WG  NM+EAERRLLANALLD SN+RFVLLSES
Sbjct  177   HSQPSFNGTAPQEGPIFHGRRVASKKVEWGKFNMVEAERRLLANALLDLSNERFVLLSES  236

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPL+NF TIY+Y++NS   F+E YDL    GRGRY  +M P++ L QWRKGSQWFE+DR
Sbjct  237   CIPLYNFTTIYNYIINSANTFMESYDLISPVGRGRYSKKMKPLVTLAQWRKGSQWFEVDR  296

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
             ++A+++ISD +Y  LF+ +C+ +CY+DEHYLPTFV +++   N NR+LTWVDW+ GG HP
Sbjct  297   EIAMDIISDQKYSHLFKRFCRPACYSDEHYLPTFVTMKYWWKNENRTLTWVDWAKGGPHP  356

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              +++R +VT   L  +R G KCEYNG  +N+CYLFARKF   +L RLLRFAPK+M+F
Sbjct  357   TKFIRPEVTEDLLNGMRNGTKCEYNGRPSNMCYLFARKFLPSTLDRLLRFAPKIMKF  413



>ref|XP_004160451.1| PREDICTED: uncharacterized protein LOC101227205 [Cucumis sativus]
 gb|KGN63836.1| hypothetical protein Csa_1G024220 [Cucumis sativus]
Length=397

 Score =   397 bits (1021),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 250/319 (78%), Gaps = 8/319 (3%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPK-IKEYPFSRVP----KVAFMFLTRGAVTL  452
             VGL+EFL PP   +HDM++EELLWRAS+VP+ I + P +       K+AF+FLT+  V+L
Sbjct  80    VGLKEFLNPPP-VLHDMTEEELLWRASLVPRRIPKLPSTETTTSTRKIAFLFLTKDGVSL  138

Query  453   APLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSV--FHGRRIPSQEVKWGDVNMIeaerr  626
             APLWE+FF+G  G YSIYVH  PS + ++   S   F+GR IPS+ VKWG+ +M+EAERR
Sbjct  139   APLWELFFKGYAGLYSIYVHRTPSSSSTSTVDSSSVFYGRSIPSKGVKWGEPSMMEAERR  198

Query  627   llanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRM  806
             LLANALLDFSN+RF+LLSESCIPLFNF T+Y+YLM S + FIE YDLPG  GRGRY  +M
Sbjct  199   LLANALLDFSNERFILLSESCIPLFNFSTVYNYLMGSKSTFIEAYDLPGPVGRGRYNPKM  258

Query  807   SPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFG  986
              P+IKL QWRKGSQWFEMDR +A +VISD +YFS+FQ +CK SCY DEHYLPTFV IRF 
Sbjct  259   RPIIKLHQWRKGSQWFEMDRTIASQVISDQKYFSVFQKFCKPSCYMDEHYLPTFVGIRFP  318

Query  987   RGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFS  1166
             + NSNR+LTWVDWS GG+HP R++R DVT+  L+ LR G  CEYNG +TN+C+LFARKF 
Sbjct  319   KTNSNRTLTWVDWSRGGAHPTRFVRTDVTLELLKRLRNGGHCEYNGVKTNLCHLFARKFM  378

Query  1167  LHSLTRLLRFAPKLMRFDE  1223
              +SL RLL FAPKLM F+ 
Sbjct  379   ANSLNRLLMFAPKLMHFNR  397



>ref|XP_004236422.2| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318627.1| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
Length=426

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/316 (59%), Positives = 247/316 (78%), Gaps = 3/316 (1%)
 Frame = +3

Query  279   VAAVGLQEFLKPPE--NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTL  452
             ++ + L++F++ P+     H M DE+L+WRA MVP + + PF+R PK+AFMFL RG++ L
Sbjct  110   LSGIRLKDFMETPKFSTPKHVMKDEDLIWRAMMVPSVSDLPFNRKPKIAFMFLARGSLPL  169

Query  453   APLWEMFFQGNEGFYSIYVHSDPSCNESAP-EGSVFHGRRIPSQEVKWGDVNMIeaerrl  629
             APLWE FFQG+EG YSIY+HS PS N SAP EG +FH RR+ S++V+WG  NM+EAERRL
Sbjct  170   APLWERFFQGHEGLYSIYIHSQPSFNGSAPQEGPIFHDRRVASKKVEWGKFNMVEAERRL  229

Query  630   lanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMS  809
             LANALLD SN+RFVLLSESCIPL++F TIY Y++NS   F+E YDL    GRGRY  +M 
Sbjct  230   LANALLDISNERFVLLSESCIPLYDFTTIYDYIINSANTFMESYDLISPVGRGRYNKKMK  289

Query  810   PVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGR  989
             P++ L QWRKGSQWFE+DR++AI++ISD +Y +LF+ +C+ +CY+DEHYLPTFV +++  
Sbjct  290   PLVTLAQWRKGSQWFEVDREIAIDIISDQKYSNLFKRFCRPACYSDEHYLPTFVTMKYWW  349

Query  990   GNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSL  1169
              N NR+LTWVDW+ GG HP +++R DVT   L  +R G KCEYNG+ +N+CYLFARKF  
Sbjct  350   KNENRTLTWVDWAKGGPHPTKFIRPDVTEDLLYGMRNGTKCEYNGQPSNMCYLFARKFLP  409

Query  1170  HSLTRLLRFAPKLMRF  1217
              +L RLLRFAPK+M+F
Sbjct  410   STLDRLLRFAPKIMKF  425



>ref|XP_009356309.1| PREDICTED: uncharacterized protein LOC103947179 [Pyrus x bretschneideri]
Length=405

 Score =   394 bits (1011),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 237/314 (75%), Gaps = 5/314 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
              GL+++LKPP+ A HDM++ ELLWRAS+ P+I EYPF  VPKVAFMFLT+G V LAPLWE
Sbjct  93    TGLKDYLKPPK-AFHDMNNAELLWRASITPRIPEYPFHFVPKVAFMFLTKGPVVLAPLWE  151

Query  468   MFFQGNEGFYSIYVHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
              FF G++G YSIYVHS PS N S+  E  VF GRRIPSQEV+WG V++I AER LLANAL
Sbjct  152   KFFAGHQGLYSIYVHSSPSYNHSSYTETPVFGGRRIPSQEVEWGKVSLIAAERLLLANAL  211

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SNQRFVLLSESCIPL+NF T+YSYLMNST  F+EV+D P   GRGRY+    P I +
Sbjct  212   LDVSNQRFVLLSESCIPLYNFSTVYSYLMNSTQTFVEVFDDPSGVGRGRYELSDYPGITI  271

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKGSQWF+ DRDLA+E +SD  YF +F   CKG C+ADEHYLPTFV I+FG  N+NR
Sbjct  272   DQWRKGSQWFQADRDLALEFVSDRTYFPVFM-KCKGYCFADEHYLPTFVYIKFGAKNANR  330

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRT--GDKCEYNGEETNVCYLFARKFSLHSL  1178
             +LTWVDW  GG HP  Y   +VT   L  LR   G KCEYNG  T+VC+LFARKF   +L
Sbjct  331   TLTWVDWEKGGPHPTEYASENVTAVLLSGLRNGFGRKCEYNGRSTDVCFLFARKFPPTAL  390

Query  1179  TRLLRFAPKLMRFD  1220
               LL+FAP +M F+
Sbjct  391   DNLLKFAPAIMHFN  404



>ref|XP_008453432.1| PREDICTED: uncharacterized protein LOC103494140 [Cucumis melo]
Length=299

 Score =   388 bits (996),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 196/299 (66%), Positives = 238/299 (80%), Gaps = 3/299 (1%)
 Frame = +3

Query  336   MSDEELLWRASMVPK-IKEYPFSRVP--KVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             M++EELLWRAS+VP+ I + P +     K+AF+FLT+  V+LAPLWE+FF+G  G YSIY
Sbjct  1     MTEEELLWRASLVPRRIPKLPSTETSRRKIAFLFLTKDGVSLAPLWELFFKGYAGLYSIY  60

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VH  PS N +    SVF+GR IPS+ VKWG+ +M+EAERRLLANALLDFSNQRF+LLSES
Sbjct  61    VHRSPSSNSTVDSSSVFYGRSIPSKGVKWGEPSMMEAERRLLANALLDFSNQRFILLSES  120

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF TIY+YLM+S + FIE YDLPG  GRGRY  +M P+I L QWRKGSQWFEMDR
Sbjct  121   CIPLFNFSTIYNYLMDSKSTFIEAYDLPGPVGRGRYSPKMRPIINLHQWRKGSQWFEMDR  180

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
              +A +V+SD +YF +FQ +CK SCY DEHYLPTFV IRF + NSNR+LTWVDWS GG+HP
Sbjct  181   TIASQVVSDQKYFPVFQKFCKPSCYMDEHYLPTFVGIRFSKSNSNRTLTWVDWSRGGAHP  240

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
              R++R DVTV  L+ LR+G  CEYNG +TN+C+LFARKF  +SL RLL FAPKLM F+ 
Sbjct  241   TRFIRTDVTVELLQRLRSGSHCEYNGVKTNLCHLFARKFMANSLNRLLMFAPKLMHFNR  299



>ref|XP_009358798.1| PREDICTED: uncharacterized protein LOC103949407 [Pyrus x bretschneideri]
Length=350

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 239/314 (76%), Gaps = 5/314 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
              GL+++LKPP+ A HDM++ ELLWRASM P+I EYPF  VPKVAFMFLTRG V LAPLWE
Sbjct  38    TGLKDYLKPPK-AFHDMNNSELLWRASMTPRIPEYPFHLVPKVAFMFLTRGPVVLAPLWE  96

Query  468   MFFQGNEGFYSIYVHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
              FF G++G YSIYVHS PS N S+  E  VF  RRIPSQEV+WG V++IEAERRLLANAL
Sbjct  97    KFFAGHQGLYSIYVHSSPSYNHSSYTETPVFRSRRIPSQEVEWGKVSLIEAERRLLANAL  156

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SNQRFVLLSE+CIPL+NF T+YSYLMNST  F+EVYD P   GRGRY+    P I +
Sbjct  157   LDISNQRFVLLSEACIPLYNFSTVYSYLMNSTQTFVEVYDDPSGVGRGRYELSDYPGITI  216

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKGSQWF+ DRDLA+E +SD +YF +F   CK  C+ADEHYLPTFV+++FG  N+NR
Sbjct  217   DQWRKGSQWFQADRDLALEFVSDRKYFPVFM-KCKDYCFADEHYLPTFVHMKFGAKNANR  275

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRT--GDKCEYNGEETNVCYLFARKFSLHSL  1178
             +LTWVDW  GG HP  Y   +VT   L  LR   G KCEYNG  T+VC+LFARKF   +L
Sbjct  276   TLTWVDWEKGGPHPTEYKSENVTAELLSGLRNGFGRKCEYNGRSTDVCFLFARKFPPTAL  335

Query  1179  TRLLRFAPKLMRFD  1220
               LL+FA +++ F+
Sbjct  336   DNLLKFAGEIIHFN  349



>gb|EPS62381.1| hypothetical protein M569_12413, partial [Genlisea aurea]
Length=371

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 241/314 (77%), Gaps = 5/314 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             VGL+E+L+PPE   HDM++EEL+WRASM   I  YPF R PKVAFMFL +  + LAPLWE
Sbjct  59    VGLKEYLRPPE-VFHDMTEEELMWRASMRAGIGTYPFDRRPKVAFMFLAKKGLPLAPLWE  117

Query  468   MFFQGNEGFYSIYVHSDPSCNES----APEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             +FF+GNEG +SIYVHS P  +      AP  SVFHGR IPS+ V+WG  +M+EAERRLLA
Sbjct  118   LFFRGNEGSFSIYVHSPPPSSSLPEWHAPPESVFHGRTIPSKAVEWGRYSMVEAERRLLA  177

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLD SNQRFVLLSESCIP++NF T+Y YL+ S  +F+E YD  G  GRGRY  RM P 
Sbjct  178   NALLDLSNQRFVLLSESCIPIYNFTTVYEYLVGSAESFVESYDEDGPVGRGRYNRRMRPH  237

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             + + QWRKG+QWFEMDR LA+EV++D  Y +LF+ +C+ SCY+DEHYLPTFV  +F R N
Sbjct  238   VTVEQWRKGAQWFEMDRGLAVEVVADRLYCNLFRRFCRPSCYSDEHYLPTFVTAKFARNN  297

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHS  1175
             SNR+LTWVDWS GG HP R+LR DV+   ++ LRTG +C YNG  TNVC+LFARKF+L +
Sbjct  298   SNRTLTWVDWSRGGPHPLRFLRSDVSPELVKRLRTGSRCVYNGRSTNVCHLFARKFTLGA  357

Query  1176  LTRLLRFAPKLMRF  1217
             L RLLRFAP LM F
Sbjct  358   LDRLLRFAPSLMYF  371



>ref|XP_007227633.1| hypothetical protein PRUPE_ppa022907mg [Prunus persica]
 gb|EMJ28832.1| hypothetical protein PRUPE_ppa022907mg [Prunus persica]
Length=378

 Score =   386 bits (991),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 215/374 (57%), Positives = 259/374 (69%), Gaps = 17/374 (5%)
 Frame = +3

Query  111   NLINLLSAFLFFACG-LTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA  287
              L NLLS FL F  G LT G+I + YF  FS + QL     +              P + 
Sbjct  14    KLFNLLSYFLLFVYGTLTLGIILT-YFTDFSFSQQLAQFPFSGM---------PSPPNSQ  63

Query  288   VGL-QEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
             + +  E++KPP+   H+M+D ELLWRASM P+I EYPF RVPKV FMF+TRG V LAPLW
Sbjct  64    LLIPNEYIKPPK-VFHNMNDTELLWRASMTPRISEYPFHRVPKVTFMFMTRGPVVLAPLW  122

Query  465   EMFFQGNEGFYSIYVHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
             E FF+G+ G YSIYVHS PS N S+ PE  VFHGRRIPSQEV+WG V+ IEAERRLLANA
Sbjct  123   EKFFKGHRGLYSIYVHSKPSYNASSHPESPVFHGRRIPSQEVEWGRVSQIEAERRLLANA  182

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLD +NQR VLLSESCIPL+NF T+YSYL++S   F+EVYD P   GR RY     P I 
Sbjct  183   LLDIANQRVVLLSESCIPLYNFYTVYSYLIHSNETFVEVYDDPSVDGRDRYYFIDYPGIT  242

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
             L QW KGSQWFE+DRDLAIEV+SD  YF LF   CKG C+A+EHYLPTFV+++F   ++ 
Sbjct  243   LDQWSKGSQWFEIDRDLAIEVVSDRIYFPLF-LRCKGECFAEEHYLPTFVHMKFAANSAY  301

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRT--GDKCEYNGEETNVCYLFARKFSLHS  1175
             RSLTW DW+ GG+HP  Y   +VT   L +LR   G +CEYNG  ++VC+LFARKF   +
Sbjct  302   RSLTWADWTKGGAHPTEYPSTNVTFELLNSLRNGYGRRCEYNGRSSDVCFLFARKFPPTT  361

Query  1176  LTRLLRFAPKLMRF  1217
             L  LLR AP +M F
Sbjct  362   LDGLLRIAPNIMHF  375



>gb|KDP29448.1| hypothetical protein JCGZ_18369 [Jatropha curcas]
Length=258

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/258 (72%), Positives = 219/258 (85%), Gaps = 0/258 (0%)
 Frame = +3

Query  450   LAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrl  629
             +APLWE FF+G+EG Y+IYVHS+PS NES PE  VFHGRRIPS++VKWG+VNMIEAERRL
Sbjct  1     MAPLWEKFFKGHEGLYTIYVHSNPSYNESFPESPVFHGRRIPSKDVKWGNVNMIEAERRL  60

Query  630   lanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMS  809
             LANALLD SNQRFVLLSE+CIPLFNF TIYSYL+NST NF+E YDL G  GRGRY H+MS
Sbjct  61    LANALLDISNQRFVLLSEACIPLFNFSTIYSYLINSTKNFVEAYDLEGPVGRGRYNHQMS  120

Query  810   PVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGR  989
             P I + QWRKGSQWFEMDR LAIEV+SD +YF +FQ YCKG+CYADEHYLPTFV+++  +
Sbjct  121   PQITIDQWRKGSQWFEMDRQLAIEVVSDQKYFPIFQKYCKGNCYADEHYLPTFVSMKHWQ  180

Query  990   GNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSL  1169
              NSNRSLTWVDWS GG HP R++R +VTV FLE LR+G KC YNG+ +++C+LFARKF  
Sbjct  181   RNSNRSLTWVDWSRGGPHPTRFIRTEVTVEFLEKLRSGSKCLYNGKSSSICFLFARKFLP  240

Query  1170  HSLTRLLRFAPKLMRFDE  1223
              +L RLLRFAPK M F++
Sbjct  241   TALDRLLRFAPKAMHFNK  258



>ref|XP_010694626.1| PREDICTED: uncharacterized protein LOC104907403 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   383 bits (983),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 189/305 (62%), Positives = 240/305 (79%), Gaps = 4/305 (1%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRV----PKVAFMFLTRGAVTLAPLWEMFFQG  482
             P    H M DEELLWRASMV KI++    +     PK+AFMFL RG + LAPLW+ FF G
Sbjct  52    PLPLAHGMDDEELLWRASMVHKIRDKELMKKKVPQPKIAFMFLVRGPLPLAPLWDKFFLG  111

Query  483   NEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQ  662
             +EG YSIYVH++P  N+S P+ S F+GRRIPS+EVKWG  NM+EAERRLLANALLD SN+
Sbjct  112   HEGLYSIYVHANPLYNQSYPKQSAFYGRRIPSKEVKWGKFNMVEAERRLLANALLDHSNE  171

Query  663   RFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKG  842
             RF+LLSESCIPLFNF T+YSYL+NST + I+VYDL G+TGRGRY + MSP+++L QWRKG
Sbjct  172   RFILLSESCIPLFNFSTVYSYLINSTKSHIQVYDLKGATGRGRYDYHMSPLVRLWQWRKG  231

Query  843   SQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVD  1022
             SQWFEM R+LAIEVISD +YF++F  +CK SCY DEHYLPT+V+I F + N+NR++TWVD
Sbjct  232   SQWFEMSRELAIEVISDKKYFTIFSKFCKNSCYGDEHYLPTYVSINFWKKNTNRTVTWVD  291

Query  1023  WSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAP  1202
             WS  G HP ++ R  VT + L+ LR+   CEYNG++TN+C+LFARKF   +L RL++F+ 
Sbjct  292   WSILGPHPGKFERPHVTPTLLQKLRSNYTCEYNGKKTNICFLFARKFMPGTLIRLMKFSR  351

Query  1203  KLMRF  1217
             K ++F
Sbjct  352   KFLKF  356



>ref|XP_006836850.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
 gb|ERM99703.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
Length=401

 Score =   384 bits (986),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 264/384 (69%), Gaps = 7/384 (2%)
 Frame = +3

Query  72    PLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQLITAAAADqpll  248
             PL+      +  + L+ ++S FL F CG+  GL  S++  + F+   +           +
Sbjct  23    PLMLQALFRDWSVGLVKVVSFFLVFICGIILGLAASAHVTRYFATKNEFFPVPRNSPNCV  82

Query  249   lpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMF  428
                 + E    + + ++ F+KP E  +H M+DEEL WRASMVPK +EYP+ RVPKVAFMF
Sbjct  83    KEIVEIE----SCLSMKGFIKP-EKLLHSMTDEELFWRASMVPKKREYPYKRVPKVAFMF  137

Query  429   LTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNM  608
             LTRG + LAP W+ FFQG+EG YS+YVH+ P    S    S F+GR+IPSQEVKWG +NM
Sbjct  138   LTRGPLPLAPFWDKFFQGHEGHYSVYVHTLPDYRLSVSTTSAFYGRQIPSQEVKWGTINM  197

Query  609   IeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRG  788
              + ERRLLANALLDFSN+RFVLLSESCIP++NFPT+Y+YL+ S  +F++ YD P   GRG
Sbjct  198   ADGERRLLANALLDFSNERFVLLSESCIPMYNFPTVYNYLITSKESFVDSYDDPSRYGRG  257

Query  789   RYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTF  968
             RY   M+P IKL QWRKGSQWFE  RD+A+ ++SD +Y+++F+ YCK SCY DEHY+PT+
Sbjct  258   RYSRNMAPDIKLHQWRKGSQWFEAHRDVAVNIVSDSKYYTIFKKYCKPSCYPDEHYIPTY  317

Query  969   VNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCY  1145
             +N+ +G  NSNRS+TWVDWS GG HPA +   D+T  F+  +R  G  C +N E T++CY
Sbjct  318   LNMFYGSLNSNRSVTWVDWSRGGPHPATFGGPDITEDFIFAIRNNGTTCFHNSEPTSLCY  377

Query  1146  LFARKFSLHSLTRLLRFAPKLMRF  1217
             LFARKF+  +L  LL  +  +M F
Sbjct  378   LFARKFAPSALGPLLNLSSTVMEF  401



>ref|XP_008351009.1| PREDICTED: uncharacterized protein LOC103414400, partial [Malus 
domestica]
Length=321

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 232/314 (74%), Gaps = 5/314 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
              GL+++LKPP NA HDM++ ELLWRAS+ P+I EYPF  VPKVAFMFLT+G V LAPLWE
Sbjct  9     TGLKDYLKPP-NAFHDMNNAELLWRASITPQIPEYPFHFVPKVAFMFLTKGPVVLAPLWE  67

Query  468   MFFQGNEGFYSIYVHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
              FF G++G YSIYVHS PS N S   E  VF GRRIPSQ V WG V++I AER LLANAL
Sbjct  68    KFFAGHQGLYSIYVHSSPSYNHSLYTETPVFGGRRIPSQXVXWGKVSLIAAERLLLANAL  127

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SNQRFVLLSESCIPL NF T+YSYLMNST  F+EV+D P   GRGRY+      I +
Sbjct  128   LDXSNQRFVLLSESCIPLXNFXTVYSYLMNSTQTFVEVFDDPSGVGRGRYELSDYXGITI  187

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKGS WF+ DRDLA+E +SD  YF +F   CKG C+ADEHYLPTFV I+FG  N+NR
Sbjct  188   DQWRKGSXWFQADRDLALEFVSDRIYFPVFM-KCKGYCFADEHYLPTFVYIKFGAKNANR  246

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRT--GDKCEYNGEETNVCYLFARKFSLHSL  1178
             +LTWVDW  GG HP  Y   +VT   L  LR   G KCEYNG  T+VC+LFARKF   +L
Sbjct  247   TLTWVDWEKGGPHPTEYASENVTAVLLSGLRNGFGRKCEYNGRXTDVCFLFARKFPPTAL  306

Query  1179  TRLLRFAPKLMRFD  1220
               LL+FAP++M F+
Sbjct  307   DNLLKFAPEIMHFN  320



>ref|XP_010537457.1| PREDICTED: uncharacterized protein LOC104812147 [Tarenaya hassleriana]
Length=398

 Score =   381 bits (979),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 244/313 (78%), Gaps = 4/313 (1%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             VGL++F++P +N MH M+DEELLWRASM P+ KE PFS+ PK+AF+FLTRG +  AP WE
Sbjct  87    VGLRDFVEP-KNVMHGMTDEELLWRASMKPERKETPFSQTPKIAFLFLTRGRLPFAPFWE  145

Query  468   MFFQGNEGFYSIYVH-SDPS-CNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
              FF+G+EGFYSIYVH SDP   +   PE S F+ RRIPS+EV+WG  +++EAERRLLANA
Sbjct  146   KFFKGHEGFYSIYVHTSDPRHVDHDTPETSPFYRRRIPSKEVEWGKFSLMEAERRLLANA  205

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLD SN+RFVLLSE+ +P+F+F T+YS+L+NS  +F++++D  G TG+GRY  RM+P++ 
Sbjct  206   LLDSSNRRFVLLSEAGVPIFDFSTVYSHLINSHHSFVDLFDDHGPTGQGRYSRRMAPLVT  265

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
             LR+WRKGSQWFEMDR+LA+ V+SD  YF LF+ +C G CYADEHYLPTFV+I+F   N+N
Sbjct  266   LREWRKGSQWFEMDRELALAVVSDTTYFPLFKKHCHGGCYADEHYLPTFVHIKFPGKNAN  325

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDK-CEYNGEETNVCYLFARKFSLHSL  1178
             RSLTW DWS GG HP  Y R  VTV FL  LR  +K C YNGE T +CYLFARKF   SL
Sbjct  326   RSLTWTDWSRGGPHPRTYTRPLVTVDFLRGLRKSEKTCAYNGETTEICYLFARKFDERSL  385

Query  1179  TRLLRFAPKLMRF  1217
              R + FAPK+M F
Sbjct  386   NRFILFAPKIMGF  398



>ref|XP_004137544.1| PREDICTED: uncharacterized protein LOC101209845 [Cucumis sativus]
Length=303

 Score =   378 bits (970),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 238/303 (79%), Gaps = 7/303 (2%)
 Frame = +3

Query  336   MSDEELLWRASMVPK-IKEYPFSRVP----KVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
             M++EELLWRAS+VP+ I + P +       K+AF+FLT+  V+LAPLWE+FF+G  G YS
Sbjct  1     MTEEELLWRASLVPRRIPKLPSTETTTSTRKIAFLFLTKDGVSLAPLWELFFKGYAGLYS  60

Query  501   IYVHSDPSCNESAPEGSV--FHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             IYVH  PS + ++   S   F+GR IPS+ VKWG+ +M+EAERRLLANALLDFSN+RF+L
Sbjct  61    IYVHRTPSSSSTSTVDSSSVFYGRSIPSKGVKWGEPSMMEAERRLLANALLDFSNERFIL  120

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSESCIPLFNF T+Y+YLM S + FIE YDLPG  GRGRY  +M P+IKL QWRKGSQWF
Sbjct  121   LSESCIPLFNFSTVYNYLMGSKSTFIEAYDLPGPVGRGRYNPKMRPIIKLHQWRKGSQWF  180

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             EMDR +A +VISD +YFS+FQ +CK SCY DEHYLPTFV IRF + NSNR+LTWVDWS G
Sbjct  181   EMDRTIASQVISDQKYFSVFQKFCKPSCYMDEHYLPTFVGIRFPKTNSNRTLTWVDWSRG  240

Query  1035  GSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             G+HP R++R DVT+  L+ LR G  CEYNG +TN+C+LFARKF  +SL RLL FAPKLM 
Sbjct  241   GAHPTRFVRTDVTLELLKRLRNGGHCEYNGVKTNLCHLFARKFMANSLNRLLMFAPKLMH  300

Query  1215  FDE  1223
             F+ 
Sbjct  301   FNR  303



>ref|XP_002280674.1| PREDICTED: uncharacterized protein LOC100244641 [Vitis vinifera]
Length=414

 Score =   380 bits (975),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 216/412 (52%), Positives = 269/412 (65%), Gaps = 26/412 (6%)
 Frame = +3

Query  60    NNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADq  239
             N   PL    +L NA L L N +  FL FA GL+ G++ S Y KSFSL L+    + +  
Sbjct  3     NEQLPLSWISRLLNACLQL-NHVFHFLSFAIGLSLGIVVSLYIKSFSLALRTSLYSISPS  61

Query  240   plllpppqpERTP---------------VAAVGLQEF----------LKPPENAMHDMSD  344
                 PP +P   P               V +V +             LK  ++ MH+MSD
Sbjct  62    ISPQPPLRPLSPPPLQPLPPPSKLPPLLVLSVPINSTSNDTGPTGVSLKEQKSLMHNMSD  121

Query  345   EELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPS  524
             EEL WRASMVPK++E P+  V KVAFMFLT+G   L PLWE FF+G+ G YSIYVH  PS
Sbjct  122   EELFWRASMVPKVQELPYKLVRKVAFMFLTKGPHPLVPLWEKFFEGHGGLYSIYVHPHPS  181

Query  525   CNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFN  704
              +ES PE SVFHGRRIPS+ V WG  +MI+AERRLLANALLDFSNQRFVLLSESCIPLFN
Sbjct  182   FDESVPETSVFHGRRIPSKPVYWGTASMIDAERRLLANALLDFSNQRFVLLSESCIPLFN  241

Query  705   FPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEV  884
             F T Y+YLM S  +F+  +D P   GRGRY  +M P I +  WRKGSQWFE+ R+LA+++
Sbjct  242   FTTTYNYLMASNLSFLGSFDDPRKPGRGRYNPQMWPAINISDWRKGSQWFEVHRELAVQI  301

Query  885   ISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRH  1064
             ISD +Y+++F  YC   CY DEHY+PT VN+ + + NSNRS+TWVDWS GG HP+++   
Sbjct  302   ISDRKYYTIFGEYCHPPCYMDEHYIPTLVNMLYVKMNSNRSITWVDWSRGGPHPSKFGWG  361

Query  1065  DVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             D+T  FL  +R G  C YNG  TN+C+LFARKF   +L  LLR AP L+ FD
Sbjct  362   DITDEFLNKIRYGSDCIYNGNTTNICFLFARKFLPTALEPLLRIAPLLLGFD  413



>ref|XP_008350857.1| PREDICTED: uncharacterized protein LOC103414237 [Malus domestica]
Length=405

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 231/314 (74%), Gaps = 5/314 (2%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
              GL+++LKPP+ A HDM++ ELLWRAS+ P I EYPF  VPKVAFMFLT+G V LAPLWE
Sbjct  93    TGLKDYLKPPK-AFHDMNNAELLWRASITPXIPEYPFHFVPKVAFMFLTKGPVVLAPLWE  151

Query  468   MFFQGNEGFYSIYVHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
              FF G++G YSIYVHS PS N S   E  VF GRRIPSQ V WG V++I AER LLANAL
Sbjct  152   KFFAGHQGLYSIYVHSSPSYNHSXYTETPVFGGRRIPSQXVXWGKVSLIAAERLLLANAL  211

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SNQRFVLLSESCIPL NF T+YSYLMNST  F+EV+D P   GRGRY+      I +
Sbjct  212   LDXSNQRFVLLSESCIPLXNFXTVYSYLMNSTQTFVEVFDDPSGVGRGRYELSDYRGITI  271

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKGS WF+ DRDLA+E +SD  YF +F   CKG C+ADEHYLPTFV I+FG  N+NR
Sbjct  272   DQWRKGSXWFQADRDLALEFVSDRIYFPVFM-KCKGYCFADEHYLPTFVYIKFGAKNANR  330

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRT--GDKCEYNGEETNVCYLFARKFSLHSL  1178
             +LTWVDW  GG HP  Y   +VT   L  LR   G KCEYNG  T+VC+LFARKF   +L
Sbjct  331   TLTWVDWEKGGPHPTEYASENVTAVLLSGLRNGFGRKCEYNGRTTDVCFLFARKFPPTAL  390

Query  1179  TRLLRFAPKLMRFD  1220
               LL+FAP++M F+
Sbjct  391   DNLLKFAPEIMHFN  404



>ref|XP_009414639.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414640.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   376 bits (965),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 191/372 (51%), Positives = 255/372 (69%), Gaps = 12/372 (3%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQLITAAAADqplllpppqpERTPVA  284
             + LI  +S  + F  G+  GL  S++F +SF+    +                      A
Sbjct  25    IGLIKFVSFLVIFMAGIIIGLSLSAHFTRSFNSQTDIFFPKT---------MYTTNCDKA  75

Query  285   AVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
             ++  + FL P  + MH MSD+EL WR SM PK+KEYPF RVPKVAFMF+TRG + LA LW
Sbjct  76    SLSFKGFLSP-AHLMHSMSDKELFWRVSMAPKMKEYPFERVPKVAFMFMTRGPLPLARLW  134

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             + FF+G+EG YS+YVH+ P    +APE S F+GR+IPS+EV WG V +++AE+RLLANAL
Sbjct  135   DRFFKGHEGLYSVYVHTIPDYKLNAPESSAFYGRQIPSEEVSWGSVTLVDAEKRLLANAL  194

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LDFSN+RF+LLSESCIP++NFPT+Y YL+NS  +F+E YD     GRGRY   M P IKL
Sbjct  195   LDFSNERFILLSESCIPVYNFPTVYEYLINSAHSFVESYDENSQQGRGRYSRHMFPTIKL  254

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKGS+WFE++R+LA+ V++D +Y+S+F  YCK SCY DEHY+PTF+N+  G  N+NR
Sbjct  255   HQWRKGSEWFELNRELAVNVVADYKYYSIFSKYCKPSCYPDEHYIPTFLNMFHGSLNANR  314

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSLT  1181
             ++TWVDWS GG HPA Y   ++T  F++++R  G  C YN   T+VC+LFARKF+  SL 
Sbjct  315   TITWVDWSRGGPHPATYGAPNITPDFIQSIRNNGTSCMYNSRPTSVCFLFARKFAPSSLD  374

Query  1182  RLLRFAPKLMRF  1217
              LL     +M F
Sbjct  375   PLLNLTSTVMGF  386



>ref|XP_010108861.1| hypothetical protein L484_027054 [Morus notabilis]
 gb|EXC20501.1| hypothetical protein L484_027054 [Morus notabilis]
Length=405

 Score =   377 bits (967),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 232/298 (78%), Gaps = 2/298 (1%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             MHDM+DEELL RASMVP++++      PKVAFMFLT+G + LAPLWE FFQG+EGFYSIY
Sbjct  109   MHDMNDEELLRRASMVPRVQDQHVR--PKVAFMFLTKGPLPLAPLWEKFFQGHEGFYSIY  166

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VHS PS N++ PE SVF+GRRIPSQ V WG + MI+AERRLLANALLD SNQRFVLLSES
Sbjct  167   VHSHPSFNDTMPESSVFYGRRIPSQPVYWGSITMIDAERRLLANALLDLSNQRFVLLSES  226

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF  IYSYL+NS  +F+  +D P S GRGRY  +M P IKL  WRKG+QWFE+ R
Sbjct  227   CIPLFNFTAIYSYLINSNLSFLGSFDDPRSPGRGRYNPQMQPHIKLSDWRKGAQWFELHR  286

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
             DLA+ V+SD +++ LF+  C+ +CY+DEHYLPT VNI +G  N+NRS+TWVDWS GG HP
Sbjct  287   DLAVRVLSDRKFYPLFRDLCRPACYSDEHYLPTLVNILYGESNANRSVTWVDWSRGGPHP  346

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              R+   DVT  FL  +R G KC YNG ET++C+LFARKF  ++L  LLR +P L+ FD
Sbjct  347   GRFGWGDVTDEFLNRIRFGSKCLYNGNETSMCFLFARKFLPNALEPLLRVSPVLLGFD  404



>ref|XP_010681643.1| PREDICTED: uncharacterized protein LOC104896576 [Beta vulgaris 
subsp. vulgaris]
Length=393

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 211/410 (51%), Positives = 266/410 (65%), Gaps = 35/410 (9%)
 Frame = +3

Query  39    MMKNQNHNNNPPLLTSIKLYNAPLNLINLLS-AFLFFACGLTCGLIFSSYFKSFSLN---  206
             +MK QN      L+  +KL     NL+ L    F+  A  LT  L   S+   FSL+   
Sbjct  2     IMKYQNQITK--LIAPMKLLYTNSNLLKLCCYIFILLATFLTFQLTIVSFSHKFSLHNNM  59

Query  207   ---------LQLITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLW  359
                      L ++T A+            E      +               MSDEEL+ 
Sbjct  60    HITLQTPQKLNVLTIASPSITSKHKGYAVESYANRGI---------------MSDEELML  104

Query  360   RASMVPKIKEYPFSRVP-KVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCN-E  533
             RAS VPK++E P  +VP K+AF+FL +G++ L  LWE FF+G+EGFYSIYVHSDPS N  
Sbjct  105   RASKVPKMEELPLKKVPYKIAFLFLIKGSLPLQALWEEFFKGHEGFYSIYVHSDPSFNFS  164

Query  534   SAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPT  713
             +     VFHGR+IPS++V+WG  +MIEAE RLLA AL D SN+RFVLLSESCIPLFNF T
Sbjct  165   NGVATGVFHGRKIPSKKVEWGKFSMIEAELRLLATALQDASNKRFVLLSESCIPLFNFST  224

Query  714   IYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISD  893
             IY+YL+NST +++E YD  G   RGRYKHR+SP+I +R WRKGSQWFEMDR+LA+EVISD
Sbjct  225   IYTYLINSTQSYVEAYDKSGPVARGRYKHRLSPIITIRDWRKGSQWFEMDRELAMEVISD  284

Query  894   DRYFSLFQYYCKGS-CYADEHYLPTFVNIRFGRG-NSNRSLTWVDWSHGGSHPARYLRHD  1067
                F  F+  C  S CYADEHYLPT++N+ + RG NSNRS+TWVDWS GG HPA+Y R  
Sbjct  285   QLQFLSFKTACNNSACYADEHYLPTWMNM-YSRGRNSNRSVTWVDWSRGGCHPAKYRRMH  343

Query  1068  VTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             +T  FLE+LR G  C+YNG+  ++C+LFARKF   +L RLL FAPK+M F
Sbjct  344   ITTKFLESLRVGKTCQYNGKRADICFLFARKFLPETLNRLLWFAPKVMDF  393



>ref|XP_008244554.1| PREDICTED: uncharacterized protein LOC103342693 [Prunus mume]
Length=341

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/298 (61%), Positives = 225/298 (76%), Gaps = 0/298 (0%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             +H+MSDEEL WRASMVP+I++ P+  VPKVAFMFLT+G + L PLWE FF+G+EG YS+Y
Sbjct  43    VHNMSDEELFWRASMVPRIQKLPYKYVPKVAFMFLTKGPLPLGPLWEKFFEGHEGLYSVY  102

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VH+ P  NES PE SVFHG+RI SQ V WG   M++AERRLLANALLDFSNQRFVLLSES
Sbjct  103   VHAHPDFNESVPEDSVFHGKRIHSQPVYWGTSTMLDAERRLLANALLDFSNQRFVLLSES  162

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF T Y YL+NS  +F+  +D P   GRGRY  +M P+I +  WRKGSQWFE+ R
Sbjct  163   CIPLFNFTTTYDYLINSNLSFLSSFDDPRKPGRGRYNPQMYPIINITNWRKGSQWFEVHR  222

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
             +LAI ++SD +Y+ +FQ YC   CY DEHY+PT VN+ +   NS RS+TWVDWS GG HP
Sbjct  223   ELAIHIVSDCKYYPIFQEYCHPPCYIDEHYIPTLVNLLYSELNSKRSITWVDWSRGGPHP  282

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              ++   D+T  FL  +R G +CEYNG  T++C+LFARKF  ++L  LLR AP L+ FD
Sbjct  283   GKFGGSDITDEFLNRIRFGSECEYNGNTTSICFLFARKFMPNTLEPLLRVAPLLLGFD  340



>ref|XP_002276791.2| PREDICTED: uncharacterized protein LOC100257764 [Vitis vinifera]
Length=411

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/279 (63%), Positives = 218/279 (78%), Gaps = 0/279 (0%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             MH M D+EL WRASMVP+I+++P+  VPKVAFMFLT+G + L PLW++FF+G+EGFYSIY
Sbjct  115   MHSMDDDELFWRASMVPRIQQFPYENVPKVAFMFLTKGPIPLGPLWDLFFKGHEGFYSIY  174

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VH  PS N+S PE SVFHGRRIPS+ VKWG   MI+AERRLLANALLDFSN+RFVLLSE+
Sbjct  175   VHPHPSYNDSVPEDSVFHGRRIPSKAVKWGRATMIDAERRLLANALLDFSNERFVLLSET  234

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF TIYSY++NS  +FI  YD P   GRGRY  +MSP I + +WRKGSQWFE+ R
Sbjct  235   CIPLFNFTTIYSYIINSNQSFIASYDDPRKVGRGRYNPQMSPTINISEWRKGSQWFEVHR  294

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
             +LAIE++SD +Y+ +F+ +C   CY DEHY+PT +NI     NSNR++TWVDWS  G HP
Sbjct  295   ELAIEIVSDKKYYPVFREHCHVPCYMDEHYIPTLINILAPEKNSNRTITWVDWSKSGPHP  354

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKF  1163
              R++R DVT+ FL   R G  C Y G  T++C+LFARKF
Sbjct  355   GRFIRQDVTLEFLNQTRFGTNCTYGGNTTSMCFLFARKF  393



>ref|XP_010693288.1| PREDICTED: uncharacterized protein LOC104906249 [Beta vulgaris 
subsp. vulgaris]
Length=391

 Score =   371 bits (952),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 232/302 (77%), Gaps = 2/302 (1%)
 Frame = +3

Query  321   NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
             N MH+MSD+ELL RASMVP+I+ YP   +PKVAFMFLT+G + LAPLWE+FF+G++GFYS
Sbjct  89    NVMHNMSDKELLRRASMVPQIEGYPLDILPKVAFMFLTKGPLPLAPLWELFFKGHQGFYS  148

Query  501   IYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             IYVH+ PS N+S P+ SVF+GRRIPSQEV WG ++MI+AE+RLLANA LD SNQRF+LLS
Sbjct  149   IYVHTHPSYNDSWPQSSVFYGRRIPSQEVIWGTMSMIDAEKRLLANAFLDQSNQRFILLS  208

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIPLFNF TIY+YLMNS  +F+  +D P   GRGRY  +M P I ++ WRKGSQWFE+
Sbjct  209   ESCIPLFNFTTIYNYLMNSKVSFLASFDDPRKQGRGRYNPKMLPNITIQDWRKGSQWFEL  268

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRF-GRGNSNRSLTWVDWSHGG  1037
              R+LAI VISD +Y+S+F+ YC   CY DEHYLPT   I F  + + NR +TWVDWSH  
Sbjct  269   HRELAILVISDQKYYSIFEQYCHPPCYNDEHYLPTLAKILFPDQISKNRGITWVDWSHVA  328

Query  1038  SHPARYLRHDVTVSFLETLRTG-DKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             SHP R+++ D+T  FL  +R G   C YNG  T++C+LFARKF   +L  LL+ APKL+ 
Sbjct  329   SHPGRFIKSDITQEFLNLIRFGLTNCTYNGNVTSMCFLFARKFVGDTLKPLLQIAPKLLG  388

Query  1215  FD  1220
             FD
Sbjct  389   FD  390



>ref|XP_010553652.1| PREDICTED: uncharacterized protein LOC104823674 [Tarenaya hassleriana]
Length=402

 Score =   371 bits (953),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 261/385 (68%), Gaps = 17/385 (4%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSS----YFKSF------SLNLQLITAAAADqplllpp  257
             L L   LS  L F  G+  GL  SS    YF S       S NLQ ++ +  +  ++   
Sbjct  20    LKLAQTLSLLLIFMAGIIIGLAASSHIDRYFSSLPSTHSTSTNLQTVSFSP-NCTIIHGE  78

Query  258   pqpERTPVAAVG-----LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAF  422
                E     + G     ++ FL+P EN  H M+DEELLWRASMVP  +EYP+ RVPKVAF
Sbjct  79    CDAESDKSRSKGRDCSSIEGFLRP-ENLSHRMTDEELLWRASMVPVKEEYPYERVPKVAF  137

Query  423   MFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDV  602
             MFLTRG + + PLWE FF+G+E F+S+YVH+ P  + +    S FHGR IPSQ V+WG  
Sbjct  138   MFLTRGPLPMLPLWEKFFKGHEKFFSVYVHAPPGYDMNVSIDSPFHGRLIPSQRVEWGTA  197

Query  603   NMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTG  782
              + +AE+RLLANALLDFSN+RF+LLSESCIP+ NFPT+Y YL+ S  +F+E YD P   G
Sbjct  198   LLTDAEKRLLANALLDFSNERFLLLSESCIPIHNFPTVYRYLIGSNYSFVESYDEPTRYG  257

Query  783   RGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLP  962
             RGRY  +M P IKL QWRKGSQWFE +R +A  +ISD +Y+SLF+ YC+ +CY DEHY+P
Sbjct  258   RGRYSRKMLPHIKLHQWRKGSQWFEANRKIATYIISDTKYYSLFKKYCRPACYPDEHYIP  317

Query  963   TFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVC  1142
             TF+N+  G  N+NR++TWVDWS GG HPARY   ++T SF++ +R+   C YNGE T++C
Sbjct  318   TFLNMFHGSDNANRTVTWVDWSFGGPHPARYNAENITESFIQQIRSNGSCLYNGEVTSLC  377

Query  1143  YLFARKFSLHSLTRLLRFAPKLMRF  1217
             YLFARKF+ ++L  L+  +  +M F
Sbjct  378   YLFARKFAPNALAPLMNLSSTVMEF  402



>ref|XP_006391144.1| hypothetical protein EUTSA_v10018660mg [Eutrema salsugineum]
 gb|ESQ28430.1| hypothetical protein EUTSA_v10018660mg [Eutrema salsugineum]
Length=400

 Score =   370 bits (950),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 208/403 (52%), Positives = 270/403 (67%), Gaps = 16/403 (4%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPL-NLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI  218
             ++N  + ++  L   +KL N PL + +NLL  FL F  G   G+I  S  +  S      
Sbjct  3     IQNDRNTSSLSLYIVVKLLNVPLQHFLNLLLYFLIFCVGAIVGIIVHSSLQEVSSPYSST  62

Query  219   TAAAADqplllpppqpERTPVAAVGLQE---FLKPPENAMHDMSDEELLWRASMVPKIKE  389
               + +   L+  PP             E   FL+PP++ MH+M D+EL WRASMVPKI+ 
Sbjct  63    VQSVSQLFLVTSPPPASPPHSPLSPNNEPGMFLRPPKSIMHNMEDKELFWRASMVPKIRN  122

Query  390   YPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRR  569
             YPF R PKVAFMFLTRG + LAPLWE FF+G+EG ++IYVH++P  NES P+GSVFHGRR
Sbjct  123   YPFPRTPKVAFMFLTRGPLPLAPLWERFFRGHEGLFTIYVHTNPFYNESVPQGSVFHGRR  182

Query  570   IPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNF  749
             IPS+ V WG+ NM++AERRLLANALLD +N+RF+LLSESCIPLFNF T+YS L+NST   
Sbjct  183   IPSKRVNWGNANMVDAERRLLANALLDINNERFLLLSESCIPLFNFTTLYSDLINSTQTH  242

Query  750   IEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCK  929
             +E YDLP   GR RY HRM P I +  WRKGSQWFE+DR +A+E +SD  Y+ +F+ Y +
Sbjct  243   VESYDLP--IGRVRYNHRMYPHIHMHHWRKGSQWFELDRAMALEAVSDTFYWPIFKAYSR  300

Query  930   GSCYADEHYLPTFVNI---RFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRT  1100
               C  DEHY PT +N+   + G  NSNR+LTW DW    +HP  +   +V V FLE LR 
Sbjct  301   --C-PDEHYFPTLLNLMPSQLGSRNSNRTLTWTDWGKRRAHPRTFGALEVNVGFLEWLRR  357

Query  1101  GDK--CEYNGE--ETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              DK  CE+NGE  +T +C+LFARKFS ++L +LL+FA  +M F
Sbjct  358   SDKEYCEHNGEVNKTRLCFLFARKFSPNALDKLLQFASTVMHF  400



>emb|CBI15479.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/276 (63%), Positives = 216/276 (78%), Gaps = 0/276 (0%)
 Frame = +3

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             M D+EL WRASMVP+I+++P+  VPKVAFMFLT+G + L PLW++FF+G+EGFYSIYVH 
Sbjct  1     MDDDELFWRASMVPRIQQFPYENVPKVAFMFLTKGPIPLGPLWDLFFKGHEGFYSIYVHP  60

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
              PS N+S PE SVFHGRRIPS+ VKWG   MI+AERRLLANALLDFSN+RFVLLSE+CIP
Sbjct  61    HPSYNDSVPEDSVFHGRRIPSKAVKWGRATMIDAERRLLANALLDFSNERFVLLSETCIP  120

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF TIYSY++NS  +FI  YD P   GRGRY  +MSP I + +WRKGSQWFE+ R+LA
Sbjct  121   LFNFTTIYSYIINSNQSFIASYDDPRKVGRGRYNPQMSPTINISEWRKGSQWFEVHRELA  180

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
             IE++SD +Y+ +F+ +C   CY DEHY+PT +NI     NSNR++TWVDWS  G HP R+
Sbjct  181   IEIVSDKKYYPVFREHCHVPCYMDEHYIPTLINILAPEKNSNRTITWVDWSKSGPHPGRF  240

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKF  1163
             +R DVT+ FL   R G  C Y G  T++C+LFARKF
Sbjct  241   IRQDVTLEFLNQTRFGTNCTYGGNTTSMCFLFARKF  276



>ref|XP_002315929.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
 gb|EEF02100.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
Length=411

 Score =   369 bits (948),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 224/301 (74%), Gaps = 0/301 (0%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             P+   H M+D+ELLWRASMVP I EYP++R PKVAFMFLTRG++ LAPLWEMFF+G+EG 
Sbjct  109   PKELCHSMNDKELLWRASMVPHIDEYPYNRTPKVAFMFLTRGSLPLAPLWEMFFKGHEGL  168

Query  495   YSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             YSIY+H  P      PE SVF+ R+IPS+  +WG   MI+AERRLLANALLDFSN+RFVL
Sbjct  169   YSIYLHKSPEFTNQHPESSVFYQRQIPSKPAEWGRATMIDAERRLLANALLDFSNERFVL  228

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSE+CIP+FNF TIY+YLMNS  +F+  +D P   GRGRY  RM P + L  WRKGSQWF
Sbjct  229   LSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGSQWF  288

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             E  R +AIE+ISD +Y+ +F+ +C+  CY DEHY PT V       NSNRS+TWVDWS G
Sbjct  289   EAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDWSGG  348

Query  1035  GSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             GSHPAR++R DV+ +FL  +R G  C YNG  T VC+LFARKF   +L  LLR AP+L+ 
Sbjct  349   GSHPARFVRKDVSEAFLNQIRNGFNCTYNGGITTVCFLFARKFHPSTLDSLLRIAPELLG  408

Query  1215  F  1217
             F
Sbjct  409   F  409



>ref|XP_011076478.1| PREDICTED: uncharacterized protein LOC105160693 [Sesamum indicum]
Length=395

 Score =   368 bits (944),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 234/313 (75%), Gaps = 1/313 (0%)
 Frame = +3

Query  282   AAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPL  461
              A GL+E++ P ++  H M+DEEL+WRASMVP I +YPF+R PKVAFMFLTRG + LAPL
Sbjct  83    TAYGLKEWISP-KDRWHSMTDEELMWRASMVPGIVQYPFNRTPKVAFMFLTRGRLPLAPL  141

Query  462   WEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
             W+MFF+G+EG +SIY+H+ P       + SVF+ RRIPS+ V+WG   MI+AERRLLANA
Sbjct  142   WDMFFRGHEGLFSIYLHTLPEFTYEPSKSSVFYKRRIPSKLVQWGRSTMIDAERRLLANA  201

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLDFSN+RFVLLSE+CIPLFNF  IY+YL+NS  +F+  +D P   GRGRY  RM P I 
Sbjct  202   LLDFSNERFVLLSETCIPLFNFSIIYNYLINSNQSFLSTFDDPRPIGRGRYNKRMWPTIT  261

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
             L  WRKGSQWFE +R+LA+ ++SD +Y+ LF+ +C   CY DEHYLPT V   +    SN
Sbjct  262   LSDWRKGSQWFEANRELALAIVSDIKYYPLFRNHCMPPCYMDEHYLPTVVTKFWPNLTSN  321

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLT  1181
             R++TW DWS GGSHPA ++R+DVT  FL+ +R G  C YNGE + +C+LFARKF  ++L 
Sbjct  322   RTITWTDWSRGGSHPAMFMRNDVTGGFLDRMRNGFNCTYNGERSTICFLFARKFHPNTLQ  381

Query  1182  RLLRFAPKLMRFD  1220
              LLR APKL+ FD
Sbjct  382   PLLRVAPKLLGFD  394



>gb|EYU40777.1| hypothetical protein MIMGU_mgv1a007709mg [Erythranthe guttata]
Length=398

 Score =   368 bits (944),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 227/302 (75%), Gaps = 0/302 (0%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             P++  H MSD EL+WRAS+VP+I ++PF+R PKVAFMFLTRG + LAPLWEMFF+GNEG 
Sbjct  96    PKDVWHTMSDRELMWRASLVPRILDFPFNRTPKVAFMFLTRGKLPLAPLWEMFFKGNEGL  155

Query  495   YSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             +SIY+H+ P      PE SVF+ RRIPS+ V+WG  +MI+AERRLLANALLDF+NQRFVL
Sbjct  156   FSIYLHTLPEFTYEPPESSVFYKRRIPSKLVQWGRPSMIDAERRLLANALLDFTNQRFVL  215

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSE+CIPLFNF TIY+YL+NS  +F+  +D P   GRGRY  RM P I L  WRKGSQWF
Sbjct  216   LSETCIPLFNFSTIYNYLINSNQSFLSTFDDPRPIGRGRYNKRMGPAISLSDWRKGSQWF  275

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             E +R+LAI +ISD  Y+ +F+ +C   CY DEHYLPT VN       SNR++TW DWS G
Sbjct  276   EANRELAIAIISDVEYYPIFRNHCLPPCYMDEHYLPTLVNKVCPNLTSNRTVTWTDWSEG  335

Query  1035  GSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             GSHP  ++R+DVT  FL+ +R+G  C YNGE  ++C LFARKF   +L  LLR APKL+ 
Sbjct  336   GSHPRMFMRNDVTEEFLDRVRSGFNCTYNGEMRSICSLFARKFHPTTLQPLLRIAPKLLG  395

Query  1215  FD  1220
             F+
Sbjct  396   FN  397



>ref|XP_010265068.1| PREDICTED: uncharacterized protein LOC104602905 [Nelumbo nucifera]
Length=409

 Score =   368 bits (944),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 211/413 (51%), Positives = 265/413 (64%), Gaps = 25/413 (6%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFK----SFSLNL  209
             M+N+ H   PPL+   K  NA +   ++L  FLFF  GL+ G I S Y K    SF +NL
Sbjct  1     MRNEQHP--PPLIP--KFLNAHIQPYHVLH-FLFFVIGLSLGTIASLYIKYLYFSFQVNL  55

Query  210   QLITAAAADqplllpppqpERTPVAAVGLQEFLKPPEN----------------AMHDMS  341
                +   +  P   PPP        +      L PP N                 MH M 
Sbjct  56    LSTSPPLSSPPQPPPPPSTSPPATLSSLSLPILPPPTNRTQNESIAAVNEEKSSLMHGMD  115

Query  342   DEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDP  521
             DEEL WRASMVP+I  +P+S  PKVAFMFLT+G + LA LWE FF+G+EGFY+IYVH  P
Sbjct  116   DEELFWRASMVPRITVFPYSLTPKVAFMFLTKGPLPLALLWEKFFRGHEGFYNIYVHPHP  175

Query  522   SCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLF  701
                +S PE SVF+ RRIPS+ V+WG   MI+AERRLLANALLDFSN+RFVLLSESCIPLF
Sbjct  176   GFVDSTPEDSVFYRRRIPSKAVEWGRSTMIDAERRLLANALLDFSNERFVLLSESCIPLF  235

Query  702   NFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIE  881
             NF T+Y+YL+NS  +F+  +D P   GRGRY   M P++ + +WRKGSQWFE+ RDLA+E
Sbjct  236   NFTTVYNYLINSNVSFLGSFDDPRKAGRGRYNRLMWPIVNITEWRKGSQWFEVHRDLAVE  295

Query  882   VISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLR  1061
             +I+D +Y+ +FQ YC  SCY DEHYLPT VN+     NSNRS+TWVDWS  G HP ++  
Sbjct  296   IIADRKYYPVFQNYCTPSCYMDEHYLPTLVNMIAPELNSNRSVTWVDWSRPGPHPGKFGW  355

Query  1062  HDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             +D+T  FL  +R G  C YNG  T++C+LFARKF   +L  LLR  P L+  D
Sbjct  356   NDMTDEFLNRIRYGTNCTYNGLPTSICFLFARKFLPSALEPLLRITPLLLGID  408



>ref|XP_010927836.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
 ref|XP_010927837.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
 ref|XP_010927838.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
Length=388

 Score =   367 bits (942),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 254/371 (68%), Gaps = 10/371 (3%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA  287
               L+  +S  + F  G   GL  S++FK +  N Q      AD                 
Sbjct  27    FGLMKFVSILVVFMAGAVLGLSVSAHFKQY-FNSQ------ADLFFPKTMYTAN-CDKDC  78

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             + ++ F+KP  + MH M+D+EL WRASMVPK+++YPF RVPKVAFMF+TRG +   PLW+
Sbjct  79    LSIKSFVKP-THLMHSMTDDELFWRASMVPKVEDYPFERVPKVAFMFMTRGPLPFVPLWD  137

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+G+EG YS+YVH+ P    +  E S F+GR+IPS+EV WG V +++AE+RLLANALL
Sbjct  138   KFFKGHEGLYSVYVHALPDYKLNVSEDSAFYGRQIPSEEVSWGSVTLVDAEKRLLANALL  197

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DFSN+RFVLLSESCIP++NFPT+Y YL+NS  +F+E YD     GRGRY   M+P IKL 
Sbjct  198   DFSNERFVLLSESCIPVYNFPTVYEYLINSEHSFVESYDEDSPQGRGRYNRYMAPHIKLY  257

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
             QWRKGS+WFE++R+LA+ +++D +Y++LF+ YCK SCY DEHY+PT++N+  G  N+NRS
Sbjct  258   QWRKGSEWFELNRELAVTMVADYKYYALFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRS  317

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             LTWVDWS GG HPA Y    +T  F++ +R  G  C YN   T++C+LFARKF+ ++L  
Sbjct  318   LTWVDWSRGGPHPATYGAPSITAGFIQAIRNNGTFCMYNSRPTSICFLFARKFAPNALES  377

Query  1185  LLRFAPKLMRF  1217
             LL     +M F
Sbjct  378   LLNLTSTVMDF  388



>ref|XP_010273586.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
 ref|XP_010273587.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
Length=405

 Score =   367 bits (943),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 190/390 (49%), Positives = 262/390 (67%), Gaps = 15/390 (4%)
 Frame = +3

Query  90    KLYNAPLN-------LINLLSAFLFFACGLTCGLIFSS----YFKS--FSLNLQLITAAA  230
             KL ++P+        L+ +++  + F  G+  GL  ++    YF S    L    I  A 
Sbjct  17    KLTSSPITSKDLSFRLVKVVTFLVIFVSGMVLGLAATAHVTRYFTSSHHELFFSPIHVAQ  76

Query  231   ADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVP  410
                          +     + L+ F+ P  +  H M+D+ELLWRAS+VPK + YP+ RVP
Sbjct  77    VSHEEDCLSITKYKKEEDCLNLKSFINP-GHLTHSMTDDELLWRASLVPKKEVYPYKRVP  135

Query  411   KVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVK  590
             KVAFMFLTRG + L+PLW+ FFQG+E  +S+YVH+ P    +    S F+GR+IPSQ+V+
Sbjct  136   KVAFMFLTRGPLPLSPLWDRFFQGHENLFSVYVHALPGYELNVSRSSAFYGRQIPSQDVQ  195

Query  591   WGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLP  770
             WG V + + ERRLLANALLDFSN+RFVLLSESCIP+++F T+Y YL+NS  +F++ YD P
Sbjct  196   WGSVTLSDGERRLLANALLDFSNERFVLLSESCIPVYDFLTVYKYLINSAYSFVDSYDDP  255

Query  771   GSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADE  950
                GRGRY  +M P IKL QWRKGSQWFE++R LA+ +++DD+Y+SLF+ YCK SCY DE
Sbjct  256   SRYGRGRYSRKMLPDIKLFQWRKGSQWFELNRTLAVNIVADDKYYSLFRKYCKPSCYPDE  315

Query  951   HYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGE  1127
             HYLPTF+N+ +G  N+NRS+TWVDWS GG HPA + + D+T  F+++++  G  C YN E
Sbjct  316   HYLPTFLNMFYGSMNANRSVTWVDWSRGGPHPATFGKEDITEGFIQSIKNNGTTCSYNSE  375

Query  1128  ETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             +T VCYLFARKF+  +L  LL     ++RF
Sbjct  376   QTLVCYLFARKFAPSALEPLLNLTSTVLRF  405



>ref|XP_009399147.1| PREDICTED: uncharacterized protein LOC103983624 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   366 bits (939),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 184/370 (50%), Positives = 259/370 (70%), Gaps = 12/370 (3%)
 Frame = +3

Query  114   LINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQLITAAAADqplllpppqpERTPVAAV  290
             L+ L++  + F  G+  GL  S+++ + ++   +L    A                  ++
Sbjct  28    LVKLVTFLVVFMAGVVLGLSVSAHYTRHYNSRTELFFPRAT---------YAGNCDKESL  78

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
              ++ F++P   +MH MSD+EL WRA++VP + EYPF RVPKVAF+F+T+G +   PLW+ 
Sbjct  79    SIKRFVQP-TCSMHGMSDDELFWRATVVPIMAEYPFERVPKVAFLFMTKGPLPFVPLWDR  137

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+ G YSIYVH+ P    S PE S F+GR+IPSQEV WG + +++AE+RLLANALLD
Sbjct  138   FFKGHRGLYSIYVHTLPDYKLSVPETSAFYGRQIPSQEVSWGSITLLDAEKRLLANALLD  197

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
             FSN+RFVLLSESCIP+++FPT+Y YL+NS  +F++ YD      RGRY  RMSP IKL Q
Sbjct  198   FSNERFVLLSESCIPVYSFPTVYEYLVNSAHSFVDSYDKDIQQARGRYNWRMSPKIKLSQ  257

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGS+WFE++R LAI+++++  Y+SLF+ YCK SCY DEHY+PT++N+  G  N+NRS+
Sbjct  258   WRKGSEWFELNRGLAIDIVAEHTYYSLFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRSV  317

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             TWVDWS GGSHPARY   ++TV F++++R  G  C YN   T+VC+LFARKF+  +L  L
Sbjct  318   TWVDWSRGGSHPARYGAANITVEFIQSIRNNGTSCMYNSRSTSVCFLFARKFAPSALAPL  377

Query  1188  LRFAPKLMRF  1217
             L  +  +M F
Sbjct  378   LNVSSTVMGF  387



>emb|CDP02764.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 224/295 (76%), Gaps = 1/295 (0%)
 Frame = +3

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             M+DEEL WRASMVP+IKE+P   +PKVAFMFLT G + LAPLWE FF+G +G YSIY+H 
Sbjct  1     MTDEELFWRASMVPQIKEFPHKFLPKVAFMFLTPGPLPLAPLWEKFFKGYQGLYSIYLHP  60

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
              PS N+S P+GSVF+GRRIPS+ V WG +NMI+AERRLLANALLDFSNQRFVLLS+SCIP
Sbjct  61    HPSYNDSWPQGSVFYGRRIPSKPVSWGRINMIDAERRLLANALLDFSNQRFVLLSDSCIP  120

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF T+Y YL++S  +F+  +D P   GRGRY  +M P I + QWRKGSQWFE+ RDLA
Sbjct  121   LFNFTTVYDYLLSSNQSFLGSFDDPRKPGRGRYNRQMFPTITIEQWRKGSQWFEVHRDLA  180

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
             + ++SD +Y+ +F  YC   CY DEHYLPT VNI +   +SNRS+TWVDWS GGSHP +Y
Sbjct  181   VGIVSDAKYYRVFHQYCLAPCYNDEHYLPTLVNILYPEMSSNRSITWVDWSKGGSHPRKY  240

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              R DVT   L  +R    C+YNGE T  C+LFARKF  +++  LLR AP ++ FD
Sbjct  241   GRADVTDELLNGMRR-RTCKYNGETTKNCFLFARKFLPNTIEPLLRVAPSVVGFD  294



>emb|CBI33634.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 221/295 (75%), Gaps = 0/295 (0%)
 Frame = +3

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             MSDEEL WRASMVPK++E P+  V KVAFMFLT+G   L PLWE FF+G+ G YSIYVH 
Sbjct  1     MSDEELFWRASMVPKVQELPYKLVRKVAFMFLTKGPHPLVPLWEKFFEGHGGLYSIYVHP  60

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
              PS +ES PE SVFHGRRIPS+ V WG  +MI+AERRLLANALLDFSNQRFVLLSESCIP
Sbjct  61    HPSFDESVPETSVFHGRRIPSKPVYWGTASMIDAERRLLANALLDFSNQRFVLLSESCIP  120

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF T Y+YLM S  +F+  +D P   GRGRY  +M P I +  WRKGSQWFE+ R+LA
Sbjct  121   LFNFTTTYNYLMASNLSFLGSFDDPRKPGRGRYNPQMWPAINISDWRKGSQWFEVHRELA  180

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
             +++ISD +Y+++F  YC   CY DEHY+PT VN+ + + NSNRS+TWVDWS GG HP+++
Sbjct  181   VQIISDRKYYTIFGEYCHPPCYMDEHYIPTLVNMLYVKMNSNRSITWVDWSRGGPHPSKF  240

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
                D+T  FL  +R G  C YNG  TN+C+LFARKF   +L  LLR AP L+ FD
Sbjct  241   GWGDITDEFLNKIRYGSDCIYNGNTTNICFLFARKFLPTALEPLLRIAPLLLGFD  295



>ref|XP_007022850.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY25472.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=390

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 253/376 (67%), Gaps = 7/376 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSF---SLNLQLITAAAADqplllpppqpER--  272
             L L+ +LS  + F  G+  GL  SS+  ++       QL + + A    +          
Sbjct  16    LKLVQVLSFLVVFVAGIIIGLATSSHINTYFSSQAQAQLFSTSTATSFRVSSGTTKANCS  75

Query  273   TPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTL  452
               V    +  FL P  N  H MSDEEL WRASM P   E+PF RVPKVAFMFLTRG + L
Sbjct  76    QKVDCFSMDAFLHP-TNLSHKMSDEELFWRASMAPYKNEFPFPRVPKVAFMFLTRGPLPL  134

Query  453   APLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrll  632
              PLWE FF+G+E ++SIY+H+ P+ + +    S F+GR+IPSQ V+WG V + +AERRLL
Sbjct  135   LPLWERFFKGHEKYFSIYLHTPPAYHLNVSSHSPFYGRQIPSQNVEWGTVLLADAERRLL  194

Query  633   anallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSP  812
             ANALLDFSN+RFVLLSESCIP++NFPT+Y YL+ ST +F+E YD P   GRGRY  +M P
Sbjct  195   ANALLDFSNERFVLLSESCIPVYNFPTVYKYLIGSTYSFVESYDDPSRYGRGRYSRKMLP  254

Query  813   VIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRG  992
              IKL QWRKGSQWFEM R +AI +ISD +Y++LF+ YC+ +CY DEHY+PTF+N+  G  
Sbjct  255   DIKLYQWRKGSQWFEMHRLVAIYIISDTKYYTLFRKYCRPACYPDEHYIPTFLNMFHGSL  314

Query  993   NSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSL  1169
             N+NRS+TWVDWS GG HPA +   ++T  F++ +R  G  C YN E+T+ CYLFARKF+ 
Sbjct  315   NANRSVTWVDWSMGGPHPAMHGGANITEGFIQAIRKNGTLCSYNEEQTSACYLFARKFAP  374

Query  1170  HSLTRLLRFAPKLMRF  1217
              +L  LL  +  +M F
Sbjct  375   SALESLLNLSSTVMEF  390



>ref|XP_008812747.1| PREDICTED: uncharacterized protein LOC103723571 [Phoenix dactylifera]
 ref|XP_008812748.1| PREDICTED: uncharacterized protein LOC103723571 [Phoenix dactylifera]
Length=388

 Score =   364 bits (934),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 259/377 (69%), Gaps = 22/377 (6%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQL-----ITAAAADqplllpppqpE  269
             + L+  +S  + F  G   GL  S++F K F+    L     + AA  D+          
Sbjct  27    IGLMKFVSILVVFMAGAVLGLSVSAHFNKYFTSQADLFFPTNMFAANCDKN---------  77

Query  270   RTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
                   + ++ F+KP  + MH M+D+EL WRA+MVPK+++YPF RVPKVAFMF+TRG + 
Sbjct  78    -----CLSIKSFVKP-THLMHSMTDDELFWRATMVPKMEDYPFERVPKVAFMFMTRGPLP  131

Query  450   LAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrl  629
               PLW+ FF+G++G YS+YVH+ P    +  E S F+GR+IPS EV WG V++++AE+RL
Sbjct  132   FVPLWDKFFKGHKGLYSVYVHALPDYKLNVSEDSAFYGRQIPSGEVSWGSVSLVDAEKRL  191

Query  630   lanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMS  809
             LANALLDFSN+RFVLLSESCIP++NFPT+Y YL+NS  +F+E YD     GRGRY   M+
Sbjct  192   LANALLDFSNERFVLLSESCIPVYNFPTVYEYLINSEHSFVESYDEDSPQGRGRYSRYMA  251

Query  810   PVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGR  989
             P IKL QWRKGS+WFE++R+LA+ V++D +Y++LF+ YC+ SCY DEHY+PT++N+  G 
Sbjct  252   PHIKLYQWRKGSEWFELNRELAVTVVADYKYYTLFRKYCRPSCYPDEHYIPTYLNMFHGS  311

Query  990   GNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFS  1166
              N+NRS+TWVDWS GG HPARY    +T  F++ +R  G  C YN   T++C+LFARKF+
Sbjct  312   LNANRSVTWVDWSRGGPHPARYGAPTITAEFIQAIRNNGTFCMYNSRPTSICFLFARKFA  371

Query  1167  LHSLTRLLRFAPKLMRF  1217
              ++L  LL     +M F
Sbjct  372   PNALESLLNLTSSVMGF  388



>ref|XP_002305172.2| hypothetical protein POPTR_0004s09690g [Populus trichocarpa]
 gb|EEE85683.2| hypothetical protein POPTR_0004s09690g [Populus trichocarpa]
Length=356

 Score =   363 bits (931),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 198/361 (55%), Positives = 240/361 (66%), Gaps = 6/361 (2%)
 Frame = +3

Query  138   LFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAAVGLQEFLKPP  317
             +FF  GL+ G+I   Y +SF+L        +      L     + T +  +  QE L   
Sbjct  1     MFFVFGLSLGMIVCLYLRSFTLQATPSPMFSPIPSKSLLVETIKGTHIY-MKEQELL---  56

Query  318   ENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFY  497
               AMH+MSDEELL RASMVP ++E    + PKVAFMFLT G + L+ LWE FF+G+EG Y
Sbjct  57    --AMHNMSDEELLRRASMVPIVQESAQKQAPKVAFMFLTNGPLPLSLLWEKFFEGHEGLY  114

Query  498   SIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLL  677
             SIYVH  PS N+S P  SVF GRRIPSQ V WG   MI+AERRLLANALLD SNQRFVLL
Sbjct  115   SIYVHPHPSYNDSWPRSSVFFGRRIPSQAVYWGTGTMIDAERRLLANALLDSSNQRFVLL  174

Query  678   SESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFE  857
             SESCIPLFNF T Y +LMNS  +F+  +D P   GRGRY  RM P I +  WRKGSQWFE
Sbjct  175   SESCIPLFNFKTTYDHLMNSNISFLGSFDDPRKPGRGRYNPRMWPAINITDWRKGSQWFE  234

Query  858   MDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGG  1037
             + RD+A+ +ISD +Y+ +FQ +C   CY DEHY PT VNI +   NSNRS+TWVDWS GG
Sbjct  235   VHRDIAVHIISDQKYYQVFQEHCHPPCYMDEHYFPTLVNILYPELNSNRSITWVDWSRGG  294

Query  1038  SHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              HP ++   D+T  FL  +R G +C YNG  T++CYLFARKF   +L  LLR AP L  F
Sbjct  295   PHPGKFRWADITDEFLNQIRHGSECVYNGNTTSMCYLFARKFLPQTLEPLLRIAPLLHVF  354

Query  1218  D  1220
             D
Sbjct  355   D  355



>gb|KDP29447.1| hypothetical protein JCGZ_18368 [Jatropha curcas]
Length=353

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 226/314 (72%), Gaps = 1/314 (0%)
 Frame = +3

Query  276   PVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLA  455
             PV +  L++++ P E   H M D+ELLWRASMVP+I EYP++R  KVAFMFLT+G++ LA
Sbjct  39    PVKSGSLRDWIAPME-IWHSMKDKELLWRASMVPRIDEYPYNRTSKVAFMFLTKGSLPLA  97

Query  456   PLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             PLWE FF+G EG YSIYVH+ P       + SVFH RRIPSQ+V+WG   M++AERRLLA
Sbjct  98    PLWERFFKGQEGLYSIYVHTSPEFTFEPSQSSVFHNRRIPSQQVEWGKATMVDAERRLLA  157

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSN+RFVLLSE+CIP+FNF TIY+YL+NS  +F+  YD P   GRGRY  R+ P 
Sbjct  158   NALLDFSNERFVLLSETCIPIFNFTTIYNYLINSNQSFLASYDDPSRAGRGRYNKRLWPT  217

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             + L  WRKGSQWFE+ R L  +++SD +Y+ +F+ YCK  CY DEHY PT V       N
Sbjct  218   VTLSDWRKGSQWFEIHRKLTGKIVSDVKYYPIFRDYCKPPCYMDEHYFPTLVTKICPELN  277

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHS  1175
             SNRS+TWVDWS GG HP  Y++ DV+ +FL  +R G  C YNG  T VC+LFARKF   +
Sbjct  278   SNRSITWVDWSLGGPHPRNYVKKDVSEAFLNWIRNGFNCSYNGAMTTVCFLFARKFHSSA  337

Query  1176  LTRLLRFAPKLMRF  1217
             L  LLR AP L+ F
Sbjct  338   LQPLLRIAPALLGF  351



>ref|XP_006842356.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
 gb|ERN04031.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
Length=376

 Score =   363 bits (931),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 227/304 (75%), Gaps = 0/304 (0%)
 Frame = +3

Query  300   EFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQ  479
             E +  P +AMH+M+DEEL+W+ASMV  +++YP+SRVPKVAFM+LTRG + L PLWE FF+
Sbjct  69    EEVAKPTDAMHNMTDEELMWQASMVSHVRQYPYSRVPKVAFMYLTRGPMPLGPLWERFFK  128

Query  480   GNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSN  659
             G+ G YSIYVH  PS    AP  SVF  R++PS+ V+WG   MI+AERRLLANALLDFSN
Sbjct  129   GHNGLYSIYVHCPPSYTVEAPPDSVFFRRKVPSKVVEWGRATMIDAERRLLANALLDFSN  188

Query  660   QRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRK  839
             +RFVLLSESCIPLFNF T YSYL+NS  +F+  +D P   GRGRY   M+P I L +WRK
Sbjct  189   ERFVLLSESCIPLFNFTTAYSYLINSHHSFVGSFDDPRHCGRGRYNKTMAPEILLSEWRK  248

Query  840   GSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWV  1019
             GSQWFE++R LAIE++SD +Y+++F+ +C   CY DEHYLPTFV   F   NSNRS  WV
Sbjct  249   GSQWFEVNRALAIEIVSDTKYYAIFREHCNPPCYMDEHYLPTFVTKNFPSSNSNRSFMWV  308

Query  1020  DWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFA  1199
             DWS GGSHPA +   D T  FL  +R  + C YNG  T++C+LFARK++ ++L  LLR A
Sbjct  309   DWSRGGSHPATFRSGDATERFLNQIRNSENCTYNGNPTSICFLFARKWAPNALQPLLRIA  368

Query  1200  PKLM  1211
             P+++
Sbjct  369   PRVL  372



>ref|XP_006385195.1| hypothetical protein POPTR_0003s00960g [Populus trichocarpa]
 gb|ERP62992.1| hypothetical protein POPTR_0003s00960g [Populus trichocarpa]
Length=392

 Score =   363 bits (932),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 186/375 (50%), Positives = 258/375 (69%), Gaps = 6/375 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQLITA---AAADqplllpppqpERT  275
             L L+ +LS  + F  G+  GL  SS+  + F+   QL      A+A              
Sbjct  19    LKLVQILSLLVIFVAGVILGLATSSHINRYFTSQAQLFLTNNIASAKLSDNNCTVVKPCE  78

Query  276   PVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLA  455
              V  + ++ F+ P +N +H M+D+++ WRAS++P+ K YPF RVPKVAFMFLTRG + L 
Sbjct  79    KVDFLNMERFVHP-DNVIHSMTDDQVFWRASLLPQKKGYPFDRVPKVAFMFLTRGPLPLL  137

Query  456   PLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             PLWE FF+G+  ++SIYVH+      +    S F+GR IPS++V+WG V++++AE+RLLA
Sbjct  138   PLWERFFRGHGQYFSIYVHTPHDYVLNVSSDSPFYGRMIPSKDVEWGSVSLVDAEKRLLA  197

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSN+RFVLLSESCIP++NFPT+Y YL+ S  +F+E YD P   GRGRY  +M P 
Sbjct  198   NALLDFSNERFVLLSESCIPIYNFPTVYKYLIRSEYSFVESYDEPTRYGRGRYSRKMLPD  257

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             I L QWRKGSQWFE+ RDLA+ ++SD +Y+++F+ YC+ +CY DEHY+PT++N+  G  N
Sbjct  258   IHLYQWRKGSQWFEIQRDLAVYIVSDTKYYTIFKKYCRPACYPDEHYIPTYLNMFHGSLN  317

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLH  1172
             SNRS+TWVDWS GG HPARY   ++T  F++++R  G +C YN E T+VCYLFARKF+  
Sbjct  318   SNRSVTWVDWSIGGPHPARYGGGNITEDFIQSIRNNGTQCSYNSEMTSVCYLFARKFAPS  377

Query  1173  SLTRLLRFAPKLMRF  1217
             +L  LL     +M F
Sbjct  378   ALVPLLSLTSTVMEF  392



>ref|XP_007033224.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY04150.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=421

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 227/306 (74%), Gaps = 1/306 (0%)
 Frame = +3

Query  306   LKPPENAMHDMSDEELLWRASMVPKIKEYPFSR-VPKVAFMFLTRGAVTLAPLWEMFFQG  482
             L+   + MH+M+++ELLWRASM P+I+E    +  PKVAFMFLT G + LAPLWE FF+G
Sbjct  115   LEEQRSLMHNMTEKELLWRASMAPRIEESSHDQHAPKVAFMFLTAGPLPLAPLWEKFFKG  174

Query  483   NEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQ  662
             NEG YSIYVHS P   E+ PE SVF+GRRIPS+ V WG   MI+AERRLLANALLD SNQ
Sbjct  175   NEGLYSIYVHSHPDYTETVPETSVFYGRRIPSKPVYWGTATMIDAERRLLANALLDISNQ  234

Query  663   RFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKG  842
             RFVLLS+SCIPLFNF  IY YL+NS  +F+ V+D P   GRGRY  +M P I +  WRKG
Sbjct  235   RFVLLSDSCIPLFNFNKIYDYLINSNLSFLSVFDDPRKAGRGRYNPQMWPAINITDWRKG  294

Query  843   SQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVD  1022
             SQWFE+ RD+A+ ++SD +Y+S+FQ YC+  CY DEHY+PT VN+ +G  NSNRS TWVD
Sbjct  295   SQWFEVHRDIALHIVSDKKYYSIFQQYCQPPCYNDEHYIPTLVNMFYGELNSNRSTTWVD  354

Query  1023  WSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAP  1202
             WS GG HP ++   D++  FL  +R G +C YNG  T++C+LFARKFS  +L  LLR AP
Sbjct  355   WSRGGPHPRKFGWPDISDEFLNQIRHGSECIYNGNTTSMCFLFARKFSPGTLEPLLRIAP  414

Query  1203  KLMRFD  1220
              ++ FD
Sbjct  415   LVLDFD  420



>ref|XP_011007501.1| PREDICTED: uncharacterized protein LOC105113152 isoform X2 [Populus 
euphratica]
Length=411

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 221/301 (73%), Gaps = 0/301 (0%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             P+   H M+D+ELLWRASMVP I EYP++R PKVAFMFLTRG++ LAPLW+MFF+G+ G 
Sbjct  109   PKELCHSMNDKELLWRASMVPHIDEYPYNRTPKVAFMFLTRGSLPLAPLWDMFFKGHAGL  168

Query  495   YSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             YSIY+H  P      PE SVF+ R+IPS+  +WG   MI+AERRLLANALLDFSN+RFVL
Sbjct  169   YSIYLHKSPEFTNQHPESSVFYQRQIPSKPAEWGRATMIDAERRLLANALLDFSNERFVL  228

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSE+CIP+FNF TIY+YLMNS  +F+  +D P   GRGRY  RM P + L  WRKGSQWF
Sbjct  229   LSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGSQWF  288

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             E  R +AIE+ISD +Y+ +F+ +C+  CY DEHY PT V       NSNRS+TWVDWS G
Sbjct  289   EAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDWSGG  348

Query  1035  GSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             GSHP R++R DV+ +FL  +R G  C YNG  T VC+LFARKF   +L  LLR AP L+ 
Sbjct  349   GSHPTRFVRKDVSEAFLNQIRNGFNCTYNGGITTVCFLFARKFHPSTLDPLLRIAPGLLG  408

Query  1215  F  1217
             F
Sbjct  409   F  409



>ref|XP_007221893.1| hypothetical protein PRUPE_ppa016090mg [Prunus persica]
 gb|EMJ23092.1| hypothetical protein PRUPE_ppa016090mg [Prunus persica]
Length=393

 Score =   362 bits (928),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 194/400 (49%), Positives = 262/400 (66%), Gaps = 22/400 (6%)
 Frame = +3

Query  45    KNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLI--------FSSYFKSFS  200
             + +++  NP LL+          L+ +LS  + F  G+  GL         F S  + +S
Sbjct  7     EREDYEKNPGLLS----------LLQVLSFLVVFVAGVVIGLATSAHINRHFGSQTEIYS  56

Query  201   LNLQLITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPK  380
                   +    ++         E+  V  + ++ FL+P +N  HDMSD+EL WRASMVP 
Sbjct  57    FINHFSSNKPNEEENCTIVQGCEK--VDCLSMETFLQP-KNLTHDMSDDELFWRASMVPG  113

Query  381   IKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFH  560
               E+PF RVPKVAFMFL+RG + + PLWE FFQG++ F+SIYVH  P    +    S F+
Sbjct  114   KVEFPFERVPKVAFMFLSRGPLPMMPLWERFFQGHDKFFSIYVHVLPGYTLNVSSTSPFY  173

Query  561   GRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNST  740
             GR+IPSQ V WG V +++AERRLL+NALLDFSNQRFVLLSESCIP++NFPT+Y YL+ S 
Sbjct  174   GRQIPSQLVSWGTVTLVDAERRLLSNALLDFSNQRFVLLSESCIPVYNFPTVYKYLIGSN  233

Query  741   TNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQY  920
              +F+E YD PG  GRGRY  +M P I+L QWRKGSQWFE+ R LAI ++S+ +Y++LF  
Sbjct  234   HSFVESYDDPGRYGRGRYSRKMLPEIELYQWRKGSQWFELSRTLAIYIVSETKYYTLFSR  293

Query  921   YCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-  1097
             YC  +CY DEHY+PT+ N+  G  NSNR++TWVDWS GG HPA Y   ++T  F+ ++R 
Sbjct  294   YCLPACYPDEHYMPTYFNMFHGSLNSNRTVTWVDWSLGGPHPATYGGDNITEDFVRSIRN  353

Query  1098  TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             +G  C+YN E T++CYLFARKF+  +L  LL  A  +M F
Sbjct  354   SGALCQYNSEMTSICYLFARKFAPSALEPLLELASSVMEF  393



>emb|CDP00652.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   358 bits (918),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 221/294 (75%), Gaps = 0/294 (0%)
 Frame = +3

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             MSDEELLWRAS+VP I EYPF+R PK+AFMFLTRG++ LAPLWE+FF+G++GF+SIY+H+
Sbjct  1     MSDEELLWRASLVPHITEYPFNRTPKIAFMFLTRGSLPLAPLWEVFFKGHQGFFSIYLHT  60

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
              P      PE SVF+ RRIPS+ V+WG V MI+AE+RLLANALLD SN+RF+LLSE+CIP
Sbjct  61    SPEFTNEPPESSVFYKRRIPSKHVQWGRVTMIDAEKRLLANALLDHSNERFILLSEACIP  120

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             +FNF TIY+YL+N+  +F+  +D P   GRGRY  RM P+I L  WRKGSQWFE +R LA
Sbjct  121   IFNFTTIYNYLINANQSFLSTFDDPRPIGRGRYNKRMWPMITLSDWRKGSQWFEANRKLA  180

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
             IE++SD + + +F+  C   CY DEHYLPT V        SNR++TW DWS GGSHP  +
Sbjct  181   IEIVSDVKLYPIFRDLCMPPCYMDEHYLPTLVTKVCPELTSNRTITWTDWSTGGSHPRTF  240

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             +R+D+T  FL   R G  C YNGE ++VC+LFARKF   +L  LLR APKL+ F
Sbjct  241   MRNDITEPFLNQARFGVNCSYNGEISSVCHLFARKFHPSTLQPLLRIAPKLLGF  294



>ref|XP_010065247.1| PREDICTED: uncharacterized protein LOC104452469 [Eucalyptus grandis]
 gb|KCW62594.1| hypothetical protein EUGRSUZ_G00083 [Eucalyptus grandis]
Length=391

 Score =   361 bits (926),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 190/375 (51%), Positives = 254/375 (68%), Gaps = 6/375 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTP---  278
             L L+ +LS+ + F  G+  GL  S++  ++  +   +  +A      +  P+   TP   
Sbjct  18    LKLVQVLSSLVIFVAGIIIGLTTSTHMNNYFASQTELFFSANHATASVAIPEKNCTPCEK  77

Query  279   VAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAP  458
             V  + +  FL P  +A H MSD ELLWRASMVP+ + YPF+RVPKVAFMFLTRG + + P
Sbjct  78    VDCLSMDTFLYP-RSATHGMSDVELLWRASMVPRKRGYPFTRVPKVAFMFLTRGPLPMLP  136

Query  459   LWEMFFQGNE-GFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             LWE FF G E   Y++YVH+ P    +    S F+GR+IPSQ+V WG V +++AERRLLA
Sbjct  137   LWEKFFDGQERHLYTVYVHALPGYELNVSSTSPFYGRQIPSQKVAWGTVQLVDAERRLLA  196

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSN+RFVLLSESCIP++NFPT+Y YL  S  +F+E YD P   GRGRY   M P 
Sbjct  197   NALLDFSNERFVLLSESCIPVYNFPTVYKYLTGSDHSFVESYDDPSRYGRGRYSRSMLPY  256

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             I+L QWRKGSQWFEM R+LA  ++SD +Y+SLF+ YCK +CY DEHY+PT++N+  G  N
Sbjct  257   IRLHQWRKGSQWFEMTRNLAAYIVSDTKYYSLFEKYCKPACYPDEHYIPTYLNMFHGSKN  316

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLH  1172
             SNRS+TWVDWS GG HPA + + ++T  F+  +R    +C YN  +T++CYLFARKF   
Sbjct  317   SNRSVTWVDWSLGGPHPATFRKSNITEDFIRAIRNNATRCWYNSGKTSLCYLFARKFDPS  376

Query  1173  SLTRLLRFAPKLMRF  1217
             +L  LL  +  +M F
Sbjct  377   ALVPLLNLSSIVMEF  391



>ref|XP_008218660.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
 ref|XP_008218661.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
 ref|XP_008218662.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
Length=393

 Score =   361 bits (926),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 194/400 (49%), Positives = 262/400 (66%), Gaps = 22/400 (6%)
 Frame = +3

Query  45    KNQNHNNNPPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLI--------FSSYFKSFS  200
             + +++  NP LL+          L+ +LS  + F  G+  GL         F S  + +S
Sbjct  7     EREDYEKNPGLLS----------LLQVLSFLVVFVAGVVIGLATSAHINRHFGSQTEIYS  56

Query  201   LNLQLITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPK  380
                   +    ++         E+  V  + ++ FL+P +N  HDMSD+EL WRASMVP 
Sbjct  57    FINHFSSNKPNEEENCTIVQGCEK--VDCLSMETFLQP-KNLTHDMSDDELFWRASMVPG  113

Query  381   IKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFH  560
              +++PF RVPKVAFMFL+RG + L PLWE FFQG++ F+SIYVH  P    +    S F+
Sbjct  114   KEDFPFERVPKVAFMFLSRGPLPLMPLWERFFQGHDKFFSIYVHVLPGYKLNVSSTSPFY  173

Query  561   GRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNST  740
             GR+IPSQ V WG V +++AERRLL+NALLDFSNQRFVLLSESCIP++NFPT+Y YL+ S 
Sbjct  174   GRQIPSQLVSWGTVTLVDAERRLLSNALLDFSNQRFVLLSESCIPVYNFPTVYKYLIGSN  233

Query  741   TNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQY  920
              +F+E YD PG  GRGRY  +M P I+L QWRKGSQWFE+ R LAI ++S+ +Y++LF  
Sbjct  234   HSFVESYDDPGRYGRGRYSRKMLPEIELYQWRKGSQWFELSRTLAIYIVSETKYYTLFSR  293

Query  921   YCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-  1097
             YC  +CY DEHY+PT+ N+  G  NSNR++TWVDWS GG HPA Y   ++T  F+ ++R 
Sbjct  294   YCMPACYPDEHYMPTYFNMFHGSLNSNRTVTWVDWSLGGPHPATYGGDNITEDFVRSIRN  353

Query  1098  TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              G  C+YN E T++CYLFARKF+  +L  LL  A  +M F
Sbjct  354   NGALCQYNSEMTSICYLFARKFAPSALEPLLELASSVMEF  393



>ref|XP_011035090.1| PREDICTED: uncharacterized protein LOC105133011 [Populus euphratica]
Length=377

 Score =   360 bits (925),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 194/356 (54%), Positives = 237/356 (67%), Gaps = 13/356 (4%)
 Frame = +3

Query  153   GLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMH  332
             GL+ G+I   Y +SF   LQ   AA +             +P+ +  L         AMH
Sbjct  34    GLSLGMILCQYLRSFPFTLQ---AAPSPMF----------SPIPSKSLLVETTHELLAMH  80

Query  333   DMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVH  512
             +MSDEELL RAS VP ++E      PKVAFMFLT G + L+ LWE FF+G+EG YSIY+H
Sbjct  81    NMSDEELLRRASKVPIVQESAHKHAPKVAFMFLTYGPLPLSLLWEKFFEGHEGLYSIYLH  140

Query  513   SDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCI  692
               PS N+S P  SVF+GRRIPSQ V WG   MI+AERRLLANALLD+SNQRFVLLSESCI
Sbjct  141   PHPSYNDSWPRSSVFYGRRIPSQAVYWGTGTMIDAERRLLANALLDYSNQRFVLLSESCI  200

Query  693   PLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDL  872
             PLFNF T Y ++MNS  +F+  +D P   GRGRY  RM P I +  WRKGSQWFE+ RD+
Sbjct  201   PLFNFKTTYDHVMNSNLSFLGSFDDPRKPGRGRYNPRMWPAINITDWRKGSQWFEVHRDM  260

Query  873   AIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPAR  1052
             A+ +ISD +Y+ +FQ +C   CY DEHY PT VNI +   NSNRS+TWVDWS GG HPA+
Sbjct  261   AVHIISDKKYYQVFQEHCHPPCYMDEHYFPTLVNILYPELNSNRSITWVDWSRGGPHPAK  320

Query  1053  YLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             +   D+T  FL  +R G +C YNG  T++CYLFARKF   +L  LLR AP L  FD
Sbjct  321   FGWADITDEFLNQIRLGSECVYNGNTTSMCYLFARKFLPQTLEPLLRIAPLLHVFD  376



>ref|XP_009345696.1| PREDICTED: uncharacterized protein LOC103937474 [Pyrus x bretschneideri]
Length=411

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 197/389 (51%), Positives = 253/389 (65%), Gaps = 21/389 (5%)
 Frame = +3

Query  117   INLLSAFLFFACGLTCGLIFSSYFKSFSL-----------NLQLITAAAADqplllpppq  263
             +N +  FLFF  GL+ G+I + YF+SFS            N+  +  ++       PP  
Sbjct  22    LNHVLHFLFFGIGLSLGIIITLYFQSFSFTTFQASLNSINNIFPLQPSSLQAQSSPPPSP  81

Query  264   pERTPVAAVGLQEF----------LKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPK  413
                 P     +  F          L   +  +H+MSD+EL  RA MVP+I++ P+  VPK
Sbjct  82    NPLPPPPPFLILSFSKNGTSNSVSLTEQKFLVHNMSDKELFSRALMVPRIQDLPYKLVPK  141

Query  414   VAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKW  593
             VAFMFLT+G + L+PLWE FF+G+EG YSIYVH+ P  NES PE SVFH RRI SQ V W
Sbjct  142   VAFMFLTKGPLPLSPLWEKFFEGHEGLYSIYVHAHPDFNESVPEDSVFHSRRIHSQPVYW  201

Query  594   GDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPG  773
             G  +M++AERRLLANALLD SNQRFVLLSESCIPLFNF T Y YL+NS  +F+  +D P 
Sbjct  202   GTSSMLDAERRLLANALLDISNQRFVLLSESCIPLFNFTTAYHYLINSNLSFLNSFDDPR  261

Query  774   STGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEH  953
               GRGRY  +M P+I +  WRKGSQWFE+ R+LA+ ++SD +Y+ +FQ YC   CY DEH
Sbjct  262   KPGRGRYNPQMYPMINITDWRKGSQWFEVHRELAVHIVSDRKYYPIFQQYCNPPCYIDEH  321

Query  954   YLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEET  1133
             Y+PT VN+ +   NSNRS+TWVDWS GG HP ++   D+T  FL  +R G +C YNG  T
Sbjct  322   YIPTLVNLMYTELNSNRSVTWVDWSRGGPHPGKFGWMDITDEFLNRIRFGSECTYNGNTT  381

Query  1134  NVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             +V +LFARKF   +L  LLR AP L+ FD
Sbjct  382   SVFFLFARKFLPDALEPLLRVAPLLLGFD  410



>ref|XP_009615448.1| PREDICTED: uncharacterized protein LOC104108166 [Nicotiana tomentosiformis]
Length=401

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 230/310 (74%), Gaps = 1/310 (0%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             + L++FL P ++  H M+D+EL+WRASMV ++K+YPF+R PKVAF+FLTRG + LAPLWE
Sbjct  92    MDLKDFLSP-KDLWHAMNDDELMWRASMVSQVKQYPFNRTPKVAFLFLTRGRLPLAPLWE  150

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
             MFF+ NEG +SIY+H+ P  N   P  SVF+ RRIPSQ V+WG  +MI+AERRLLANALL
Sbjct  151   MFFKRNEGLFSIYLHTSPEFNFEPPPSSVFYKRRIPSQTVQWGRASMIDAERRLLANALL  210

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             D SN+RF+LLSE+CIPLFNF TIY++L  S  +F+ ++D P   GRGRY  RM P+I + 
Sbjct  211   DISNERFILLSETCIPLFNFTTIYNFLTKSNQSFLGLFDDPRKIGRGRYNKRMHPIITIS  270

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
              WRKGSQWFE+ R LA+++ISD  Y+ +F+ YC   CY DEHYLPT VN    +  SN S
Sbjct  271   DWRKGSQWFEVHRKLALKIISDVTYYPVFKNYCTPPCYMDEHYLPTLVNKVCPKLTSNWS  330

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             +TW DWS GGSHP  +LR DVT  FL+++R G  C YNGE +++C+LF RKF   +L  L
Sbjct  331   VTWADWSAGGSHPTTFLRKDVTEEFLDSVRYGFNCSYNGELSSICFLFGRKFHPSTLQPL  390

Query  1188  LRFAPKLMRF  1217
             LR  PKL+ F
Sbjct  391   LRIGPKLLGF  400



>ref|XP_009767015.1| PREDICTED: uncharacterized protein LOC104218269 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009767016.1| PREDICTED: uncharacterized protein LOC104218269 isoform X2 [Nicotiana 
sylvestris]
Length=310

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 224/301 (74%), Gaps = 0/301 (0%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             P++  H M+DEEL+WRASMV +I +YPF+R PKVAF+FLTRG + LAPLWEMFF+G+E  
Sbjct  9     PKDLWHAMNDEELMWRASMVSQIMDYPFNRTPKVAFLFLTRGRLPLAPLWEMFFKGHEEL  68

Query  495   YSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             +SIY+H+ P  N   P  SVF+ RRIPSQEV+WG  +MI+AERRLLANALLD SN+RF+L
Sbjct  69    FSIYLHTSPEFNFEPPPTSVFYKRRIPSQEVQWGRASMIDAERRLLANALLDISNERFIL  128

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSE+CIPLFNF TIY++L  S  +F+ ++D P   GRGRY  RM P+I +  WRKGSQWF
Sbjct  129   LSETCIPLFNFTTIYTFLTKSNQSFLGLFDDPRKIGRGRYNKRMYPIITISDWRKGSQWF  188

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             E+ R+LA+++ISD  Y+ +F+ YC   CY DEHYLPT VN    +  SN S+TW DWS G
Sbjct  189   EVHRELALKIISDVTYYPVFKNYCTPPCYMDEHYLPTLVNKVCPKLTSNWSVTWADWSAG  248

Query  1035  GSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             GSHP  +LR DVT  FL+++R G  C YNGE +++C+LF RKF   +L  LLR  PKL  
Sbjct  249   GSHPTTFLRKDVTEEFLDSVRYGSNCSYNGELSSICFLFGRKFHPSTLQPLLRIGPKLFG  308

Query  1215  F  1217
             F
Sbjct  309   F  309



>ref|XP_004300973.1| PREDICTED: uncharacterized protein LOC101293399 [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   360 bits (924),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/317 (58%), Positives = 230/317 (73%), Gaps = 4/317 (1%)
 Frame = +3

Query  276   PVAAV-GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTL  452
             P++ +  L +++ P E   H MSD+ELLWRASM P++ EYP++R PKVAFMFLT+G + L
Sbjct  87    PISTLPNLSDYIAPKE-LWHSMSDQELLWRASMAPQVTEYPYNRTPKVAFMFLTKGKLPL  145

Query  453   APLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrll  632
             APLWE FF+G+EGFYS+Y+H+ P      PE SVF+ R IPS+ V+WG V M+EAERRLL
Sbjct  146   APLWERFFRGHEGFYSVYLHAAPDFKNEPPESSVFYKRMIPSKAVEWGKVTMVEAERRLL  205

Query  633   anallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSP  812
             ANALLDFSN+RFVLLSESCIPLFNF T+Y YL NS  +FI  +D P  TGRGRY  RM P
Sbjct  206   ANALLDFSNERFVLLSESCIPLFNFTTVYDYLTNSKYSFISSFDDPRGTGRGRYNRRMWP  265

Query  813   VIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRG  992
              + L  WRKGSQWFE+ R+LA++++SD  YF +F+  C+  CY DEHYL T V  + G G
Sbjct  266   TVTLSDWRKGSQWFEVHRNLALKIVSDVTYFPIFRDLCQPPCYNDEHYLATLVT-KVGPG  324

Query  993   -NSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSL  1169
              NSNRS+TW DWS GG HPA Y R DV   FL  LR G  C YNG  +N+C+LFARKF  
Sbjct  325   VNSNRSITWADWSIGGPHPATYERRDVNEMFLNQLRHGFNCTYNGGISNICHLFARKFHP  384

Query  1170  HSLTRLLRFAPKLMRFD  1220
              +L  LL+ AP L +F+
Sbjct  385   SALEPLLKIAPALFKFN  401



>ref|XP_003603189.1| hypothetical protein MTR_3g104840 [Medicago truncatula]
 gb|AES73440.1| core-2/I-branching enzyme [Medicago truncatula]
Length=394

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 200/413 (48%), Positives = 263/413 (64%), Gaps = 39/413 (9%)
 Frame = +3

Query  42    MKNQNHNNNPPLLTSIKLYNAPLNLINLLSAFL-FFACGLTCGLIFSSYFKSFSLNLQLI  218
             M  +N+ +   + + +K + A L   N  +  L F  C L  G+  +   K+FS N+QL 
Sbjct  1     MTMENNKDQQSITSYLKFFIAKLYSRNFFAFNLAFCCCCLLVGITLTFCAKTFSFNIQLQ  60

Query  219   T------------------AAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSD  344
                                 ++ +           +  +    L+++ K P    HDM+D
Sbjct  61    QLQNPPLIFNEPSHFSPPPISSNNSTKSHYQNNQTKFSINENSLEDYSKIPM-VTHDMND  119

Query  345   EELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPS  524
             +EL  R S++  I E PF++ PK+AFMFLT+G V LAP WE FF+GNEG YSIY+H  PS
Sbjct  120   DELFRRTSLISMIHEPPFNQTPKIAFMFLTKGPVLLAPFWEKFFKGNEGMYSIYIHPSPS  179

Query  525   CNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLF  701
              N++   E SVFHGRRIPS+EVKWG+ +MIEAERRLLANALLDFSNQRFVLLSESCIPLF
Sbjct  180   FNQTVYNERSVFHGRRIPSKEVKWGETSMIEAERRLLANALLDFSNQRFVLLSESCIPLF  239

Query  702   NFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIE  881
             NF TIY+YLMNS   F+E  +                 IK  QW+KGSQWF++DR L + 
Sbjct  240   NFSTIYTYLMNSNETFVEANE-----------------IKNSQWKKGSQWFQIDRYLGLH  282

Query  882   VISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLR  1061
             ++SD  YFS+F+ YC   CY+DEHYLPTF++  FG+ NSNR+LTWVDWS GG HP+ +  
Sbjct  283   IVSDKTYFSMFKKYCNTPCYSDEHYLPTFISNEFGKRNSNRTLTWVDWSKGGPHPSSFTG  342

Query  1062  HDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              DVT  FLE LR G  CE+NG  T++C+LFARKF+ H+L  L+R+APKLM+F+
Sbjct  343   KDVTTEFLERLRFGSTCEHNG-RTSICHLFARKFTPHALDILVRYAPKLMQFN  394



>ref|XP_011047853.1| PREDICTED: uncharacterized protein LOC105142093 [Populus euphratica]
 ref|XP_011003712.1| PREDICTED: uncharacterized protein LOC105110387 [Populus euphratica]
Length=392

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 185/375 (49%), Positives = 255/375 (68%), Gaps = 6/375 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKS-FSLNLQLITA---AAADqplllpppqpERT  275
             L L+ +LS  + F  G+  GL  SS+    F+   QL      A+A              
Sbjct  19    LKLVQILSLLVIFVAGVILGLATSSHINHYFTSQAQLFLTNNIASAKLSDNNCTVVKPCE  78

Query  276   PVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLA  455
              V  + ++ F+ P +N +H M+D+++ WRAS++P+ K YPF RVPKVAFMFLTRG + L 
Sbjct  79    KVDFLNMERFVHP-DNVIHSMTDDQVFWRASLLPQKKGYPFDRVPKVAFMFLTRGPLPLL  137

Query  456   PLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             PLWE FF+G+  ++SIYVH+      +    S F+GR IPS++V+WG V++++AE+RLLA
Sbjct  138   PLWERFFRGHGQYFSIYVHTPHDYVLNVSSDSPFYGRMIPSKDVEWGSVSLVDAEKRLLA  197

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSN+RFVLLSESCIP++NFPT+Y YL+ S  +F+E YD P   GRGRY  +M P 
Sbjct  198   NALLDFSNERFVLLSESCIPIYNFPTVYKYLIRSEYSFVESYDEPTRYGRGRYSRKMLPD  257

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             I L QWRKGSQWFE+ RDLA+ ++SD +Y+++F+ YC+  CY DEHY+PT++N+  G  N
Sbjct  258   IHLYQWRKGSQWFEIQRDLAVYIVSDTKYYTIFKKYCRPVCYPDEHYIPTYLNMFHGSLN  317

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLH  1172
             SNRS+TWVDWS GG HPA Y   ++T  F++++R  G +C YN E T+VCYLFARKF+  
Sbjct  318   SNRSVTWVDWSIGGPHPATYGGGNITEDFIQSIRNNGTQCSYNSEMTSVCYLFARKFAPS  377

Query  1173  SLTRLLRFAPKLMRF  1217
             +L  LL     +M F
Sbjct  378   ALVPLLSLTSTVMEF  392



>gb|KDP34129.1| hypothetical protein JCGZ_07700 [Jatropha curcas]
Length=386

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 224/309 (72%), Gaps = 0/309 (0%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
              L  ++KPP N +H M+DEELLWRAS+VP+IK+YPF RVPK+AFMFLT+G + LAPLWE 
Sbjct  78    ALDRWIKPPSNLLHKMNDEELLWRASLVPRIKKYPFKRVPKIAFMFLTKGPLPLAPLWER  137

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             F +G+EG YSIY+HS P+     P  SVFHGR++PSQ  +WG +NM +AERRLLANALLD
Sbjct  138   FLRGHEGLYSIYIHSLPTFEAKFPPSSVFHGRQVPSQISEWGKMNMCDAERRLLANALLD  197

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+ F+LLSESCIPL+NF  IY Y+M S  +F+  +D PG  GRGRY   M+P + + Q
Sbjct  198   ISNEWFILLSESCIPLYNFTVIYHYIMRSKYSFVGAFDDPGPYGRGRYNENMAPEVNISQ  257

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGSQWFE++R LA+ ++ D +Y+  F+ +CK +CY DEHY PT +NI+     +NRSL
Sbjct  258   WRKGSQWFEVNRRLAVTIVEDTKYYPKFEEFCKPNCYVDEHYFPTMLNIQAAHLIANRSL  317

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLL  1190
             TWVDWS GG+HPA + R D+T  F      G  C YN + +++C+LF RKF+  +L  LL
Sbjct  318   TWVDWSRGGAHPATFGRADITEDFFRKFFEGQHCTYNNQPSSICFLFGRKFAPSALEPLL  377

Query  1191  RFAPKLMRF  1217
               AP ++ F
Sbjct  378   HIAPSVLGF  386



>ref|XP_007044267.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY00099.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=404

 Score =   359 bits (922),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 226/303 (75%), Gaps = 0/303 (0%)
 Frame = +3

Query  318   ENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFY  497
             E+A H M+DEEL+WRAS VP + EYP +R PKVAFMFL+RG + LAPLWE FF G++G Y
Sbjct  102   EDAWHSMTDEELMWRASTVPNVVEYPHNRTPKVAFMFLSRGTLPLAPLWEKFFMGHKGLY  161

Query  498   SIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLL  677
             SIY H+ P   +     SVF+ RRIPS+ V+WG   M++AERRLLANALLD +N+RFVLL
Sbjct  162   SIYFHTSPDFIDKPLVTSVFYERRIPSKPVQWGRATMVDAERRLLANALLDLTNERFVLL  221

Query  678   SESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFE  857
             SE+CIPLFNF T+Y+YL+NS+ +F+  +D P  TGRGRY  +M P + L  WRKGSQWFE
Sbjct  222   SEACIPLFNFTTVYNYLINSSRSFLGSFDDPTHTGRGRYNKQMWPTVSLADWRKGSQWFE  281

Query  858   MDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGG  1037
             ++R LA E++SDD+Y+ +F+ +C+  CY DEHYLPT VN+     NSNRS+TWVDWS GG
Sbjct  282   VNRMLAAEIVSDDKYYPVFRDHCRPPCYMDEHYLPTLVNLICPELNSNRSITWVDWSRGG  341

Query  1038  SHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              HP +YLR DV+V+ L  +R G  C YNGE +++C+LFARKF   +L  LLR AP L+ F
Sbjct  342   PHPTKYLRKDVSVALLNQVRQGFNCTYNGERSSICFLFARKFHPSTLEPLLRIAPALLGF  401

Query  1218  DEK  1226
               +
Sbjct  402   GHQ  404



>ref|XP_006647208.1| PREDICTED: uncharacterized protein LOC102715175 [Oryza brachyantha]
Length=429

 Score =   360 bits (924),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 229/297 (77%), Gaps = 5/297 (2%)
 Frame = +3

Query  333   DMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVH  512
             D+SDEEL+    +  ++     +  PKVAF+FLTR  + +APLWE FF+G+ G YS+YVH
Sbjct  135   DISDEELM---KLAARVAPREAAGAPKVAFLFLTRWDLPMAPLWEKFFEGHRGLYSVYVH  191

Query  513   SDPSCNESAP-EGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESC  689
             +DP+ N S P E S FH R IPS+EVKWG ++M+EAERRLLA+A+LD SN RFVLLSES 
Sbjct  192   TDPAFNGSDPGEASAFHRRTIPSKEVKWGQISMVEAERRLLAHAILDHSNARFVLLSESH  251

Query  690   IPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRD  869
             +PLF+FPT+YSYL+NS+  ++E YDLPG+TGRGRYK  M P++ + QWRKGSQWFEMDR 
Sbjct  252   VPLFDFPTVYSYLVNSSKVYVESYDLPGATGRGRYKRAMGPLVTVAQWRKGSQWFEMDRR  311

Query  870   LAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPA  1049
             +A +V++DD YF +F+ +C+ +CYADEHYLPT ++IR     +NRS+TWVDWSHGG HPA
Sbjct  312   VAGDVVADDVYFPVFRRFCRRNCYADEHYLPTLLSIRHPSRVANRSVTWVDWSHGGPHPA  371

Query  1050  RYLRHDVTVSFLETLRTGDK-CEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             R+ R +VT  FL  LRTG   C+YNG  T VC+LFARKF  +SLTR LRFAPK+M F
Sbjct  372   RFTRMEVTPDFLRWLRTGAATCDYNGGTTTVCFLFARKFLPNSLTRFLRFAPKVMGF  428



>ref|XP_004972519.1| PREDICTED: uncharacterized protein LOC101756391 [Setaria italica]
Length=452

 Score =   361 bits (926),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 228/296 (77%), Gaps = 6/296 (2%)
 Frame = +3

Query  342   DEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDP  521
             DEEL+  A+  P+  + P    PKVAF+FLTR  + +APLW+ FF G+ G YS+YVH+DP
Sbjct  158   DEELMALAATAPR--KVPRGAAPKVAFLFLTRWDLPMAPLWDKFFAGHRGRYSVYVHTDP  215

Query  522   SCNES-APEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF-SNQRFVLLSESCIP  695
             + N S  PE S F+ RRIPS+EVKWG+V+M+EAERRLLA+ALLD  SN RFVLLSES +P
Sbjct  216   AFNGSEPPETSAFYRRRIPSKEVKWGEVSMVEAERRLLAHALLDDPSNARFVLLSESHVP  275

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LF+FPT++SYL+NST  F+E YD PG+TGRGRY  RMSPV+   QWRKGSQWFE+DR LA
Sbjct  276   LFDFPTVHSYLINSTKVFLESYDQPGATGRGRYSRRMSPVVAAAQWRKGSQWFELDRGLA  335

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
              +V++D  +F +F+ YCK SCYADEHYLPTF+N+R     +NRSLTWVDWS GG HPAR+
Sbjct  336   ADVVADRVFFPVFRRYCKRSCYADEHYLPTFLNVRRPSAGANRSLTWVDWSRGGPHPARF  395

Query  1056  LRHDVTVSFLETLR--TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              R +VTV FL  LR   G  CEYNG  T+VC+LFARKF  +SLTR LRFAPK+M F
Sbjct  396   TRMEVTVDFLRWLRGGAGSTCEYNGRTTDVCFLFARKFLPNSLTRFLRFAPKVMGF  451



>ref|XP_006431491.1| hypothetical protein CICLE_v10001419mg [Citrus clementina]
 gb|ESR44731.1| hypothetical protein CICLE_v10001419mg [Citrus clementina]
Length=393

 Score =   358 bits (920),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 252/381 (66%), Gaps = 8/381 (2%)
 Frame = +3

Query  96    YNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI-----TAAAADqplllppp  260
             Y   L L+ +LS  + FA G+  GL  SS+   +      +      +A +  P      
Sbjct  14    YMGLLKLVQILSFLVVFAAGIIIGLATSSHMNRYFTRESFLFSDSRYSAPSSTPQGSCAV  73

Query  261   qpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRG  440
                   +  + + +F++P  N  H M+DE+L WRASMVP  +EYPF R P+VAFMFLTRG
Sbjct  74    VQTCDDIDYLNIDKFVRP-ANLSHRMTDEQLFWRASMVPYKEEYPFERTPRVAFMFLTRG  132

Query  441   AVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeae  620
              + L PLWE FF+G+E ++SIYVH+ P    +    S F+GR+IPS+ V WG V M +AE
Sbjct  133   PLPLLPLWERFFKGHEKYFSIYVHALPGYKLNVSSDSPFYGRQIPSRNVGWGTVEMADAE  192

Query  621   rrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKH  800
             +RLLANALLDFSN+RFVLLSESCIP++NFPT+Y YL  S  +F+E YD P   GRGRY  
Sbjct  193   KRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSR  252

Query  801   RMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR  980
              M P IK+ QWRKGSQWFEM R +AI +ISD +Y SLF+ YCK SCY DEHY+PT++NI 
Sbjct  253   WMRPDIKIYQWRKGSQWFEMQRKVAIYIISDTKYLSLFRKYCKPSCYPDEHYIPTYLNIF  312

Query  981   FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR--TGDKCEYNGEETNVCYLFA  1154
              G   +NRS+TWVDWS  G HPA Y + ++T  F+++LR   G  C YN + T+ CYLFA
Sbjct  313   HGSLMANRSVTWVDWSMLGPHPAMYKKENITEEFIQSLRNSNGSLCLYNEQRTSRCYLFA  372

Query  1155  RKFSLHSLTRLLRFAPKLMRF  1217
             RKF+ ++L  LL+ + K+M F
Sbjct  373   RKFAPNTLEPLLKISSKVMEF  393



>ref|XP_009337144.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
 ref|XP_009337145.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
Length=389

 Score =   358 bits (919),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 179/371 (48%), Positives = 244/371 (66%), Gaps = 12/371 (3%)
 Frame = +3

Query  105   PLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVA  284
             P+ L+ L + FL F    +   I++   + F +N  + T AA+           +  P  
Sbjct  31    PIRLLQLFALFLVFCITFSVISIYT--IRHFGINGMMTTVAAS----------FQPCPEE  78

Query  285   AVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
               GL  ++KPP +  H M+DEELLWRAS  P+IK+YPF RVPK+AFMFLT+G + LAPLW
Sbjct  79    PKGLDRWIKPPSSVKHTMNDEELLWRASFTPRIKKYPFERVPKIAFMFLTKGPLPLAPLW  138

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             E F +G+EG YS+YVHS PS        SVF+GR IPSQ  +WG ++M +AERRLLANAL
Sbjct  139   ERFLKGHEGLYSVYVHSLPSFQPHFNPSSVFYGRHIPSQVAEWGRMSMCDAERRLLANAL  198

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SN+RF+LLSESCIPL+NF  IY YLM S  +++  +D PG  GRGRY   M+P +K+
Sbjct  199   LDISNERFILLSESCIPLYNFSVIYHYLMKSKYSYVGAFDDPGPYGRGRYNDNMAPEVKI  258

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              +WRKGSQWFE++R LAI ++ D +++  F+ +C+ +CY DEHY PT + I  G   +NR
Sbjct  259   SKWRKGSQWFEVNRKLAITIVEDTKFYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANR  318

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             S+TWVDWS GG HPA + R  +T  FL+ +    +C YN   + +C+LF RKF+  ++  
Sbjct  319   SITWVDWSRGGPHPATFGRAHITGEFLKRIFETQRCTYNDRNSTICFLFGRKFAPSAMEP  378

Query  1185  LLRFAPKLMRF  1217
             LL  APK + F
Sbjct  379   LLHLAPKFLGF  389



>ref|XP_009767014.1| PREDICTED: uncharacterized protein LOC104218269 isoform X1 [Nicotiana 
sylvestris]
Length=406

 Score =   358 bits (920),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 224/301 (74%), Gaps = 0/301 (0%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             P++  H M+DEEL+WRASMV +I +YPF+R PKVAF+FLTRG + LAPLWEMFF+G+E  
Sbjct  105   PKDLWHAMNDEELMWRASMVSQIMDYPFNRTPKVAFLFLTRGRLPLAPLWEMFFKGHEEL  164

Query  495   YSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             +SIY+H+ P  N   P  SVF+ RRIPSQEV+WG  +MI+AERRLLANALLD SN+RF+L
Sbjct  165   FSIYLHTSPEFNFEPPPTSVFYKRRIPSQEVQWGRASMIDAERRLLANALLDISNERFIL  224

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSE+CIPLFNF TIY++L  S  +F+ ++D P   GRGRY  RM P+I +  WRKGSQWF
Sbjct  225   LSETCIPLFNFTTIYTFLTKSNQSFLGLFDDPRKIGRGRYNKRMYPIITISDWRKGSQWF  284

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             E+ R+LA+++ISD  Y+ +F+ YC   CY DEHYLPT VN    +  SN S+TW DWS G
Sbjct  285   EVHRELALKIISDVTYYPVFKNYCTPPCYMDEHYLPTLVNKVCPKLTSNWSVTWADWSAG  344

Query  1035  GSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             GSHP  +LR DVT  FL+++R G  C YNGE +++C+LF RKF   +L  LLR  PKL  
Sbjct  345   GSHPTTFLRKDVTEEFLDSVRYGSNCSYNGELSSICFLFGRKFHPSTLQPLLRIGPKLFG  404

Query  1215  F  1217
             F
Sbjct  405   F  405



>ref|XP_008775897.1| PREDICTED: uncharacterized protein LOC103696141 [Phoenix dactylifera]
Length=391

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/362 (51%), Positives = 252/362 (70%), Gaps = 10/362 (3%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA  287
             + L+  +S  + F  G   GL  S++F  +  N Q    A    P  +     +R     
Sbjct  31    IGLMKFVSILVVFMAGAVLGLSVSAHFNKY-FNSQ----ADLFFPRTMYTANCDRD---C  82

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
             + ++ F+ P  + MH M+D+EL WRA+MVPK+++YPF RVPKVAFMFLTRG +   PLW+
Sbjct  83    LSIKSFVNP-SHLMHTMTDDELFWRATMVPKMEDYPFERVPKVAFMFLTRGPLPFVPLWD  141

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              F +G+EG YS+YVH+ P    +  + S F+GR++PS EV WG V +++AE+RLLANALL
Sbjct  142   KFLRGHEGLYSVYVHALPDYKLNVSDDSAFYGRQVPSLEVSWGSVTLVDAEKRLLANALL  201

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DFSN+RFVLLSESCIP+ NFP +Y YL+NS  +F+E YD   S GRGRY   M+P IKL 
Sbjct  202   DFSNERFVLLSESCIPVHNFPAVYEYLINSEHSFVESYDDDSSQGRGRYSRYMAPHIKLY  261

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
             QWRKGS+WFE++RDLA+ +++D RY+++F+ YCK SCY DEHY+PT++N+  G  N+NRS
Sbjct  262   QWRKGSEWFELNRDLAVTIVADYRYYAIFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRS  321

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             LTWVDWS GG HPARY   ++T  F++ +R  G  C YN   T+VC+LFARKF+ ++L  
Sbjct  322   LTWVDWSRGGPHPARYGAPNITAEFIQAIRNNGTFCMYNSRPTSVCFLFARKFAPNALEP  381

Query  1185  LL  1190
             LL
Sbjct  382   LL  383



>ref|XP_009410706.1| PREDICTED: uncharacterized protein LOC103992641 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 229/302 (76%), Gaps = 1/302 (0%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             P N +H M+D+EL WRASMVPK+ EYPF RVPKVAF+F+TRG +   PLW+ FF+G++G 
Sbjct  90    PTNLIHSMTDDELNWRASMVPKMDEYPFQRVPKVAFLFMTRGPLPFVPLWDRFFKGHKGL  149

Query  495   YSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVL  674
             YSIYVH+ P    +    S F+GR+IPS+EV WG + +++AE+RLLANALLDFSN+RFVL
Sbjct  150   YSIYVHTLPDYKLNVSGTSAFYGRQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVL  209

Query  675   LSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWF  854
             LSESCIP++NFPT+Y YL+NS  +F+E YD     GRGRY  RM+P I L QWRKGS+WF
Sbjct  210   LSESCIPVYNFPTVYEYLINSAHSFVESYDENTRQGRGRYSWRMAPKIMLYQWRKGSEWF  269

Query  855   EMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             E++R+LA  ++++ +Y+ LF+ YCK SCY DEHY+PT++N+  G  N+NRSLTWVDWS G
Sbjct  270   ELNRELATNIVAEHKYYPLFRKYCKPSCYPDEHYIPTYLNMFHGALNANRSLTWVDWSRG  329

Query  1035  GSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLM  1211
             GSHPARY   ++TV F++++R  G  C YN   T++C+LFARKF+  +L  LL     +M
Sbjct  330   GSHPARYGAPNITVEFIQSIRNNGTFCLYNSVPTSICFLFARKFAPSALAPLLNLTSTVM  389

Query  1212  RF  1217
              F
Sbjct  390   GF  391



>ref|XP_008240317.1| PREDICTED: uncharacterized protein LOC103338839 [Prunus mume]
Length=380

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 223/298 (75%), Gaps = 3/298 (1%)
 Frame = +3

Query  327   MHDMSDE-ELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSI  503
             +H M D+ ELLWRAS+VP+I+++PF+ VP+VAFMFLT+G + LAPLWEMFF+G+EG Y+I
Sbjct  79    LHKMDDDDELLWRASLVPRIRKFPFNHVPRVAFMFLTKGPIPLAPLWEMFFKGHEGLYTI  138

Query  504   YVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSE  683
             YVH+ PS  +S P+ SVF+GRRIPS+EV WG   MI+ ERRLLA+ALLDFSN+RFVLLSE
Sbjct  139   YVHTHPSYVDSWPQNSVFYGRRIPSKEVGWGKSTMIDGERRLLASALLDFSNERFVLLSE  198

Query  684   SCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMD  863
             SCIPLFNF TIYSYLMNS+ + I  YD P   GRGRY  +M P I +  WRKGSQWFE  
Sbjct  199   SCIPLFNFTTIYSYLMNSSESNIGSYDDPRKVGRGRYNPKMWPAINISDWRKGSQWFEAS  258

Query  864   RDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSH  1043
             R LAIE+ISD +Y+ +F+ +C   CY DEHY+PT VNI     NSNRS+TWVDWS  G H
Sbjct  259   RKLAIEIISDTKYYPIFKEHCNPPCYMDEHYIPTLVNILGVEDNSNRSITWVDWSKSGPH  318

Query  1044  PARYLRHDVTVSFLETLRTGDKCEYNG--EETNVCYLFARKFSLHSLTRLLRFAPKLM  1211
             P R+ R+DV+  FL  +R G  C  NG    T +C+LFARKF   +L  LL+ AP L+
Sbjct  319   PGRFRRNDVSYEFLNQIRFGTNCTCNGINATTCMCFLFARKFMGDTLRPLLQIAPILL  376



>ref|XP_011007493.1| PREDICTED: uncharacterized protein LOC105113152 isoform X1 [Populus 
euphratica]
Length=415

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 221/305 (72%), Gaps = 4/305 (1%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             P+   H M+D+ELLWRASMVP I EYP++R PKVAFMFLTRG++ LAPLW+MFF+G+ G 
Sbjct  109   PKELCHSMNDKELLWRASMVPHIDEYPYNRTPKVAFMFLTRGSLPLAPLWDMFFKGHAGL  168

Query  495   YSIYVHSDPSCNESAPEGSVFHGRRIPS----QEVKWGDVNMIeaerrllanallDFSNQ  662
             YSIY+H  P      PE SVF+ R+IPS    Q  +WG   MI+AERRLLANALLDFSN+
Sbjct  169   YSIYLHKSPEFTNQHPESSVFYQRQIPSKCFLQPAEWGRATMIDAERRLLANALLDFSNE  228

Query  663   RFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKG  842
             RFVLLSE+CIP+FNF TIY+YLMNS  +F+  +D P   GRGRY  RM P + L  WRKG
Sbjct  229   RFVLLSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKG  288

Query  843   SQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVD  1022
             SQWFE  R +AIE+ISD +Y+ +F+ +C+  CY DEHY PT V       NSNRS+TWVD
Sbjct  289   SQWFEAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVD  348

Query  1023  WSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAP  1202
             WS GGSHP R++R DV+ +FL  +R G  C YNG  T VC+LFARKF   +L  LLR AP
Sbjct  349   WSGGGSHPTRFVRKDVSEAFLNQIRNGFNCTYNGGITTVCFLFARKFHPSTLDPLLRIAP  408

Query  1203  KLMRF  1217
              L+ F
Sbjct  409   GLLGF  413



>ref|XP_010907977.1| PREDICTED: uncharacterized protein LOC105034483 [Elaeis guineensis]
Length=388

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 256/377 (68%), Gaps = 22/377 (6%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQL-----ITAAAADqplllpppqpE  269
             + L+  +S  + F  G   GL  S++F K FS    L     +  A  D+          
Sbjct  27    IGLMKFVSLLVVFMAGAVLGLSVSAHFHKYFSSQADLFFPRTLYTATCDRD---------  77

Query  270   RTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
                   + ++ F+ P  + MH M+D++L WRA+MVPK+++YPF RVPKVAFMFLTRG + 
Sbjct  78    -----CMSIKSFVNP-SHLMHAMTDDKLFWRATMVPKMEDYPFERVPKVAFMFLTRGPLP  131

Query  450   LAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrl  629
                LW+ FF+G+EG YS+YVH+ P    +  E S F+GR+IPS EV WG V +++AE+RL
Sbjct  132   FVRLWDKFFKGHEGLYSVYVHALPDYKLNVSEDSAFYGRQIPSLEVSWGSVTLVDAEKRL  191

Query  630   lanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMS  809
             LANALLDFSN+RFVLLSESCIP++NFP +Y YL+NS  +F+E YD     GRGRY+  MS
Sbjct  192   LANALLDFSNERFVLLSESCIPIYNFPAVYEYLINSHHSFVESYDEDSLQGRGRYRRGMS  251

Query  810   PVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGR  989
             P IKL QWRKGS+WFE++R+LA+ +++D +Y+++F+ +CK SCY DEHY+PT++N+  G 
Sbjct  252   PHIKLYQWRKGSEWFELNRELAVTIVADYKYYAIFRKHCKPSCYPDEHYIPTYLNMFHGS  311

Query  990   GNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFS  1166
              N+NRSLTWVDWS GG HPARY   +VT  F++ LR  G  C YN   T++C+LFARKF+
Sbjct  312   LNANRSLTWVDWSRGGPHPARYGASNVTPEFIQALRNNGTFCMYNSRPTSICFLFARKFA  371

Query  1167  LHSLTRLLRFAPKLMRF  1217
              ++L  LL     +M F
Sbjct  372   PNALEPLLNLTSTVMGF  388



>ref|XP_010551624.1| PREDICTED: uncharacterized protein LOC104822176 [Tarenaya hassleriana]
Length=374

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 210/386 (54%), Positives = 257/386 (67%), Gaps = 44/386 (11%)
 Frame = +3

Query  90    KLYNAPLN-LINLLSAFLFFACGLTCGLIFSSYFKSFSLN-----LQLITAAAADqplll  251
             KL NA  +  INLLS  L F CG+  G++  S  +  SL+     LQ I+          
Sbjct  22    KLLNAQYHHFINLLSCSLIFCCGVIVGILLHSSLQHLSLSPPLSGLQRISQH--HMMTSP  79

Query  252   pppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMV-PKIKEYPFSRVPKVAFMF  428
             PPP P  +     GL+ F +PPE+ MH+M DEELLWRASM+ PKIK YPF R PK+AFMF
Sbjct  80    PPPPPPPSSRGGGGLEHFFRPPEDLMHEMEDEELLWRASMMDPKIKTYPFHRTPKLAFMF  139

Query  429   LTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNM  608
             LT+G + LAPLWE FF+G+ G +++YVHSDPS N S P GSVFHGRRIPS++V+WG+VNM
Sbjct  140   LTKGPLPLAPLWEKFFEGHNGLFTVYVHSDPSYNWSMPRGSVFHGRRIPSKKVEWGNVNM  199

Query  609   IeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRG  788
             +EAERRLLANALLD  N+RF+LLSESC+PLFNF T+YSYL +S+ + +E YDLPGS GRG
Sbjct  200   VEAERRLLANALLDIYNERFILLSESCVPLFNFSTVYSYLTSSSLSHVESYDLPGSVGRG  259

Query  789   RYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTF  968
             RY  RM P + L                                +C GSCY+DEHYLPT 
Sbjct  260   RYNRRMGPTLPL--------------------------------HCHGSCYSDEHYLPTL  287

Query  969   VNI--RFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDK-CEYNGEETNV  1139
             VN+    GR NSNR+LTWVDWS GG HP R++R +VT  FL  LRT +K C +NG  T V
Sbjct  288   VNVGKGLGRRNSNRTLTWVDWSKGGPHPNRFVRPEVTEEFLAKLRTSEKGCVHNGGRTRV  347

Query  1140  CYLFARKFSLHSLTRLLRFAPKLMRF  1217
             CYLFARKF   +L RL+RFAPK+M F
Sbjct  348   CYLFARKFLPTALDRLIRFAPKVMHF  373



>emb|CAH67921.1| OSIGBa0138E08-OSIGBa0161L23.2 [Oryza sativa Indica Group]
Length=412

 Score =   357 bits (916),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 230/313 (73%), Gaps = 1/313 (0%)
 Frame = +3

Query  282   AAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPL  461
             AA+  Q F++P     H M DEEL WRASM P+++EYP+ RVPKVAF+FLTRG +  APL
Sbjct  100   AALSFQRFVQPHPPWGHSMKDEELFWRASMAPRVEEYPYQRVPKVAFLFLTRGPLPFAPL  159

Query  462   WEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
             WE FF G+EG YS+YVH+ P    +    S FHGR+IPS +V WG + +++AE+RLLANA
Sbjct  160   WERFFHGHEGLYSVYVHALPEYRLNVSSSSPFHGRQIPSGDVSWGSITLVDAEKRLLANA  219

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLDFSN+RFVL SESC+P+FNFPT+Y YL+NS  +++E Y++      GRY  RM+P + 
Sbjct  220   LLDFSNERFVLASESCVPVFNFPTVYEYLVNSAQSYVESYNIDVPQCAGRYNPRMAPDVL  279

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
               QWRKGS+WFEM RDLA ++++D +Y ++F+ +C  SCY DEHY+PT++++R G  N+N
Sbjct  280   EEQWRKGSEWFEMSRDLAADIVADRKYHAIFRKHCTPSCYPDEHYIPTYLHLRHGARNAN  339

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSL  1178
             R++TWVDWS GG HPAR+ +  VT +F++ +R  G +C YNG+ T VCYLFARKF+  +L
Sbjct  340   RTVTWVDWSRGGPHPARFGKATVTPAFVQAIRNNGTRCAYNGKPTTVCYLFARKFAPSAL  399

Query  1179  TRLLRFAPKLMRF  1217
               LL  +  L+ F
Sbjct  400   GPLLNMSTTLLEF  412



>ref|XP_007036566.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY21067.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=463

 Score =   358 bits (920),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 223/301 (74%), Gaps = 0/301 (0%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             MH+MSDEEL WRAS VP++KE+PF  VPK+AFMFLT+GA+ LAPLWEMFF+G+EG Y+IY
Sbjct  162   MHNMSDEELFWRASFVPRVKEFPFENVPKIAFMFLTKGALPLAPLWEMFFKGHEGLYNIY  221

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VH  P   +S PE SVF+GRRIPS+ V+WG   MI+AERRLLANALLDF+N RFVLLSE+
Sbjct  222   VHPHPLYKDSVPEDSVFYGRRIPSKPVEWGKKTMIDAERRLLANALLDFTNDRFVLLSET  281

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF TIY+YL+NS  ++I  YD P   GRGRY  +M P I + QWRKGSQWFE+ R
Sbjct  282   CIPLFNFTTIYNYLLNSNQSYIGSYDDPRKVGRGRYNPKMFPAISIAQWRKGSQWFEVTR  341

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
              LAIE++SD +Y+  F+ YC   CY DEHY+PT V I +   NSNRS+TWVDWS  G HP
Sbjct  342   SLAIEIVSDKKYYESFRKYCSPPCYMDEHYIPTLVYIAWPEQNSNRSVTWVDWSKAGPHP  401

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDEK  1226
              ++ +  ++  FL  +R    C YNG  T++C+LFARKF  ++L  LL  A  L+  ++ 
Sbjct  402   GKFGKGAISEDFLNKVRFAGNCCYNGNITSMCFLFARKFLPNTLQPLLDIATMLLSSNQF  461

Query  1227  L  1229
             L
Sbjct  462   L  462



>ref|NP_001052347.1| Os04g0272400 [Oryza sativa Japonica Group]
 emb|CAE01750.2| OSJNBb0056F09.13 [Oryza sativa Japonica Group]
 dbj|BAF14261.1| Os04g0272400 [Oryza sativa Japonica Group]
 gb|EAZ30027.1| hypothetical protein OsJ_14085 [Oryza sativa Japonica Group]
 dbj|BAH00498.1| unnamed protein product [Oryza sativa Japonica Group]
Length=412

 Score =   357 bits (915),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 230/313 (73%), Gaps = 1/313 (0%)
 Frame = +3

Query  282   AAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPL  461
             AA+  Q F++P     H M DEEL WRASM P+++EYP+ RVPKVAF+FLTRG +  APL
Sbjct  100   AALSFQRFVQPHPPWGHSMKDEELFWRASMAPRVEEYPYQRVPKVAFLFLTRGPLPFAPL  159

Query  462   WEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
             WE FF G+EG YS+YVH+ P    +    S FHGR+IPS +V WG + +++AE+RLLANA
Sbjct  160   WERFFHGHEGLYSVYVHALPEYRLNVSSSSPFHGRQIPSGDVSWGSITLVDAEKRLLANA  219

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLDFSN+RFVL SESC+P+FNFPT+Y YL+NS  +++E Y++      GRY  RM+P + 
Sbjct  220   LLDFSNERFVLASESCVPVFNFPTVYEYLVNSAQSYVESYNIDVPQCAGRYNPRMAPDVL  279

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
               QWRKGS+WFEM RDLA ++++D +Y ++F+ +C  SCY DEHY+PT++++R G  N+N
Sbjct  280   EEQWRKGSEWFEMSRDLAADIVADRKYHAIFRKHCTPSCYPDEHYIPTYLHLRHGARNAN  339

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSL  1178
             R++TWVDWS GG HPAR+ +  VT +F++ +R  G +C YNG+ T VCYLFARKF+  +L
Sbjct  340   RTVTWVDWSRGGPHPARFGKATVTPAFVQAIRNNGTRCAYNGKPTTVCYLFARKFAPSAL  399

Query  1179  TRLLRFAPKLMRF  1217
               LL  +  L+ F
Sbjct  400   GPLLNMSTTLLEF  412



>ref|XP_004238913.2| PREDICTED: uncharacterized protein LOC101249916 [Solanum lycopersicum]
Length=351

 Score =   354 bits (909),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 225/299 (75%), Gaps = 0/299 (0%)
 Frame = +3

Query  321   NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
             +  H M+DEEL+WRASMVP+IK+YPF+R+P+VAF+FLTRG + LAPLWEMFF+G++G +S
Sbjct  52    DVWHSMNDEELMWRASMVPQIKKYPFNRIPRVAFLFLTRGRLPLAPLWEMFFKGHKGLFS  111

Query  501   IYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             IY+H+ P  N   P  SVF+ RRIPSQ V+WG   MI+AERRLLANALLD SN+RF+LLS
Sbjct  112   IYIHTSPDFNYEPPPSSVFYKRRIPSQAVQWGRSTMIDAERRLLANALLDISNERFILLS  171

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIPLFNF TIY+YL NS  +F+  +D P   GRGRY  RM P I L  WRKGSQWFE+
Sbjct  172   ESCIPLFNFTTIYTYLTNSDQSFLGSFDDPRKIGRGRYNKRMYPNITLFDWRKGSQWFEI  231

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
              R+LA++++SD  Y+ +F+ +C   CY DEHYLPT VN       SNRS+TWVDWS GGS
Sbjct  232   HRELAVKIVSDVLYYPVFKNHCVPPCYMDEHYLPTLVNKVCPGLTSNRSVTWVDWSAGGS  291

Query  1041  HPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             HP  +L+ DVT  FL+++ +   C YNG+ +++C+LF RKF   +L  LLR APKL+ F
Sbjct  292   HPMTFLKKDVTEEFLKSVGSELNCSYNGKMSSICFLFGRKFHPSTLQPLLRIAPKLLGF  350



>ref|XP_008645560.1| PREDICTED: uncharacterized protein LOC103626979 [Zea mays]
 gb|AFW71055.1| hypothetical protein ZEAMMB73_279959 [Zea mays]
Length=464

 Score =   358 bits (919),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 180/293 (61%), Positives = 225/293 (77%), Gaps = 4/293 (1%)
 Frame = +3

Query  345   EELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPS  524
             EEL+ RA+  P+  E P    P+VAF+FLTR  + + PLW+MFF+G+   Y++YVHSDP+
Sbjct  173   EELMARAASAPR--EVPAGTTPRVAFLFLTRWDLPMEPLWDMFFRGHRSLYNVYVHSDPA  230

Query  525   CNES-APEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD-FSNQRFVLLSESCIPL  698
              N S  PE S F+ RRIPS++VKWG+++M+EAERRLLA+ALLD  +N RFVLLSE+ +PL
Sbjct  231   FNGSEPPETSAFYRRRIPSKDVKWGEISMMEAERRLLAHALLDDHANARFVLLSETHVPL  290

Query  699   FNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAI  878
             F+FPT+YSYL+NST  ++E YD PG TGRGRY  RMSPV+   QWRKGSQWF++DR LA+
Sbjct  291   FDFPTVYSYLVNSTKLYLESYDQPGPTGRGRYSRRMSPVVAAGQWRKGSQWFDLDRGLAV  350

Query  879   EVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYL  1058
             +V++D  YF LF  +C+ SCYADEHYLPT +NIR     +NRSLTWVDWSHGG HPAR+ 
Sbjct  351   DVVADRVYFPLFHRFCRRSCYADEHYLPTLLNIRRPAAGANRSLTWVDWSHGGPHPARFT  410

Query  1059  RHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             R +VTV FL  LR G  C YNG  T VC+LFARKF  +SLTR LRFAPK+M F
Sbjct  411   RMEVTVDFLRWLRGGSTCTYNGRTTTVCFLFARKFLPNSLTRFLRFAPKVMGF  463



>ref|XP_006349290.1| PREDICTED: uncharacterized protein LOC102579219 [Solanum tuberosum]
Length=397

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/378 (50%), Positives = 254/378 (67%), Gaps = 6/378 (2%)
 Frame = +3

Query  99    NAPLNLINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQLITA--AAADqplllpppqpE  269
             ++ ++L+ +LS  + F  G+  GL  SS+  + F+   + I A  A AD           
Sbjct  21    DSSVSLLRVLSTLIVFVIGVVIGLTSSSHIDRYFTFQAEQIIANNALADTVSKESGNCSV  80

Query  270   RTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
                   + +  F++P +  +H MSDEEL WRAS+ P  KE+PF RVPKVAFMFLTRG + 
Sbjct  81    CEKEDCLSMDSFVRP-KILIHGMSDEELFWRASLEPYKKEFPFKRVPKVAFMFLTRGQLP  139

Query  450   LAPLWEMFFQGNE-GFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerr  626
               PLWE FFQG +   YSIY+H+ P    S    SVF+ R+IPSQ V+WG V +++AE+R
Sbjct  140   FIPLWERFFQGQDVNKYSIYMHALPGYVLSISNTSVFYKRQIPSQHVEWGSVTLVDAEKR  199

Query  627   llanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRM  806
             L+ANALLDFSN+RFVLLSESCIP++NFPT+Y YL+ S  +F+E YD P   GRGRY   M
Sbjct  200   LMANALLDFSNERFVLLSESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRHM  259

Query  807   SPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFG  986
              P IKL  WRKGSQWFEM+R LA+ V+SD +Y+ +F+ +CK +CY DEHY+PTF+ +  G
Sbjct  260   KPDIKLPDWRKGSQWFEMNRTLAVRVVSDTKYYDIFRRFCKPACYPDEHYIPTFIRLFHG  319

Query  987   RGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKF  1163
               N+NR++T+VDWS GG HPA +   ++T  FL+ +R  G  C YN E+T+VCYLFARKF
Sbjct  320   PLNANRTVTYVDWSLGGPHPAAFSAVNITEGFLQLIRNNGTACAYNSEKTHVCYLFARKF  379

Query  1164  SLHSLTRLLRFAPKLMRF  1217
             +  +L  LL  + K+M F
Sbjct  380   NPSALEPLLNLSSKVMEF  397



>ref|XP_009344746.1| PREDICTED: uncharacterized protein LOC103936628 [Pyrus x bretschneideri]
Length=558

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/298 (60%), Positives = 222/298 (74%), Gaps = 0/298 (0%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             +H+MSD+EL  RA MVP+I++ P+  VPKVAFMFLT+G + L+PLWE FF+G+EG YSIY
Sbjct  260   VHNMSDKELFSRALMVPRIQDLPYKLVPKVAFMFLTKGPLPLSPLWEKFFEGHEGLYSIY  319

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VH+ P  NES PE SVFH RRI SQ V WG  +M++AERRLLANALLD SNQRFVLLSES
Sbjct  320   VHAHPDFNESVPEDSVFHSRRIHSQPVYWGTSSMLDAERRLLANALLDISNQRFVLLSES  379

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF T Y YL+NS  +F+  +D P   GRGRY  +M P+I +  WRKGSQWFE+ R
Sbjct  380   CIPLFNFTTAYHYLINSNLSFLNSFDDPRKPGRGRYNPQMYPMINITDWRKGSQWFEVHR  439

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
             +LA+ ++SD +Y+ +FQ YC   CY DEHY+PT VN+ +   NSNRS+TWVDWS GG HP
Sbjct  440   ELAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLMYTELNSNRSVTWVDWSRGGPHP  499

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
              ++   D+T  FL  +R G +C YNG  T+VC+LFARKF   +L  LLR AP L+ FD
Sbjct  500   GKFGWMDITDEFLNRIRFGSECTYNGNTTSVCFLFARKFLPDALEPLLRVAPLLLGFD  557



>ref|XP_007208880.1| hypothetical protein PRUPE_ppa026447mg [Prunus persica]
 gb|EMJ10079.1| hypothetical protein PRUPE_ppa026447mg [Prunus persica]
Length=436

 Score =   357 bits (915),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 230/313 (73%), Gaps = 3/313 (1%)
 Frame = +3

Query  282   AAVGLQEFLKPPENAMHDMSDE-ELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAP  458
             A +G +   K     +H M D+ ELLWRAS+VP+I+++PF+ VP+VAFMFLT+G + LAP
Sbjct  120   ADLGTEVTSKIEAFMLHKMDDDDELLWRASLVPRIRKFPFNHVPRVAFMFLTKGNIPLAP  179

Query  459   LWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllan  638
             LWEMFF+G+EG Y+IYVH+ PS  +S P+ SVF+GRRIPS+EV+WG   MI+ ERRLLA+
Sbjct  180   LWEMFFKGHEGLYTIYVHTHPSYVDSWPQNSVFYGRRIPSKEVEWGKPTMIDGERRLLAS  239

Query  639   allDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVI  818
             ALLDFSN+RFVLLSESCIPLFNF TIYSYL+NS+ + I  YD P   GRGRY  +M P I
Sbjct  240   ALLDFSNERFVLLSESCIPLFNFTTIYSYLVNSSESNIGSYDDPRKVGRGRYNPKMWPAI  299

Query  819   KLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNS  998
              +  WRKGSQWFE  R LAIE+ISD +Y+ +F+ +C   CY DEHY+PT VNI     NS
Sbjct  300   NISDWRKGSQWFEASRKLAIEIISDTKYYPIFKEHCNPPCYMDEHYIPTLVNILGVEDNS  359

Query  999   NRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNG--EETNVCYLFARKFSLH  1172
             NRS+TWVDWS GG HP R+ R+DV+  FL  +R G  C  NG    T +C+LFARKF   
Sbjct  360   NRSITWVDWSRGGPHPRRFGRNDVSYEFLNQIRFGTNCTCNGINATTCMCFLFARKFMGD  419

Query  1173  SLTRLLRFAPKLM  1211
             +L  LL+ AP L+
Sbjct  420   TLRPLLQIAPILL  432



>ref|XP_009411881.1| PREDICTED: uncharacterized protein LOC103993515 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/380 (48%), Positives = 255/380 (67%), Gaps = 12/380 (3%)
 Frame = +3

Query  81    TSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllppp  260
             T IK ++  + L+  +S  +    G+  GL  S+ F  +  NLQ        +       
Sbjct  19    TPIKRWS--IGLVKFVSFLVTLMAGVVLGLSLSTNFSRY-YNLQ-------TELFFPRTM  68

Query  261   qpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRG  440
                      + ++ FL P  + MH M+DEEL WRAS+VPK++EYPF RVPKVAF+FLTRG
Sbjct  69    YMANCDKDCLSMKSFLGP-THLMHGMTDEELFWRASLVPKMEEYPFERVPKVAFLFLTRG  127

Query  441   AVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeae  620
              +   PLWE FF G++G YSIY+HS P    +  E SVF+ R+IPS+EV WG + +++AE
Sbjct  128   PLPFKPLWERFFMGHKGLYSIYIHSIPDYKLNVTEDSVFYSRQIPSEEVFWGSITLVDAE  187

Query  621   rrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKH  800
             +RLLANALLDFSN+RFVLLSESC+P++NFP++Y YL+NS  +F+E YD     GRGRY  
Sbjct  188   KRLLANALLDFSNERFVLLSESCVPVYNFPSVYEYLINSAHSFVESYDEDSPQGRGRYSQ  247

Query  801   RMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR  980
              M+P I+  QW KGS+WFE++R+LA+ +++D +Y+S+F+ YCK SCY DEHY+PT++N+ 
Sbjct  248   NMAPEIQEYQWMKGSEWFELNRELAVNIVADYKYYSIFRKYCKPSCYPDEHYIPTYLNMF  307

Query  981   FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDK-CEYNGEETNVCYLFAR  1157
              G  N+NRS+TWVDWS GG HPARY   ++TV F++ +R     C YN   T +C+LFAR
Sbjct  308   HGALNANRSVTWVDWSRGGPHPARYGDPNITVGFIQAIRNNATFCMYNSRPTPICFLFAR  367

Query  1158  KFSLHSLTRLLRFAPKLMRF  1217
             KF+  +L  LL  A  +M F
Sbjct  368   KFAPSALVPLLDMASTVMGF  387



>ref|XP_002279551.2| PREDICTED: uncharacterized protein LOC100250702 [Vitis vinifera]
Length=427

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 224/314 (71%), Gaps = 1/314 (0%)
 Frame = +3

Query  279   VAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAP  458
              ++  L++ + P E   H M+D+EL+WRASMVP   +YP+ R PKVAFMFL+RG + LA 
Sbjct  114   TSSRALRDLIAPKE-LWHSMNDKELMWRASMVPHFVDYPYDRTPKVAFMFLSRGRLPLAS  172

Query  459   LWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllan  638
             LWE FF+G+ G YSIY+H+ P  N   PE SVF+ RRIPS+ V WG   M++AERRLLAN
Sbjct  173   LWEKFFKGHAGLYSIYLHTSPEFNTEMPESSVFYKRRIPSKSVDWGKATMVDAERRLLAN  232

Query  639   allDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVI  818
             ALLDFSN+RFVLLSE+CIPLFNF TIY YL+NS  +F+  +D P   GRGRY  RM P +
Sbjct  233   ALLDFSNERFVLLSETCIPLFNFTTIYKYLINSNHSFVSSFDDPRHIGRGRYNKRMFPTV  292

Query  819   KLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNS  998
              L  WRKGSQWFE+ R LAIE++SD  Y+ +FQ +C+  CY DEHYL T VN      NS
Sbjct  293   TLPDWRKGSQWFEVHRKLAIEIVSDVTYYPIFQEHCRPPCYMDEHYLATLVNKLRPDLNS  352

Query  999   NRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSL  1178
             NRS+TWVDWS GGSHP +++R DV+ +FL   R G  C YN   +++C+LFARKF   +L
Sbjct  353   NRSITWVDWSRGGSHPTKFVRKDVSEAFLNQARHGFNCSYNSGLSSICFLFARKFHPSTL  412

Query  1179  TRLLRFAPKLMRFD  1220
               LLR AP L+ FD
Sbjct  413   EPLLRIAPSLLGFD  426



>ref|XP_006598780.1| PREDICTED: uncharacterized protein LOC100796634 isoform X1 [Glycine 
max]
 ref|XP_006598781.1| PREDICTED: uncharacterized protein LOC100796634 isoform X2 [Glycine 
max]
 ref|XP_006598782.1| PREDICTED: uncharacterized protein LOC100796634 isoform X3 [Glycine 
max]
 ref|XP_006598783.1| PREDICTED: uncharacterized protein LOC100796634 isoform X4 [Glycine 
max]
 ref|XP_006598784.1| PREDICTED: uncharacterized protein LOC100796634 isoform X5 [Glycine 
max]
 ref|XP_006598785.1| PREDICTED: uncharacterized protein LOC100796634 isoform X6 [Glycine 
max]
Length=394

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 249/376 (66%), Gaps = 7/376 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLN-----LQLITAAAADqplllpppqpER  272
             L L  +L+  + FA G+  GL  SS+     ++     + L    +   P        + 
Sbjct  20    LRLAQILTFLVVFAGGVVIGLTTSSHINGHFISQPYQYISLRNVPSPPPPEPTAMAAADP  79

Query  273   TPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTL  452
                  + L+ FL P  N  H +SDEEL WRAS++PK + YPFSR+PKVAFMFLTRG + +
Sbjct  80    PLPPNLDLEAFLHP-LNLTHCLSDEELFWRASLIPKKESYPFSRIPKVAFMFLTRGPLPM  138

Query  453   APLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrll  632
              PLWE FF G+   ++IY+HS P    +    S F+ R IPSQ+V WG V + +AERRLL
Sbjct  139   LPLWERFFHGHSSLFNIYIHSPPRFLLNVSHSSPFYLRHIPSQDVSWGTVTLADAERRLL  198

Query  633   anallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSP  812
             ANALLDFSN+RFVLLSESCIP++NFPT+Y YL NS+ +F+E YD P   GRGRY   M P
Sbjct  199   ANALLDFSNERFVLLSESCIPVYNFPTVYRYLTNSSLSFVESYDEPTRYGRGRYSRNMLP  258

Query  813   VIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRG  992
              I+LR WRKGSQWFE++R LA+ ++SD  Y+SLF+ YCK +CY DEHY+PTF+N+  G  
Sbjct  259   HIQLRHWRKGSQWFELNRALAVYIVSDTNYYSLFRKYCKPACYPDEHYIPTFLNMFHGSL  318

Query  993   NSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSL  1169
             NSNR++TWVDWS  G HPA Y R ++T  F++++R  G  C YN E T++CYLFARKF  
Sbjct  319   NSNRTVTWVDWSMLGPHPATYGRANITAGFIQSIRNNGSLCRYNSEITSICYLFARKFDP  378

Query  1170  HSLTRLLRFAPKLMRF  1217
              +L  LL  + ++M F
Sbjct  379   SALEPLLNLSSEVMNF  394



>ref|XP_008389264.1| PREDICTED: uncharacterized protein LOC103451628 [Malus domestica]
Length=326

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/312 (59%), Positives = 228/312 (73%), Gaps = 5/312 (2%)
 Frame = +3

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             L+++L+PP+   HDM+  ELLWRASM P+I EYP   VPKVAFMFLT+G V LA LWE F
Sbjct  16    LKKYLRPPK-VFHDMNVSELLWRASMSPRIXEYPIHLVPKVAFMFLTKGPVHLALLWENF  74

Query  474   FQGNEGFYSIYVHSDPSCNESA-PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             F+G++G YSIYVHS PS   ++ PE  VFH RRIPSQEV+WG  ++IEA RRLLANALL+
Sbjct  75    FKGHQGLYSIYVHSSPSYEAASHPESPVFHERRIPSQEVEWGKASLIEAVRRLLANALLN  134

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SNQ FVLLSE+CIPL+NF T+YSYL+NST  F+EV+D P S GRGRY       I + Q
Sbjct  135   ISNQHFVLLSETCIPLYNFSTVYSYLINSTRTFVEVFDDPSSVGRGRYYLSNXTRITVDQ  194

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKG  WF +DR++AIE ISD +YF  F   CKG C+ DEHYLPTFV+++F   N+NR+L
Sbjct  195   WRKGWAWFAIDREVAIESISDRKYFPEF-LKCKGYCFPDEHYLPTFVHLKFAARNANRTL  253

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLRT--GDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             TWVDWS GG HP  Y   + T + L +LR+  G KCEYN   T+VC+LFARKF   +L  
Sbjct  254   TWVDWSKGGPHPXEYRSPNXTAALLSSLRSGYGRKCEYNXRSTDVCFLFARKFMPBTLDX  313

Query  1185  LLRFAPKLMRFD  1220
             LLR A ++M F 
Sbjct  314   LLRLAXQIMYFS  325



>gb|EEC73057.1| hypothetical protein OsI_07014 [Oryza sativa Indica Group]
Length=439

 Score =   356 bits (914),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 228/301 (76%), Gaps = 6/301 (2%)
 Frame = +3

Query  333   DMSDEELLWRASMVPKIKEYPFSRVP--KVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             D+SDEEL+  A+  P+         P  KVAF+FLTR  + +APLWE FF+G+ G YS+Y
Sbjct  138   DISDEELMKLAAAAPREVRTGGGGGPRPKVAFLFLTRWDLPMAPLWEKFFEGHRGLYSVY  197

Query  507   VHSDPSCNESAP-EGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSE  683
             VH+DP+ N S P E SVF+ R IPS+EVKWG+++M+EAERRLLA+ALLD +N RF+LLSE
Sbjct  198   VHTDPAFNGSDPGEASVFYRRTIPSKEVKWGEISMVEAERRLLAHALLDQANARFILLSE  257

Query  684   SCIPLFNFPTIYSYLMNSTTN-FIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             S +PLF+FPT+YSYL+NSTT  ++E YDLPG TGRGRYK  MSPV+   QWRKGSQWFE+
Sbjct  258   SHVPLFDFPTVYSYLINSTTKIYLESYDLPGVTGRGRYKRSMSPVVTASQWRKGSQWFEV  317

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
             DR LA +VI+DD YF +F  +C  +CYADEHYLPTF+ IR     +NRS+TWVDWSHGG 
Sbjct  318   DRGLAADVITDDVYFPVFARHCSRNCYADEHYLPTFLGIRHPSRVTNRSVTWVDWSHGGP  377

Query  1041  HPARYLRHDVTVSFLETLR--TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             HPAR+ R +VT  FL  LR   G  C+YNG  T VC+LFARKF  +SLTR LRFAPK+M 
Sbjct  378   HPARFTRMEVTPDFLRWLRAGAGTTCDYNGATTTVCFLFARKFLPNSLTRFLRFAPKVMG  437

Query  1215  F  1217
             F
Sbjct  438   F  438



>ref|NP_001046711.1| Os02g0327500 [Oryza sativa Japonica Group]
 dbj|BAD16024.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD16394.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08625.1| Os02g0327500 [Oryza sativa Japonica Group]
 dbj|BAG91611.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56873.1| hypothetical protein OsJ_06510 [Oryza sativa Japonica Group]
Length=439

 Score =   356 bits (914),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 228/301 (76%), Gaps = 6/301 (2%)
 Frame = +3

Query  333   DMSDEELLWRASMVPKIKEYPFSRVP--KVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             D+SDEEL+  A+  P+         P  KVAF+FLTR  + +APLWE FF+G+ G YS+Y
Sbjct  138   DISDEELMKLAAAAPREVRTGGGGGPRPKVAFLFLTRWDLPMAPLWEKFFEGHRGLYSVY  197

Query  507   VHSDPSCNESAP-EGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSE  683
             VH+DP+ N S P E SVF+ R IPS+EVKWG+++M+EAERRLLA+ALLD +N RF+LLSE
Sbjct  198   VHTDPAFNGSDPGEASVFYRRTIPSKEVKWGEISMVEAERRLLAHALLDQANARFILLSE  257

Query  684   SCIPLFNFPTIYSYLMNSTTN-FIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             S +PLF+FPT+YSYL+NSTT  ++E YDLPG TGRGRYK  MSPV+   QWRKGSQWFE+
Sbjct  258   SHVPLFDFPTVYSYLINSTTKIYLESYDLPGVTGRGRYKRSMSPVVTAAQWRKGSQWFEV  317

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
             DR LA +VI+DD YF +F  +C  +CYADEHYLPTF+ IR     +NRS+TWVDWSHGG 
Sbjct  318   DRGLAADVITDDVYFPVFARHCSRNCYADEHYLPTFLGIRHPSRVTNRSVTWVDWSHGGP  377

Query  1041  HPARYLRHDVTVSFLETLR--TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             HPAR+ R +VT  FL  LR   G  C+YNG  T VC+LFARKF  +SLTR LRFAPK+M 
Sbjct  378   HPARFTRMEVTPDFLRWLRAGAGTTCDYNGATTTVCFLFARKFLPNSLTRFLRFAPKVMG  437

Query  1215  F  1217
             F
Sbjct  438   F  438



>ref|XP_003573284.1| PREDICTED: uncharacterized protein LOC100833185 [Brachypodium 
distachyon]
Length=406

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/370 (47%), Positives = 254/370 (69%), Gaps = 2/370 (1%)
 Frame = +3

Query  111   NLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAAV  290
              L+ L++A + F  G+  GL  S+    +  N        A+        +   +     
Sbjct  38    GLLKLVTAMVIFMAGVVIGLSVSANVSRYYYNSHTELFFPANTYSTSYCDRRGASGDCGP  97

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             G + F+ PP  A H M+D+EL WRA++VP  +E+PF RVPKVAF+F+TRG +  APLWE 
Sbjct  98    GFKAFVHPPYLA-HSMTDDELFWRATLVPTAEEFPFQRVPKVAFLFMTRGPIPFAPLWEK  156

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G++G YS+YVH+ P    +  + S F+GR+IPS+EV WG +++++AE+RLLANALLD
Sbjct  157   FFRGHQGLYSVYVHAIPDYKLNVSKASPFYGRQIPSEEVSWGSISLVDAEKRLLANALLD  216

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
             FSN+RFVLLSESCIP+FNFPT+Y YL+NS  +F+E Y++      GRY  RM+P I   Q
Sbjct  217   FSNERFVLLSESCIPVFNFPTVYEYLINSEHSFVESYNIDTPQSAGRYNRRMAPHILPDQ  276

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGS+WFE++R+LA+ V++D +Y+S+F+ +C+ SCY DEHY+PT++++  G  N+NR++
Sbjct  277   WRKGSEWFELNRELAVRVVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTI  336

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             TWVDWS GG HPARY   ++ V F++ +R  G +C YN + T+VCYLFARKF+  +L  L
Sbjct  337   TWVDWSRGGPHPARYGAANINVEFIQAIRNNGTQCLYNSKHTSVCYLFARKFAPSALGPL  396

Query  1188  LRFAPKLMRF  1217
             +     ++ F
Sbjct  397   MNLTSTILDF  406



>emb|CDY31036.1| BnaA08g25860D [Brassica napus]
Length=377

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 250/371 (67%), Gaps = 10/371 (3%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA  287
             L L   LS  L F  G+  GL  SS+   +  +L  + +++A                  
Sbjct  16    LKLAQTLSFLLIFMAGIIIGLAASSHIDRYFNSLPQMLSSSASVQTDEIRD--------C  67

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
               +  F++P E   H MSD+EL WRASMVP  +EYP+ RVPKVAFMFLTRGA+ + PLWE
Sbjct  68    WSVDGFVRP-EEVRHGMSDDELFWRASMVPVKEEYPYDRVPKVAFMFLTRGALPMLPLWE  126

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+GNE F S+YVH+ P  + +    S F+ R++PSQ+V WG   + +AE+RLLANALL
Sbjct  127   KFFRGNEKFLSVYVHTPPGYDMNVSSDSPFYNRQVPSQKVAWGSPLLTDAEKRLLANALL  186

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DFSN+RFVLLSESC+P++NF T+YSYL+NS  +F++ YD P   GRGRY  +M P IKL 
Sbjct  187   DFSNERFVLLSESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLH  246

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
              WRKGSQWFE++R +AI +ISD +Y+SLF+ +C+ +CY DEHY+PT +N+  G  N+NRS
Sbjct  247   HWRKGSQWFEVNRKIAIYIISDSKYYSLFKKFCRPACYPDEHYIPTLLNMFHGSVNANRS  306

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYNGEETNVCYLFARKFSLHSLTR  1184
             +TWVDWS GG HPA Y   ++T  FL+++R  D  C YN E T++C+LFARKF+  +L  
Sbjct  307   VTWVDWSIGGPHPATYGADNITEGFLQSIRKNDTDCLYNEEPTSLCFLFARKFAPSALAP  366

Query  1185  LLRFAPKLMRF  1217
             L+  +  +M F
Sbjct  367   LMNLSSTVMGF  377



>ref|XP_010941940.1| PREDICTED: uncharacterized protein LOC105060052 [Elaeis guineensis]
Length=384

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 248/372 (67%), Gaps = 11/372 (3%)
 Frame = +3

Query  105   PLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVA  284
             P  ++  L+ F+    G     +FS Y   +  +LQ I   A          +       
Sbjct  24    PARILKFLTLFVVLGFGF---FVFSVYMTRY-FDLQTIGFQARPVIKPCIEEEQS-----  74

Query  285   AVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
                L+ ++KPP + MH MS+EEL WRAS VP++K+YPF RVPKVAFMFLT+G + L PLW
Sbjct  75    --DLRRWIKPPRSLMHKMSEEELFWRASFVPQVKKYPFKRVPKVAFMFLTKGPLPLFPLW  132

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             E FF+G+E  YSIY+HS P    + P  SVF+ R+IPS+  +WG +NM +AERRLLANAL
Sbjct  133   EKFFKGHEELYSIYIHSLPDYQPNFPPSSVFYNRQIPSKVAEWGKMNMCDAERRLLANAL  192

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SN+ FVLLSESCIPL+NF  IY YLM S  +F+  +D PG  GRGRY  RM+P I +
Sbjct  193   LDLSNEWFVLLSESCIPLYNFSIIYQYLMRSRYSFVGSFDDPGPYGRGRYNLRMAPEIDI  252

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKG+QWFE++R LAI+++ D +Y+  F+ +CK SCY DEHY PT + I      +NR
Sbjct  253   TQWRKGAQWFEVNRKLAIDIVRDTKYYPKFKEFCKPSCYVDEHYFPTMLTIESPHLIANR  312

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             +LTWVDWS GG+HPA + + D+T +FL+ +  G  C YN + ++VC+LFARKF+  ++  
Sbjct  313   TLTWVDWSRGGAHPATFGKGDITEAFLKKIFEGKSCLYNDQPSSVCFLFARKFAPSAMAP  372

Query  1185  LLRFAPKLMRFD  1220
             LL+FAP L+ F+
Sbjct  373   LLQFAPSLLGFE  384



>ref|XP_002516755.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45653.1| conserved hypothetical protein [Ricinus communis]
Length=373

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 225/302 (75%), Gaps = 3/302 (1%)
 Frame = +3

Query  318   ENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFY  497
             ++ MH++SDEELL RAS VP   E     VPKVAFMFLT G +  APLWE +FQG+EG Y
Sbjct  73    QSLMHNISDEELLLRASTVPIPVEAKI--VPKVAFMFLTYGPLPFAPLWEKYFQGHEGLY  130

Query  498   SIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLL  677
             SIYVH  PS N+S PE SVF+GRRIPSQ V WG  ++++AERRLLANALLD SNQRFVLL
Sbjct  131   SIYVHPHPSYNDSWPETSVFYGRRIPSQPVYWGTASLLDAERRLLANALLDISNQRFVLL  190

Query  678   SESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFE  857
             SESCIPL NF   Y+YL+NS  +F+E YD P   GRGRY   M P I +  WRKGSQWFE
Sbjct  191   SESCIPLLNFKITYNYLINSNLSFVESYDDPRKAGRGRYSPNMWPAINITHWRKGSQWFE  250

Query  858   MDRDLAIEVISDDRYFSLFQYYCK-GSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHG  1034
             + RDLAI ++SDD+Y+ LF+ YC   +CY+DEHY+PT +N+ +   +SNR++TWVDWS G
Sbjct  251   VHRDLAIHIVSDDKYYQLFRDYCHPHACYSDEHYIPTLLNMHYPEISSNRTVTWVDWSRG  310

Query  1035  GSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMR  1214
             G+HP+++   D+T  FL  +R G KC YNG  T+VCYLFARKF+ ++L  LLR AP L+ 
Sbjct  311   GAHPSKFGWGDITDEFLNQIRYGSKCVYNGNTTSVCYLFARKFAPNALDPLLRIAPLLLG  370

Query  1215  FD  1220
             FD
Sbjct  371   FD  372



>ref|XP_006344151.1| PREDICTED: uncharacterized protein LOC102582712 [Solanum tuberosum]
Length=305

 Score =   350 bits (899),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 221/299 (74%), Gaps = 0/299 (0%)
 Frame = +3

Query  321   NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
             +  H M+DEEL+WRASMVP+I++ PF+R+P+VAF+FLTRG + LAPLWEMFF+G+EG +S
Sbjct  6     DVWHSMNDEELMWRASMVPQIEKNPFNRIPRVAFLFLTRGRLPLAPLWEMFFKGHEGLFS  65

Query  501   IYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             IY+H+ P  N   P  SVF+ RRIPSQ V+WG   MI+AERRLLANALLD SN+RF+LLS
Sbjct  66    IYIHTSPDFNYEPPPSSVFYKRRIPSQAVQWGRSTMIDAERRLLANALLDISNERFILLS  125

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIP FNF TIY+YL NS  +F+  +D P   GRGRY  RM P I L  WRKGSQWFE+
Sbjct  126   ESCIPFFNFTTIYTYLTNSDQSFLGSFDDPRKIGRGRYNKRMYPNITLSDWRKGSQWFEV  185

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
              R LA++++SD  Y+ +F+ YC   CY DEHYLPT VN       SNRS+TW DWS GGS
Sbjct  186   HRKLAVKIVSDVMYYPVFKNYCVPPCYMDEHYLPTLVNKVCPGLTSNRSVTWADWSAGGS  245

Query  1041  HPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             HP  +L+ DVT  FL+++ +   C YNG+ +++C+LF RKF   +L  LLR APKL+ F
Sbjct  246   HPMTFLKKDVTEEFLKSVGSELNCSYNGKMSSICFLFGRKFHPSTLQPLLRIAPKLLGF  304



>ref|XP_010942037.1| PREDICTED: uncharacterized protein LOC105060116 isoform X1 [Elaeis 
guineensis]
Length=384

 Score =   353 bits (905),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 183/371 (49%), Positives = 248/371 (67%), Gaps = 11/371 (3%)
 Frame = +3

Query  105   PLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVA  284
             P  ++ LL+ F+  A   +   + S Y   +  +LQ I + A            E+T   
Sbjct  24    PSRILQLLTLFVVLA---SVFFVLSMYMTRY-FDLQTIKSQARPVVKSCVVE--EQT---  74

Query  285   AVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
                L+ ++KPP   MH+MSDE+L WRAS  P++K+YPF RVPKVAF+FLTRG + L+PLW
Sbjct  75    --DLRRWIKPPRTLMHNMSDEQLFWRASFAPQVKKYPFQRVPKVAFLFLTRGPLPLSPLW  132

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             E FF+G+E  YSIY+HS P      P  SVF+ R+IPS+  +WG ++M +AERRLLANAL
Sbjct  133   ERFFEGHEELYSIYIHSLPGYQPDFPPSSVFYKRQIPSKVTEWGKMSMCDAERRLLANAL  192

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SN+RFVLLSESCIPL+NF   Y YLM S  +F+  +D PG  GRGRY  RM P + +
Sbjct  193   LDLSNERFVLLSESCIPLYNFSITYRYLMRSRYSFVGSFDDPGPHGRGRYNLRMKPEVNI  252

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKG+QWFE++R LAI +ISD +Y+  F+ +CK  CY DEHY PT + I      +NR
Sbjct  253   AQWRKGAQWFEVNRKLAINIISDAKYYPKFRDFCKPGCYVDEHYFPTMLAIESPHLMANR  312

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             S+TWVDWS GG+HPA + + D+T +FL+ +  G  C YN + ++VC+LFARKF+ ++L  
Sbjct  313   SVTWVDWSRGGAHPATFGKRDITEAFLKKILEGKSCFYNAQPSSVCFLFARKFAPNALEP  372

Query  1185  LLRFAPKLMRF  1217
             LL+ AP L+ F
Sbjct  373   LLQLAPSLLGF  383



>ref|XP_006470991.1| PREDICTED: uncharacterized protein LOC102625510 isoform X2 [Citrus 
sinensis]
Length=392

 Score =   353 bits (906),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 187/380 (49%), Positives = 249/380 (66%), Gaps = 8/380 (2%)
 Frame = +3

Query  96    YNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI-----TAAAADqplllppp  260
             Y   L L+ +LS  + FA G+  GL  SS+   +      +      +A +         
Sbjct  14    YIGLLKLVQILSFLVVFAAGIIIGLATSSHMNRYFTRESFLFSDSRYSAPSSTLQGNCAV  73

Query  261   qpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRG  440
                   +  + + +F++P  N  H M+DE+L WRASMVP  +EYPF R P+VAFMFLTRG
Sbjct  74    VQTCDDIDYLNIDKFVRP-ANLSHRMTDEQLFWRASMVPYKEEYPFERTPRVAFMFLTRG  132

Query  441   AVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeae  620
              + L PLWE FF+G+E ++SIYVH+ P    +    S F+GR+IPS+ V WG V M +AE
Sbjct  133   PLPLLPLWERFFKGHEKYFSIYVHALPGYKLNVSSDSPFYGRQIPSRNVGWGTVEMADAE  192

Query  621   rrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKH  800
             +RLLANALLDFSN+RFVLLSESCIP++NFPT+Y YL  S  +F+E YD P   GRGRY  
Sbjct  193   KRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSR  252

Query  801   RMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR  980
              M P IK+ QWRKGSQWFEM R +AI +ISD +Y +LF+ YCK SCY DEHY+PT++NI 
Sbjct  253   WMRPDIKIYQWRKGSQWFEMQRKVAIYIISDTKYLTLFRKYCKPSCYPDEHYIPTYLNIF  312

Query  981   FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR--TGDKCEYNGEETNVCYLFA  1154
              G   +NRS+TWVDWS  G HP  Y + ++T  F+++LR   G  C YN + T+ CYLFA
Sbjct  313   HGSLMANRSVTWVDWSMLGPHPVMYKKENITEQFIQSLRNSNGSLCLYNEQRTSRCYLFA  372

Query  1155  RKFSLHSLTRLLRFAPKLMR  1214
             RKF+ ++L  LL+ + K+ R
Sbjct  373   RKFAPNTLEPLLKISSKVYR  392



>emb|CDX94911.1| BnaC05g07600D [Brassica napus]
Length=385

 Score =   353 bits (905),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 183/371 (49%), Positives = 253/371 (68%), Gaps = 5/371 (1%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA  287
             L L   LS  L F  G+  GL  SS+   +  +L     +++         + +R     
Sbjct  19    LKLAQTLSFLLIFMAGIIIGLAASSHIDRYFNSLPTTAFSSSSSSSAALQTRRDRD---C  75

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
              G++ F++P EN  H MSD+EL WRASMVP  + YP+ R PKVAFMFLTRG + + PLWE
Sbjct  76    WGVEGFVRP-ENLSHGMSDDELFWRASMVPVKEGYPYERAPKVAFMFLTRGPLPMLPLWE  134

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+GNE + S+YVH+ P  + +   GS F+ R+IPSQ+V+WG   + +AE+RLLANALL
Sbjct  135   KFFRGNEKYLSVYVHTPPGYDMNVSSGSAFYDRQIPSQKVEWGSPLLTDAEKRLLANALL  194

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DFSN+RF+LLSESC+P++NF T+YSYL+NS  +F++ YD P   GRGRY  +M P IKL 
Sbjct  195   DFSNERFILLSESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLH  254

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
              WRKGSQWFE++R LAI +ISD +Y+ LF+ +C+ +CY DEHY+PTF+N+  G  N+NRS
Sbjct  255   HWRKGSQWFEVNRKLAIYIISDSKYYLLFKLFCRPACYPDEHYIPTFLNMFHGSVNANRS  314

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYNGEETNVCYLFARKFSLHSLTR  1184
             +TWVDWS GG HPA Y   ++T  FL+++R  +  C YN E T++C+LFARKF+  +L  
Sbjct  315   VTWVDWSIGGPHPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAP  374

Query  1185  LLRFAPKLMRF  1217
             L+  +  +M F
Sbjct  375   LMNLSSTVMGF  385



>ref|XP_010682059.1| PREDICTED: uncharacterized protein LOC104896962 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   354 bits (908),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 197/384 (51%), Positives = 249/384 (65%), Gaps = 12/384 (3%)
 Frame = +3

Query  99    NAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQ----LITAAAADqplllpppqp  266
             +AP  +  L   FL F  GL  GL+ SS  +S +L LQ    L  A    Q +       
Sbjct  39    DAPSKITKLAVLFLIFIAGLVTGLLSSSSHRS-TLTLQNYNNLYAAVKRGQTITTSTSSS  97

Query  267   ERTPVAAVGLQ------EFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMF  428
                      L       + L  P+   H++SDEELLWRASMVPK+ EYPF RVPKVAFMF
Sbjct  98    ASLRNNDNSLNFDCKNIDNLVHPKELNHNLSDEELLWRASMVPKVVEYPFKRVPKVAFMF  157

Query  429   LTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNM  608
             LTRG + L PLWE FF+G E +YSIYVH+ P         SVF GR+IPS+EV WG+V++
Sbjct  158   LTRGPLPLLPLWERFFKGYEQYYSIYVHTIPGFVLEVSPDSVFFGRQIPSKEVSWGNVSL  217

Query  609   IeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRG  788
              +AE+RLLANALLDFSN+RFVLLSESCIP++NF T+Y YL  ST  F+E YD P   GRG
Sbjct  218   ADAEKRLLANALLDFSNERFVLLSESCIPIYNFQTVYKYLTESTHTFVESYDDPTRFGRG  277

Query  789   RYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTF  968
             RY   M P I + QWRKG+QWFE++R L IE+ISD +Y+ LF+ YC   C+ DEHY+PT+
Sbjct  278   RYDRHMRPSIMIDQWRKGAQWFEINRALGIEIISDYKYYDLFRKYCHPPCFPDEHYIPTY  337

Query  969   VNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTG-DKCEYNGEETNVCY  1145
             +NI     NSNR+LT VDWS GG HP  ++R ++T  F++ +R    KC YN + T VCY
Sbjct  338   LNIFHAPFNSNRTLTKVDWSLGGPHPTTFVRDNITEGFIQNIRNNKKKCLYNSKSTTVCY  397

Query  1146  LFARKFSLHSLTRLLRFAPKLMRF  1217
             LFARKF+  +L  LL  + K+M F
Sbjct  398   LFARKFAPSALEPLLDLSLKVMGF  421



>gb|KDP42488.1| hypothetical protein JCGZ_00285 [Jatropha curcas]
Length=392

 Score =   352 bits (904),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/375 (50%), Positives = 252/375 (67%), Gaps = 6/375 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQLI---TAAAADqplllpppqpERT  275
             L L+ +LS  + F  G+  GL  SS+  + F+   +L      AA               
Sbjct  19    LKLVQILSFLVVFVAGIIMGLATSSHINQMFTSQARLFFTSNIAATKISGNNCTIVRPCK  78

Query  276   PVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLA  455
              V    ++ FL P +N  H M DEEL WRAS+VP  +EYPF RVPKVAFMFLTRG + + 
Sbjct  79    RVDCFSMETFLHP-KNLTHRMKDEELFWRASLVPIKEEYPFDRVPKVAFMFLTRGPLPML  137

Query  456   PLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             PLWE FF+G+E ++SIY+H+  +   +    S F+ R+IPS+ V+WG V +++AE+RLLA
Sbjct  138   PLWERFFRGHENYFSIYLHTPRNYVLNVSMDSPFYRRQIPSKNVEWGTVKLVDAEKRLLA  197

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSN+RFVLLSESCIP++NFPT+Y YL+ S  +F+E YD P   GRGRY   M P 
Sbjct  198   NALLDFSNERFVLLSESCIPIYNFPTVYKYLIGSEHSFVESYDEPTRYGRGRYNRNMFPD  257

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             I+L QWRKGSQWFE+ R LA+ V++D +Y+S+F+ YCK +CY DEHY+PT++N+  G  N
Sbjct  258   IQLYQWRKGSQWFEIQRALAVYVLADTKYYSIFKKYCKPACYPDEHYIPTYLNMFHGPLN  317

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYNGEETNVCYLFARKFSLH  1172
             SNR++TWVDWS GG HPA Y   +VT SF++++R  + +C YN E T+VCYLFARKF   
Sbjct  318   SNRTVTWVDWSVGGPHPATYWGINVTESFIQSIRNNETQCSYNSEMTSVCYLFARKFHPS  377

Query  1173  SLTRLLRFAPKLMRF  1217
             +L  LL     +M F
Sbjct  378   ALEPLLNLTSTVMEF  392



>emb|CBI26990.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 215/295 (73%), Gaps = 0/295 (0%)
 Frame = +3

Query  336   MSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHS  515
             M+D+EL+WRASMVP   +YP+ R PKVAFMFL+RG + LA LWE FF+G+ G YSIY+H+
Sbjct  1     MNDKELMWRASMVPHFVDYPYDRTPKVAFMFLSRGRLPLASLWEKFFKGHAGLYSIYLHT  60

Query  516   DPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
              P  N   PE SVF+ RRIPS+ V WG   M++AERRLLANALLDFSN+RFVLLSE+CIP
Sbjct  61    SPEFNTEMPESSVFYKRRIPSKSVDWGKATMVDAERRLLANALLDFSNERFVLLSETCIP  120

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LFNF TIY YL+NS  +F+  +D P   GRGRY  RM P + L  WRKGSQWFE+ R LA
Sbjct  121   LFNFTTIYKYLINSNHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDWRKGSQWFEVHRKLA  180

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
             IE++SD  Y+ +FQ +C+  CY DEHYL T VN      NSNRS+TWVDWS GGSHP ++
Sbjct  181   IEIVSDVTYYPIFQEHCRPPCYMDEHYLATLVNKLRPDLNSNRSITWVDWSRGGSHPTKF  240

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFD  1220
             +R DV+ +FL   R G  C YN   +++C+LFARKF   +L  LLR AP L+ FD
Sbjct  241   VRKDVSEAFLNQARHGFNCSYNSGLSSICFLFARKFHPSTLEPLLRIAPSLLGFD  295



>ref|XP_004972466.1| PREDICTED: uncharacterized protein LOC101769924 [Setaria italica]
Length=410

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/373 (47%), Positives = 258/373 (69%), Gaps = 10/373 (3%)
 Frame = +3

Query  111   NLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADq---plllpppqpERTPV  281
              L+ L++A + F  G+  GL  S     +  N     A+ A+             +R   
Sbjct  44    GLLKLVTATVIFMGGVVLGLSVSGSVARYYYN-----ASHAELFFPATTYGCDPRDRDCG  98

Query  282   AAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPL  461
               +  + F+ PP  A H M+D+EL WRAS+VP+ +++PF RVPKVAF+F+TRG +  APL
Sbjct  99    LGLAFKAFVHPPRLA-HSMTDDELFWRASLVPRAEDFPFQRVPKVAFLFMTRGPIPFAPL  157

Query  462   WEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
             W+ FF+G++G YS+YVH+ P    +  + S F+GR+IPS+EV WG + +++AE+RLLANA
Sbjct  158   WDKFFRGHQGLYSVYVHTVPDYKLNVSKNSAFYGRQIPSEEVSWGSITLVDAEKRLLANA  217

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLDFSN+RFVLLSESCIP+FNFPT+Y YL+NS  +F+E Y++      GRY  RM+P I 
Sbjct  218   LLDFSNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHIM  277

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
               QWRKGS+WFE++R+LA+++++D +Y+S+F+ +C+ SCY DEHY+PT++++  G  N+N
Sbjct  278   ADQWRKGSEWFELNRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNAN  337

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSL  1178
             R++TWVDWS GG HPA Y   D+T  F++T+R  G +C YN + T+VCYLFARKF+ ++L
Sbjct  338   RTITWVDWSRGGPHPASYGAADITEEFIQTIRNNGTQCFYNSKPTSVCYLFARKFAPNAL  397

Query  1179  TRLLRFAPKLMRF  1217
              RL+     ++ F
Sbjct  398   GRLMNLTSTVLDF  410



>ref|XP_007148589.1| hypothetical protein PHAVU_006G221200g [Phaseolus vulgaris]
 gb|ESW20583.1| hypothetical protein PHAVU_006G221200g [Phaseolus vulgaris]
Length=392

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/376 (50%), Positives = 253/376 (67%), Gaps = 7/376 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSY-----FKSFSLNLQLITAAAADqplllpppqpER  272
             L L  +L+  + FA G+  GL  SS+     F S  L+  L  +  +       PP P  
Sbjct  18    LRLAQILTYLVVFAGGVVMGLTTSSHIHNTNFISLPLHNYLPISNCSTTAPSPLPPPPPP  77

Query  273   TPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTL  452
              P   + + +FL PP N  H +SD+EL WRAS++P  + YPF R+PKVAFMFLTRG + +
Sbjct  78    PPPPPLDMADFLHPP-NLTHTLSDDELFWRASLMPNKEGYPFRRIPKVAFMFLTRGPLPM  136

Query  453   APLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrll  632
              PLWE FF G+   ++IYVH+ P  + +    S F+ R+IPSQ+V WG V + +AERRLL
Sbjct  137   LPLWERFFNGHAPLFNIYVHAPPRFHLNVSLSSPFYARQIPSQDVSWGTVTLADAERRLL  196

Query  633   anallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSP  812
             ANALLDFSN+RFVLLSESCIP++NFPT+Y YL +S  +F+E YD P   GRGRY   M P
Sbjct  197   ANALLDFSNERFVLLSESCIPIYNFPTVYRYLTDSAHSFVESYDDPTRYGRGRYSRSMLP  256

Query  813   VIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRG  992
              I+LR WRKGSQWFE++R LA+ +ISD +Y++LF+ YCK +CY DEHY+PTF+N+  G  
Sbjct  257   HIQLRHWRKGSQWFELNRSLAVYIISDTKYYTLFRKYCKPACYPDEHYIPTFLNMFHGPL  316

Query  993   NSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSL  1169
             NSNR++TWVDWS  G HPA + R ++T  F++ +R  G  C YN E T++CYLFARKF  
Sbjct  317   NSNRTVTWVDWSMLGPHPASFGRANITAHFIQAIRNNGSLCRYNSEMTSICYLFARKFDP  376

Query  1170  HSLTRLLRFAPKLMRF  1217
              +L  LL  + ++M F
Sbjct  377   SALEPLLNLSSQVMNF  392



>ref|XP_010669159.1| PREDICTED: uncharacterized protein LOC104886401 [Beta vulgaris 
subsp. vulgaris]
Length=382

 Score =   351 bits (901),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 225/309 (73%), Gaps = 0/309 (0%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL  +++PP N MH MSDEEL WRA++VP+I++YPF+R PK+AFMFLT+G + LAPLWE 
Sbjct  74    GLDRWIRPPSNLMHTMSDEELFWRATLVPRIRKYPFNRTPKIAFMFLTKGPLPLAPLWER  133

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+EG YSIY+HS PS +E  P  SVF+ R IPSQ  +WG +++ +AERRLLANALLD
Sbjct  134   FFKGHEGRYSIYIHSLPSYDEEFPPTSVFYRRNIPSQLTQWGTMSLCDAERRLLANALLD  193

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+RF+LLSESCIPL+ F  I +Y+ NS  +FI  +D  G  GRGRY   M+P + + +
Sbjct  194   ISNERFILLSESCIPLYKFNFIQNYITNSKYSFIGAFDDVGPFGRGRYDENMAPEVNITE  253

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGSQWFE++R LAI ++ D  ++  F+ +CK +CY DEHY PT + IR     +NRS+
Sbjct  254   WRKGSQWFEINRRLAINIVEDTIFYPKFEAFCKPNCYVDEHYFPTMLTIRAANLLANRSI  313

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLL  1190
             T VDWS GGSHPA + + DVTV FL+ +R    C YNG  T VCYLFARKF+  +L  LL
Sbjct  314   TLVDWSRGGSHPATFGKGDVTVDFLKKIREKTTCTYNGRNTTVCYLFARKFAPSTLEPLL  373

Query  1191  RFAPKLMRF  1217
               APK+  F
Sbjct  374   EVAPKVFDF  382



>emb|CDX97139.1| BnaC09g44860D [Brassica napus]
Length=386

 Score =   351 bits (900),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 220/308 (71%), Gaps = 0/308 (0%)
 Frame = +3

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             L ++++PP   MH+MSDEELLWRAS  P+ KEYPF RVPKVAFMFLT+G + LA LWE F
Sbjct  79    LGKWIQPPAVLMHNMSDEELLWRASFWPRRKEYPFQRVPKVAFMFLTKGPLPLALLWERF  138

Query  474   FQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF  653
              +G++G YS+YVH  PS     P GSVFH R+IPSQ  +WG + M +AE+RLLANALLD 
Sbjct  139   LKGHKGLYSVYVHPHPSFTAKFPAGSVFHQRQIPSQVAEWGRMTMCDAEKRLLANALLDI  198

Query  654   SNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQW  833
             SN+ FVL+SESCIPLFNF TIYSYL  S  +F+  +D PG  GRGRY H M P + + +W
Sbjct  199   SNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNHNMEPEVPITKW  258

Query  834   RKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             RKGSQWFE++R+LA  ++ D  Y+  F+ +C+ +CY DEHY PT + I      +NRSLT
Sbjct  259   RKGSQWFEINRELAATIVKDTLYYPKFKDFCRPACYVDEHYFPTMLTIEKPMALANRSLT  318

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             WVDWS GG HPA + R D+T  F E +  G  C YNG  T++CYLFARKF+  +L  LL 
Sbjct  319   WVDWSRGGPHPATFGRSDITERFFEKILDGKNCIYNGRNTSMCYLFARKFAPSALESLLH  378

Query  1194  FAPKLMRF  1217
              APK++ +
Sbjct  379   IAPKILGY  386



>ref|XP_008796992.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796993.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796994.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
Length=384

 Score =   351 bits (900),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 228/309 (74%), Gaps = 0/309 (0%)
 Frame = +3

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             L+  ++PP N MH MS+EEL WRAS  P++K+YPF RVPKVAFMFLT+G + L+PLWE F
Sbjct  76    LRRLIEPPTNLMHKMSEEELFWRASFAPQVKKYPFKRVPKVAFMFLTKGPLPLSPLWENF  135

Query  474   FQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF  653
             F+G+EG YSIY+HS P    + P  SVF+ R+IPS+  +WG ++M +AERRLLANALLD 
Sbjct  136   FKGHEGLYSIYIHSLPDYQPNFPPTSVFYNRQIPSKVAEWGRMSMCDAERRLLANALLDL  195

Query  654   SNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQW  833
             SN+RFVLLSESCIPL+NF  IY YLM S  +F+  +D PG  GRGRY  RM+P + + QW
Sbjct  196   SNERFVLLSESCIPLYNFSIIYHYLMRSRYSFVGSFDDPGPYGRGRYNLRMAPEVNIMQW  255

Query  834   RKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             RKG+QWFE++R LAI+++ D +Y+  F  +C+ SCY DEHY PT + I      +NR++T
Sbjct  256   RKGAQWFEVNRKLAIDIVRDTKYYPKFNEFCRPSCYVDEHYFPTMLTIESPHLIANRTIT  315

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             WVDWS GG+HPA + + D+T +FL+ +  G  C YN + ++VC+LFARKF+  +L  LL+
Sbjct  316   WVDWSRGGAHPATFGKGDITEAFLKKILEGKTCLYNDQPSSVCFLFARKFAPSALEPLLQ  375

Query  1194  FAPKLMRFD  1220
             FA  L+ F+
Sbjct  376   FATSLLGFE  384



>ref|XP_007222675.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
 gb|EMJ23874.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
Length=325

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 223/309 (72%), Gaps = 0/309 (0%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL  ++KPP N  H M+D+ELLWRAS++P+IK+YPF RVPK+AFMFLTRG + LAPLWE 
Sbjct  17    GLDRWIKPPSNLQHTMTDKELLWRASLMPRIKKYPFERVPKIAFMFLTRGPLPLAPLWER  76

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             F +G+EG YSIYVHS PS        SVF+GR IPSQ  +WG ++M +AERRLLANALLD
Sbjct  77    FLKGHEGRYSIYVHSLPSFQPHFHTSSVFYGRHIPSQVSEWGRMSMCDAERRLLANALLD  136

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+ F+L+SESCIPL+NF  IY YLM S  +FI  +D PG  GRGRY + M+P + + Q
Sbjct  137   ISNEWFILVSESCIPLYNFSVIYHYLMKSKYSFIGAFDDPGPFGRGRYNNNMAPEVNITQ  196

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGSQWFE++R LAI ++ D  ++  F+ +C+ +CY DEHY PT + I+ G   +NRS+
Sbjct  197   WRKGSQWFEVNRKLAISIVEDTTFYQKFEKFCRPACYVDEHYFPTMLTIQAGNSLANRSI  256

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLL  1190
             TWVDWS GG HPA + R D+T  F + +  G +C YN   +++C+LF RKF+  ++  LL
Sbjct  257   TWVDWSRGGPHPATFGRADITEEFFKRMLEGHRCTYNDRNSSICFLFGRKFAPSAMEPLL  316

Query  1191  RFAPKLMRF  1217
               APK + F
Sbjct  317   HLAPKFLGF  325



>ref|XP_006470990.1| PREDICTED: uncharacterized protein LOC102625510 isoform X1 [Citrus 
sinensis]
Length=404

 Score =   351 bits (901),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 247/377 (66%), Gaps = 8/377 (2%)
 Frame = +3

Query  96    YNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLI-----TAAAADqplllppp  260
             Y   L L+ +LS  + FA G+  GL  SS+   +      +      +A +         
Sbjct  14    YIGLLKLVQILSFLVVFAAGIIIGLATSSHMNRYFTRESFLFSDSRYSAPSSTLQGNCAV  73

Query  261   qpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRG  440
                   +  + + +F++P  N  H M+DE+L WRASMVP  +EYPF R P+VAFMFLTRG
Sbjct  74    VQTCDDIDYLNIDKFVRP-ANLSHRMTDEQLFWRASMVPYKEEYPFERTPRVAFMFLTRG  132

Query  441   AVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeae  620
              + L PLWE FF+G+E ++SIYVH+ P    +    S F+GR+IPS+ V WG V M +AE
Sbjct  133   PLPLLPLWERFFKGHEKYFSIYVHALPGYKLNVSSDSPFYGRQIPSRNVGWGTVEMADAE  192

Query  621   rrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKH  800
             +RLLANALLDFSN+RFVLLSESCIP++NFPT+Y YL  S  +F+E YD P   GRGRY  
Sbjct  193   KRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSR  252

Query  801   RMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIR  980
              M P IK+ QWRKGSQWFEM R +AI +ISD +Y +LF+ YCK SCY DEHY+PT++NI 
Sbjct  253   WMRPDIKIYQWRKGSQWFEMQRKVAIYIISDTKYLTLFRKYCKPSCYPDEHYIPTYLNIF  312

Query  981   FGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR--TGDKCEYNGEETNVCYLFA  1154
              G   +NRS+TWVDWS  G HP  Y + ++T  F+++LR   G  C YN + T+ CYLFA
Sbjct  313   HGSLMANRSVTWVDWSMLGPHPVMYKKENITEQFIQSLRNSNGSLCLYNEQRTSRCYLFA  372

Query  1155  RKFSLHSLTRLLRFAPK  1205
             RKF+ ++L  LL+ + K
Sbjct  373   RKFAPNTLEPLLKISSK  389



>ref|XP_009144462.1| PREDICTED: uncharacterized protein LOC103868108 isoform X2 [Brassica 
rapa]
Length=404

 Score =   351 bits (901),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 259/389 (67%), Gaps = 19/389 (5%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNL-QLITAAAA--------Dqplllppp  260
             L L   LS  L F  G+  GL  SS+   +  +L Q+++++A+        +  ++    
Sbjct  16    LKLAQTLSFLLIFMAGIIIGLAASSHIDRYFNSLPQMLSSSASVQTVPDYSNCTVIHRDC  75

Query  261   qpERTPVAAVGLQEFLKP---------PENAMHDMSDEELLWRASMVPKIKEYPFSRVPK  413
               +   V A   ++ ++          PE   H MSD+EL WRASMVP  +EYP+ RVPK
Sbjct  76    SNDDDDVKAAKKKDEIRDCWSVDGFVRPEEVRHGMSDDELFWRASMVPVKEEYPYDRVPK  135

Query  414   VAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKW  593
             VAFMFLTRGA+ + PLWE FF+GNE F S+YVH+ P  + +    S F+ R++PSQ+V W
Sbjct  136   VAFMFLTRGALPMLPLWEKFFRGNEKFLSVYVHTPPGYDMNVSSDSPFYNRQVPSQKVAW  195

Query  594   GDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPG  773
             G   + +AE+RLLANALLDFSN+RFVLLSESC+P++NF T+YSYL+NS  +F++ YD P 
Sbjct  196   GSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFTTVYSYLINSAYSFVDSYDEPT  255

Query  774   STGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEH  953
               GRGRY  +M P IKL  WRKGSQWFE++R +AI +ISD +Y+SLF+ +C+ +CY DEH
Sbjct  256   RYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFKKFCRPACYPDEH  315

Query  954   YLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYNGEE  1130
             Y+PT +N+  G  N+NRS+TWVDWS GG HPA Y   ++T  FL+++R  D  C YN E 
Sbjct  316   YIPTLLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNITEGFLQSIRKNDTDCLYNEEP  375

Query  1131  TNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             T++C+LFARKF+  +L  L+  +  +M F
Sbjct  376   TSLCFLFARKFAPSALAPLMNLSSTVMGF  404



>ref|XP_009415010.1| PREDICTED: uncharacterized protein LOC103995962 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   351 bits (900),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 230/310 (74%), Gaps = 1/310 (0%)
 Frame = +3

Query  282   AAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPL  461
             +++ L+ F++P  + +H+MSDEEL WRASMVPK++EYPF RVPKVAFMFLTRG + L+PL
Sbjct  82    SSLRLEGFVRP-SHLLHEMSDEELFWRASMVPKVEEYPFRRVPKVAFMFLTRGPLPLSPL  140

Query  462   WEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
             WE F +G+E  YSIYVH+ P  N +  + S F+GR+IP++ V+WG ++M++AE+RLLANA
Sbjct  141   WEEFLKGHEDLYSIYVHTIPGYNLNVSQSSAFYGRQIPNKVVRWGSISMVDAEKRLLANA  200

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLDFSN+RFVLLSESCIP++ FPT+Y YL+ S  +F++ +D     GRGRY HRM+P I 
Sbjct  201   LLDFSNERFVLLSESCIPVYGFPTVYKYLIRSAHSFVQSFDENSPLGRGRYNHRMAPDIV  260

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
             L QWRKGS+W E+ R LA+EV++D +Y  LF+ YC+  CYADEHY PT+ N+  G   +N
Sbjct  261   LSQWRKGSEWLELSRSLAVEVVADFKYHFLFRKYCQPPCYADEHYFPTYFNMFHGALIAN  320

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLT  1181
             RS+TWVDWS GG HPA Y   ++T   ++++R    C+YN   T +C+LFARKF+  +L 
Sbjct  321   RSITWVDWSRGGPHPATYGYQNITKDLIQSIRESKICKYNSGATTMCFLFARKFASDALE  380

Query  1182  RLLRFAPKLM  1211
              LL     +M
Sbjct  381   LLLNLTSAVM  390



>ref|XP_004161853.1| PREDICTED: uncharacterized LOC101207079 [Cucumis sativus]
 gb|KGN64131.1| hypothetical protein Csa_1G042430 [Cucumis sativus]
Length=404

 Score =   351 bits (901),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 180/307 (59%), Positives = 228/307 (74%), Gaps = 6/307 (2%)
 Frame = +3

Query  306   LKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGN  485
             ++PP   MH MSD+E+ WRASMVP IKE+P+ RVPK+AFMFL +G++ LAPLWEMFF+G+
Sbjct  97    VEPP--LMHRMSDDEVFWRASMVPMIKEFPYERVPKIAFMFLIKGSLPLAPLWEMFFKGH  154

Query  486   EGFYSIYVHSDPSCNESA--PEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSN  659
             E  +SIYVH+ P  N S+  P  SVF+GRRIPSQ V+WG  +MI+AERRLLANALLDFSN
Sbjct  155   EHLFSIYVHTHPLYNVSSSLPPNSVFYGRRIPSQAVQWGRPSMIDAERRLLANALLDFSN  214

Query  660   QRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRK  839
             +RF+LLSE+CIPL+NF TIY+YL+NS   F+  YD P   GRGRY  RM PVI +  WRK
Sbjct  215   ERFILLSETCIPLYNFTTIYNYLINSQYTFVSSYDDPRKIGRGRYNPRMFPVISIADWRK  274

Query  840   GSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWV  1019
             GSQW E+DR +AIE+ISD  Y+ +F+ +C   CY DEHY+PT VNI     NSNR++TWV
Sbjct  275   GSQWIEVDRRVAIEIISDSTYYPVFREHCGPPCYMDEHYIPTLVNIVLPDRNSNRTVTWV  334

Query  1020  DWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYN-GEET-NVCYLFARKFSLHSLTRLLR  1193
             DWS  G HP R+ R +++V  L  +R G  C YN G ET ++C+LFARKF   SL  LL+
Sbjct  335   DWSKNGPHPGRFGRREISVELLNRVRFGFNCSYNDGNETVSLCFLFARKFMPDSLQPLLK  394

Query  1194  FAPKLMR  1214
               P L++
Sbjct  395   IWPSLLQ  401



>dbj|BAK05476.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   350 bits (899),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 226/309 (73%), Gaps = 0/309 (0%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL+ + +PP  A H M+DEELLWRAS  P+++ YPF RVPKVAFMFLTRG + LAPLWE 
Sbjct  82    GLERWTRPPARARHAMTDEELLWRASFAPRVRPYPFRRVPKVAFMFLTRGPLPLAPLWER  141

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             FF+G+EG YS+YVH+ PS   +  + SVF+ R+I S+  +WG ++M +AERRLLANALLD
Sbjct  142   FFRGHEGRYSVYVHALPSYRANFTKDSVFYQRQIASKVAEWGQMSMCDAERRLLANALLD  201

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+ FVL+SESCIP+F+F T Y Y  NS+ +F+ V+D PG  GRGRY + M+P ++L Q
Sbjct  202   ISNEWFVLVSESCIPIFDFNTTYEYFQNSSQSFVMVFDDPGPYGRGRYNYNMTPEVELTQ  261

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGSQWFE+DRDL IE+I D RY+  F+ +C+  CY DEHY PT + I   +  +NRS+
Sbjct  262   WRKGSQWFEVDRDLGIEIIRDTRYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSV  321

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLL  1190
             TWVDWS GG+HPA + R D++  FL  ++TG  C YN + T  C+LFARKF+  +L  LL
Sbjct  322   TWVDWSRGGAHPATFGRGDISEEFLRRVQTGRTCLYNNQNTTTCFLFARKFAPSALQPLL  381

Query  1191  RFAPKLMRF  1217
               AP ++ +
Sbjct  382   VLAPTVLGY  390



>gb|KEH39949.1| core-2/I-branching enzyme [Medicago truncatula]
Length=376

 Score =   350 bits (898),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 221/301 (73%), Gaps = 0/301 (0%)
 Frame = +3

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
              GL++++KPP N +H+MSD+ELLWRAS+VPKIK YPF RVPK+AFMFLT+G + LAP+WE
Sbjct  66    AGLEQWIKPPSNLIHNMSDKELLWRASLVPKIKNYPFERVPKIAFMFLTKGPLPLAPVWE  125

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              F +G+E  YS+YVH  PS     P  SVF+ R+IPSQ  +WG ++M +AERRLLANALL
Sbjct  126   RFLKGHESRYSVYVHPTPSYQAHFPPSSVFYKRQIPSQIAEWGRMSMCDAERRLLANALL  185

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             D SN+RF+LLSESCIPL+ F  +Y+YLM S  +F+  +D PG  GRGRY   M+P++ + 
Sbjct  186   DISNERFILLSESCIPLYKFSLVYNYLMKSKFSFVGAFDDPGPYGRGRYNPNMAPLVDVA  245

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
             +WRKGSQWFE+ R LAI ++ D  ++  F+ YC+ +CY DEHY PT + I+ G   +NRS
Sbjct  246   KWRKGSQWFEVSRKLAINIVEDTAFYPKFEQYCRPACYVDEHYFPTMLTIQAGSALANRS  305

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRL  1187
             +TWVDWS GG+HPA + R D+T  F + +R G KC YN   + +C LFARKF+  +L  L
Sbjct  306   VTWVDWSRGGAHPATFGRTDITNEFFDRVRGGQKCLYNNRNSTLCSLFARKFAPSALEPL  365

Query  1188  L  1190
             L
Sbjct  366   L  366



>ref|XP_010046585.1| PREDICTED: uncharacterized protein LOC104435558 [Eucalyptus grandis]
Length=403

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 223/302 (74%), Gaps = 1/302 (0%)
 Frame = +3

Query  315   PENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGF  494
             PE + H MSDEEL WRASMVP I EYP +R PKVAFMFL+RG++ LAPLWE FF+G++  
Sbjct  100   PETSWHSMSDEELAWRASMVPHILEYPCNRTPKVAFMFLSRGSLPLAPLWEKFFKGHKDL  159

Query  495   YSIYVH-SDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFV  671
             YSIY+H S    N+  PE SVF+ RRIPS+  +WG  +MI+AERRLLANALLDFSN+RFV
Sbjct  160   YSIYLHMSVDLGNDEMPETSVFYKRRIPSKPAQWGRASMIDAERRLLANALLDFSNERFV  219

Query  672   LLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQW  851
             LLSE+CIPLFNF T+YSYL+NS  +F+  +D P   GRGRY  RM P + L +WRKGSQW
Sbjct  220   LLSETCIPLFNFTTVYSYLINSNQSFLGSFDDPRPMGRGRYNKRMWPTVSLSEWRKGSQW  279

Query  852   FEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSH  1031
             FE+ R +A+E++SD  Y+ +F+ +C   CY DEHYLPT V       NSNRS+TWVDWS 
Sbjct  280   FEVQRRVAVEIVSDVIYYPVFRNHCMPPCYMDEHYLPTLVTKVCPGANSNRSITWVDWSG  339

Query  1032  GGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLM  1211
             GGSHP ++ R DV+  FL  +R G  C YNG  T++C+LFARKF  ++L  LL+ AP L+
Sbjct  340   GGSHPKQFTRTDVSQVFLNRIRHGFNCTYNGITTSICFLFARKFHPNTLQPLLKIAPPLL  399

Query  1212  RF  1217
              F
Sbjct  400   GF  401



>ref|NP_001143215.1| uncharacterized protein LOC100275720 [Zea mays]
 gb|ACG29786.1| hypothetical protein [Zea mays]
Length=414

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 261/387 (67%), Gaps = 12/387 (3%)
 Frame = +3

Query  69    PPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADq---  239
             PP  T  K Y     L+ L++A + F  G+  GL  S     +  N     A+ A+    
Sbjct  36    PP--TPRKDYWWSTGLLKLVTATVIFMGGVVLGLSVSGSVARYYYN-----ASHAELFFP  88

Query  240   plllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVA  419
                      +R     +  + F+ PP  A H M+D+EL WRAS+VP+ +E+PF RVPKVA
Sbjct  89    ATTYGCDPRDRDCGMGLAFRAFVHPPRLA-HSMTDDELFWRASLVPRAEEFPFQRVPKVA  147

Query  420   FMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGD  599
             F+F+ RG +  APLW+ FF+G++G YS+YVH+ P    +  + S F+GR+IPS+EV WG 
Sbjct  148   FLFMARGPIPFAPLWDKFFRGHQGLYSVYVHTVPDYKLNVSKSSAFYGRQIPSEEVSWGS  207

Query  600   VNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGST  779
             + +++AE+RLLANALLDFSN+RFVLLSESCIP+FNFPT+Y YL+NS  +F+E Y++    
Sbjct  208   ITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQ  267

Query  780   GRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYL  959
               GRY  RM+P I   QWRKGS+WFE++R+LA+++++D +Y+S+F+ +C+ SCY DEHY+
Sbjct  268   CAGRYNRRMAPHIMADQWRKGSEWFELNRELAVQIVADYKYYSIFRKHCRPSCYPDEHYI  327

Query  960   PTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETN  1136
             PT++++  G  N+NR++TWVDWS GG HPA Y   D+T  F++ +R  G +C YN + T+
Sbjct  328   PTYLHLFHGPLNANRTITWVDWSRGGPHPASYGATDITEEFIQAIRNNGTQCFYNSKPTS  387

Query  1137  VCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             VCYLFARKF+ ++L RL+     ++ F
Sbjct  388   VCYLFARKFAPNALPRLMNLTSTVLDF  414



>emb|CDX93443.1| BnaA06g06050D [Brassica napus]
Length=384

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 247/371 (67%), Gaps = 6/371 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAA  287
             L L   LS  L F  G+  GL  SS+   +      +   A            +  P  +
Sbjct  19    LKLAQTLSFLLIFMAGIIIGLAASSHIDRY---FNSLPTTAFSSSSSSSSAALQTVPDYS  75

Query  288   VGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
                  F++P  N  H MSD+EL WRASMVP  +EYP+ R PKVAFMFLTRG + + PLWE
Sbjct  76    -NCTGFVRP-GNLSHGMSDDELFWRASMVPVKEEYPYERAPKVAFMFLTRGPLPMLPLWE  133

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
              FF+GNE + S+YVH+ P  + +   GS F+ R+IPSQ+V+WG   + +AE+RLL NALL
Sbjct  134   KFFRGNEKYLSVYVHTPPGYDMNVSSGSAFYDRQIPSQKVEWGSPLLTDAEKRLLGNALL  193

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DFSN+RF+LLSESC+P++NF T+YSYL+NS  +F++ YD P   GRGRY  +M P IKL 
Sbjct  194   DFSNERFILLSESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLH  253

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
              WRKGSQWFE++R LAI +ISD +Y+SLF+ +C+ +CY DEHY+PTF+N+  G  N+NRS
Sbjct  254   HWRKGSQWFEVNRKLAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSVNANRS  313

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYNGEETNVCYLFARKFSLHSLTR  1184
             +TWVDWS GG HPA Y   ++T  FL+++R  +  C YN E T++C+LFARKF+  +L  
Sbjct  314   VTWVDWSIGGPHPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAP  373

Query  1185  LLRFAPKLMRF  1217
             L+  +  +M F
Sbjct  374   LMNLSSTVMGF  384



>dbj|BAJ98037.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   353 bits (905),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 218/294 (74%), Gaps = 4/294 (1%)
 Frame = +3

Query  348   ELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSC  527
              L+  AS  P+         PKVAF+FL +  + +APLWE FF+G+ G YS+YVH+ P+ 
Sbjct  176   RLMALASAAPRAVRVGAGGAPKVAFLFLAKWDLPMAPLWERFFEGHRGLYSVYVHTHPAF  235

Query  528   NESAP----EGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIP  695
             N SA      GS FH R IPS+EVKWG ++M+EAERRLLA+ALLD SN RF+LLSES +P
Sbjct  236   NASAAASDDSGSAFHRRHIPSKEVKWGHISMVEAERRLLAHALLDHSNARFILLSESHVP  295

Query  696   LFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLA  875
             LF+FPT+YSYL+NST  ++E YD PG TGRGRYK  M+P I   QWRKGSQWFEMDR LA
Sbjct  296   LFDFPTVYSYLINSTKVYMESYDEPGGTGRGRYKRGMAPTITPWQWRKGSQWFEMDRALA  355

Query  876   IEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARY  1055
             ++V++DD YF +F+  CK +CYADEHYLPTF++IR  +  + R +TWVDWSHGG HP+R+
Sbjct  356   VDVVADDIYFPVFKKLCKHNCYADEHYLPTFLHIRHPKAAAGRIVTWVDWSHGGPHPSRF  415

Query  1056  LRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              R +VTV FL  LR G  CEYNG  T +C+LFARKF  +SLTR LRFAPK+M F
Sbjct  416   TRMEVTVDFLRWLRGGTTCEYNGRTTTICFLFARKFLPNSLTRFLRFAPKVMGF  469



>ref|NP_001143222.1| uncharacterized protein LOC100275738 [Zea mays]
 gb|ACG29937.1| hypothetical protein [Zea mays]
 gb|ACN25800.1| unknown [Zea mays]
 gb|ACN28199.1| unknown [Zea mays]
 gb|AFW74275.1| hypothetical protein ZEAMMB73_796456 [Zea mays]
Length=414

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 261/387 (67%), Gaps = 12/387 (3%)
 Frame = +3

Query  69    PPLLTSIKLYNAPLNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADq---  239
             PP  T  K Y     L+ L++A + F  G+  GL  S     +  N     A+ A+    
Sbjct  36    PP--TPRKDYWWSTGLLKLVTATVIFMGGVVLGLSVSGSVARYYYN-----ASHAELFFP  88

Query  240   plllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVA  419
                      +R     +  + F+ PP  A H M+D+EL WRAS+VP+ +E+PF RVPKVA
Sbjct  89    ATTYGCDPRDRDCGMGLAFRAFVHPPRLA-HSMTDDELFWRASLVPRAEEFPFQRVPKVA  147

Query  420   FMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGD  599
             F+F+ RG +  APLW+ FF+G++G YS+YVH+ P    +  + S F+GR+IPS+EV WG 
Sbjct  148   FLFMARGPIPFAPLWDKFFRGHQGLYSVYVHTVPDYKLNVSKSSAFYGRQIPSEEVSWGS  207

Query  600   VNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGST  779
             + +++AE+RLLANALLDFSN+RFVLLSESCIP+FNFPT+Y YL+NS  +F+E Y++    
Sbjct  208   ITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQ  267

Query  780   GRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYL  959
               GRY  RM+P I   QWRKGS+WFE++R+LA+++++D +Y+S+F+ +C+ SCY DEHY+
Sbjct  268   CAGRYNRRMAPHIMADQWRKGSEWFELNRELAVQIVADYKYYSIFRKHCRPSCYPDEHYI  327

Query  960   PTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETN  1136
             PT++++  G  N+NR++TWVDWS GG HPA Y   D+T  F++ +R  G +C YN + T+
Sbjct  328   PTYLHLFHGPLNANRTITWVDWSRGGPHPASYGATDITEDFIQAIRNNGTQCFYNSKPTS  387

Query  1137  VCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             VCYLFARKF+ ++L RL+     ++ F
Sbjct  388   VCYLFARKFAPNALPRLMNLTSTVLDF  414



>ref|XP_004230423.1| PREDICTED: uncharacterized protein LOC101259085 [Solanum lycopersicum]
Length=406

 Score =   350 bits (898),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 252/378 (67%), Gaps = 6/378 (2%)
 Frame = +3

Query  99    NAPLNLINLLSAFLFFACGLTCGLIFSSYF-KSFSLNLQLITA--AAADqplllpppqpE  269
             ++ ++L+ +L+  + F  G+  GL  SS+  + F+   + I A  A AD           
Sbjct  30    DSSVSLLRVLATLIVFVIGVVIGLTSSSHIDRYFTFQAEQIIANNALADTVSKESGNCSV  89

Query  270   RTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVT  449
                   + +  F++P +  +H MSD EL WRAS+ P  KE+PF RVPKVAFMFLTRG + 
Sbjct  90    CEKEDCLSMDSFVRP-KILIHGMSDVELFWRASLEPYKKEFPFKRVPKVAFMFLTRGELP  148

Query  450   LAPLWEMFFQGNE-GFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerr  626
               PLWE FFQG +   YSIY+H+ P    S    SVF+ R+IPSQ V+WG V +++AE+R
Sbjct  149   FIPLWERFFQGQDVNKYSIYIHALPGFVLSISNTSVFYKRQIPSQHVEWGSVTLVDAEKR  208

Query  627   llanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRM  806
             L+ANALLDFSN+RFVLLSESCIP++NFPT+Y YL+ S  +F+E YD P   GRGRY   M
Sbjct  209   LMANALLDFSNERFVLLSESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRHM  268

Query  807   SPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFG  986
              P IKL  WRKGSQWFEM+R LA+ V+SD +Y+ LF+ +CK +CY DEHY+PT + +  G
Sbjct  269   RPDIKLPDWRKGSQWFEMNRTLAVRVVSDTKYYDLFERFCKPACYPDEHYIPTLIRLFHG  328

Query  987   RGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKF  1163
               N+NR++T+VDWS GG HPA +   ++T  FL+ +R  G  C YN E+T+VCYLFARKF
Sbjct  329   PLNANRTVTYVDWSLGGPHPAAFSAVNITEGFLQLIRNNGTACAYNSEKTHVCYLFARKF  388

Query  1164  SLHSLTRLLRFAPKLMRF  1217
             +  +L  LL  + K+M +
Sbjct  389   NPSALEPLLNLSSKVMEY  406



>ref|XP_009360140.1| PREDICTED: uncharacterized protein LOC103950635 [Pyrus x bretschneideri]
 ref|XP_009345483.1| PREDICTED: uncharacterized protein LOC103937281 [Pyrus x bretschneideri]
Length=403

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 249/375 (66%), Gaps = 16/375 (4%)
 Frame = +3

Query  135   FLFFACGLTCGLIFSSYFKSF-SLNLQ------LITAAAADqplllpppqpERTPVAAVG  293
              +FF  GL+ G++ SSY+K+F    LQ      L+   A+    L  PP P   P    G
Sbjct  27    LVFFVIGLSVGVMVSSYYKTFFPFTLQTTSSSSLLLPPASITEFLQQPPSPPLLPSQESG  86

Query  294   LQEFLKPPENAM-HDMSDE-ELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWE  467
                     E  + H M D+ EL WRAS VP+I ++P++RVP++AFMFLT+G + LAPLWE
Sbjct  87    TDNVASDTEALLVHKMVDDGELFWRASFVPRIGKFPYNRVPRIAFMFLTKGPIPLAPLWE  146

Query  468   MFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanall  647
             MFF G+EG Y+IYVH  PS  +S P+ SVF+GRRIPS+ V+WG   MI+ ERRLLA+ALL
Sbjct  147   MFFNGHEGLYNIYVHPHPSYVDSWPQNSVFYGRRIPSKAVEWGSPTMIDGERRLLASALL  206

Query  648   DFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLR  827
             DF+N+RFVLLSESCIPLFNF TIYSYLMN++ + I  YD P   GRGRY  RM P I + 
Sbjct  207   DFTNERFVLLSESCIPLFNFTTIYSYLMNASESNIGSYDDPRKVGRGRYNPRMWPEINIS  266

Query  828   QWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRS  1007
              WRKGSQWFE+ R LA+E+ISD++Y+ +F+ +C   CY DEHY+PT VNI     NSNRS
Sbjct  267   DWRKGSQWFEVSRKLAVEIISDNKYYPIFKEHCSPPCYMDEHYIPTLVNIIGPEKNSNRS  326

Query  1008  LTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEET-------NVCYLFARKFS  1166
             +TWVDWS  G HP R+ R+DV+   L  +R G  C  +G          ++C+LFARKF 
Sbjct  327   VTWVDWSKSGPHPGRFGRNDVSEVILNQIRFGSNCSCSGNSNANSTITCSMCFLFARKFM  386

Query  1167  LHSLTRLLRFAPKLM  1211
               +L  LL+ AP L+
Sbjct  387   GDTLRPLLQIAPMLL  401



>ref|XP_002268014.1| PREDICTED: uncharacterized protein LOC100250508 [Vitis vinifera]
Length=379

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 220/301 (73%), Gaps = 1/301 (0%)
 Frame = +3

Query  321   NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
             N  H  SD EL WRASMVP+  EYPF RVPKVAFMFLTRG + L PLWE FF+G+  ++S
Sbjct  77    NLTHGFSDNELFWRASMVPRRAEYPFKRVPKVAFMFLTRGPLPLMPLWERFFEGHRKYFS  136

Query  501   IYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             +YVH+ P    +    S F+ R+IPS+ V+WG V + EAERRLLANALLDFSN+RFVLLS
Sbjct  137   VYVHALPGFELNVSMHSAFYKRQIPSKSVEWGTVALAEAERRLLANALLDFSNERFVLLS  196

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIP++NFP +Y YL+NS  +F+E YD P   GRGRY   M P IKL QWRKGSQWFE+
Sbjct  197   ESCIPIYNFPIVYKYLINSDYSFVESYDDPSRYGRGRYSRNMLPNIKLYQWRKGSQWFEL  256

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
              R+LA+ +++D +Y++LF+ YCK SCY DEHY+ TF+N+ +G  N+NRS+TWVDWS GG 
Sbjct  257   SRELAVNIVADTKYYTLFKKYCKPSCYPDEHYIQTFLNMFYGSLNANRSVTWVDWSMGGP  316

Query  1041  HPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             HPA     ++T  F++ LR  G  C YN E+T+VCYLFARKF+  +L  LL    K+M F
Sbjct  317   HPATLGAANITEGFIQALRNNGTVCPYNSEKTSVCYLFARKFAPSALEPLLNLTSKVMGF  376

Query  1218  D  1220
              
Sbjct  377   K  377



>ref|XP_009357886.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103948560 
[Pyrus x bretschneideri]
Length=496

 Score =   352 bits (904),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 221/299 (74%), Gaps = 1/299 (0%)
 Frame = +3

Query  327   MHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             +H+MSDEEL  RASMVP+I+ +P+  VPKVAFMFLT+G + L+PLWE FF+G+EG YSIY
Sbjct  199   VHNMSDEELFRRASMVPRIQYFPYKLVPKVAFMFLTKGPLPLSPLWEKFFKGHEGLYSIY  258

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VH+ P  NES PE SVFHGRRI SQ V WG  +M++AERRLLAN LLD SNQRFVLLSES
Sbjct  259   VHAHPDFNESVPEDSVFHGRRIHSQPVYWGTSSMLDAERRLLANGLLDISNQRFVLLSES  318

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF T Y YL+NS  +F+  +D P   GRGRY  +M P+I +  WRKGSQWFE+ R
Sbjct  319   CIPLFNFTTAYDYLINSNQSFLNSFDDPRKPGRGRYNPQMYPMINITNWRKGSQWFEVHR  378

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
               A+ ++SD +Y+ +FQ YC   CY DEHY+PT VN+ +   +S RS+TWVDWS GG HP
Sbjct  379   -XAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLLYTELSSKRSVTWVDWSRGGPHP  437

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDE  1223
              ++   D++   L  +R G KC YNG  T+VC+LFARKF  ++L  LLR AP L+ FD+
Sbjct  438   GKFGWIDISNELLNRIRFGSKCTYNGNTTSVCFLFARKFLPNTLEPLLRVAPLLLGFDQ  496



>emb|CDX69735.1| BnaA10g20840D [Brassica napus]
Length=386

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 219/308 (71%), Gaps = 0/308 (0%)
 Frame = +3

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             L ++++PP   MH+M+DEELLWRAS  P+ KEYPF RVPK+AFMFLT+G + LA LWE F
Sbjct  79    LSKWIQPPAVLMHNMTDEELLWRASFWPRRKEYPFQRVPKIAFMFLTKGPLPLALLWERF  138

Query  474   FQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF  653
              +G++G YS+YVH  PS     P GSVFH R+IPSQ  +WG + M +AE+RLLANALLD 
Sbjct  139   LKGHKGLYSVYVHPHPSFTAKFPAGSVFHQRQIPSQVAEWGRMTMCDAEKRLLANALLDI  198

Query  654   SNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQW  833
             SN+ FVL+SESCIPLFNF TIYSYL  S  +F+  +D PG  GRGRY   M P + + +W
Sbjct  199   SNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNDNMEPEVPITKW  258

Query  834   RKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             RKGSQWFE++R+LA  ++ D  Y+  F+ +C+ +CY DEHY PT + I      +NRSLT
Sbjct  259   RKGSQWFEINRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRSLT  318

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             WVDWS GG HPA + R D+T  F E +  G  C YNG  T++CYLFARKF+  +L  LL 
Sbjct  319   WVDWSRGGPHPATFGRSDITEKFFEKILDGKNCVYNGRNTSMCYLFARKFAPSALESLLH  378

Query  1194  FAPKLMRF  1217
              APK++ +
Sbjct  379   IAPKILGY  386



>emb|CDX97141.1| BnaC09g44840D [Brassica napus]
Length=386

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 219/308 (71%), Gaps = 0/308 (0%)
 Frame = +3

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             L ++++PP   MH+MSDEELLWRAS  P+ KEYPF RVPKVAFMFLT+G + LA LWE F
Sbjct  79    LGKWIQPPAVLMHNMSDEELLWRASFWPRRKEYPFQRVPKVAFMFLTKGPLPLALLWERF  138

Query  474   FQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF  653
              +G++G YS+YVH  PS     P  SVFH R+IPSQ  +WG + M +AE+RLLANALLD 
Sbjct  139   LKGHKGLYSVYVHPHPSFTAKFPATSVFHQRQIPSQVAEWGRMTMCDAEKRLLANALLDI  198

Query  654   SNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQW  833
             SN+ FVL+SESCIPLFNF TIYSYL  S  +F+  +D PG  GRGRY H M P + + +W
Sbjct  199   SNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNHNMEPEVPITKW  258

Query  834   RKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             RKGSQWFE++R+LA  ++ D  Y+  F+ +C+ +CY DEHY PT + I      +NRSLT
Sbjct  259   RKGSQWFEINRELAATIVKDTLYYPKFKDFCRPACYVDEHYFPTMLTIEKPMALANRSLT  318

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             WVDWS GG HPA + R D+T  F E +  G  C YNG  T++CYLFARKF+  +L  LL 
Sbjct  319   WVDWSRGGPHPATFGRSDITERFFEKILDGKNCIYNGRNTSMCYLFARKFAPSALESLLH  378

Query  1194  FAPKLMRF  1217
              APK++ +
Sbjct  379   IAPKILGY  386



>ref|XP_010519868.1| PREDICTED: uncharacterized protein LOC104799181 [Tarenaya hassleriana]
Length=384

 Score =   348 bits (894),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 237/352 (67%), Gaps = 2/352 (1%)
 Frame = +3

Query  168   LIFSSYFKSFSLNLQLITAAAADqplllpppqpERTPVAAV--GLQEFLKPPENAMHDMS  341
             L+    F SFS+   +I+ +      +         P      GL  +++PP + MH+MS
Sbjct  33    LLLLGVFLSFSIAFFIISVSMVKYFGIHTTVASGFVPCHGEENGLDRWIRPPSDLMHEMS  92

Query  342   DEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDP  521
             DEELLWRAS VP+ KEYPF+RVPK+AFMFLT+G + L+PLWE F +G EG YS+Y+HS P
Sbjct  93    DEELLWRASFVPRRKEYPFNRVPKIAFMFLTKGPLPLSPLWERFLKGYEGLYSVYIHSHP  152

Query  522   SCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLF  701
             S     P  SVF+ R+IPS+  +WG + M +AERRLLANALLD SN+ FVLLSE+CIPLF
Sbjct  153   SFTAKFPPSSVFYRRQIPSKAAEWGRMTMCDAERRLLANALLDISNEWFVLLSETCIPLF  212

Query  702   NFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIE  881
             NF TI+ Y+  S  +F+  +D PG  GRGRY   M+P + + QWRKGSQWFE++R+LA+ 
Sbjct  213   NFTTIHRYITKSKHSFVGSFDDPGPYGRGRYNSSMAPEMDITQWRKGSQWFEVNRELAVT  272

Query  882   VISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLR  1061
             ++ D  Y+  F+ +C+ +CY DEHY PT +N+      +NRS+TWVDWS GG+HPA + R
Sbjct  273   IVKDTVYYPKFRDFCRPACYVDEHYFPTMLNVEKPGLLANRSVTWVDWSRGGAHPATFGR  332

Query  1062  HDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              D+T  F   +  G  C YNG  T++CYLFARKF+  +L  LL  APK++ F
Sbjct  333   SDMTEDFFGRIHGGRNCSYNGHNTSMCYLFARKFAPSALEPLLHLAPKVLGF  384



>gb|KHG05757.1| hypothetical protein F383_31190 [Gossypium arboreum]
Length=387

 Score =   348 bits (894),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 187/374 (50%), Positives = 243/374 (65%), Gaps = 13/374 (3%)
 Frame = +3

Query  111   NLINLLSAFLFFAC----GLTCGL-IFSSYFKSFSLNLQLITAAAADqplllpppqpERT  275
             NL   L + L   C    G+  GL I S Y   FS+  QL T A +    L         
Sbjct  22    NLFRALPSRLLVFCLLFLGVGVGLSIISMYSVRFSMVQQLATKATSAVQPLFQDD-----  76

Query  276   PVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLA  455
                   +  F++PP N MH+M+D ELLWRAS VP+IK+YPF RVPK+AFMFLT+G + LA
Sbjct  77    ---GTTIDNFIRPPSNLMHNMNDTELLWRASFVPQIKDYPFKRVPKIAFMFLTKGPLPLA  133

Query  456   PLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             PLW+ FF+G+E  YSIYVH+ PS     P  S F+GR+IPSQ V+WG ++M EAERRLLA
Sbjct  134   PLWDRFFKGHEELYSIYVHALPSYTAGYPPSSPFYGRQIPSQMVEWGRMSMCEAERRLLA  193

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLD SN+ F+LLSESCIPL NF  IY Y+  S  +F+  +D PG  GRGRY   M P 
Sbjct  194   NALLDISNEWFILLSESCIPLHNFSIIYHYISRSRYSFMGSFDEPGPYGRGRYNPHMEPE  253

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             + L QWRKGSQWFE++R LAI+++ D  Y+  F+ +C+ +CY DEHY PT + I+     
Sbjct  254   VTLSQWRKGSQWFEVNRKLAIDIVVDTTYYPKFKKFCRPACYVDEHYFPTMLTIQSPHLL  313

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHS  1175
             +NR+LTW DWS GG+HPA + + D+T  F + +  G  C YNG+ + VCYLFARKF+  +
Sbjct  314   ANRTLTWTDWSRGGAHPATFGKADITEGFFKKIFEGQVCLYNGQPSTVCYLFARKFAPSA  373

Query  1176  LTRLLRFAPKLMRF  1217
             L  LL  A K+ R+
Sbjct  374   LDPLLGLASKVFRY  387



>emb|CBI29648.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   349 bits (895),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 220/301 (73%), Gaps = 1/301 (0%)
 Frame = +3

Query  321   NAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYS  500
             N  H  SD EL WRASMVP+  EYPF RVPKVAFMFLTRG + L PLWE FF+G+  ++S
Sbjct  107   NLTHGFSDNELFWRASMVPRRAEYPFKRVPKVAFMFLTRGPLPLMPLWERFFEGHRKYFS  166

Query  501   IYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLS  680
             +YVH+ P    +    S F+ R+IPS+ V+WG V + EAERRLLANALLDFSN+RFVLLS
Sbjct  167   VYVHALPGFELNVSMHSAFYKRQIPSKSVEWGTVALAEAERRLLANALLDFSNERFVLLS  226

Query  681   ESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEM  860
             ESCIP++NFP +Y YL+NS  +F+E YD P   GRGRY   M P IKL QWRKGSQWFE+
Sbjct  227   ESCIPIYNFPIVYKYLINSDYSFVESYDDPSRYGRGRYSRNMLPNIKLYQWRKGSQWFEL  286

Query  861   DRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGS  1040
              R+LA+ +++D +Y++LF+ YCK SCY DEHY+ TF+N+ +G  N+NRS+TWVDWS GG 
Sbjct  287   SRELAVNIVADTKYYTLFKKYCKPSCYPDEHYIQTFLNMFYGSLNANRSVTWVDWSMGGP  346

Query  1041  HPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
             HPA     ++T  F++ LR  G  C YN E+T+VCYLFARKF+  +L  LL    K+M F
Sbjct  347   HPATLGAANITEGFIQALRNNGTVCPYNSEKTSVCYLFARKFAPSALEPLLNLTSKVMGF  406

Query  1218  D  1220
              
Sbjct  407   K  407



>gb|KFK43315.1| hypothetical protein AALP_AA1G108500 [Arabis alpina]
Length=409

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 190/390 (49%), Positives = 254/390 (65%), Gaps = 20/390 (5%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSS----YFKSF------SLNLQLITAAAADqplllpp  257
             L L   LS  L F  G+  GL  SS    YF S       + NLQ I  ++ D       
Sbjct  20    LKLAQTLSFLLIFMAGIIIGLAASSHIDRYFNSLPRMFSTTTNLQTIPFSSPDYSNCTII  79

Query  258   pqpERTPVAAVGLQEFLKP---------PENAMHDMSDEELLWRASMVPKIKEYPFSRVP  410
              +  R    A   ++  +          P N  H MSDEEL WRASMVP  + YP+ RVP
Sbjct  80    HRDCRDEDEAEKPKKVKRDCWSIDGFVRPVNLSHVMSDEELFWRASMVPVKELYPYERVP  139

Query  411   KVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVK  590
             KVAFMFLTRG + + PLWE FF+GNE + S+YVH+ P  + +    S F+ R+IPSQ+V+
Sbjct  140   KVAFMFLTRGPLPMIPLWEKFFKGNEKYLSVYVHTPPRYDMNVSRESPFYDRQIPSQKVE  199

Query  591   WGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLP  770
             WG   + +AE+RLLANALLDFSN+RFVLLSESC+P++NF T+Y+YL+NS  +F++ YD P
Sbjct  200   WGSALLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFSTVYTYLINSAYSFVDSYDEP  259

Query  771   GSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADE  950
                GRGRY  +M P IKL  WRKGSQWFE++R LAI +ISD +Y+SLF+ +C+ +CY DE
Sbjct  260   TRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKLAIYIISDSKYYSLFKQFCRPACYPDE  319

Query  951   HYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYNGE  1127
             HY+PTF+N+  G  N+NRS+TWVDWS GG HPA Y   ++T  FL+++R  +  C YN E
Sbjct  320   HYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEGFLQSIRNNETDCLYNEE  379

Query  1128  ETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              T++C+LFARKFS  +L  L+  +  ++ F
Sbjct  380   PTSLCFLFARKFSPSALAPLMNLSSTVLGF  409



>ref|XP_002524909.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37533.1| conserved hypothetical protein [Ricinus communis]
Length=405

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 223/301 (74%), Gaps = 7/301 (2%)
 Frame = +3

Query  330   HDMSDE-ELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIY  506
             H+M D  ELL RA+MVP         VPKVAFMFLT+G + LA LWE FF+G+EG Y+IY
Sbjct  105   HNMEDNVELLHRAAMVPH------DHVPKVAFMFLTKGPLPLAALWEKFFKGHEGLYTIY  158

Query  507   VHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSES  686
             VHS PS N++ P+ SVFHGRR+PS+ V+WG  +MI+AERRLLANALLDFSN+RFVLLSES
Sbjct  159   VHSHPSFNDTVPQDSVFHGRRVPSKPVEWGKPSMIDAERRLLANALLDFSNERFVLLSES  218

Query  687   CIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDR  866
             CIPLFNF TIY+YL+N+  +FI+ +D P   GRGRY  +MSP I +  WRKGSQWFE++R
Sbjct  219   CIPLFNFTTIYNYLLNTNQSFIDSFDDPRKIGRGRYNPKMSPTINISDWRKGSQWFEVNR  278

Query  867   DLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHP  1046
              LAI+++SD +Y+ +F  +C   CY DEHY+PT VN+     N+NR +TWVDWS  G HP
Sbjct  279   KLAIKIVSDTKYYPIFSEHCSPPCYMDEHYIPTLVNVICPEENANRGITWVDWSKSGPHP  338

Query  1047  ARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRFDEK  1226
              ++++ DV+V FL+ +R G  C YNG  +++C+LFARKF  ++L  LL  AP+L+ F   
Sbjct  339   GKFVKQDVSVEFLDQIRFGHNCSYNGIASSICFLFARKFLPNTLQPLLHIAPELLYFSNP  398

Query  1227  L  1229
             L
Sbjct  399   L  399



>ref|XP_002444900.1| hypothetical protein SORBIDRAFT_07g001090 [Sorghum bicolor]
 gb|EES14395.1| hypothetical protein SORBIDRAFT_07g001090 [Sorghum bicolor]
Length=412

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/373 (47%), Positives = 255/373 (68%), Gaps = 10/373 (3%)
 Frame = +3

Query  111   NLINLLSAFLFFACGLTCGLIFSSYFKSFSLNLQLITAAAADq---plllpppqpERTPV  281
              L+ L++A + F  G+  GL  S     +  N     A+ A+             +R   
Sbjct  46    GLLKLVTATVIFMGGVVLGLSVSGSVARYYYN-----ASHAELFFPTTTYSCDPRDRDCG  100

Query  282   AAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPL  461
               +  + F+ PP  A H M+D+EL WRAS+VPK +E+PF RVPKVAF+F+ RG +  APL
Sbjct  101   MGLAFRAFVHPPRLA-HSMTDDELFWRASLVPKAEEFPFQRVPKVAFLFMARGPLPFAPL  159

Query  462   WEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllana  641
             W+ FF+ ++G YS+YVH+ P    +  + S F+GR+IPSQ+V WG + +++AE+RLLANA
Sbjct  160   WDKFFRDHQGLYSVYVHTVPDYKLNVSKNSAFYGRQIPSQDVSWGSITLVDAEKRLLANA  219

Query  642   llDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIK  821
             LLDFSN+RFVLLSESCIP+FNFPT+Y YL+NS  +F+E Y++      GRY  RM+P I 
Sbjct  220   LLDFSNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQSAGRYNRRMAPHIM  279

Query  822   LRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSN  1001
               QWRKGS+WFE++R+LA+++++D +Y+S+F+ +C+ SCY DEHY+PT++++  G  N+N
Sbjct  280   ADQWRKGSEWFELNRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNAN  339

Query  1002  RSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNVCYLFARKFSLHSL  1178
             R++TWVDWS GG HPA Y   D+T  F++ +R  G +C YN + T+VCYLFARKF+ ++L
Sbjct  340   RTITWVDWSRGGPHPASYGAADITEDFIQAIRNNGTQCFYNSKPTSVCYLFARKFAPNAL  399

Query  1179  TRLLRFAPKLMRF  1217
              RL+     ++ F
Sbjct  400   GRLMNMTSTVLDF  412



>ref|XP_006355313.1| PREDICTED: uncharacterized protein LOC102601627 [Solanum tuberosum]
Length=388

 Score =   348 bits (892),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/308 (54%), Positives = 222/308 (72%), Gaps = 0/308 (0%)
 Frame = +3

Query  294   LQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEMF  473
             L+ ++ PP N +H MSD+ELLWRASMVP++K+YPF RVPK+AFMFLT+G + LAP+WE F
Sbjct  81    LESWINPPSNLLHTMSDKELLWRASMVPRVKKYPFKRVPKIAFMFLTKGPLPLAPIWERF  140

Query  474   FQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallDF  653
             F+G++GFYSIY+HS PS     P  SVF+ R+IPSQ  +WG ++M +AERRLLANALLD 
Sbjct  141   FKGHQGFYSIYIHSLPSFEADFPASSVFYKRQIPSQVTEWGKMSMCDAERRLLANALLDI  200

Query  654   SNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQW  833
             SN+ FVLLSESCIPL+NF  IY Y+  S  +F+  +D PG  GRGRY   M P + + QW
Sbjct  201   SNEWFVLLSESCIPLYNFNVIYKYISQSKHSFVGAFDDPGPYGRGRYDENMLPEVNISQW  260

Query  834   RKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSLT  1013
             RKGSQWFEM R LA+ ++ D +++  F  +C+ +CY DEHY PT + I+     +NRS+T
Sbjct  261   RKGSQWFEMSRKLALFIVEDTKFYPKFAEFCRPACYVDEHYFPTMLTIQASNLLANRSIT  320

Query  1014  WVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLLR  1193
             WVDWS GG+HPA + + D+T  F++ +  G  C YN   T++CY+FARKF+  +L  L  
Sbjct  321   WVDWSRGGAHPATFGKSDITEEFMKRMLAGPNCTYNDRNTSMCYIFARKFAPSALEPLFL  380

Query  1194  FAPKLMRF  1217
              APK + F
Sbjct  381   LAPKYLGF  388



>ref|XP_008452226.1| PREDICTED: uncharacterized protein LOC103493307 isoform X2 [Cucumis 
melo]
Length=389

 Score =   348 bits (892),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 255/386 (66%), Gaps = 25/386 (6%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSS----YFKS----------FSLNLQLITAAAADqpl  245
             L L+ +LS  + F  G+  GL  +S    YF S          FS+    +     D  +
Sbjct  13    LKLMQILSFLVVFVAGVVIGLATTSHVSRYFTSQAELYSFINHFSVPTTHVEENCTDSNI  72

Query  246   llpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEY-PFSRVPKVAF  422
                    ER   ++  +  F+ P +N  H MSD+EL WRASMV K + Y PF RVPKVAF
Sbjct  73    C------ERKDCSSFHM--FIHP-DNLTHAMSDDELFWRASMVSKRENYYPFKRVPKVAF  123

Query  423   MFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDV  602
             MFLTRG + + PLWE FF G++  +SIYVH+ P    +    SVF+ R+IPSQ V WG V
Sbjct  124   MFLTRGPLPMLPLWERFFAGHDNLFSIYVHALPGYELNVSTSSVFYRRQIPSQRVSWGTV  183

Query  603   NMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTG  782
             ++ +AERRLLANALLDFSN+RFVLLSESCIP++NF T+Y YL NS  +F+E YD P   G
Sbjct  184   SLADAERRLLANALLDFSNERFVLLSESCIPVYNFQTVYDYLTNSAHSFVESYDEPTRYG  243

Query  783   RGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLP  962
             RGRY  +M P IKL+ WRKGSQWFE+ R LAI +++D +Y++LF+ +CK +CY DEHY+P
Sbjct  244   RGRYSRQMLPDIKLQHWRKGSQWFELSRALAIYIVADTKYYTLFKKFCKPACYPDEHYIP  303

Query  963   TFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNV  1139
             T++N+  G  NSNR++TWVDWS GG HPA Y   ++T SF+E++R  G +C YN E T+V
Sbjct  304   TYLNMFHGSLNSNRTVTWVDWSMGGPHPAMYGPANITESFIESIRNNGTECLYNSEITSV  363

Query  1140  CYLFARKFSLHSLTRLLRFAPKLMRF  1217
             CYLFARKF+  +L  LL     +M+F
Sbjct  364   CYLFARKFAPSTLEPLLNLTSSVMKF  389



>ref|XP_010475888.1| PREDICTED: uncharacterized protein LOC104755237 [Camelina sativa]
Length=407

 Score =   348 bits (894),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 188/392 (48%), Positives = 254/392 (65%), Gaps = 22/392 (6%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSS----YFKSF------SLNLQLITAA----------  227
             L L   LS  L F  G+  GL  SS    YF S       S +LQ  T            
Sbjct  16    LKLAQTLSFLLIFMAGIIIGLAASSHIDRYFNSLPRMFSSSTHLQFSTTPDYSNCTVIHR  75

Query  228   -AADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSR  404
                D+       + E+  V      +    PEN  H MSD+EL WRASMVP  +E+P+ R
Sbjct  76    DCNDENDDDGGVKAEKPKVRDCWSIDGFVRPENLSHGMSDDELFWRASMVPVKEEFPYDR  135

Query  405   VPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQE  584
             VPKVAF+FLTRG + + PLWE FF+GNE + S+YVH+ P  + +    S F+ R+IPSQ+
Sbjct  136   VPKVAFLFLTRGPLPMLPLWEKFFKGNEKYLSVYVHTPPGYDMNVSRDSPFYDRQIPSQK  195

Query  585   VKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYD  764
             V+WG   + +AE+R+LANALLDFSN+RFVLLSESC+P++NF T+Y+YL+NS  +F++ YD
Sbjct  196   VEWGSPLLTDAEKRVLANALLDFSNERFVLLSESCVPVYNFSTVYNYLINSAYSFVDSYD  255

Query  765   LPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYA  944
              P   GRGRY  +M P IKL  WRKGSQWFE++R +AI +ISD +Y+SLF+ +C+ +CY 
Sbjct  256   EPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFKQFCRPACYP  315

Query  945   DEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYN  1121
             DEHY+PTF+N+  G  N+NRS+TWVDWS GG HPA Y   ++T  FL+++R  +  C YN
Sbjct  316   DEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEEFLQSIRKNETDCLYN  375

Query  1122  GEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              E T++C+LFARKFS  +L  L+  +  +M F
Sbjct  376   DEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  407



>emb|CDY20644.1| BnaC08g14140D [Brassica napus]
Length=390

 Score =   348 bits (892),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 254/372 (68%), Gaps = 3/372 (1%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSFSLNL-QLITAAAADqplllpppqpERTPVA  284
             L L   LS  L F  G+  GL  SS+   +  +L Q+++++++   L   P     T   
Sbjct  20    LKLAQTLSFLLIFMAGIIIGLAASSHIDRYFNSLPQMLSSSSSSASLQTIPDYSNCTIRD  79

Query  285   AVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
                +  F++P E   H MSD+EL WRASMVP  +EYP+ RVPKVAFMFL RG + + PLW
Sbjct  80    CWSVDGFVRP-EEVRHRMSDDELFWRASMVPVKEEYPYDRVPKVAFMFLARGPLPMLPLW  138

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             E FF+GNE + S+YVH+ P  + +    S F+ R++PSQ+V WG   + +AE+RLLANAL
Sbjct  139   EKFFRGNEKYLSVYVHTPPGYDMNVSSDSPFYDRQVPSQKVAWGSPLLTDAEKRLLANAL  198

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LDFSN+RFVLLSESC+P++NF T+YSYL+NS  +F++ YD P   GRGRY  +M P IKL
Sbjct  199   LDFSNERFVLLSESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKL  258

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
               WRKGSQWFE++R +AI +ISD +Y+SLF+ YC+ +CY DEHY+PT +N+  G  N+NR
Sbjct  259   HNWRKGSQWFEVNRKIAIYIISDSKYYSLFKQYCRPACYPDEHYIPTLLNMFHGSVNANR  318

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-KCEYNGEETNVCYLFARKFSLHSLT  1181
             S+TWVDWS GG HPA Y   ++T  FL+++R  +  C YN E T++C+LFARKF+  +L 
Sbjct  319   SVTWVDWSIGGPHPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALA  378

Query  1182  RLLRFAPKLMRF  1217
              L+  +  +M F
Sbjct  379   PLMNLSSTVMGF  390



>ref|XP_011081713.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
 ref|XP_011081714.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
Length=385

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 224/311 (72%), Gaps = 0/311 (0%)
 Frame = +3

Query  285   AVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
             A+ L++++KPP N MH MSDEEL WRAS VP++K+YPF RVPK+AFMFLT+G + LAPLW
Sbjct  75    ALTLEQWIKPPTNLMHKMSDEELFWRASFVPRVKKYPFQRVPKIAFMFLTKGQLPLAPLW  134

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             E FF+G+EG YSIY+HS PS     P  SVF+ R+IPSQ  +WG ++M++AERRLLANAL
Sbjct  135   ERFFKGHEGQYSIYIHSLPSFEADFPSSSVFYKRQIPSQVSEWGKMSMVDAERRLLANAL  194

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SN+ FVLLSESCIPL+NF  +Y+Y+  S  +FI  +D PG  GRGRY   M P + +
Sbjct  195   LDISNEWFVLLSESCIPLYNFSMVYNYITGSKYSFIGAFDDPGPYGRGRYNDNMLPEVNI  254

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
               WRKGSQWFE+++ LA+ ++ D +++  F  +CK +CY DEHY PT + I+     +NR
Sbjct  255   TDWRKGSQWFEINKKLALYIVEDTKFYPKFSEFCKPACYVDEHYFPTMLTIQAATLLANR  314

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             S+TWVDWS GG+HPA +   D+T  F + +  G  C YN + +++CYLFARKFS  +L  
Sbjct  315   SITWVDWSRGGAHPATFGGSDITEEFFKKIFDGRSCLYNNKPSSICYLFARKFSPSALEA  374

Query  1185  LLRFAPKLMRF  1217
             L   APK + F
Sbjct  375   LFLLAPKFLGF  385



>ref|XP_008452225.1| PREDICTED: uncharacterized protein LOC103493307 isoform X1 [Cucumis 
melo]
Length=394

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 255/386 (66%), Gaps = 25/386 (6%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSS----YFKS----------FSLNLQLITAAAADqpl  245
             L L+ +LS  + F  G+  GL  +S    YF S          FS+    +     D  +
Sbjct  18    LKLMQILSFLVVFVAGVVIGLATTSHVSRYFTSQAELYSFINHFSVPTTHVEENCTDSNI  77

Query  246   llpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEY-PFSRVPKVAF  422
                    ER   ++  +  F+ P +N  H MSD+EL WRASMV K + Y PF RVPKVAF
Sbjct  78    C------ERKDCSSFHM--FIHP-DNLTHAMSDDELFWRASMVSKRENYYPFKRVPKVAF  128

Query  423   MFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDV  602
             MFLTRG + + PLWE FF G++  +SIYVH+ P    +    SVF+ R+IPSQ V WG V
Sbjct  129   MFLTRGPLPMLPLWERFFAGHDNLFSIYVHALPGYELNVSTSSVFYRRQIPSQRVSWGTV  188

Query  603   NMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTG  782
             ++ +AERRLLANALLDFSN+RFVLLSESCIP++NF T+Y YL NS  +F+E YD P   G
Sbjct  189   SLADAERRLLANALLDFSNERFVLLSESCIPVYNFQTVYDYLTNSAHSFVESYDEPTRYG  248

Query  783   RGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLP  962
             RGRY  +M P IKL+ WRKGSQWFE+ R LAI +++D +Y++LF+ +CK +CY DEHY+P
Sbjct  249   RGRYSRQMLPDIKLQHWRKGSQWFELSRALAIYIVADTKYYTLFKKFCKPACYPDEHYIP  308

Query  963   TFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNV  1139
             T++N+  G  NSNR++TWVDWS GG HPA Y   ++T SF+E++R  G +C YN E T+V
Sbjct  309   TYLNMFHGSLNSNRTVTWVDWSMGGPHPAMYGPANITESFIESIRNNGTECLYNSEITSV  368

Query  1140  CYLFARKFSLHSLTRLLRFAPKLMRF  1217
             CYLFARKF+  +L  LL     +M+F
Sbjct  369   CYLFARKFAPSTLEPLLNLTSSVMKF  394



>ref|XP_006385074.1| hypothetical protein POPTR_0004s23660g [Populus trichocarpa]
 gb|ERP62871.1| hypothetical protein POPTR_0004s23660g [Populus trichocarpa]
Length=392

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 250/375 (67%), Gaps = 6/375 (2%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSSYFKSF--SLNLQLITAAAADqplllpppqpERT--  275
             L L+ +LS  + F  G+  G+  S +   +  SL     T   A   +        RT  
Sbjct  19    LQLVQMLSLLVIFVAGIIIGIATSPHINRYFDSLAQLTFTNNIASPKISDDNCTILRTCE  78

Query  276   PVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLA  455
              V  + ++ F+ P +N  H M+D+E+LWRASM+P  K YPF RVPKVAFMFLTRG + L 
Sbjct  79    KVDCLTMEGFVHP-DNLTHSMTDDEVLWRASMLPYKKGYPFDRVPKVAFMFLTRGPLPLL  137

Query  456   PLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrlla  635
             PLWE FF+G+ G++SIYVH+      +    S F+GR+IPS++V+WG ++M++AE+RLLA
Sbjct  138   PLWERFFRGHAGYFSIYVHTPEDYELNVSTDSPFYGRKIPSKDVEWGSISMVDAEKRLLA  197

Query  636   nallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPV  815
             NALLDFSN+RFVLLSESCIP++ F  +Y YL+ S  +F+E YD P    RGRY  +M P 
Sbjct  198   NALLDFSNERFVLLSESCIPIYKFSIVYKYLIRSKHSFVESYDAPTRYARGRYNQKMLPD  257

Query  816   IKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGN  995
             I L QWRKGSQWFE+ RDLA+ ++SD +Y ++F+ YC+ +CY DEHY+PT++N+  G  N
Sbjct  258   IHLYQWRKGSQWFEIQRDLAVYLVSDTKYHTIFKKYCRPACYPDEHYIPTYLNMFHGSLN  317

Query  996   SNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRT-GDKCEYNGEETNVCYLFARKFSLH  1172
             +NR++TWVDWS    HP  Y   DVT  F++++R  G++C YN E T+VCYLFARKF+  
Sbjct  318   ANRTVTWVDWSIVAPHPPTYDGIDVTEGFIQSIRNKGNQCSYNSEMTSVCYLFARKFAPS  377

Query  1173  SLTRLLRFAPKLMRF  1217
             +L  LL     +M F
Sbjct  378   ALVPLLNLTSTVMGF  392



>ref|XP_010049161.1| PREDICTED: uncharacterized protein LOC104437817 [Eucalyptus grandis]
 gb|KCW81640.1| hypothetical protein EUGRSUZ_C03002 [Eucalyptus grandis]
Length=385

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 226/311 (73%), Gaps = 0/311 (0%)
 Frame = +3

Query  285   AVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLW  464
             A  L  +++PP + +H+MSD+EL WRA++VPKIK+YPF RVPK+AFMFLT+G + LAPLW
Sbjct  75    ANSLDRWIQPPSDLLHNMSDKELFWRATLVPKIKKYPFRRVPKIAFMFLTKGPLPLAPLW  134

Query  465   EMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanal  644
             E FF+G+EG YSIY+HS PS +      SVF+ R+IPSQ  +WG ++M +AE+RLLANAL
Sbjct  135   ERFFKGHEGLYSIYIHSHPSFHAHFHPWSVFNRRQIPSQVSEWGRMSMCDAEKRLLANAL  194

Query  645   lDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKL  824
             LD SN+RF+LLSESCIPL+NF  IY Y+M S  +F+  +D PG  GRGRY   M+P + +
Sbjct  195   LDISNERFILLSESCIPLYNFSLIYHYIMKSGYSFMGAFDDPGPYGRGRYNLNMAPEVNI  254

Query  825   RQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNR  1004
              QWRKGSQWFE++R LAI ++ D  Y   F+ +C+ +CY DEHY PT + I+ G   +NR
Sbjct  255   SQWRKGSQWFEINRKLAINIVEDATYHPKFETFCRPACYVDEHYFPTMLTIQAGHLLANR  314

Query  1005  SLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTR  1184
             S+TWVDWS GG+HPA + R D+T  FL  +    +C YN   ++ C+LFARKF+  +L  
Sbjct  315   SITWVDWSRGGAHPATFGRSDITEEFLRRISKNQRCTYNKRNSSTCFLFARKFAPSALHP  374

Query  1185  LLRFAPKLMRF  1217
             LL  APK++ +
Sbjct  375   LLELAPKVLGY  385



>ref|XP_010536211.1| PREDICTED: uncharacterized protein LOC104811254 [Tarenaya hassleriana]
Length=387

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 219/309 (71%), Gaps = 0/309 (0%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
             GL++++KPP + MH MSD ELLWRAS VP+ KEYPF RVPK+AFMFLT+G + LAPLWE 
Sbjct  79    GLEKWIKPPSDLMHKMSDGELLWRASFVPRRKEYPFRRVPKIAFMFLTKGPLPLAPLWER  138

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             F +G EG YS+Y+HS PS     P  SVF+ R+IPSQ  +WG + M +AERRLLANALLD
Sbjct  139   FLKGQEGLYSVYIHSHPSFTAKFPPSSVFYRRQIPSQVAEWGRMTMCDAERRLLANALLD  198

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+ FVLLSE+CIPLFNF TIY Y+  S  +FI  +D  G  GRGRY   M+P + + Q
Sbjct  199   ISNEWFVLLSETCIPLFNFTTIYRYISKSKQSFIGAFDDHGPYGRGRYNDNMAPEVGITQ  258

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGSQWFE++R+LA  ++ D  Y+  F+ +C+ +CY DEHY PT + I      +NRS+
Sbjct  259   WRKGSQWFEINRELAATIVKDTVYYPKFRDFCRPACYVDEHYFPTMLTIEKPSLLANRSV  318

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLL  1190
             TWVDWS GG+HPA + R D+   F   +  G  C YNG  T++CY+FARKF+  SL  LL
Sbjct  319   TWVDWSRGGAHPATFGRADIKEEFFRRIYGGHNCTYNGRNTSMCYVFARKFAPSSLEPLL  378

Query  1191  RFAPKLMRF  1217
               APK++ F
Sbjct  379   HIAPKILGF  387



>ref|XP_009148352.1| PREDICTED: uncharacterized protein LOC103871798 [Brassica rapa]
Length=414

 Score =   348 bits (892),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 188/397 (47%), Positives = 253/397 (64%), Gaps = 28/397 (7%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSS----YFKSFSLN-----------LQLI--------  218
             L L   LS  L F  G+  GL  SS    YF S               LQ +        
Sbjct  19    LKLAQTLSFLLIFMAGIIIGLAASSHIDRYFNSLPTTAFSSSSPSSAALQTVPDYSNCTV  78

Query  219   ---TAAAADqplllpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIKE  389
                  A  +          +R       ++ F++P  N  H MSD+EL WRASMVP  +E
Sbjct  79    VHRDCAGGEDENHDDDAAEKRRDRECWSVEGFVRP-GNLSHGMSDDELFWRASMVPVKEE  137

Query  390   YPFSRVPKVAFMFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRR  569
             YP+ R PKVAFMFLTRG + + PLWE FF+GNE + S+YVH+ P  + +   GS F+ R+
Sbjct  138   YPYERAPKVAFMFLTRGPLPMLPLWEKFFRGNEKYLSVYVHTPPGYDMNVSSGSAFYDRQ  197

Query  570   IPSQEVKWGDVNMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNF  749
             IPSQ+V+WG   + +AE+RLLANALLDFSN+RF+LLSESC+P++NF T+YSYL+NS  +F
Sbjct  198   IPSQKVEWGSPLLTDAEKRLLANALLDFSNERFILLSESCVPVYNFSTVYSYLINSAYSF  257

Query  750   IEVYDLPGSTGRGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCK  929
             ++ YD P   GRGRY  +M P IKL  WRKGSQWFE++R LAI +ISD +Y+SLF+ +C+
Sbjct  258   VDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKLAIYIISDSKYYSLFKQFCR  317

Query  930   GSCYADEHYLPTFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLRTGD-  1106
              +CY DEHY+PTF+N+  G  N+NRS+TWVDWS GG HPA Y   ++T  FL+++R  + 
Sbjct  318   PACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNITEGFLQSIRKNET  377

Query  1107  KCEYNGEETNVCYLFARKFSLHSLTRLLRFAPKLMRF  1217
              C YN E T++C+LFARKF+  +L  L+  +  +M F
Sbjct  378   DCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  414



>ref|XP_007012231.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY29850.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=392

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 225/309 (73%), Gaps = 0/309 (0%)
 Frame = +3

Query  291   GLQEFLKPPENAMHDMSDEELLWRASMVPKIKEYPFSRVPKVAFMFLTRGAVTLAPLWEM  470
              L  ++KPP N +H M+D+ELLWRAS VP+IK+YPF+R+PK+AFMFLT+G + L+PLWE 
Sbjct  80    SLNRWIKPPSNLLHTMNDKELLWRASFVPRIKKYPFNRLPKIAFMFLTKGPLPLSPLWER  139

Query  471   FFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDVNMIeaerrllanallD  650
             F +G+EG YSIY+HS PS N   P  SVF+GR+IPSQ  +WG ++M +AERRLLANALLD
Sbjct  140   FLKGHEGLYSIYIHSLPSYNAEFPPSSVFYGRQIPSQVSEWGRMSMCDAERRLLANALLD  199

Query  651   FSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTGRGRYKHRMSPVIKLRQ  830
              SN+ F+LLSESCIPL+NF  IY Y+  S  +FI  +D PG  GRGRY   M+P + + Q
Sbjct  200   ISNEWFILLSESCIPLYNFSVIYHYIKKSKYSFIGAFDDPGPYGRGRYNENMAPEVNITQ  259

Query  831   WRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLPTFVNIRFGRGNSNRSL  1010
             WRKGSQWFE++R LA+ ++ D  Y+  F+ +C+ +CY DEHY PT + I+     +NRS+
Sbjct  260   WRKGSQWFEINRRLALNIVEDSTYYPKFEQFCRPACYVDEHYFPTMLTIQASNLIANRSI  319

Query  1011  TWVDWSHGGSHPARYLRHDVTVSFLETLRTGDKCEYNGEETNVCYLFARKFSLHSLTRLL  1190
             TWVDWS GG+HPA + R D+T    + +    +C YN + + VC+LFARKF+  +L  LL
Sbjct  320   TWVDWSRGGAHPATFGRADITEELFKRIFEDHQCRYNDQPSLVCFLFARKFAPSALEPLL  379

Query  1191  RFAPKLMRF  1217
             + APK++ F
Sbjct  380   QIAPKILGF  388



>ref|XP_004163997.1| PREDICTED: uncharacterized LOC101215808 [Cucumis sativus]
 gb|KGN56275.1| hypothetical protein Csa_3G110720 [Cucumis sativus]
Length=394

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 254/386 (66%), Gaps = 25/386 (6%)
 Frame = +3

Query  108   LNLINLLSAFLFFACGLTCGLIFSS----YFKS----------FSLNLQLITAAAADqpl  245
             L L+ +LS  + F  G+  GL  +S    YF S          FS+    +     D  +
Sbjct  18    LKLMQILSFLVVFVAGVVIGLATTSHVSRYFTSQTELYSFINHFSVPTTHVEENCTDSNI  77

Query  246   llpppqpERTPVAAVGLQEFLKPPENAMHDMSDEELLWRASMVPKIK-EYPFSRVPKVAF  422
                    ER   ++     F+ P +N  H MSD+EL WRASMV K + +YPF RVPKVAF
Sbjct  78    C------ERRDCSS--FHTFIHP-DNLTHAMSDDELFWRASMVSKRENDYPFERVPKVAF  128

Query  423   MFLTRGAVTLAPLWEMFFQGNEGFYSIYVHSDPSCNESAPEGSVFHGRRIPSQEVKWGDV  602
             MFLTRG + + PLWE FF G+E  +SIYVH+ P    +    SVF+ R+IPSQ V WG V
Sbjct  129   MFLTRGPLPMLPLWERFFAGHEKLFSIYVHALPGYKLNVSTSSVFYRRQIPSQRVSWGTV  188

Query  603   NMIeaerrllanallDFSNQRFVLLSESCIPLFNFPTIYSYLMNSTTNFIEVYDLPGSTG  782
             ++ +AERRLLANALLDFSN RFVLLSESCIP++NF T+Y YL+NS  +F+E YD P   G
Sbjct  189   SLADAERRLLANALLDFSNDRFVLLSESCIPVYNFQTVYEYLINSAHSFVESYDEPTRYG  248

Query  783   RGRYKHRMSPVIKLRQWRKGSQWFEMDRDLAIEVISDDRYFSLFQYYCKGSCYADEHYLP  962
             RGRY  +M P IKL+ WRKGSQWFE+ R LA+ +++D +Y++LF+ +CK +CY DEHY+P
Sbjct  249   RGRYSRQMLPDIKLQHWRKGSQWFELSRALAVYIVADIKYYTLFKKFCKPACYPDEHYIP  308

Query  963   TFVNIRFGRGNSNRSLTWVDWSHGGSHPARYLRHDVTVSFLETLR-TGDKCEYNGEETNV  1139
             T++N+  G  NSNR++TWVDWS GG HPA Y   ++T SF+E++R  G +C YN E T V
Sbjct  309   TYLNMFHGSLNSNRTVTWVDWSMGGPHPAMYGPANITESFIESIRNNGTECLYNSEITYV  368

Query  1140  CYLFARKFSLHSLTRLLRFAPKLMRF  1217
             CYLFARKF+  +L  LL     +M+F
Sbjct  369   CYLFARKFAPSTLEPLLNLTSSVMKF  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3875747767884