BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6610_g1_i1 len=1179 path=[1157:0-1178]

Length=1179
                                                                      Score     E

ref|XP_009795133.1|  PREDICTED: probable xyloglucan endotransgluc...    469   1e-161   
emb|CDP00178.1|  unnamed protein product                                464   1e-159   
ref|XP_004238674.1|  PREDICTED: probable xyloglucan endotransgluc...    463   2e-159   
ref|XP_009623898.1|  PREDICTED: probable xyloglucan endotransgluc...    461   2e-158   
ref|XP_009804330.1|  PREDICTED: probable xyloglucan endotransgluc...    461   2e-158   
ref|XP_006355979.1|  PREDICTED: probable xyloglucan endotransgluc...    457   3e-157   
ref|XP_011086549.1|  PREDICTED: probable xyloglucan endotransgluc...    456   2e-156   
gb|ABA54988.1|  xyloglucan endotransglycosylase hydrolase               448   2e-153   Apium graveolens
gb|EYU22485.1|  hypothetical protein MIMGU_mgv1a023829mg                441   3e-151   
ref|XP_011071081.1|  PREDICTED: probable xyloglucan endotransgluc...    442   5e-151   
ref|XP_002263411.1|  PREDICTED: probable xyloglucan endotransgluc...    403   6e-136   Vitis vinifera
ref|XP_007019688.1|  Xyloglucan:xyloglucosyl transferase 33             400   7e-135   
ref|XP_006438421.1|  hypothetical protein CICLE_v10032164mg             400   1e-134   
ref|XP_010100482.1|  putative xyloglucan endotransglucosylase/hyd...    395   1e-132   
ref|XP_007223169.1|  hypothetical protein PRUPE_ppa009090mg             394   3e-132   
gb|KHN10598.1|  Putative xyloglucan endotransglucosylase/hydrolas...    393   6e-132   
ref|XP_008221789.1|  PREDICTED: probable xyloglucan endotransgluc...    392   9e-132   
ref|XP_010271956.1|  PREDICTED: probable xyloglucan endotransgluc...    392   1e-131   
ref|XP_010044645.1|  PREDICTED: probable xyloglucan endotransgluc...    392   2e-131   
gb|KDP26566.1|  hypothetical protein JCGZ_17724                         389   2e-130   
gb|AFK40151.1|  unknown                                                 386   3e-129   
gb|KFK43349.1|  hypothetical protein AALP_AA1G114300                    386   4e-129   
gb|KEH19982.1|  xyloglucan endotransglucosylase/hydrolase family ...    385   6e-129   
ref|XP_007153638.1|  hypothetical protein PHAVU_003G052400g             385   7e-129   
ref|XP_002892577.1|  hypothetical protein ARALYDRAFT_471170             384   2e-128   
ref|XP_004297640.1|  PREDICTED: probable xyloglucan endotransgluc...    384   2e-128   
emb|CCH26639.1|  putative xyloglucan endotransglucosylase/hydrolase     383   3e-128   
ref|XP_006417453.1|  hypothetical protein EUTSA_v10008234mg             384   4e-128   
ref|XP_004170208.1|  PREDICTED: probable xyloglucan endotransgluc...    383   5e-128   
ref|XP_004135238.1|  PREDICTED: probable xyloglucan endotransgluc...    383   5e-128   
ref|XP_010544004.1|  PREDICTED: probable xyloglucan endotransgluc...    382   1e-127   
ref|NP_172525.1|  probable xyloglucan endotransglucosylase/hydrol...    382   2e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AFK37086.1|  unknown                                                 382   2e-127   
gb|AAM63851.1|  putative endoxyloglucan transferase                     381   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040569.1|  PREDICTED: probable xyloglucan endotransgluc...    381   2e-127   
emb|CDY20620.1|  BnaC08g14380D                                          381   4e-127   
ref|XP_009144434.1|  PREDICTED: probable xyloglucan endotransgluc...    380   6e-127   
gb|KHN39740.1|  Putative xyloglucan endotransglucosylase/hydrolas...    380   6e-127   
ref|XP_002320268.2|  xyloglucan endotransglucosylase/hydrolase pr...    380   8e-127   Populus trichocarpa [western balsam poplar]
ref|XP_003552017.2|  PREDICTED: probable xyloglucan endotransgluc...    380   1e-126   
gb|AFR46574.1|  xyloglucan endotransglucosylase/hydrolase 5             379   1e-126   
ref|XP_004509833.1|  PREDICTED: probable xyloglucan endotransgluc...    379   1e-126   
gb|ABM91064.1|  xyloglucan endotransglycosylase/hydrolase precurs...    379   2e-126   Populus tremula x Populus tremuloides
emb|CDY20956.1|  BnaA08g25690D                                          379   4e-126   
ref|XP_008340024.1|  PREDICTED: probable xyloglucan endotransgluc...    378   5e-126   
ref|XP_010491392.1|  PREDICTED: probable xyloglucan endotransgluc...    377   2e-125   
ref|XP_010475924.1|  PREDICTED: probable xyloglucan endotransgluc...    376   3e-125   
ref|XP_010458404.1|  PREDICTED: probable xyloglucan endotransgluc...    374   3e-124   
gb|KHG29510.1|  putative xyloglucan endotransglucosylase/hydrolas...    373   5e-124   
ref|XP_008446221.1|  PREDICTED: probable xyloglucan endotransgluc...    373   6e-124   
emb|CDY20621.1|  BnaC08g14370D                                          372   8e-124   
ref|XP_010682574.1|  PREDICTED: probable xyloglucan endotransgluc...    373   9e-124   
ref|XP_010913577.1|  PREDICTED: probable xyloglucan endotransgluc...    369   1e-122   
ref|XP_006305398.1|  hypothetical protein CARUB_v10009787mg             369   2e-122   
ref|XP_009391747.1|  PREDICTED: probable xyloglucan endotransgluc...    353   3e-116   
ref|XP_006364060.1|  PREDICTED: probable xyloglucan endotransgluc...    280   1e-87    
gb|ABK23681.1|  unknown                                                 281   2e-87    Picea sitchensis
ref|XP_010553506.1|  PREDICTED: probable xyloglucan endotransgluc...    278   1e-86    
gb|ABK24235.1|  unknown                                                 278   1e-86    Picea sitchensis
ref|XP_002875095.1|  endoxyloglucan transferase                         277   2e-86    
ref|XP_010527818.1|  PREDICTED: probable xyloglucan endotransgluc...    277   2e-86    
ref|XP_010496847.1|  PREDICTED: probable xyloglucan endotransgluc...    277   2e-86    
ref|XP_010554388.1|  PREDICTED: probable xyloglucan endotransgluc...    277   3e-86    
ref|XP_002892825.1|  hypothetical protein ARALYDRAFT_471659             276   4e-86    
ref|XP_004228752.1|  PREDICTED: probable xyloglucan endotransgluc...    276   7e-86    
ref|XP_009390870.1|  PREDICTED: probable xyloglucan endotransgluc...    276   7e-86    
ref|XP_006291465.1|  hypothetical protein CARUB_v10017602mg             275   1e-85    
ref|XP_009763784.1|  PREDICTED: probable xyloglucan endotransgluc...    275   1e-85    
ref|XP_008466948.1|  PREDICTED: probable xyloglucan endotransgluc...    275   2e-85    
ref|XP_004162296.1|  PREDICTED: probable xyloglucan endotransgluc...    275   2e-85    
gb|ACD03223.1|  xyloglucan endotransglucosylase/hydrolase 13            275   2e-85    Actinidia deliciosa [Chinese gooseberry]
ref|XP_009621666.1|  PREDICTED: probable xyloglucan endotransgluc...    275   2e-85    
ref|XP_010424960.1|  PREDICTED: probable xyloglucan endotransgluc...    274   3e-85    
ref|XP_011070536.1|  PREDICTED: probable xyloglucan endotransgluc...    274   5e-85    
ref|XP_007222502.1|  hypothetical protein PRUPE_ppa008275mg             274   5e-85    
emb|CDP20286.1|  unnamed protein product                                273   6e-85    
ref|XP_010513916.1|  PREDICTED: probable xyloglucan endotransgluc...    273   8e-85    
ref|XP_004142816.1|  PREDICTED: probable xyloglucan endotransgluc...    273   1e-84    
emb|CDP05491.1|  unnamed protein product                                274   1e-84    
ref|XP_004297402.1|  PREDICTED: probable xyloglucan endotransgluc...    273   1e-84    
ref|XP_010043929.1|  PREDICTED: probable xyloglucan endotransgluc...    273   1e-84    
ref|NP_178294.1|  endoxyloglucan transferase A3                         273   1e-84    Arabidopsis thaliana [mouse-ear cress]
gb|AAD45125.1|AF163821_1  endoxyloglucan transferase                    272   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285140.1|  PREDICTED: probable xyloglucan endotransgluc...    272   2e-84    Vitis vinifera
gb|AAM63050.1|  putative xyloglucan-specific glucanase                  272   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220940.1|  PREDICTED: probable xyloglucan endotransgluc...    272   2e-84    
gb|EYU45258.1|  hypothetical protein MIMGU_mgv1a008549mg                273   3e-84    
ref|NP_172925.1|  probable xyloglucan endotransglucosylase/hydrol...    272   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414788.1|  PREDICTED: probable xyloglucan endotransgluc...    272   3e-84    
gb|ADE42489.1|  xyloglucan endotransglucosylase/hydrolase 2             271   3e-84    
ref|XP_008389143.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    271   5e-84    
gb|KFK33417.1|  hypothetical protein AALP_AA5G010000                    271   7e-84    
gb|KFK43745.1|  hypothetical protein AALP_AA1G167300                    270   7e-84    
gb|ADE42491.1|  xyloglucan endotransglucosylase/hydrolase 2             268   7e-84    
emb|CDX81665.1|  BnaC08g39360D                                          270   7e-84    
gb|AAK30204.1|AF349963_1  endoxyloglucan transferase                    270   9e-84    Daucus carota [carrots]
ref|XP_007045473.1|  Xyloglucan endotransglucosylase/hydrolase 28       270   1e-83    
emb|CDY33745.1|  BnaA09g45510D                                          270   1e-83    
ref|XP_010261561.1|  PREDICTED: probable xyloglucan endotransgluc...    270   1e-83    
ref|XP_010476541.1|  PREDICTED: probable xyloglucan endotransgluc...    270   2e-83    
ref|XP_011070344.1|  PREDICTED: probable xyloglucan endotransgluc...    270   2e-83    
emb|CAN74084.1|  hypothetical protein VITISV_018042                     270   2e-83    Vitis vinifera
ref|XP_009390348.1|  PREDICTED: probable xyloglucan endotransgluc...    270   2e-83    
ref|XP_008454733.1|  PREDICTED: probable xyloglucan endotransgluc...    270   2e-83    
ref|XP_009117879.1|  PREDICTED: probable xyloglucan endotransgluc...    269   3e-83    
ref|XP_008652681.1|  PREDICTED: probable xyloglucan endotransgluc...    269   4e-83    
ref|XP_004142294.1|  PREDICTED: probable xyloglucan endotransgluc...    268   5e-83    
ref|XP_010066550.1|  PREDICTED: probable xyloglucan endotransgluc...    269   5e-83    
ref|XP_008365814.1|  PREDICTED: probable xyloglucan endotransgluc...    268   5e-83    
gb|KDP38168.1|  hypothetical protein JCGZ_04811                         268   5e-83    
ref|XP_004156140.1|  PREDICTED: probable xyloglucan endotransgluc...    268   5e-83    
ref|XP_010677382.1|  PREDICTED: probable xyloglucan endotransgluc...    269   6e-83    
ref|XP_003555818.1|  PREDICTED: probable xyloglucan endotransgluc...    269   6e-83    
ref|XP_006305074.1|  hypothetical protein CARUB_v10009442mg             270   9e-83    
ref|XP_008466018.1|  PREDICTED: probable xyloglucan endotransgluc...    268   2e-82    
ref|XP_010496455.1|  PREDICTED: probable xyloglucan endotransgluc...    267   2e-82    
ref|XP_006416979.1|  hypothetical protein EUTSA_v10008160mg             267   2e-82    
ref|XP_002315842.1|  xyloglucan endotransglycosylase family protein     267   2e-82    Populus trichocarpa [western balsam poplar]
ref|XP_010458984.1|  PREDICTED: probable xyloglucan endotransgluc...    267   2e-82    
ref|XP_010055251.1|  PREDICTED: probable xyloglucan endotransgluc...    268   2e-82    
gb|KHN25480.1|  Putative xyloglucan endotransglucosylase/hydrolas...    267   2e-82    
ref|XP_004504585.1|  PREDICTED: probable xyloglucan endotransgluc...    267   2e-82    
ref|XP_003529235.1|  PREDICTED: probable xyloglucan endotransgluc...    267   3e-82    
gb|AGZ15408.1|  xyloglucan endotransglucosylase/hydrolase protein 28    266   3e-82    
gb|AGV54504.1|  xyloglucan endotransglucosylase/hydrolase protein...    266   3e-82    
ref|XP_009351584.1|  PREDICTED: probable xyloglucan endotransgluc...    266   4e-82    
ref|XP_006849428.1|  hypothetical protein AMTR_s00024p00025540          266   4e-82    
gb|KDO60844.1|  hypothetical protein CISIN_1g019909mg                   266   5e-82    
ref|XP_007153190.1|  hypothetical protein PHAVU_003G014400g             266   5e-82    
ref|XP_004297401.1|  PREDICTED: probable xyloglucan endotransgluc...    266   5e-82    
ref|XP_006395846.1|  hypothetical protein EUTSA_v10004560mg             266   6e-82    
emb|CDY03100.1|  BnaC07g21270D                                          266   6e-82    
emb|CDY17630.1|  BnaA06g34490D                                          266   6e-82    
ref|XP_011018473.1|  PREDICTED: probable xyloglucan endotransgluc...    266   6e-82    
gb|ABM91072.1|  xyloglucan endotransglycosylase/hydrolase precurs...    266   7e-82    Populus tremula [European aspen]
ref|XP_003524850.1|  PREDICTED: probable xyloglucan endotransgluc...    266   8e-82    
ref|XP_004163204.1|  PREDICTED: probable xyloglucan endotransgluc...    266   9e-82    
gb|KHN25980.1|  Putative xyloglucan endotransglucosylase/hydrolas...    265   9e-82    
ref|XP_010911228.1|  PREDICTED: probable xyloglucan endotransgluc...    265   1e-81    
ref|XP_009129188.1|  PREDICTED: probable xyloglucan endotransgluc...    265   1e-81    
ref|XP_010276803.1|  PREDICTED: probable xyloglucan endotransgluc...    265   1e-81    
ref|XP_008798384.1|  PREDICTED: probable xyloglucan endotransgluc...    265   1e-81    
ref|XP_009101303.1|  PREDICTED: probable xyloglucan endotransgluc...    265   1e-81    
ref|XP_010105548.1|  putative xyloglucan endotransglucosylase/hyd...    265   2e-81    
ref|XP_009390346.1|  PREDICTED: probable xyloglucan endotransgluc...    265   2e-81    
gb|KHN28876.1|  Putative xyloglucan endotransglucosylase/hydrolas...    265   2e-81    
ref|XP_003576504.1|  PREDICTED: probable xyloglucan endotransgluc...    265   2e-81    
ref|XP_004136205.1|  PREDICTED: probable xyloglucan endotransgluc...    265   2e-81    
ref|XP_010906322.1|  PREDICTED: probable xyloglucan endotransgluc...    264   2e-81    
ref|XP_003531138.1|  PREDICTED: probable xyloglucan endotransgluc...    265   3e-81    
emb|CDY70985.1|  BnaAnng35740D                                          264   3e-81    
ref|XP_006469297.1|  PREDICTED: probable xyloglucan endotransgluc...    264   3e-81    
ref|XP_010053644.1|  PREDICTED: probable xyloglucan endotransgluc...    265   3e-81    
ref|XP_009380067.1|  PREDICTED: probable xyloglucan endotransgluc...    264   3e-81    
ref|XP_004236920.1|  PREDICTED: probable xyloglucan endotransgluc...    264   3e-81    
ref|XP_011021731.1|  PREDICTED: probable xyloglucan endotransgluc...    264   4e-81    
gb|KDP30712.1|  hypothetical protein JCGZ_15540                         263   5e-81    
ref|XP_002311545.1|  xyloglucan endotransglycosylase family protein     263   6e-81    Populus trichocarpa [western balsam poplar]
gb|ABK92940.1|  unknown                                                 263   7e-81    Populus trichocarpa [western balsam poplar]
dbj|BAK04928.1|  predicted protein                                      263   8e-81    
ref|XP_009621345.1|  PREDICTED: probable xyloglucan endotransgluc...    263   9e-81    
ref|XP_011081425.1|  PREDICTED: probable xyloglucan endotransgluc...    263   9e-81    
gb|AFR46578.1|  xyloglucan endotransglucosylase/hydrolase 9             261   9e-81    
ref|XP_006448095.1|  hypothetical protein CICLE_v10015872mg             263   1e-80    
ref|XP_002304356.2|  hypothetical protein POPTR_0003s09590g             263   1e-80    Populus trichocarpa [western balsam poplar]
ref|XP_011024575.1|  PREDICTED: probable xyloglucan endotransgluc...    263   1e-80    
ref|XP_002462345.1|  hypothetical protein SORBIDRAFT_02g024120          263   1e-80    Sorghum bicolor [broomcorn]
gb|ABM91070.1|  xyloglucan endotransglycosylase/hydrolase precurs...    263   1e-80    Populus tremula x Populus tremuloides
ref|XP_006368348.1|  xyloglucan endotransglycosylase 2 family pro...    263   1e-80    
ref|XP_007158788.1|  hypothetical protein PHAVU_002G182000g             262   1e-80    
ref|XP_009777519.1|  PREDICTED: probable xyloglucan endotransgluc...    262   2e-80    
ref|XP_010271176.1|  PREDICTED: probable xyloglucan endotransgluc...    262   2e-80    
ref|XP_007040721.1|  Xyloglucan endotransglucosylase/hydrolase pr...    262   2e-80    
dbj|BAK07675.1|  predicted protein                                      261   3e-80    
ref|XP_011093429.1|  PREDICTED: probable xyloglucan endotransgluc...    262   3e-80    
ref|XP_010674965.1|  PREDICTED: probable xyloglucan endotransgluc...    261   4e-80    
ref|XP_003638758.1|  Xyloglucan endotransglycosylase/hydrolase          261   4e-80    
ref|XP_002518990.1|  Xyloglucan endotransglucosylase/hydrolase pr...    261   5e-80    Ricinus communis
emb|CDP11680.1|  unnamed protein product                                261   7e-80    
ref|XP_008341063.1|  PREDICTED: probable xyloglucan endotransgluc...    261   8e-80    
ref|XP_002527547.1|  Xyloglucan endotransglucosylase/hydrolase pr...    260   1e-79    Ricinus communis
ref|XP_009413224.1|  PREDICTED: probable xyloglucan endotransgluc...    260   1e-79    
ref|XP_009804856.1|  PREDICTED: probable xyloglucan endotransgluc...    261   1e-79    
ref|XP_006355045.1|  PREDICTED: probable xyloglucan endotransgluc...    259   1e-79    
gb|ACU19067.1|  unknown                                                 259   2e-79    Glycine max [soybeans]
dbj|BAA88668.1|  ETAG-A3                                                259   2e-79    Solanum lycopersicum
ref|XP_009107996.1|  PREDICTED: probable xyloglucan endotransgluc...    259   3e-79    
gb|KHG00933.1|  putative xyloglucan endotransglucosylase/hydrolas...    259   3e-79    
ref|XP_004513237.1|  PREDICTED: probable xyloglucan endotransgluc...    259   3e-79    
ref|XP_010478638.1|  PREDICTED: probable xyloglucan endotransgluc...    259   3e-79    
ref|NP_001049503.1|  Os03g0239000                                       259   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004514368.1|  PREDICTED: probable xyloglucan endotransgluc...    258   5e-79    
gb|KEH40692.1|  xyloglucan endotransglucosylase/hydrolase family ...    258   5e-79    
ref|XP_009409244.1|  PREDICTED: probable xyloglucan endotransgluc...    258   5e-79    
ref|XP_009405165.1|  PREDICTED: probable xyloglucan endotransgluc...    258   6e-79    
ref|XP_006303176.1|  hypothetical protein CARUB_v10009628mg             258   6e-79    
emb|CDY60254.1|  BnaCnng35910D                                          258   6e-79    
ref|XP_010499761.1|  PREDICTED: probable xyloglucan endotransgluc...    258   7e-79    
gb|EAY89191.1|  hypothetical protein OsI_10687                          258   9e-79    Oryza sativa Indica Group [Indian rice]
gb|EPS64838.1|  xyloglucan endotransglucosylase/hydrolase 14            257   1e-78    
ref|XP_006415244.1|  hypothetical protein EUTSA_v10008109mg             257   1e-78    
ref|XP_009344136.1|  PREDICTED: probable xyloglucan endotransgluc...    258   2e-78    
gb|AIL30514.1|  xyloglucan endotransglucosylase-hydrolase XTH5          256   3e-78    
ref|XP_008795338.1|  PREDICTED: probable xyloglucan endotransgluc...    256   4e-78    
ref|XP_009764906.1|  PREDICTED: probable xyloglucan endotransgluc...    256   5e-78    
ref|NP_001234470.1|  xyloglucan endotransglucosylase-hydrolase XT...    256   5e-78    
ref|XP_008373536.1|  PREDICTED: probable xyloglucan endotransgluc...    256   6e-78    
ref|XP_007158243.1|  hypothetical protein PHAVU_002G136200g             256   6e-78    
dbj|BAO02542.1|  endo-(1,4)-beta-D-glucanase ortholog                   255   7e-78    
ref|XP_006354588.1|  PREDICTED: probable xyloglucan endotransgluc...    256   7e-78    
ref|XP_010933426.1|  PREDICTED: probable xyloglucan endotransgluc...    255   1e-77    
gb|EAZ09009.1|  hypothetical protein OsI_31270                          254   1e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_009348482.1|  PREDICTED: probable xyloglucan endotransgluc...    255   1e-77    
ref|XP_009607215.1|  PREDICTED: probable xyloglucan endotransgluc...    255   2e-77    
gb|ACD03224.1|  xyloglucan endotransglucosylase/hydrolase 14            254   2e-77    Actinidia deliciosa [Chinese gooseberry]
ref|XP_004985060.1|  PREDICTED: probable xyloglucan endotransgluc...    254   2e-77    
ref|XP_009608904.1|  PREDICTED: probable xyloglucan endotransgluc...    254   2e-77    
ref|XP_010919979.1|  PREDICTED: probable xyloglucan endotransgluc...    254   2e-77    
emb|CDY29941.1|  BnaC05g28950D                                          254   3e-77    
emb|CDY35550.1|  BnaA05g16360D                                          254   3e-77    
ref|XP_008800080.1|  PREDICTED: probable xyloglucan endotransgluc...    253   4e-77    
gb|KHN04842.1|  Putative xyloglucan endotransglucosylase/hydrolas...    253   5e-77    
ref|XP_003516952.1|  PREDICTED: probable xyloglucan endotransgluc...    253   5e-77    
ref|XP_002973138.1|  hypothetical protein SELMODRAFT_232041             251   6e-77    
ref|XP_009373460.1|  PREDICTED: probable xyloglucan endotransgluc...    254   6e-77    
ref|XP_007210518.1|  hypothetical protein PRUPE_ppa007685mg             254   6e-77    
gb|KFK44960.1|  hypothetical protein AALP_AA1G325900                    253   9e-77    
ref|XP_006651207.1|  PREDICTED: probable xyloglucan endotransgluc...    251   1e-76    
ref|XP_010663022.1|  PREDICTED: probable xyloglucan endotransgluc...    252   2e-76    
ref|XP_004956750.1|  PREDICTED: probable xyloglucan endotransgluc...    251   3e-76    
ref|XP_003612793.1|  Xyloglucan endotransglucosylase/hydrolase          251   3e-76    
ref|XP_006352933.1|  PREDICTED: probable xyloglucan endotransgluc...    253   3e-76    
gb|AAB18365.1|  xyloglucan endotransglycosylase-related protein         251   4e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890971.1|  hypothetical protein ARALYDRAFT_473398             251   4e-76    
ref|NP_174496.1|  probable xyloglucan endotransglucosylase/hydrol...    251   5e-76    Arabidopsis thaliana [mouse-ear cress]
gb|EYU43720.1|  hypothetical protein MIMGU_mgv1a0191281mg               248   6e-76    
ref|XP_010519083.1|  PREDICTED: probable xyloglucan endotransgluc...    249   8e-76    
ref|XP_002465580.1|  hypothetical protein SORBIDRAFT_01g041510          250   1e-75    Sorghum bicolor [broomcorn]
ref|XP_003561836.1|  PREDICTED: probable xyloglucan endotransgluc...    249   1e-75    
ref|XP_002973430.1|  hypothetical protein SELMODRAFT_56616              247   1e-75    
ref|XP_009417676.1|  PREDICTED: probable xyloglucan endotransgluc...    250   1e-75    
ref|XP_002976477.1|  hypothetical protein SELMODRAFT_56624              247   1e-75    
ref|XP_009384131.1|  PREDICTED: probable xyloglucan endotransgluc...    249   1e-75    
emb|CDX78912.1|  BnaA01g09790D                                          249   1e-75    
ref|XP_004245964.1|  PREDICTED: probable xyloglucan endotransgluc...    250   1e-75    
ref|XP_008238168.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    250   2e-75    
ref|XP_009401243.1|  PREDICTED: probable xyloglucan endotransgluc...    249   2e-75    
emb|CDX99402.1|  BnaC01g11500D                                          248   3e-75    
gb|AGT17403.1|  hypothetical protein SHCRBa_230_N09_R_40                248   3e-75    
gb|AAM67311.1|  endoxyloglucan transferase, putative                    248   4e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086421.1|  PREDICTED: probable xyloglucan endotransgluc...    249   4e-75    
ref|XP_009386254.1|  PREDICTED: probable xyloglucan endotransgluc...    248   5e-75    
emb|CDY09410.1|  BnaA02g26000D                                          247   9e-75    
ref|XP_009414090.1|  PREDICTED: probable xyloglucan endotransgluc...    247   1e-74    
gb|AFK40626.1|  unknown                                                 247   2e-74    
ref|XP_010088654.1|  putative xyloglucan endotransglucosylase/hyd...    247   2e-74    
gb|AFR46573.1|  xyloglucan endotransglucosylase/hydrolase 4             247   2e-74    
gb|EYU40279.1|  hypothetical protein MIMGU_mgv1a009338mg                246   2e-74    
gb|KDO60846.1|  hypothetical protein CISIN_1g019909mg                   245   2e-74    
gb|EAZ21594.1|  hypothetical protein OsJ_05221                          246   2e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004512469.1|  PREDICTED: probable xyloglucan endotransgluc...    246   2e-74    
gb|EPS65144.1|  hypothetical protein M569_09632                         249   3e-74    
gb|KDO60845.1|  hypothetical protein CISIN_1g019909mg                   246   3e-74    
ref|NP_001045764.1|  Os02g0127800                                       246   3e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539209.1|  PREDICTED: probable xyloglucan endotransgluc...    245   5e-74    
ref|XP_009132429.1|  PREDICTED: probable xyloglucan endotransgluc...    246   6e-74    
ref|XP_002529962.1|  Xyloglucan endotransglucosylase/hydrolase pr...    243   1e-73    Ricinus communis
ref|XP_004300192.1|  PREDICTED: probable xyloglucan endotransgluc...    244   2e-73    
ref|XP_004954728.1|  PREDICTED: probable xyloglucan endotransgluc...    244   2e-73    
ref|XP_009417372.1|  PREDICTED: probable xyloglucan endotransgluc...    246   3e-73    
emb|CDP09316.1|  unnamed protein product                                242   4e-73    
ref|NP_001242723.1|  uncharacterized protein LOC100800720 precursor     243   6e-73    
emb|CDY01577.1|  BnaC07g35670D                                          243   7e-73    
ref|XP_010434473.1|  PREDICTED: probable xyloglucan endotransgluc...    243   1e-72    
ref|XP_009136983.1|  PREDICTED: probable xyloglucan endotransgluc...    242   1e-72    
ref|XP_006854072.1|  hypothetical protein AMTR_s00048p00113910          240   1e-72    
gb|EAZ44637.1|  hypothetical protein OsJ_29257                          241   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010943419.1|  PREDICTED: probable xyloglucan endotransgluc...    242   1e-72    
ref|XP_006491484.1|  PREDICTED: probable xyloglucan endotransgluc...    240   2e-72    
ref|XP_008802555.1|  PREDICTED: probable xyloglucan endotransgluc...    241   2e-72    
gb|KDO86570.1|  hypothetical protein CISIN_1g036126mg                   239   2e-72    
dbj|BAJ92690.1|  predicted protein                                      241   3e-72    
emb|CAA16756.1|  xyloglucan endo-transglycosylase-like protein          241   4e-72    
ref|XP_002981828.1|  hypothetical protein SELMODRAFT_115266             236   4e-72    
ref|XP_010449431.1|  PREDICTED: probable xyloglucan endotransgluc...    241   4e-72    
ref|XP_002867966.1|  predicted protein                                  240   9e-72    
ref|XP_009397822.1|  PREDICTED: probable xyloglucan endotransgluc...    239   1e-71    
ref|XP_009399416.1|  PREDICTED: probable xyloglucan endotransgluc...    239   1e-71    
ref|XP_010439782.1|  PREDICTED: probable xyloglucan endotransgluc...    239   2e-71    
ref|XP_003570869.1|  PREDICTED: probable xyloglucan endotransgluc...    238   2e-71    
ref|XP_006661197.1|  PREDICTED: probable xyloglucan endotransgluc...    234   4e-71    
ref|XP_002982797.1|  hypothetical protein SELMODRAFT_117370             234   5e-71    
gb|ABK23544.1|  unknown                                                 236   5e-71    
ref|XP_006432690.1|  hypothetical protein CICLE_v10001649mg             238   6e-71    
ref|XP_006444767.1|  hypothetical protein CICLE_v10024263mg             235   6e-71    
ref|XP_009389336.1|  PREDICTED: probable xyloglucan endotransgluc...    237   1e-70    
ref|XP_006385680.1|  xyloglucan endotransglycosylase 2 family pro...    234   1e-70    
ref|XP_003572846.1|  PREDICTED: probable xyloglucan endotransgluc...    237   1e-70    
ref|NP_193634.1|  probable xyloglucan endotransglucosylase/hydrol...    237   1e-70    
gb|KDO57189.1|  hypothetical protein CISIN_1g018153mg                   237   2e-70    
ref|XP_006285076.1|  hypothetical protein CARUB_v10006389mg             237   2e-70    
gb|EAY87162.1|  hypothetical protein OsI_08563                          236   5e-70    
ref|NP_001146328.1|  uncharacterized protein LOC100279904 precursor     234   9e-70    
gb|AFW66656.1|  hypothetical protein ZEAMMB73_269375                    234   9e-70    
ref|XP_002451458.1|  hypothetical protein SORBIDRAFT_04g002290          235   1e-69    
ref|NP_001047814.1|  Os02g0696500                                       234   1e-69    
ref|NP_001051939.1|  Os03g0854600                                       234   2e-69    
ref|XP_006648953.1|  PREDICTED: probable xyloglucan endotransgluc...    231   2e-69    
gb|EAY92640.1|  hypothetical protein OsI_14384                          234   2e-69    
gb|EMT08504.1|  Putative xyloglucan endotransglucosylase/hydrolas...    233   2e-69    
gb|EPS58610.1|  xyloglucan endotransglucosylase/hydrolase 13            231   3e-69    
ref|XP_004983539.1|  PREDICTED: probable xyloglucan endotransgluc...    233   3e-69    
gb|EMT09688.1|  Putative xyloglucan endotransglucosylase/hydrolas...    232   5e-69    
dbj|BAJ95159.1|  predicted protein                                      232   6e-69    
gb|ACS13756.1|  xyloglucan xyloglucosyl transferase                     232   6e-69    
gb|KEH27691.1|  xyloglucan endotransglucosylase/hydrolase family ...    231   8e-69    
ref|XP_008658729.1|  PREDICTED: probable xyloglucan endotransgluc...    231   3e-68    
ref|XP_006662147.1|  PREDICTED: probable xyloglucan endotransgluc...    229   4e-68    
ref|NP_001048699.1|  Os03g0108300                                       228   8e-68    
ref|XP_009382126.1|  PREDICTED: probable xyloglucan endotransgluc...    228   1e-67    
ref|XP_009418633.1|  PREDICTED: probable xyloglucan endotransgluc...    228   1e-67    
ref|XP_010506905.1|  PREDICTED: probable xyloglucan endotransgluc...    229   1e-67    
ref|XP_001752695.1|  predicted protein                                  227   2e-67    
ref|XP_001765152.1|  predicted protein                                  225   2e-67    
ref|XP_011000931.1|  PREDICTED: probable xyloglucan endotransgluc...    226   5e-67    
ref|NP_001241497.1|  uncharacterized protein LOC100776165 precursor     226   6e-67    
ref|XP_003572123.1|  PREDICTED: probable xyloglucan endotransgluc...    227   7e-67    
ref|XP_007150148.1|  hypothetical protein PHAVU_005G130900g             226   8e-67    
ref|NP_001130874.1|  hypothetical protein precursor                     227   1e-66    
gb|ACN35866.1|  unknown                                                 226   1e-66    
ref|XP_002464870.1|  hypothetical protein SORBIDRAFT_01g027960          226   1e-66    
gb|AAN62784.1|  Putative cellulase                                      223   3e-66    
ref|XP_006650922.1|  PREDICTED: probable xyloglucan endotransgluc...    226   4e-66    
gb|EAY77529.1|  hypothetical protein OsI_32570                          224   4e-66    
gb|KHN21066.1|  Putative xyloglucan endotransglucosylase/hydrolas...    223   7e-66    
ref|XP_003539787.1|  PREDICTED: probable xyloglucan endotransgluc...    223   8e-66    
gb|AFW72906.1|  hypothetical protein ZEAMMB73_758929                    224   8e-66    
gb|ACF80442.1|  unknown                                                 224   8e-66    
ref|XP_006662567.1|  PREDICTED: probable xyloglucan endotransgluc...    223   1e-65    
gb|ABU93486.1|  xyloglucan endotraglucosylase/hydrolase                 223   1e-65    
ref|XP_009397821.1|  PREDICTED: probable xyloglucan endotransgluc...    224   1e-65    
ref|XP_004980998.1|  PREDICTED: probable xyloglucan endotransgluc...    224   1e-65    
ref|XP_004506064.1|  PREDICTED: probable xyloglucan endotransgluc...    222   1e-65    
ref|NP_001065491.1|  Os10g0577500                                       223   2e-65    
ref|XP_002454441.1|  hypothetical protein SORBIDRAFT_04g031050          223   2e-65    
gb|EAY79636.1|  hypothetical protein OsI_34780                          223   2e-65    
gb|AES88539.2|  xyloglucan endotransglucosylase/hydrolase family ...    222   2e-65    
dbj|BAJ85889.1|  predicted protein                                      223   3e-65    
gb|AAL34939.1|AC079037_12  Putative xyloglucan endo-transglycosylase    221   4e-65    
dbj|BAJ85343.1|  predicted protein                                      223   4e-65    
ref|XP_007205463.1|  hypothetical protein PRUPE_ppa007943mg             223   5e-65    
ref|XP_008226948.1|  PREDICTED: probable xyloglucan endotransgluc...    220   7e-65    
ref|XP_004953564.1|  PREDICTED: probable xyloglucan endotransgluc...    222   7e-65    
ref|NP_001148432.1|  xyloglucan endotransglucosylase/hydrolase pr...    221   8e-65    
ref|XP_007132324.1|  hypothetical protein PHAVU_011G085200g             220   8e-65    
tpg|DAA46166.1|  TPA: xyloglucan endotransglucosylase/hydrolase p...    221   8e-65    
ref|XP_006833493.1|  hypothetical protein AMTR_s00082p00180450          219   1e-64    
ref|XP_002266609.1|  PREDICTED: probable xyloglucan endotransgluc...    220   2e-64    
ref|XP_009394629.1|  PREDICTED: probable xyloglucan endotransgluc...    219   2e-64    
gb|EPS58974.1|  xyloglucan endotransglucosylase/hydrolase 14            218   3e-64    
gb|EPS62787.1|  hypothetical protein M569_12004                         218   3e-64    
ref|XP_010031407.1|  PREDICTED: probable xyloglucan endotransgluc...    219   4e-64    
ref|XP_009413141.1|  PREDICTED: probable xyloglucan endotransgluc...    218   4e-64    
ref|XP_002523709.1|  Xyloglucan endotransglucosylase/hydrolase pr...    218   5e-64    
ref|XP_004957690.1|  PREDICTED: probable xyloglucan endotransgluc...    218   7e-64    
gb|EMS64042.1|  putative xyloglucan endotransglucosylase/hydrolas...    216   8e-64    
ref|XP_003559116.1|  PREDICTED: probable xyloglucan endotransgluc...    219   8e-64    
gb|ABK30788.1|  xyloglucan endotransglycosylase 1                       218   9e-64    
ref|XP_007016865.1|  Xyloglucan endotransglucosylase/hydrolase pr...    219   1e-63    
ref|XP_008226469.1|  PREDICTED: probable xyloglucan endotransgluc...    217   2e-63    
gb|EMS66374.1|  putative xyloglucan endotransglucosylase/hydrolas...    219   2e-63    
ref|XP_009418263.1|  PREDICTED: probable xyloglucan endotransgluc...    216   2e-63    
ref|XP_009418099.1|  PREDICTED: probable xyloglucan endotransgluc...    216   2e-63    
ref|XP_009390370.1|  PREDICTED: probable xyloglucan endotransgluc...    217   2e-63    
ref|XP_010045311.1|  PREDICTED: probable xyloglucan endotransgluc...    216   3e-63    
ref|XP_002460690.1|  hypothetical protein SORBIDRAFT_02g033240          216   4e-63    
emb|CDP07041.1|  unnamed protein product                                215   5e-63    
ref|XP_008359637.1|  PREDICTED: probable xyloglucan endotransgluc...    215   8e-63    
ref|XP_002269285.1|  PREDICTED: probable xyloglucan endotransgluc...    215   8e-63    
gb|AFK34415.1|  unknown                                                 215   8e-63    
ref|XP_011089954.1|  PREDICTED: probable xyloglucan endotransgluc...    214   1e-62    
tpg|DAA46479.1|  TPA: hypothetical protein ZEAMMB73_030943              219   1e-62    
dbj|BAC45131.1|  putative xyloglucan endo-transglycosylase              215   1e-62    
ref|XP_009356929.1|  PREDICTED: probable xyloglucan endotransgluc...    214   1e-62    
gb|AGT17107.1|  xyloglucan endotransglucosylase/hydrolase protein       215   1e-62    
gb|KHN39069.1|  Putative xyloglucan endotransglucosylase/hydrolas...    214   1e-62    
gb|EYU36148.1|  hypothetical protein MIMGU_mgv1a011053mg                214   3e-62    
ref|XP_008799509.1|  PREDICTED: probable xyloglucan endotransgluc...    213   3e-62    
ref|NP_001065209.2|  Os10g0545500                                       214   4e-62    
ref|XP_009398020.1|  PREDICTED: probable xyloglucan endotransgluc...    213   4e-62    
gb|EAY79406.1|  hypothetical protein OsI_34534                          213   4e-62    
gb|EMT10260.1|  Putative xyloglucan endotransglucosylase/hydrolas...    215   4e-62    
ref|XP_010908974.1|  PREDICTED: probable xyloglucan endotransgluc...    213   4e-62    
ref|XP_004986046.1|  PREDICTED: probable xyloglucan endotransgluc...    213   4e-62    
ref|XP_009345745.1|  PREDICTED: probable xyloglucan endotransgluc...    213   6e-62    
tpg|DAA62696.1|  TPA: xyloglucan endotransglucosylase/hydrolase p...    213   6e-62    
ref|XP_003535142.1|  PREDICTED: probable xyloglucan endotransgluc...    213   6e-62    
ref|XP_011006618.1|  PREDICTED: probable xyloglucan endotransgluc...    212   7e-62    
gb|EPS67980.1|  xyloglucan endotransglucosylase/hydrolase 14            212   1e-61    
ref|XP_003559007.1|  PREDICTED: probable xyloglucan endotransgluc...    213   1e-61    
ref|NP_001240151.1|  uncharacterized protein LOC100796768 precursor     212   1e-61    
ref|XP_010918611.1|  PREDICTED: probable xyloglucan endotransgluc...    211   2e-61    
gb|KEH42168.1|  xyloglucan endotransglucosylase/hydrolase family ...    211   2e-61    
emb|CAA48324.1|  cellulase                                              211   2e-61    
ref|XP_009335973.1|  PREDICTED: probable xyloglucan endotransgluc...    211   2e-61    
ref|XP_004983770.1|  PREDICTED: probable xyloglucan endotransgluc...    212   2e-61    
gb|KEH20811.1|  xyloglucan endotransglucosylase/hydrolase family ...    212   2e-61    
emb|CDP03889.1|  unnamed protein product                                211   2e-61    
ref|XP_008805707.1|  PREDICTED: probable xyloglucan endotransgluc...    211   3e-61    
ref|XP_007016866.1|  Xyloglucan endotransglucosylase/hydrolase 32...    209   4e-61    
ref|XP_002467558.1|  hypothetical protein SORBIDRAFT_01g030140          211   4e-61    
ref|XP_010267216.1|  PREDICTED: probable xyloglucan endotransgluc...    210   5e-61    
ref|XP_003542521.1|  PREDICTED: probable xyloglucan endotransgluc...    210   5e-61    
ref|XP_010696289.1|  PREDICTED: probable xyloglucan endotransgluc...    210   7e-61    
ref|XP_006354379.1|  PREDICTED: probable xyloglucan endotransgluc...    210   7e-61    
ref|XP_004147295.1|  PREDICTED: probable xyloglucan endotransgluc...    209   7e-61    
pdb|2VH9|A  Chain A, Crystal Structure Of Nxg1-Deltayniig In Comp...    209   7e-61    
ref|XP_011015586.1|  PREDICTED: probable xyloglucan endotransgluc...    210   8e-61    
ref|XP_011094597.1|  PREDICTED: probable xyloglucan endotransgluc...    210   8e-61    
ref|XP_011093008.1|  PREDICTED: probable xyloglucan endotransgluc...    210   9e-61    
gb|EMT24012.1|  Xyloglucan endotransglucosylase/hydrolase protein 2     209   1e-60    
gb|EAZ16868.1|  hypothetical protein OsJ_32344                          210   1e-60    
ref|XP_002983278.1|  hypothetical protein SELMODRAFT_118035             209   1e-60    
gb|KHN06880.1|  Putative xyloglucan endotransglucosylase/hydrolas...    209   1e-60    
emb|CCH26633.1|  putative xyloglucan endotransglucosylase/hydrolase     209   1e-60    
ref|XP_011032301.1|  PREDICTED: probable xyloglucan endotransgluc...    209   1e-60    
dbj|BAJ88307.1|  predicted protein                                      209   1e-60    
gb|KGN64814.1|  hypothetical protein Csa_1G109370                       209   2e-60    
ref|XP_004163686.1|  PREDICTED: probable xyloglucan endotransgluc...    209   2e-60    
gb|EMT25808.1|  Putative xyloglucan endotransglucosylase/hydrolas...    207   2e-60    
ref|XP_004487062.1|  PREDICTED: probable xyloglucan endotransgluc...    209   2e-60    
gb|EAZ03861.1|  hypothetical protein OsI_25995                          209   2e-60    
ref|XP_004246615.1|  PREDICTED: probable xyloglucan endotransgluc...    209   2e-60    
ref|XP_002323501.1|  xyloglucan endotransglucosylase/hydrolase pr...    208   2e-60    
gb|KHN21488.1|  Putative xyloglucan endotransglucosylase/hydrolas...    208   3e-60    
ref|XP_003540201.1|  PREDICTED: probable xyloglucan endotransgluc...    209   3e-60    
ref|XP_008787464.1|  PREDICTED: probable xyloglucan endotransgluc...    208   3e-60    
ref|XP_004515909.1|  PREDICTED: probable xyloglucan endotransgluc...    208   3e-60    
ref|XP_002972773.1|  hypothetical protein SELMODRAFT_98543              207   4e-60    
ref|XP_002984349.1|  hypothetical protein SELMODRAFT_120108             207   5e-60    
ref|NP_001151883.1|  LOC100285520 precursor                             208   5e-60    
ref|XP_010940514.1|  PREDICTED: probable xyloglucan endotransgluc...    207   5e-60    
ref|XP_009386049.1|  PREDICTED: probable xyloglucan endotransgluc...    207   5e-60    
ref|XP_010050769.1|  PREDICTED: probable xyloglucan endotransgluc...    207   6e-60    
ref|XP_003563122.1|  PREDICTED: probable xyloglucan endotransgluc...    207   6e-60    
ref|XP_002984470.1|  hypothetical protein SELMODRAFT_120330             207   7e-60    
ref|XP_003625695.1|  Xyloglucan endotransglucosylase/hydrolase          207   7e-60    
ref|NP_001132709.1|  uncharacterized protein LOC100194192 precursor     207   7e-60    
ref|XP_008241393.1|  PREDICTED: probable xyloglucan endotransgluc...    207   9e-60    
ref|XP_006381392.1|  xyloglucan endotransglucosylase/hydrolase pr...    207   1e-59    
ref|XP_008385521.1|  PREDICTED: probable xyloglucan endotransgluc...    207   1e-59    
ref|XP_002973000.1|  hypothetical protein SELMODRAFT_98674              206   1e-59    
ref|XP_008442717.1|  PREDICTED: probable xyloglucan endotransgluc...    207   1e-59    
emb|CBI30149.3|  unnamed protein product                                206   1e-59    
ref|XP_009766795.1|  PREDICTED: xyloglucan endotransglucosylase/h...    206   1e-59    
ref|XP_010689134.1|  PREDICTED: probable xyloglucan endotransgluc...    206   1e-59    
ref|XP_007162780.1|  hypothetical protein PHAVU_001G179900g             206   1e-59    
ref|XP_008462950.1|  PREDICTED: probable xyloglucan endotransgluc...    206   2e-59    
ref|XP_002984011.1|  hypothetical protein SELMODRAFT_119243             206   2e-59    
ref|XP_009611819.1|  PREDICTED: probable xyloglucan endotransgluc...    206   2e-59    
ref|XP_006291596.1|  hypothetical protein CARUB_v10017750mg             206   2e-59    
ref|XP_010935831.1|  PREDICTED: probable xyloglucan endotransgluc...    206   2e-59    
gb|KHN09532.1|  Putative xyloglucan endotransglucosylase/hydrolas...    206   2e-59    
ref|XP_002519471.1|  Xyloglucan endotransglucosylase/hydrolase pr...    206   2e-59    
gb|ACS13755.1|  xyloglucan xyloglucosyl transferase                     206   2e-59    
dbj|BAB78506.1|  Xyloglucan endo-transglycosylase                       206   3e-59    
gb|AAK51119.1|  xyloglucan endo-transglycosylase                        206   3e-59    
ref|XP_002863180.1|  predicted protein                                  206   3e-59    
pdb|2UWC|A  Chain A, Crystal Structure Of Nasturtium Xyloglucan H...    205   3e-59    
ref|XP_002463490.1|  hypothetical protein SORBIDRAFT_01g000710          206   4e-59    
ref|NP_001233858.1|  probable xyloglucan endotransglucosylase/hyd...    205   4e-59    
ref|XP_009145277.1|  PREDICTED: probable xyloglucan endotransgluc...    205   4e-59    
ref|XP_006848333.1|  hypothetical protein AMTR_s00013p00167480          202   4e-59    
ref|XP_002972756.1|  hypothetical protein SELMODRAFT_97913              205   5e-59    
ref|XP_009611317.1|  PREDICTED: probable xyloglucan endotransgluc...    205   5e-59    
ref|XP_002313534.2|  xyloglucan endotransglucosylase/hydrolase pr...    205   5e-59    
ref|XP_009772755.1|  PREDICTED: probable xyloglucan endotransgluc...    205   5e-59    
emb|CDX99172.1|  BnaA06g18630D                                          205   5e-59    
ref|XP_009150317.1|  PREDICTED: probable xyloglucan endotransgluc...    205   5e-59    
ref|NP_001148998.1|  xyloglucan endotransglucosylase/hydrolase pr...    205   5e-59    
gb|KHF98411.1|  putative xyloglucan endotransglucosylase/hydrolas...    205   5e-59    
ref|XP_011018780.1|  PREDICTED: probable xyloglucan endotransgluc...    205   6e-59    
ref|XP_002993371.1|  hypothetical protein SELMODRAFT_136972             205   6e-59    
ref|XP_007202396.1|  hypothetical protein PRUPE_ppa009437mg             204   6e-59    
ref|XP_004494070.1|  PREDICTED: probable xyloglucan endotransgluc...    204   7e-59    
emb|CDP15274.1|  unnamed protein product                                203   7e-59    
pdb|2UWA|A  Chain A, Crystal Structure Of The Nasturtium Seedling...    204   7e-59    
ref|XP_007027440.1|  Xyloglucan endotransglucosylase/hydrolase 32...    205   8e-59    
ref|XP_010259646.1|  PREDICTED: probable xyloglucan endotransgluc...    204   9e-59    
ref|XP_006298227.1|  hypothetical protein CARUB_v10014286mg             204   9e-59    
gb|KHG21816.1|  putative xyloglucan endotransglucosylase/hydrolas...    204   9e-59    
gb|KDP29175.1|  hypothetical protein JCGZ_16564                         204   9e-59    
ref|XP_002984345.1|  hypothetical protein SELMODRAFT_120242             204   1e-58    
ref|NP_001241974.1|  uncharacterized protein LOC100796698 precursor     204   1e-58    
ref|XP_006428458.1|  hypothetical protein CICLE_v10012353mg             204   1e-58    
gb|KHG09774.1|  putative xyloglucan endotransglucosylase/hydrolas...    204   1e-58    
ref|XP_008779033.1|  PREDICTED: probable xyloglucan endotransgluc...    204   1e-58    
ref|XP_010098793.1|  putative xyloglucan endotransglucosylase/hyd...    204   1e-58    
ref|XP_003597276.1|  Xyloglucan endotransglycosylase                    204   1e-58    
ref|XP_010527991.1|  PREDICTED: probable xyloglucan endotransgluc...    204   1e-58    



>ref|XP_009795133.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Nicotiana sylvestris]
Length=316

 Score =   469 bits (1207),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 260/318 (82%), Gaps = 9/318 (3%)
 Frame = -1

Query  1152  MGLFKNSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYG  973
             M  F ++  F    F I  M+V+   VS RGP+Y PP V++LTD F++  V++GYNV +G
Sbjct  1     MDFFHHNKTFLLSQFFIFCMIVV---VSCRGPVYKPPEVEKLTDHFSRLSVNQGYNVFFG  57

Query  972   GHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQD  793
             G N+++ NNGSSADL+LDKSSG GL+SK++YYYGFFNAA+KLPA FTSGVV+AFYMSN D
Sbjct  58    GANVRMTNNGSSADLILDKSSGSGLISKEKYYYGFFNAALKLPAHFTSGVVIAFYMSNSD  117

Query  792   VYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWN  613
             V+PHNHDEID ELLG+DKRRDWVLQTNLY NGSV TGREEKFYLWFDPT   HDY+ILWN
Sbjct  118   VFPHNHDEIDFELLGHDKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDYTILWN  177

Query  612   SHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFV  433
             +HHI+FLVDN+P+REVV+N AIS+VYPSKPMSV  TIWDGSEWATHGGKYPVNY YAPFV
Sbjct  178   NHHIVFLVDNVPIREVVHNTAISSVYPSKPMSVIATIWDGSEWATHGGKYPVNYQYAPFV  237

Query  432   ASMGRVELEGC-----TNSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFY  271
              SM  VELEGC     T+++S C RRS S+   ++GE F+KL+QQQ++GL W R KHMFY
Sbjct  238   TSMKEVELEGCVRQQNTSATSTCFRRSTSSLDPVDGEEFMKLSQQQMTGLDWVRRKHMFY  297

Query  270   SYCKDKARYKVLPLECTA  217
             SYC+D  RYKVLP ECT+
Sbjct  298   SYCQDTNRYKVLPPECTS  315



>emb|CDP00178.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   464 bits (1193),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 211/300 (70%), Positives = 261/300 (87%), Gaps = 3/300 (1%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
             FF +L + +++  VS+RGP+YTPP+V+R+TD+F +  VS+GYNV YGG N+ L NNG+SA
Sbjct  10    FFGLLKLWMLM-PVSSRGPVYTPPNVERVTDQFRRISVSQGYNVFYGGSNVHLTNNGTSA  68

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
             DL+LDKSSG GLVSK+RYYYGFF+AA+KLPAGFTSG+V AFY+SNQD++PHNHDEID EL
Sbjct  69    DLILDKSSGSGLVSKNRYYYGFFSAAMKLPAGFTSGIVTAFYLSNQDLFPHNHDEIDFEL  128

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG++KRR WVLQTNLY NGSV TGREEKFYLWFDPTQA H+YSILWN+HHI+FLVDN+PV
Sbjct  129   LGHEKRRQWVLQTNLYGNGSVGTGREEKFYLWFDPTQAFHEYSILWNNHHIVFLVDNVPV  188

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-  397
             REV++N AIS+ YPSKPMS YVTIWDGS+WATHGGKYPVNY+YAPF  S+  +E+EGC  
Sbjct  189   REVIHNGAISSAYPSKPMSAYVTIWDGSKWATHGGKYPVNYSYAPFATSLRGIEMEGCIR  248

Query  396   NSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
              +S+ C++RS S+   ++G+ F KL+Q Q +GL+WARGKHMFYSYC+DK+RYKVLP ECT
Sbjct  249   ENSAACSKRSVSSLDPVDGQEFAKLSQLQTTGLEWARGKHMFYSYCQDKSRYKVLPPECT  308



>ref|XP_004238674.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Solanum lycopersicum]
Length=313

 Score =   463 bits (1192),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 216/317 (68%), Positives = 260/317 (82%), Gaps = 8/317 (3%)
 Frame = -1

Query  1152  MGLFKNSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYG  973
             M  F +   F    FLIL M+++   VS RGP+Y PP +++LTD F++  V++ YNV YG
Sbjct  1     MEFFLHDRKFILSAFLILCMIIV---VSCRGPVYKPPEIEKLTDHFSRLSVNQSYNVFYG  57

Query  972   GHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQD  793
             G NI + NNGSSA+++LDKSSG GL+SK++YYYGFFNAA+KLPA FTSGVVVAFYMSN D
Sbjct  58    GSNIHITNNGSSAEIILDKSSGSGLISKEKYYYGFFNAALKLPAHFTSGVVVAFYMSNSD  117

Query  792   VYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWN  613
             V+PHNHDEID ELLG++KRRDWVLQTNLY NGSV TGREEKFYLWFDPT   HDY+ILWN
Sbjct  118   VFPHNHDEIDFELLGHEKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDYTILWN  177

Query  612   SHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFV  433
             +HHI+FLVDN+PVREVV+N AIS+VYPSKPMS  +TIWDGSEWATHGGKYPVNYNYAPF+
Sbjct  178   NHHIVFLVDNVPVREVVHNTAISSVYPSKPMSTILTIWDGSEWATHGGKYPVNYNYAPFI  237

Query  432   ASMGRVELEGCTNSSSD-CTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSY  265
              ++  +ELEGC     + C++RS STSSL   +GEGF+KL+ QQ+ GL WAR KHMFYSY
Sbjct  238   TTIKGIELEGCVKQQQNTCSKRS-STSSLDPVDGEGFMKLSSQQMKGLDWARRKHMFYSY  296

Query  264   CKDKARYKVLPLECTAK  214
             C+D  RYKVLP ECT++
Sbjct  297   CQDTKRYKVLPPECTSE  313



>ref|XP_009623898.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Nicotiana tomentosiformis]
Length=316

 Score =   461 bits (1185),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 219/304 (72%), Positives = 254/304 (84%), Gaps = 9/304 (3%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             FLI  M+ +    S+ GPIYTPP  +RLTDRF++  V++GYNV +GG N++L NNGS+AD
Sbjct  15    FLIFCMIAV---ASSLGPIYTPPEAERLTDRFSRLSVNQGYNVFFGGANVRLTNNGSNAD  71

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L+LDKSSG GLVS+D+YYYGFFNAA+KLPA FTSGVVVAFY+SNQ+++PHNHDE+D ELL
Sbjct  72    LILDKSSGSGLVSRDKYYYGFFNAALKLPANFTSGVVVAFYLSNQNIFPHNHDELDFELL  131

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             GYDKRRDWVLQTN+Y NGSV TGREEKFYLWFDPTQ  HDYSILWN+HHILFLVDN+PVR
Sbjct  132   GYDKRRDWVLQTNIYGNGSVSTGREEKFYLWFDPTQDFHDYSILWNNHHILFLVDNVPVR  191

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT--  397
             EVVNN  IS+VYPSKPMS+Y TIWDGS+WAT GGKYPVNY YAPFV S+  VELEGC   
Sbjct  192   EVVNNTTISSVYPSKPMSIYATIWDGSQWATRGGKYPVNYTYAPFVTSIKGVELEGCVSE  251

Query  396   -NSSSDCTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPL  229
              N+S+       STSSL   +GE FVKL+QQQ++GL WAR KHMFYSYC+D  RYKVLP 
Sbjct  252   QNASAASACARRSTSSLDPVDGEEFVKLSQQQMTGLDWARRKHMFYSYCQDTRRYKVLPP  311

Query  228   ECTA  217
             ECTA
Sbjct  312   ECTA  315



>ref|XP_009804330.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Nicotiana sylvestris]
Length=316

 Score =   461 bits (1185),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 217/318 (68%), Positives = 258/318 (81%), Gaps = 9/318 (3%)
 Frame = -1

Query  1152  MGLFKNSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYG  973
             M  F          FLI  M+ +    S+ GPIYTPP V++LTDRF++  V++GYN+ +G
Sbjct  1     MEFFHQHNTLLLSEFLIFCMISV---ASSLGPIYTPPEVEQLTDRFSRLSVNQGYNMFFG  57

Query  972   GHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQD  793
             G N++L NNGSSADL+LDKSSG GLVS+D+YYYGFFNAA+KLPA FTSGVVVAFY+SNQ+
Sbjct  58    GVNVRLTNNGSSADLILDKSSGSGLVSRDKYYYGFFNAALKLPANFTSGVVVAFYLSNQN  117

Query  792   VYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWN  613
             ++PH+HDE+D ELLGYDKRRDWVLQTN Y NGSV TGRE KFYLWFDPTQ  HDY+ILWN
Sbjct  118   IFPHDHDELDFELLGYDKRRDWVLQTNNYGNGSVSTGREGKFYLWFDPTQDFHDYTILWN  177

Query  612   SHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFV  433
             +HHILFLVDN+PVREVV+N AIS+VYPSKPMS+YVTIWDGS+WAT GGKYPVNY YAPFV
Sbjct  178   NHHILFLVDNVPVREVVHNTAISSVYPSKPMSIYVTIWDGSQWATRGGKYPVNYTYAPFV  237

Query  432   ASMGRVELEGCT-----NSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFY  271
              S+  VELEGC      ++++ C RRS S+   ++GE FVKL+QQQ+ GL WAR KHMFY
Sbjct  238   TSIKGVELEGCVSEQNGSAATACARRSTSSLDPVDGEEFVKLSQQQMMGLDWARRKHMFY  297

Query  270   SYCKDKARYKVLPLECTA  217
             SYC+D  RYKVLP ECTA
Sbjct  298   SYCQDTRRYKVLPPECTA  315



>ref|XP_006355979.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33-like [Solanum tuberosum]
Length=304

 Score =   457 bits (1176),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 215/304 (71%), Positives = 254/304 (84%), Gaps = 15/304 (5%)
 Frame = -1

Query  1086  IITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSG  907
             +I  VS RGP+Y PP +++LTD F++  V++ YNV YGG NI + NNGSSA+++LDKSSG
Sbjct  1     MIIVVSCRGPVYKPPEIEKLTDHFSRLSVNQSYNVFYGGSNIHMTNNGSSAEIILDKSSG  60

Query  906   CGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDW  727
              GL+SK++YYYGFFNAA+KLPA FTSGVVVAFYMSN DV+PHNHDEID ELLG++KRRDW
Sbjct  61    SGLISKEKYYYGFFNAALKLPAHFTSGVVVAFYMSNSDVFPHNHDEIDFELLGHEKRRDW  120

Query  726   VLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAI  547
             VLQTNLY NGSV TGREEKFYLWFDPT   HDY+ILWN+HHI+FLVDN+P+REVV+N AI
Sbjct  121   VLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDYTILWNNHHIVFLVDNVPIREVVHNTAI  180

Query  546   STVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC-------TNSS  388
             S+VYPSKPMS+ VTIWDGSEWATHGGKYPVNYNYAPF+ +M  +ELEGC       TNSS
Sbjct  181   SSVYPSKPMSIIVTIWDGSEWATHGGKYPVNYNYAPFITTMKGIELEGCIKQQQNNTNSS  240

Query  387   S----DCTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPL  229
             S     C++RS STSSL   +GEGF+KL+ QQ++GL WAR KHMFYSYC+D  RYKVLP 
Sbjct  241   SILTPTCSKRS-STSSLDPVDGEGFMKLSSQQMAGLDWARRKHMFYSYCQDTKRYKVLPP  299

Query  228   ECTA  217
             EC A
Sbjct  300   ECNA  303



>ref|XP_011086549.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Sesamum indicum]
Length=314

 Score =   456 bits (1172),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 256/317 (81%), Gaps = 9/317 (3%)
 Frame = -1

Query  1152  MGLFKNSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYG  973
             M +F +  +F +   L+L M++   +V +RGP+YTPP V+RLTDRF++  V   YNV +G
Sbjct  1     MAIF-HPKHFLTSSILVLGMII---EVYSRGPVYTPPDVERLTDRFSRVSVDRSYNVFFG  56

Query  972   GHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQD  793
             G N+ +  NG+SADL LDKSSG G+VSK+RY YGFFNAAIKLPAGFTSGVVVA+Y+SN D
Sbjct  57    GSNVHVTGNGTSADLSLDKSSGSGVVSKNRYNYGFFNAAIKLPAGFTSGVVVAYYLSNAD  116

Query  792   VYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWN  613
              YPHNHDEIDIELLG++KRRDWVLQTN+Y NGSV TGREEKFYLWFDPTQ  HDYSILWN
Sbjct  117   SYPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVSTGREEKFYLWFDPTQNFHDYSILWN  176

Query  612   SHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFV  433
             +HHI+FLVDN+P+REV++N AISTVYPSKPMSVY TIWDGSEWATHGGKYPV+Y +APFV
Sbjct  177   NHHIVFLVDNVPIREVIHNNAISTVYPSKPMSVYATIWDGSEWATHGGKYPVDYKFAPFV  236

Query  432   ASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYS  268
             ASM  +E+EGC       + S       S   ++GE F KL+ QQI+GL WARGKHMFYS
Sbjct  237   ASMRGIEMEGCVLNPKGMAPSCSRSSLSSLDPVDGEEFAKLSSQQITGLNWARGKHMFYS  296

Query  267   YCKDKARYKVLPLECTA  217
             YC+DK+RYKVLP ECTA
Sbjct  297   YCQDKSRYKVLPAECTA  313



>gb|ABA54988.1| xyloglucan endotransglycosylase hydrolase [Apium graveolens]
Length=307

 Score =   448 bits (1152),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 244/301 (81%), Gaps = 4/301 (1%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
             F L+L +   I  VS+RGPIY PP V+RLTDRF Q  V + ++ LYG  NI   NNGSS 
Sbjct  4     FLLVLFICSSIVAVSSRGPIYKPPPVERLTDRFVQQSVDKAFSNLYGNKNIHQLNNGSSV  63

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
             +++LDKSSG GL+SK+RYYYGFF+AAIKLPA FTSGVVVAFY+SN D+YPHNHDEID EL
Sbjct  64    NIILDKSSGSGLISKNRYYYGFFSAAIKLPASFTSGVVVAFYLSNSDMYPHNHDEIDFEL  123

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG++KRRDWVLQTN+Y NGS KTGREEKFYLWFDPT  SH YSILWN+HH +FLVDN+PV
Sbjct  124   LGHEKRRDWVLQTNIYGNGSTKTGREEKFYLWFDPTIESHQYSILWNNHHTVFLVDNVPV  183

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTN  394
             REVV+NAAI++ YPSKPMSVY TIWD SEWATHGGKY VNY YAPFVAS+G++E+ GC  
Sbjct  184   REVVHNAAIASAYPSKPMSVYATIWDASEWATHGGKYAVNYKYAPFVASLGQIEMGGCIK  243

Query  393   SSSDCTRR---SPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
               +D T+     PST   +EG+ F KL++QQ +G+ WAR KHMFYSYCKD +RYKVLP E
Sbjct  244   QRADSTQSCVTGPSTLDPVEGQEFAKLSKQQTTGMDWARRKHMFYSYCKDTSRYKVLPAE  303

Query  225   C  223
             C
Sbjct  304   C  304



>gb|EYU22485.1| hypothetical protein MIMGU_mgv1a023829mg, partial [Erythranthe 
guttata]
Length=289

 Score =   441 bits (1135),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 245/288 (85%), Gaps = 6/288 (2%)
 Frame = -1

Query  1062  GPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDR  883
             GP+YTPP V+RLTDRF Q  V++ Y+V +GG NI + NNG++ADL LDKSSG GLVSK++
Sbjct  1     GPVYTPPDVERLTDRFNQVSVNKSYDVFFGGSNIHVPNNGTNADLSLDKSSGSGLVSKNK  60

Query  882   YYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYC  703
             YYYGFFNAA+KLPAGFTSGVVVA+Y+SN D +PHNHDEIDIELLG++KR++WVLQTN+Y 
Sbjct  61    YYYGFFNAALKLPAGFTSGVVVAYYLSNADAFPHNHDEIDIELLGHEKRKEWVLQTNIYG  120

Query  702   NGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKP  523
             NGSV TGREEKFYLWFDPTQA H+YSILWN+HHI+FLVDNIPVREVV++ AI++VYPSK 
Sbjct  121   NGSVSTGREEKFYLWFDPTQAFHNYSILWNNHHIVFLVDNIPVREVVHSNAIASVYPSKA  180

Query  522   MSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPST  358
             MSVY TIWDGSEWAT GGKYPVNYN+APFV SM  +E+EGC       +++ C R SPS+
Sbjct  181   MSVYATIWDGSEWATRGGKYPVNYNFAPFVVSMRGIEMEGCVINQKEITATSCLRGSPSS  240

Query  357   -SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECTA  217
                ++GE F KL+ Q+++GL WAR KHMFYSYC+DK+RYKVLP EC +
Sbjct  241   LDPVDGEQFAKLSSQEVAGLDWARRKHMFYSYCQDKSRYKVLPRECNS  288



>ref|XP_011071081.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Sesamum indicum]
Length=312

 Score =   442 bits (1136),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 248/306 (81%), Gaps = 5/306 (2%)
 Frame = -1

Query  1125  FFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNN  946
             FFS   +  ++V+   +V +RGP+Y PP V+ LTDRF+Q  V++ YNV +GG NI + NN
Sbjct  9     FFSSLLIFCNLVL---EVYSRGPVYRPPDVELLTDRFSQVSVAQSYNVSFGGSNIGVTNN  65

Query  945   GSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEI  766
             G+SADL LDKSSG GLVSK +Y+YGFFNAA+KLPAGFTSGVVVA+Y+SN DV+PHNHDEI
Sbjct  66    GTSADLSLDKSSGSGLVSKSKYFYGFFNAALKLPAGFTSGVVVAYYLSNADVFPHNHDEI  125

Query  765   DIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVD  586
             DIELLG++KRRDWVLQTN+Y NGSV+TGREEKFYLWFDPT+  H+YSILWN+HHI+FLVD
Sbjct  126   DIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEGFHNYSILWNNHHIVFLVD  185

Query  585   NIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELE  406
             N+PVRE V+  AI +VYPSKPMSVY TIWDGSEWATHGGKYPVNY +APFV SM  +E+E
Sbjct  186   NVPVREFVHGNAIGSVYPSKPMSVYTTIWDGSEWATHGGKYPVNYKFAPFVVSMRGIEME  245

Query  405   GCT--NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
             GC     +S       S   ++GE F KL+ QQ++GL WAR KHMFYSYC+DK RYKVLP
Sbjct  246   GCVLNQRASCSRSSLSSLDPVDGEQFAKLSSQQMTGLDWARRKHMFYSYCQDKNRYKVLP  305

Query  231   LECTAK  214
              EC AK
Sbjct  306   PECNAK  311



>ref|XP_002263411.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Vitis vinifera]
 emb|CBI32135.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   403 bits (1036),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 236/306 (77%), Gaps = 8/306 (3%)
 Frame = -1

Query  1107  LILSMVVII---TKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSS  937
             L+ S++VI      VSA       P+V RLTD F     + G+   +GG NIQ  NNGS 
Sbjct  8     LLASLLVIFGISAAVSAGNGHDAAPNVTRLTDLFGHLTFNHGFTEFFGGSNIQPINNGSY  67

Query  936   ADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIE  757
             A+L+L+KSSG GLVS+ +YYYGFF+AAIKLP+G+TSGVVVAFYMSN D++PHNHDEIDIE
Sbjct  68    ANLILNKSSGSGLVSQSKYYYGFFSAAIKLPSGYTSGVVVAFYMSNADLFPHNHDEIDIE  127

Query  756   LLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIP  577
             LLG++KR+DWVLQTN+Y NGSV TGREEKF LWFDPT+  H YS +WN HHI+FLVDN+P
Sbjct  128   LLGHEKRKDWVLQTNMYGNGSVSTGREEKFRLWFDPTEQYHHYSFIWNRHHIVFLVDNVP  187

Query  576   VREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT  397
             VRE++ N AIS+VYPSKPMSVY TIWDGSEWATHGGKYPV+Y YAPFV S G +E++GCT
Sbjct  188   VREILYNDAISSVYPSKPMSVYATIWDGSEWATHGGKYPVDYKYAPFVVSFGEMEMDGCT  247

Query  396   ----NSSSDCTRRSPSTSS-LEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
                      C++ S S+   ++GE F KL++QQ  G++WAR K MFYSYCKD +R+KVLP
Sbjct  248   FDPKKKGVSCSKGSVSSRDPVDGEEFAKLSEQQRMGMEWARKKLMFYSYCKDSSRFKVLP  307

Query  231   LECTAK  214
              EC AK
Sbjct  308   PECKAK  313



>ref|XP_007019688.1| Xyloglucan:xyloglucosyl transferase 33 [Theobroma cacao]
 gb|EOY16913.1| Xyloglucan:xyloglucosyl transferase 33 [Theobroma cacao]
Length=309

 Score =   400 bits (1029),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 226/303 (75%), Gaps = 6/303 (2%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
              F+ LSM  + + VS+    YT PSV RLTD  +   V  G++  +GG NI+L NNGS A
Sbjct  8     LFMSLSMFCMTSVVSSHSRHYTTPSVPRLTDLLSHVSVDTGFSKFFGGPNIKLINNGSMA  67

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
              L LDK+SG GLVS+ +YYYGFF+AAIKLPAG TSGVVVAFY+SN D+YPH+HDEIDIEL
Sbjct  68    TLALDKTSGSGLVSRRKYYYGFFSAAIKLPAGLTSGVVVAFYLSNADMYPHSHDEIDIEL  127

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG+DKR DWVLQTN+Y NG V TGREEKFY WFDPTQ  H YSILWNSHHI+FLVDNIPV
Sbjct  128   LGHDKRIDWVLQTNVYANG-VSTGREEKFYFWFDPTQQHHYYSILWNSHHIVFLVDNIPV  186

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTN  394
             RE  NN   ST YPSKPMS+YVTIWDGS+WATHGGKYPVNY YAPFVAS   +E+ GC  
Sbjct  187   REFPNNGKFSTAYPSKPMSLYVTIWDGSQWATHGGKYPVNYKYAPFVASFADMEMAGCIT  246

Query  393   SSSD-----CTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPL  229
             + +            S   + G  FVKL+ QQI+ + WAR K MFYSYCKD +R+KVLP 
Sbjct  247   NPTPPGSSCSNASLSSMDPVGGPYFVKLSNQQITAMDWARRKLMFYSYCKDTSRFKVLPP  306

Query  228   ECT  220
             ECT
Sbjct  307   ECT  309



>ref|XP_006438421.1| hypothetical protein CICLE_v10032164mg [Citrus clementina]
 ref|XP_006483829.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33-like [Citrus sinensis]
 gb|ESR51661.1| hypothetical protein CICLE_v10032164mg [Citrus clementina]
 gb|KDO82483.1| hypothetical protein CISIN_1g021307mg [Citrus sinensis]
Length=314

 Score =   400 bits (1028),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 229/295 (78%), Gaps = 6/295 (2%)
 Frame = -1

Query  1089  VIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSS  910
             ++  KVS+    Y  PSV RLTD F    V +G++  +GG N++  NNGS A L LDKSS
Sbjct  19    IMAPKVSSHNRAYAAPSVARLTDLFGHVSVDQGFSTFFGGSNVKRINNGSMATLALDKSS  78

Query  909   GCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRD  730
             G GLVS+++YY+GFF+AAIKLP+G +SGVV+AFY+SN D YPHNHDEIDIELLG+DKR D
Sbjct  79    GSGLVSRNKYYHGFFSAAIKLPSGLSSGVVLAFYLSNADSYPHNHDEIDIELLGHDKRND  138

Query  729   WVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAA  550
             WVLQTN+Y NG V TGREEKFY WFDPT   H YSI+WNSHHI+FLVDN+P+RE  N  A
Sbjct  139   WVLQTNIYANGGVSTGREEKFYFWFDPTAQHHYYSIIWNSHHIVFLVDNVPLREFPNTGA  198

Query  549   ISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC--TNSSS---  385
              S+VYPSKPMSVYVTIWDGS+WATHGGKYPVNY YAPFVAS+  +E+ GC  +NS+S   
Sbjct  199   FSSVYPSKPMSVYVTIWDGSQWATHGGKYPVNYKYAPFVASLAEMEMAGCVLSNSASAPA  258

Query  384   DCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
              C++ S S+   ++G+ F  L++QQ++ L W+R K MFYSYCKD  R+KV+P EC
Sbjct  259   SCSKGSASSLDPVDGQQFTTLSKQQVAALDWSRRKLMFYSYCKDTTRFKVMPPEC  313



>ref|XP_010100482.1| putative xyloglucan endotransglucosylase/hydrolase protein 33 
[Morus notabilis]
 gb|EXB82616.1| putative xyloglucan endotransglucosylase/hydrolase protein 33 
[Morus notabilis]
Length=314

 Score =   395 bits (1015),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/311 (62%), Positives = 229/311 (74%), Gaps = 11/311 (4%)
 Frame = -1

Query  1122  FSQFFLILSMVVII---TKVSAR--GPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQ  958
             FSQ  L++ +++I    T +SAR     YTPPSV  LTD F    +S G++ ++G  N Q
Sbjct  3     FSQDKLLIFVLLIFCATTSLSARPRNRQYTPPSVPHLTDLFPHVSISNGFSNIFGAKNFQ  62

Query  957   LKNNGSSADLVLDKSSG---CGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVY  787
             L  NGS A L LDKSSG    GL SK+ YYYGFF+AAIKLP+G + GVV AFY+SN +VY
Sbjct  63    LTGNGSMATLALDKSSGKYRSGLASKNEYYYGFFSAAIKLPSGLSPGVVAAFYLSNANVY  122

Query  786   PHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSH  607
             PHNHDEIDIELLG+DKR DW  QTN+Y NGSV TGREEKFYLWFDPT   H YSILWN+H
Sbjct  123   PHNHDEIDIELLGHDKRNDWAFQTNIYANGSVSTGREEKFYLWFDPTAEHHQYSILWNNH  182

Query  606   HILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVAS  427
             HI+F+VDNIPVRE   N+A  +V+PSKPMSVY TIWDGSEWATHGGKYPVNY YAPFV S
Sbjct  183   HIVFMVDNIPVREYQRNSAYPSVFPSKPMSVYATIWDGSEWATHGGKYPVNYKYAPFVVS  242

Query  426   MGRVELEGC--TNSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKD  256
                VE+ GC  +N +  C++ SPS    +EG+ F  L+++Q   L WAR K MFYSYCKD
Sbjct  243   FADVEMSGCVVSNPTGTCSKTSPSNLDPVEGQEFATLSKEQARALDWARSKLMFYSYCKD  302

Query  255   KARYKVLPLEC  223
              +R+KVLP EC
Sbjct  303   VSRFKVLPPEC  313



>ref|XP_007223169.1| hypothetical protein PRUPE_ppa009090mg [Prunus persica]
 gb|EMJ24368.1| hypothetical protein PRUPE_ppa009090mg [Prunus persica]
Length=307

 Score =   394 bits (1012),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/300 (64%), Positives = 229/300 (76%), Gaps = 12/300 (4%)
 Frame = -1

Query  1107  LILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADL  928
             LIL M V+   VS+    YT PSV RLTD F +  +S G++  +GG NIQ+ N GS A L
Sbjct  14    LILCMAVL---VSSHNRYYTSPSVPRLTDAFPRVPISNGFSKAFGGSNIQVIN-GSMATL  69

Query  927   VLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLG  748
              LDKSSG GL S ++Y+YGFF+AAIKLPAG TSGVVVAFY+SN DV+PHNHDEIDIELLG
Sbjct  70    ALDKSSGSGLASVNKYHYGFFSAAIKLPAGLTSGVVVAFYLSNADVFPHNHDEIDIELLG  129

Query  747   YDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVRE  568
             +DKR DWV+QTN+Y NGSV TGREEKFYLWFDPTQ  H YSI+WN+HHI+FLVDNIPVRE
Sbjct  130   HDKRNDWVIQTNVYANGSVNTGREEKFYLWFDPTQQQHQYSIIWNNHHIVFLVDNIPVRE  189

Query  567   VVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC----  400
               ++ +    +PSKPMSVY TIWD S+WATHGGKYPVNY YAPF  S   +E+ GC    
Sbjct  190   FQHSGSF---FPSKPMSVYATIWDASQWATHGGKYPVNYKYAPFRVSFAEMEMSGCISNP  246

Query  399   TNSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             T + + C++ +PS+   +EG  FVKL+ QQIS L WAR K MFYSYCKD +R+KV+P EC
Sbjct  247   TGTVTSCSKNTPSSLDPIEGPEFVKLSNQQISALGWARSKLMFYSYCKDTSRFKVMPPEC  306



>gb|KHN10598.1| Putative xyloglucan endotransglucosylase/hydrolase protein 33 
[Glycine soja]
Length=311

 Score =   393 bits (1010),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 225/301 (75%), Gaps = 5/301 (2%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F  L ++ + T VS+    YT PSV RLTD F +  V   ++  +G  NIQ  +NGS+A 
Sbjct  10    FSCLLILCLATVVSSHSRPYTTPSVTRLTDSFPRVQVDSAFSKTFGAKNIQFLSNGSTAT  69

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDK +G GLVS+ RY YGFF+AAIKLP+G + GVVVAFY+SN D +PHNHDEIDIELL
Sbjct  70    LALDKITGSGLVSQSRYSYGFFSAAIKLPSGLSPGVVVAFYLSNADKFPHNHDEIDIELL  129

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+DKR DWV+QTN+Y NGSV TGREEKFY WFDPTQ  H YSILWNS+H +FLVDNIPVR
Sbjct  130   GHDKRNDWVIQTNIYANGSVSTGREEKFYFWFDPTQQYHYYSILWNSYHTVFLVDNIPVR  189

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC---  400
             E +++    ++YPSKPMSVY TIWDGS+WATHGGKYPVNY YAPFV S  ++EL GC   
Sbjct  190   EFIHSNTYPSIYPSKPMSVYATIWDGSQWATHGGKYPVNYKYAPFVVSFAQIELSGCISD  249

Query  399   -TNSSSDCTRRSPS-TSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
              T + S C++ SPS    + G  F KL+QQQI+ + WAR K MFYSYC D++R+KV+P E
Sbjct  250   PTAAVSSCSKASPSGLDPVNGSEFTKLSQQQIAAMDWARRKLMFYSYCNDRSRFKVMPPE  309

Query  225   C  223
             C
Sbjct  310   C  310



>ref|XP_008221789.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Prunus mume]
Length=307

 Score =   392 bits (1008),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 191/300 (64%), Positives = 229/300 (76%), Gaps = 12/300 (4%)
 Frame = -1

Query  1107  LILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADL  928
             LIL M V+   VS+    YT PSV RLTD F +  +S G++  YG  NIQ+ N GS A L
Sbjct  14    LILCMAVL---VSSHNRYYTSPSVPRLTDDFPRVPISNGFSKAYGASNIQVIN-GSMATL  69

Query  927   VLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLG  748
              LDKSSG GLVS ++Y+YGFF+AAIKLPAG TSGVVVAFY+SN DV+PHNHDEIDIELLG
Sbjct  70    ALDKSSGSGLVSVNKYHYGFFSAAIKLPAGLTSGVVVAFYLSNADVFPHNHDEIDIELLG  129

Query  747   YDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVRE  568
             +DKR DWV+QTN+Y NGSV TGREEKFYLWFDPT+  H YSI+WN+HHI+FLVDNIPVRE
Sbjct  130   HDKRNDWVIQTNVYANGSVNTGREEKFYLWFDPTEQQHQYSIIWNNHHIVFLVDNIPVRE  189

Query  567   VVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC----  400
               ++ +    +PSKPMSVY TIWD S+WATHGGKYPVNY YAPF  S   +E+ GC    
Sbjct  190   FQHSGSF---FPSKPMSVYATIWDASQWATHGGKYPVNYKYAPFRVSFSEMEMSGCISNP  246

Query  399   TNSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             T + + C++ +PS+   +EG  FVKL+ QQIS L WAR K MFYSYCKD +R+KV+P EC
Sbjct  247   TGTVTSCSKNTPSSLDPIEGPEFVKLSNQQISALGWARSKLMFYSYCKDTSRFKVMPPEC  306



>ref|XP_010271956.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Nelumbo nucifera]
Length=314

 Score =   392 bits (1008),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/307 (61%), Positives = 228/307 (74%), Gaps = 12/307 (4%)
 Frame = -1

Query  1125  FFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNN  946
             F S F  +LS        S+R   YTP ++  LTD F     ++G++  +GG NIQL NN
Sbjct  14    FISCFVFVLS--------SSRNVNYTPSNLTHLTDLFPHRTFAQGFSEFFGGPNIQLTNN  65

Query  945   GSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEI  766
             GS  +L+L+KSSG G VS+DRY YGFF+ AIKLP+G+TSGVVVAFYMSN D +PH HDEI
Sbjct  66    GSYVNLMLNKSSGSGFVSRDRYKYGFFSTAIKLPSGYTSGVVVAFYMSNADNFPHTHDEI  125

Query  765   DIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVD  586
             D ELLG++KR++W+LQTNLY NGS  TGREEKF LWFDPT+  H YSI+WN +HI+FLVD
Sbjct  126   DFELLGHEKRKEWILQTNLYGNGSTGTGREEKFRLWFDPTEEFHQYSIIWNDYHIVFLVD  185

Query  585   NIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELE  406
             NIPVREV ++ AIS++YPSK MSVY TIWDGS+WATHGGKYPVNY + PFVAS G +E+E
Sbjct  186   NIPVREVNHSQAISSIYPSKAMSVYATIWDGSQWATHGGKYPVNYKFEPFVASFGEMEME  245

Query  405   GC----TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKV  238
             GC    T S + C     S   ++GE F KL+QQQ  G++WAR + MFYSYCKD AR+KV
Sbjct  246   GCILDPTTSVASCPESGLSIDPVQGEAFAKLSQQQNMGMEWARKRFMFYSYCKDAARFKV  305

Query  237   LPLECTA  217
             LP EC  
Sbjct  306   LPPECNG  312



>ref|XP_010044645.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Eucalyptus grandis]
 gb|KCW86737.1| hypothetical protein EUGRSUZ_B03348 [Eucalyptus grandis]
Length=314

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 221/299 (74%), Gaps = 15/299 (5%)
 Frame = -1

Query  1086  IITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSG  907
             +   VS+    Y+PP V RLTD F    V +G++  +G  N++L NNGS A+L LDKSSG
Sbjct  19    MAISVSSHNRPYSPPDVPRLTDLFPHVAVDQGFSKFFGAQNVRLLNNGSYANLALDKSSG  78

Query  906   CGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDW  727
              GLVS+ +Y+YGFF+AAIKLPAG +SGVVVAFY+SN D + H+HDEIDIELLG+DKR DW
Sbjct  79    SGLVSRSKYHYGFFSAAIKLPAGLSSGVVVAFYLSNADAFAHSHDEIDIELLGHDKRNDW  138

Query  726   VLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAI  547
             VLQTN+Y NGSV TGREEKFY WFDPTQ  H YSI+WNSHHI+F VDNIPVRE  ++   
Sbjct  139   VLQTNIYSNGSVSTGREEKFYFWFDPTQEHHYYSIIWNSHHIVFFVDNIPVREFPSSGVF  198

Query  546   STVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRS  367
             S+ YPSKPMSVY TIWDGS+WATHGGKYPVNY YAPFV S+   E+ GC ++     R+ 
Sbjct  199   SSTYPSKPMSVYATIWDGSQWATHGGKYPVNYKYAPFVVSLAETEMVGCVSN----PRQQ  254

Query  366   P-----------STSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             P            +  +EG+ F  L+QQQI+ +QWAR K MFYSYCKD +R+KV+P EC
Sbjct  255   PLSSCSNQSTSSGSDPVEGQDFAALSQQQITAMQWARSKLMFYSYCKDTSRFKVMPPEC  313



>gb|KDP26566.1| hypothetical protein JCGZ_17724 [Jatropha curcas]
Length=311

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/279 (64%), Positives = 217/279 (78%), Gaps = 2/279 (1%)
 Frame = -1

Query  1053  YTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYY  874
             YTPP+V   TD F+   VS+G++  +GG N++L NNGS A+L LDKSSG GL SK++YYY
Sbjct  32    YTPPNVTHFTDLFSHVSVSQGFSTFFGGSNVKLLNNGSYANLALDKSSGSGLASKNKYYY  91

Query  873   GFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGS  694
             GFF+AAIKLPAG +SGVVVAFYMSN D  PHNHDEIDIELLG+DKR +WVLQTN+Y NGS
Sbjct  92    GFFSAAIKLPAGQSSGVVVAFYMSNADTNPHNHDEIDIELLGHDKRNNWVLQTNIYANGS  151

Query  693   VKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSV  514
             V TGREEKFY WFDPT+  H YSI+WN+HHI+FLVDN+PVRE V+N A  ++YPSKPMS+
Sbjct  152   VSTGREEKFYFWFDPTEDYHHYSIIWNNHHIVFLVDNVPVREFVHNNAYPSIYPSKPMSL  211

Query  513   YVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-NSSSDCTRRSPST-SSLEGE  340
             Y TIWDGS+WATHGGKYPVNY YAPFV S   +E+ GC    S  C++   S+   ++G+
Sbjct  212   YATIWDGSQWATHGGKYPVNYQYAPFVVSFAEMEMTGCLYTPSPSCSKTGTSSLDPVDGQ  271

Query  339   GFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
              F  L++ Q   + WAR K MFYSYC DK R+KV+P EC
Sbjct  272   EFAALSKDQNVAMDWARRKLMFYSYCNDKPRFKVMPPEC  310



>gb|AFK40151.1| unknown [Medicago truncatula]
Length=311

 Score =   386 bits (992),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 220/302 (73%), Gaps = 8/302 (3%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
             F LI S+    T VS+    Y+PPSV  +T+ F    +   ++  +G  N++  +NGS A
Sbjct  12    FLLIFSLT---TLVSSHSRPYSPPSVTHITNSFPHVTIESAFSNAFGASNVKFLSNGSMA  68

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
              L LDK SG GLVS+ RY YGFF+AAIKLPAG + GVVVAFY+SN D +PHNHDEIDIEL
Sbjct  69    TLALDKISGSGLVSQSRYSYGFFSAAIKLPAGLSPGVVVAFYLSNADKFPHNHDEIDIEL  128

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG+DKR DWV+QTN+Y NGSV+TGREEKFYLWFDPTQ  H YSILWNS+H +F VDNIPV
Sbjct  129   LGHDKRNDWVIQTNIYANGSVRTGREEKFYLWFDPTQQHHYYSILWNSYHTVFFVDNIPV  188

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTN  394
             RE ++    S +YP KPMS+Y TIWDGSEWATHGGKYPVNY Y PFV S+  +EL GC N
Sbjct  189   REFIHKNTPSFIYPLKPMSLYATIWDGSEWATHGGKYPVNYKYGPFVVSLAEMELSGCIN  248

Query  393   SS----SDCTRRSPS-TSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPL  229
                   S C++ +PS    ++G  F+KL+QQQI  + WAR K MFYSYC D+ RYKVLP 
Sbjct  249   DPKSPISSCSKSNPSGLDPVDGAEFIKLSQQQIGAMDWARRKLMFYSYCNDRTRYKVLPP  308

Query  228   EC  223
             EC
Sbjct  309   EC  310



>gb|KFK43349.1| hypothetical protein AALP_AA1G114300 [Arabis alpina]
Length=317

 Score =   386 bits (992),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 228/303 (75%), Gaps = 11/303 (4%)
 Frame = -1

Query  1104  ILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLV  925
             ++  +  ++ VS+    +T PSV R+TD+F++  +  G++  +G HNI +  NGS A L 
Sbjct  17    VVFFLCSLSLVSSHSRRFTTPSVTRITDQFSKIAIENGFSKRFGAHNILV--NGSLAKLT  74

Query  924   LDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGY  745
             LDKSSG GLVSK++Y+YGFF+A +KLPAGF SGVVVAFY+SN + YP NHDEIDIELLG 
Sbjct  75    LDKSSGAGLVSKNKYHYGFFSARLKLPAGFASGVVVAFYLSNAEDYPKNHDEIDIELLGR  134

Query  744   DKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREV  565
              +R DW +QTN+Y NGS+KTGREEKFY WFDPTQA HDY+++WNSHHI+FLVDNIPVRE 
Sbjct  135   SRRDDWTIQTNVYANGSLKTGREEKFYFWFDPTQAYHDYTLIWNSHHIVFLVDNIPVREF  194

Query  564   VNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC-----  400
              N  A ++ YPSKPMS+YVT+WDGS+WATHGGKYPVNY Y PFVAS+  V+L GC     
Sbjct  195   PNRGAFTSAYPSKPMSLYVTVWDGSDWATHGGKYPVNYKYGPFVASVADVKLTGCSINNG  254

Query  399   -TNSSSDCTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
              +  S  CT+   S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P
Sbjct  255   TSTGSGPCTKSGGSVSSLDPVDGQDFATLSKNQITAMDWARRKLMFYSYCSDKSRYKVMP  314

Query  231   LEC  223
              EC
Sbjct  315   AEC  317



>gb|KEH19982.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=311

 Score =   385 bits (990),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 219/302 (73%), Gaps = 8/302 (3%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
             F LI S+    T VS+    Y+PPSV  +T+ F    +   ++  +G  N++  +NGS A
Sbjct  12    FLLIFSLT---TLVSSHSRPYSPPSVTHITNSFPHVTIESAFSNAFGASNVKFLSNGSMA  68

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
              L LDK SG GLVS+ RY YGFF+AAIKLPAG + GVVVAFY+SN D +PHNHDEIDIEL
Sbjct  69    TLALDKISGSGLVSQSRYSYGFFSAAIKLPAGLSPGVVVAFYLSNADKFPHNHDEIDIEL  128

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG+DKR DWV+QTN+Y NGSV+TGREEKFYLWFDPTQ  H YSILWNS+H +F VDNIPV
Sbjct  129   LGHDKRNDWVIQTNIYANGSVRTGREEKFYLWFDPTQQHHYYSILWNSYHTVFFVDNIPV  188

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTN  394
             RE ++    S +YP KPMS+Y TIWDGSEWATHGGKYPVNY Y PFV S+  +EL GC N
Sbjct  189   REFIHKNTPSFIYPLKPMSLYATIWDGSEWATHGGKYPVNYKYGPFVVSLAEMELSGCIN  248

Query  393   SS----SDCTRRSPS-TSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPL  229
                   S C++ +PS    ++G  F KL+QQQI  + WAR K MFYSYC D+ RYKVLP 
Sbjct  249   DPKSPISSCSKSNPSGLDPVDGAEFTKLSQQQIGAMDWARRKLMFYSYCNDRTRYKVLPP  308

Query  228   EC  223
             EC
Sbjct  309   EC  310



>ref|XP_007153638.1| hypothetical protein PHAVU_003G052400g [Phaseolus vulgaris]
 gb|ESW25632.1| hypothetical protein PHAVU_003G052400g [Phaseolus vulgaris]
Length=311

 Score =   385 bits (989),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 225/301 (75%), Gaps = 5/301 (2%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F  L ++ + T VS+    +T P+V RLTD F    V + ++  +G  NIQ   NGS+A 
Sbjct  10    FSYLLILCLTTVVSSHNRPFTIPTVTRLTDSFPLVPVDQAFSKAFGASNIQFLRNGSTAT  69

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDK SG GLVS+ RY YGFF+AAIKLP+G + GVVVAFY+SN D +PHNHDEIDIE+L
Sbjct  70    LALDKVSGSGLVSQRRYNYGFFSAAIKLPSGLSPGVVVAFYLSNADKFPHNHDEIDIEIL  129

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+DKR DWV+QTN+Y NGSV TGREEKFY WFDPTQ  H YSILWNS+H +FLVDN+PVR
Sbjct  130   GHDKRNDWVIQTNVYANGSVSTGREEKFYFWFDPTQQYHHYSILWNSYHTVFLVDNVPVR  189

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNS  391
             E +++    ++YPSKPMSVY TIWDGSEWAT+GGKYPVNY YAPFV S+ ++EL GC + 
Sbjct  190   EFIHSNTHPSIYPSKPMSVYATIWDGSEWATNGGKYPVNYKYAPFVVSLAQIELSGCISD  249

Query  390   S----SDCTRRSPSTSS-LEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
                  S C++ +PS    + G  F+KL+QQQ++ + WAR K MFYSYCKD+ R+KV+P E
Sbjct  250   PSAPVSSCSKVNPSAQDPVNGPEFIKLSQQQVAAMDWARRKLMFYSYCKDRPRFKVMPPE  309

Query  225   C  223
             C
Sbjct  310   C  310



>ref|XP_002892577.1| hypothetical protein ARALYDRAFT_471170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68836.1| hypothetical protein ARALYDRAFT_471170 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 225/296 (76%), Gaps = 11/296 (4%)
 Frame = -1

Query  1083  ITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGC  904
             ++ VS+    +T P+V RLTD+FT+  +  G+   +G HNIQ+  NGS A L LDKSSG 
Sbjct  16    LSLVSSHSRKFTTPNVTRLTDQFTKITIENGFVRRFGAHNIQV--NGSLAKLTLDKSSGA  73

Query  903   GLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWV  724
             GLVSK++Y+YGFF+A +KLPAGF SGVVVAFY+SN + YP NHDEIDIELLG  +R DW 
Sbjct  74    GLVSKNKYHYGFFSARLKLPAGFASGVVVAFYLSNAESYPKNHDEIDIELLGRSRRDDWT  133

Query  723   LQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAIS  544
             +QTN+Y NGS +TGREEKFY WFDPTQA HDY+++WNSHH +FLVDNIPVR+  N  A +
Sbjct  134   IQTNVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFT  193

Query  543   TVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT--NSSS----D  382
             + YPSKPMS+YVT+WDGSEWAT GGKYPVNY YAPFVAS+  VEL GC+  N SS     
Sbjct  194   SAYPSKPMSLYVTVWDGSEWATKGGKYPVNYKYAPFVASVADVELSGCSVYNGSSIGSGP  253

Query  381   CTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             CT+   S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P EC
Sbjct  254   CTKSGGSISSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKSRYKVMPAEC  309



>ref|XP_004297640.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33-like [Fragaria vesca subsp. vesca]
Length=308

 Score =   384 bits (986),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 218/288 (76%), Gaps = 7/288 (2%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
              S+R   YT PSV RLTD F    +S  ++  +GG N+Q+  NGS A LVLDKSSG GL 
Sbjct  23    ASSRKRRYTSPSVPRLTDAFPHVSISNVFSKAFGGSNVQVTGNGSMATLVLDKSSGSGLA  82

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             S ++Y+YGFF+AAIKLP G +SGVVVAFY+SN DV+PHNHDEIDIELLG+DKR +WV+QT
Sbjct  83    SVNKYHYGFFSAAIKLPPGDSSGVVVAFYLSNADVFPHNHDEIDIELLGHDKRNEWVIQT  142

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGSV TGREEKFYLWFDPT   H Y+I+WN++H +FLVDNIPVRE  +    S+ +
Sbjct  143   NMYANGSVSTGREEKFYLWFDPTTQHHQYTIIWNNYHAVFLVDNIPVREFEHK---SSFF  199

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC----TNSSSDCTRRS  367
             PSKPM+VY TIWDGSEWATHGGKYPVNY  APF  S   +E+ GC    + S+  C++ S
Sbjct  200   PSKPMTVYATIWDGSEWATHGGKYPVNYKNAPFTVSFAEMEISGCISNPSASAPSCSKTS  259

Query  366   PSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
              S   +EG  FVKLT QQ+S + WARGK MFYSYCKD +R+KV+P EC
Sbjct  260   SSLDPVEGPEFVKLTNQQVSAMDWARGKLMFYSYCKDTSRFKVMPPEC  307



>emb|CCH26639.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=303

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 226/303 (75%), Gaps = 15/303 (5%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F+ L M+ +    S     YTPPSV RLTD   +    + +  ++G  NIQL+NNGSS D
Sbjct  8     FIFLCMLFVAPSCSR---YYTPPSVPRLTDLVPRVSTDQCFAKIFGASNIQLRNNGSSVD  64

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDK SG GLVS+++Y+YGFF+A+IKLP+G TSGVVVAFY+SN DVYPH+HDEIDIELL
Sbjct  65    LTLDKVSGAGLVSRNKYHYGFFSASIKLPSGLTSGVVVAFYLSNADVYPHSHDEIDIELL  124

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+DKR+DWV+QTN+Y NGSVKTGREEKFYLWFDP+   HDY+I+WN++H +FLVDN+PVR
Sbjct  125   GHDKRKDWVIQTNIYANGSVKTGREEKFYLWFDPSLKYHDYTIIWNNYHTVFLVDNVPVR  184

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEG----  403
             E+ N+      YPSKPMSV+VTIWDGSEWATHGGKYPV+Y +AP+ AS   +E+ G    
Sbjct  185   ELRNSEVF---YPSKPMSVFVTIWDGSEWATHGGKYPVDYKHAPYTASFEEMEINGGILT  241

Query  402   ---CTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
                   SSS      P T+  EG  F+KL+QQQ+  + WAR K MFYSYCKD +RYKVLP
Sbjct  242   PTATVPSSSKANVSGPDTA--EGPEFIKLSQQQVDAMDWARRKLMFYSYCKDTSRYKVLP  299

Query  231   LEC  223
              EC
Sbjct  300   PEC  302



>ref|XP_006417453.1| hypothetical protein EUTSA_v10008234mg [Eutrema salsugineum]
 gb|ESQ35806.1| hypothetical protein EUTSA_v10008234mg [Eutrema salsugineum]
Length=318

 Score =   384 bits (985),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 224/297 (75%), Gaps = 11/297 (4%)
 Frame = -1

Query  1083  ITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGC  904
             ++ VS+    +T P+V RLTD+F++  +  G++  +G  NI +  NGS A L LDKSSG 
Sbjct  24    LSLVSSHSRKFTTPNVTRLTDQFSKIAIENGFSKRFGAPNILV--NGSLAKLTLDKSSGA  81

Query  903   GLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWV  724
             GLVSK+RY+YGFF+A +KLPAGF SGVVVAFY+SN + YP NHDEIDIELLG  +R DWV
Sbjct  82    GLVSKNRYHYGFFSAKLKLPAGFASGVVVAFYLSNAESYPKNHDEIDIELLGRSRRDDWV  141

Query  723   LQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAIS  544
             +QTN+Y NGS+KTGREEKFY WFDPTQA HDY+++WNSHHI+F VDNIPVR+  N  A  
Sbjct  142   IQTNVYANGSLKTGREEKFYFWFDPTQAFHDYTLVWNSHHIVFFVDNIPVRQFPNRGAFM  201

Query  543   TVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT------NSSSD  382
             + YPSKPMS+YVT+WDGSEWATHGGKYPVNY Y PFVAS+  V+L GC+        S  
Sbjct  202   SAYPSKPMSLYVTVWDGSEWATHGGKYPVNYKYGPFVASVADVKLSGCSVNNGSFTGSGA  261

Query  381   CTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
             CT+   S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P EC+
Sbjct  262   CTKSGGSISSLDPVDGQDFATLSKNQITAMDWARRKLMFYSYCSDKSRYKVMPAECS  318



>ref|XP_004170208.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33-like [Cucumis sativus]
Length=310

 Score =   383 bits (984),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 226/303 (75%), Gaps = 15/303 (5%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F+ L M+ +    S     YTPPSV RLTD   +    + +  ++G  NIQL+NNGSS D
Sbjct  15    FIFLCMLFVAPSCSR---YYTPPSVPRLTDLVPRVSTDQCFAKIFGASNIQLRNNGSSVD  71

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDK SG GLVS+++Y+YGFF+A+IKLP+G TSGVVVAFY+SN DVYPH+HDEIDIELL
Sbjct  72    LTLDKVSGAGLVSRNKYHYGFFSASIKLPSGLTSGVVVAFYLSNADVYPHSHDEIDIELL  131

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+DKR+DWV+QTN+Y NGSVKTGREEKFYLWFDP+   HDY+I+WN++H +FLVDN+PVR
Sbjct  132   GHDKRKDWVIQTNIYANGSVKTGREEKFYLWFDPSLKYHDYTIIWNNYHTVFLVDNVPVR  191

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEG----  403
             E+ N+      YPSKPMSV+VTIWDGSEWATHGGKYPV+Y +AP+ AS   +E+ G    
Sbjct  192   ELRNSEVF---YPSKPMSVFVTIWDGSEWATHGGKYPVDYKHAPYTASFEEMEINGGILT  248

Query  402   ---CTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
                   SSS      P T+  EG  F+KL+QQQ+  + WAR K MFYSYCKD +RYKVLP
Sbjct  249   PTATVPSSSKANVSGPDTA--EGPEFIKLSQQQVDAMDWARRKLMFYSYCKDTSRYKVLP  306

Query  231   LEC  223
              EC
Sbjct  307   PEC  309



>ref|XP_004135238.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33-like [Cucumis sativus]
 gb|KGN51813.1| hypothetical protein Csa_5G602120 [Cucumis sativus]
Length=310

 Score =   383 bits (983),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 226/303 (75%), Gaps = 15/303 (5%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F+ L M+ +    S     YTPPSV RLTD   +    + +  ++G  NIQL+NNGSS D
Sbjct  15    FIFLCMLFVAPSCSR---YYTPPSVPRLTDLVPRVSTDQCFAKIFGASNIQLRNNGSSVD  71

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDK SG GLVS+++Y+YGFF+A+IKLP+G TSGVVVAFY+SN DVYPH+HDEIDIELL
Sbjct  72    LTLDKVSGAGLVSRNKYHYGFFSASIKLPSGLTSGVVVAFYLSNADVYPHSHDEIDIELL  131

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+DKR+DWV+QTN+Y NGSVKTGREEKFYLWFDP+   HDY+I+WN++H +FLVDN+PVR
Sbjct  132   GHDKRKDWVIQTNIYANGSVKTGREEKFYLWFDPSLKYHDYTIIWNNYHTVFLVDNVPVR  191

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEG----  403
             E+ N+      YPSKPMSV+VTIWDGSEWATHGGKYPV+Y +AP+ AS   +E+ G    
Sbjct  192   ELRNSEVF---YPSKPMSVFVTIWDGSEWATHGGKYPVDYKHAPYTASFEEMEINGGILT  248

Query  402   ---CTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
                   SSS      P T+  EG  F+KL+QQQ+  + WAR K MFYSYCKD +RYKVLP
Sbjct  249   PKATVPSSSKANVSGPDTA--EGPEFIKLSQQQVDAMDWARRKLMFYSYCKDTSRYKVLP  306

Query  231   LEC  223
              EC
Sbjct  307   PEC  309



>ref|XP_010544004.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Tarenaya hassleriana]
Length=318

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 222/299 (74%), Gaps = 6/299 (2%)
 Frame = -1

Query  1107  LILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADL  928
             L+  +      VSA    YT P+V RLTD F++  + EG++  +G  NIQ+  NG++A L
Sbjct  21    LVFCLCSWAQMVSAHSRKYTTPNVKRLTDYFSRISIDEGFSQRFGTQNIQI--NGTAAKL  78

Query  927   VLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLG  748
              LDK+SG GLVSK  Y+YGFF+A +KLPAGF SGVVVAFY+SN + YP NHDEIDIE+LG
Sbjct  79    TLDKTSGAGLVSKSNYHYGFFSAKLKLPAGFASGVVVAFYLSNAEKYPKNHDEIDIEILG  138

Query  747   YDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVRE  568
               +R DWV+QTN+Y NGS+ TGREEKFY WFDPTQ  H YS++WN+HHILFL+DNIPVRE
Sbjct  139   RSRRDDWVVQTNVYANGSLSTGREEKFYFWFDPTQDFHYYSVIWNTHHILFLIDNIPVRE  198

Query  567   VVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-NS  391
               N  A +  YPSKPMS+YVT+WDGSEWATHGGKYPVNY Y PFVAS+  VEL GC+ + 
Sbjct  199   FPNRGAFTKAYPSKPMSLYVTVWDGSEWATHGGKYPVNYKYGPFVASIADVELNGCSVDG  258

Query  390   SSDCTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             +  CT+   S S L   +G+ F  L+++QI+ + WAR K MFYSYC DK RYKV+P EC
Sbjct  259   TGSCTKSGGSVSGLDPVDGQDFATLSKEQITAMDWARRKLMFYSYCSDKPRYKVMPSEC  317



>ref|NP_172525.1| probable xyloglucan endotransglucosylase/hydrolase protein 33 
[Arabidopsis thaliana]
 sp|Q8LC45.2|XTH33_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 33; Short=At-XTH33; Short=XTH-33; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD39577.1|AC007067_17 T10O24.17 [Arabidopsis thaliana]
 gb|AEE28593.1| probable xyloglucan endotransglucosylase/hydrolase protein 33 
[Arabidopsis thaliana]
Length=310

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 222/296 (75%), Gaps = 11/296 (4%)
 Frame = -1

Query  1083  ITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGC  904
             ++ VS+    +T P+V RLTD+F++  +  G++  +G HNIQ+  NGS A L LDKSSG 
Sbjct  16    LSLVSSHSRKFTTPNVTRLTDQFSKIAIENGFSRRFGAHNIQV--NGSLAKLTLDKSSGA  73

Query  903   GLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWV  724
             GLVSK++Y+YGFF+A +KLPAGF SGVVVAFY+SN + YP +HDEIDIELLG  +R DW 
Sbjct  74    GLVSKNKYHYGFFSARLKLPAGFASGVVVAFYLSNAETYPKSHDEIDIELLGRSRRDDWT  133

Query  723   LQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAIS  544
             +QTN+Y NGS +TGREEKFY WFDPTQA HDY+++WNSHH +FLVDNIPVR+  N  A +
Sbjct  134   IQTNVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFT  193

Query  543   TVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC------TNSSSD  382
             + YPSKPMS+YVT+WDGSEWAT GGKYPVNY YAPFV S+  VEL GC      +  S  
Sbjct  194   SAYPSKPMSLYVTVWDGSEWATKGGKYPVNYKYAPFVVSVADVELSGCSVNNGSSTGSGP  253

Query  381   CTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             CT+   S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK RYKV+P EC
Sbjct  254   CTKSGGSISSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKPRYKVMPAEC  309



>gb|AFK37086.1| unknown [Lotus japonicus]
Length=309

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 219/296 (74%), Gaps = 5/296 (2%)
 Frame = -1

Query  1095  MVVIITKV-SARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLD  919
             +++  T V S+R   YTPPSV RLTD F Q  +   ++  +G  N+Q  +NGS A L LD
Sbjct  13    LILCFTNVFSSRIRPYTPPSVTRLTDSFPQVSIDRAFSKGFGASNVQFLSNGSMATLALD  72

Query  918   KSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDK  739
             K SG GLVS+ RY YGFF+AAIKLPAG +SGVVVAFY+SN D +PH+HDEIDIELLG+DK
Sbjct  73    KISGSGLVSQSRYSYGFFSAAIKLPAGLSSGVVVAFYLSNADKFPHHHDEIDIELLGHDK  132

Query  738   RRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVN  559
             R DWV+QTN+Y NGSV TGREEKFY WFDPTQ  H YSILWNS+H +FLVDNIPVRE ++
Sbjct  133   RNDWVIQTNIYANGSVGTGREEKFYPWFDPTQQHHYYSILWNSYHTVFLVDNIPVREFIH  192

Query  558   NAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTN----S  391
             ++   ++YPSKPMSVY TIWD SEWAT GGKYPVNY  APFV S   +E  GC +    S
Sbjct  193   SSTYPSIYPSKPMSVYATIWDASEWATKGGKYPVNYKNAPFVVSFAEMEQSGCISDPAAS  252

Query  390   SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
              S C++ +PS     G  F KL+QQQI+ + WAR K MFYSYC DK R+KVLP EC
Sbjct  253   VSLCSKANPSGLDPNGAEFTKLSQQQIAAMDWARRKLMFYSYCNDKPRFKVLPPEC  308



>gb|AAM63851.1| putative endoxyloglucan transferase [Arabidopsis thaliana]
Length=307

 Score =   381 bits (979),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 221/296 (75%), Gaps = 11/296 (4%)
 Frame = -1

Query  1083  ITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGC  904
             ++ VSA    +T P+V RLTD+F++  +  G++  +G HNIQ+  NGS A L LDKSSG 
Sbjct  13    LSLVSAHSRKFTTPNVTRLTDQFSKIAIENGFSRRFGAHNIQV--NGSLAKLTLDKSSGA  70

Query  903   GLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWV  724
             GLVSK+ Y+YGFF+A +KLPAGF SGVVVAFY+SN + YP +HDEIDIELLG  +R DW 
Sbjct  71    GLVSKNNYHYGFFSARLKLPAGFASGVVVAFYLSNAETYPKSHDEIDIELLGRSRRDDWT  130

Query  723   LQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAIS  544
             +QTN+Y NGS +TGREEKFY WFDPTQA HDY+++WNSHH +FLVDNIPVR+  N  A +
Sbjct  131   IQTNVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFT  190

Query  543   TVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC------TNSSSD  382
             + YPSKPMS+YVT+WDGSEWAT GGKYPVNY YAPFV S+  VEL GC      +  S  
Sbjct  191   SAYPSKPMSLYVTVWDGSEWATKGGKYPVNYKYAPFVVSVADVELSGCSVNNGSSTGSGP  250

Query  381   CTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             CT+   S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK RYKV+P EC
Sbjct  251   CTKSGGSISSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKPRYKVMPAEC  306



>ref|XP_011040569.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Populus euphratica]
Length=311

 Score =   381 bits (979),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 229/301 (76%), Gaps = 6/301 (2%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
              L+L M   ++  S R   YTPP+V RLTD F+   + + Y+  +GG N +L NNGSSA+
Sbjct  12    LLVLCMTAAVSSHS-RHSRYTPPNVMRLTDAFSHVSIGQEYSTFFGGSNTKLLNNGSSAN  70

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDKSSG GLVS+++YYYGFF+AAIKLP+G + GVVVAFY+SN D YPHNHDEIDIELL
Sbjct  71    LALDKSSGSGLVSRNKYYYGFFSAAIKLPSGLSPGVVVAFYLSNADNYPHNHDEIDIELL  130

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+D R DWVLQTN+Y NGS  TGREEKFYLWFDPT+  H YSI+WNSHHI+FLVDN+PVR
Sbjct  131   GHDMRNDWVLQTNVYANGSTGTGREEKFYLWFDPTEQHHHYSIIWNSHHIVFLVDNVPVR  190

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNS  391
             E  ++++  +VYPSKPMS+Y TIWDGS+WATHGGKYPVNY YAPFV S   +E+ GC  +
Sbjct  191   EFAHSSSYPSVYPSKPMSLYATIWDGSQWATHGGKYPVNYKYAPFVVSFAEMEMTGCIFN  250

Query  390   SS----DCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
              S     C++ +PS+   ++G  F +L+++Q   + WAR K MFYSYC DK+R+K +P E
Sbjct  251   QSALVTSCSKANPSSLDPVDGPEFARLSKEQSVAMDWARRKLMFYSYCNDKSRFKAMPPE  310

Query  225   C  223
             C
Sbjct  311   C  311



>emb|CDY20620.1| BnaC08g14380D [Brassica napus]
Length=317

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 223/293 (76%), Gaps = 11/293 (4%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
             VS+    +T P+V R+TD+F++  +  G++  +G HNI +  NGS A L LDKSSG GLV
Sbjct  27    VSSHSRKFTTPNVTRVTDQFSRIAIESGFSKRFGDHNIIV--NGSLAKLTLDKSSGAGLV  84

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             +K+RY+YGFF+A +KLPAGF SGVVVAFY+SN + YP  HDEIDIELLG  +R DW +QT
Sbjct  85    TKNRYHYGFFSARLKLPAGFASGVVVAFYLSNAESYPKTHDEIDIELLGRSRRDDWSIQT  144

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGS+KTGREEKFY WFDPTQA HDY+++WNSHHI+FLVDNIPVRE  N  A  + Y
Sbjct  145   NVYANGSLKTGREEKFYYWFDPTQAFHDYTLIWNSHHIVFLVDNIPVREFPNRGAFMSAY  204

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT--NSSSD----CTR  373
             PSKPMS+YVT+WDGSEWATHGGKYPVNY Y PFVAS+  V+L GC+  N SS     CT+
Sbjct  205   PSKPMSLYVTVWDGSEWATHGGKYPVNYKYGPFVASIADVKLSGCSVNNGSSSGPGPCTK  264

Query  372   RSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P EC
Sbjct  265   SGGSVSSLDPVDGQDFATLSKNQIAAMDWARRKLMFYSYCNDKSRYKVMPAEC  317



>ref|XP_009144434.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Brassica rapa]
Length=317

 Score =   380 bits (977),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 223/293 (76%), Gaps = 11/293 (4%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
             VS+    +T P+V R+TD+F++  +  G++  +G HNI +  NGS A L LDKSSG GLV
Sbjct  27    VSSHSRKFTTPNVTRVTDQFSRIAIESGFSKRFGDHNIII--NGSLAKLTLDKSSGAGLV  84

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             +K+ Y+YGFF+A +KLPAGF SGVVVAFY+SN + YP NHDEIDIELLG  +R DW +QT
Sbjct  85    TKNTYHYGFFSARLKLPAGFASGVVVAFYLSNAESYPKNHDEIDIELLGRSRRDDWSIQT  144

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGS+KTGREEKFY WFDPTQA HDY+++WNSHHI+FLVDNIPVRE  N  A  + Y
Sbjct  145   NVYANGSLKTGREEKFYYWFDPTQAFHDYTLIWNSHHIVFLVDNIPVREFPNRGAFMSAY  204

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT--NSSSD----CTR  373
             PSKPMS+YVT+WDGSEWATHGGKYPVNY Y PFVAS+  V+L GC+  N SS     CT+
Sbjct  205   PSKPMSLYVTVWDGSEWATHGGKYPVNYKYGPFVASIADVKLSGCSVNNGSSTGPGPCTK  264

Query  372   RSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P EC
Sbjct  265   SGGSVSSLDPVDGQDFATLSKNQIAAMDWARRKLMFYSYCNDKSRYKVMPAEC  317



>gb|KHN39740.1| Putative xyloglucan endotransglucosylase/hydrolase protein 33 
[Glycine soja]
Length=310

 Score =   380 bits (976),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 220/301 (73%), Gaps = 6/301 (2%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F  L ++ + T VS+  P YT PSV RLTD F +  V   ++  +G  NIQ  +NGS+  
Sbjct  10    FSYLLILCLATLVSSHRP-YTTPSVTRLTDSFPRVQVDSAFSKTFGAKNIQFLSNGSTVT  68

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDK SG GLVS+ RY YGFF+AAIKLP+G + GVVVAFY+SN D +PHNHDEIDIELL
Sbjct  69    LALDKISGSGLVSQSRYSYGFFSAAIKLPSGLSPGVVVAFYLSNSDKFPHNHDEIDIELL  128

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+DKR DWV+QTN+Y NGSV TGREEKFY WFDPTQ  H YSILWNS+H +FLVDNIPVR
Sbjct  129   GHDKRNDWVIQTNIYANGSVSTGREEKFYFWFDPTQQYHYYSILWNSYHTVFLVDNIPVR  188

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNS  391
             E +++    ++YPSKPMSVY TIWDGSEWATHGGKYPVNY YAPFV S  ++EL GC + 
Sbjct  189   EFIHSNTYPSIYPSKPMSVYATIWDGSEWATHGGKYPVNYKYAPFVVSFAQIELSGCISD  248

Query  390   SSDCTRRSPSTSS-----LEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
              +         SS     + G  F KL+QQQI+ + WAR K MFYSYC D++R+KV+P E
Sbjct  249   PTAPVSSCSKASSSGLDPVNGPEFTKLSQQQIAAMDWARRKLMFYSYCNDRSRFKVMPPE  308

Query  225   C  223
             C
Sbjct  309   C  309



>ref|XP_002320268.2| xyloglucan endotransglucosylase/hydrolase protein 33 precursor 
[Populus trichocarpa]
 gb|EEE98583.2| xyloglucan endotransglucosylase/hydrolase protein 33 precursor 
[Populus trichocarpa]
Length=312

 Score =   380 bits (976),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 228/301 (76%), Gaps = 6/301 (2%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
              L+L M   ++  S R   YTPP+V RLTD F+   + + Y+  +GG N +L NNGSSA+
Sbjct  12    LLVLCMTAAVSSHS-RHSRYTPPNVMRLTDAFSHVSIGQEYSTFFGGSNTKLLNNGSSAN  70

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDKSSG GL S+++YYYGFF+AAIKLP+G + GVVVAFY+SN D YPHNHDEIDIELL
Sbjct  71    LALDKSSGSGLASRNKYYYGFFSAAIKLPSGLSPGVVVAFYLSNADNYPHNHDEIDIELL  130

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+D R DWVLQTN+Y NGS  TGREEKFYLWFDPT+  H YSI+WNSHHI+FLVDN+PVR
Sbjct  131   GHDMRNDWVLQTNVYANGSTGTGREEKFYLWFDPTEQHHHYSIIWNSHHIVFLVDNVPVR  190

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC---  400
             E  ++++  +VYPSKPMS+Y TIWDGS+WATHGGKYPVNY YAPFV S   +E+ GC   
Sbjct  191   EFAHSSSYPSVYPSKPMSLYATIWDGSQWATHGGKYPVNYKYAPFVVSFAEMEMTGCIFN  250

Query  399   -TNSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
              T   + C++ +PS+   ++G  FV+L+ +Q   + WAR K MFYSYC D++R+K +P E
Sbjct  251   QTALVTSCSKANPSSLDPVDGPEFVRLSNEQSVAMDWARRKLMFYSYCNDRSRFKAMPPE  310

Query  225   C  223
             C
Sbjct  311   C  311



>ref|XP_003552017.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33-like [Glycine max]
Length=320

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 220/301 (73%), Gaps = 6/301 (2%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F  L ++ + T VS+  P YT PSV RLTD F +  V   ++  +G  NIQ  +NGS+  
Sbjct  20    FSYLLILCLATLVSSHRP-YTTPSVTRLTDSFPRVQVDSAFSKTFGAKNIQFLSNGSTVT  78

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDK SG GLVS+ RY YGFF+AAIKLP+G + GVVVAFY+SN D +PHNHDEIDIELL
Sbjct  79    LALDKISGSGLVSQSRYSYGFFSAAIKLPSGLSPGVVVAFYLSNSDKFPHNHDEIDIELL  138

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+DKR DWV+QTN+Y NGSV TGREEKFY WFDPTQ  H YSILWNS+H +FLVDNIPVR
Sbjct  139   GHDKRNDWVIQTNIYANGSVSTGREEKFYFWFDPTQQYHYYSILWNSYHTVFLVDNIPVR  198

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNS  391
             E +++    ++YPSKPMSVY TIWDGSEWATHGGKYPVNY YAPFV S  ++EL GC + 
Sbjct  199   EFIHSNTYPSIYPSKPMSVYATIWDGSEWATHGGKYPVNYKYAPFVVSFAQIELSGCISD  258

Query  390   SSDCTRRSPSTSS-----LEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
              +         SS     + G  F KL+QQQI+ + WAR K MFYSYC D++R+KV+P E
Sbjct  259   PTAPVSSCSKASSSGLDPVNGPEFTKLSQQQIAAMDWARRKLMFYSYCNDRSRFKVMPPE  318

Query  225   C  223
             C
Sbjct  319   C  319



>gb|AFR46574.1| xyloglucan endotransglucosylase/hydrolase 5 [Rosa x borboniana]
Length=291

 Score =   379 bits (973),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 214/288 (74%), Gaps = 7/288 (2%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
              S+R   YT PSV RLTD F    ++  ++  +GG N+Q+  NGS A L LDK SG GL 
Sbjct  6     ASSRNRRYTSPSVPRLTDVFPHVSITNVFSKAFGGSNVQVTGNGSMATLALDKISGSGLA  65

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             S ++Y+YGFF+AAIKLP G +SGVVVAFY+SN DV+PHNHDEIDIELLG+DKR +WV+QT
Sbjct  66    SVNKYHYGFFSAAIKLPPGDSSGVVVAFYLSNADVFPHNHDEIDIELLGHDKRNEWVIQT  125

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGSV TGREEKFYLWFDPT   H Y+I+WN+HH +FLVDNIPVRE  ++   ST Y
Sbjct  126   NVYANGSVNTGREEKFYLWFDPTTQHHQYTIIWNNHHTVFLVDNIPVREFQHS---STFY  182

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC----TNSSSDCTRRS  367
             PSKPMSVY TIWDGSEWATHGGKYPVNY  APF  S   +E+ GC    + S S C++  
Sbjct  183   PSKPMSVYATIWDGSEWATHGGKYPVNYKNAPFTVSFAEMEMSGCISNPSASPSSCSKTP  242

Query  366   PSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
              S   +EG  FVKLT QQ S + WAR K MFYSYCKD +R+KV+P EC
Sbjct  243   SSLDPVEGPEFVKLTNQQASAMDWARRKLMFYSYCKDTSRFKVMPPEC  290



>ref|XP_004509833.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33-like [Cicer arietinum]
Length=313

 Score =   379 bits (974),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 220/303 (73%), Gaps = 8/303 (3%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
             FFLI+    + T VS+    Y+ PSV  LTD F    +   ++  +G  N++  ++GS A
Sbjct  12    FFLII--FCLATLVSSHSRPYSTPSVTHLTDSFPHVPIDSAFSNAFGATNVKFLSHGSMA  69

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
              L LDK SG GLVSK+RYYYGFF+AAIKLPAG + GVVVAFYMSN D +PHNHDEIDIE+
Sbjct  70    TLALDKISGSGLVSKNRYYYGFFSAAIKLPAGLSPGVVVAFYMSNADKFPHNHDEIDIEI  129

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG+DKR DWV+QTN+Y NGSV TGREEKFY WFDPTQ  H YSILWN++H +F VDNIPV
Sbjct  130   LGHDKRNDWVVQTNIYANGSVSTGREEKFYFWFDPTQQHHYYSILWNNYHTVFFVDNIPV  189

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC--  400
             RE  ++    ++YPSKPMSVY TIWDGSEWATHGGKYPVNY Y+PF+ S   +EL GC  
Sbjct  190   REFKHSNTHLSIYPSKPMSVYATIWDGSEWATHGGKYPVNYKYSPFIVSFAEMELSGCIA  249

Query  399   --TNSSSDCTRRS-PS-TSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
               T S S C+  + PS    + G  F KL+QQQI+ + WAR K MFYSYC D+ RYKVLP
Sbjct  250   DPTASISSCSNSNHPSQIDPVNGAEFTKLSQQQIAAMNWARNKLMFYSYCNDRTRYKVLP  309

Query  231   LEC  223
              EC
Sbjct  310   PEC  312



>gb|ABM91064.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-38 [Populus 
tremula x Populus tremuloides]
Length=312

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 229/301 (76%), Gaps = 6/301 (2%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
              L+L M   ++  S R   YTPP+V RLTD F+   + + Y+  +GG N +L NNGSSA+
Sbjct  12    LLVLCMTAAVSSHS-RHSRYTPPNVVRLTDAFSHVSIGQEYSTFFGGSNTKLLNNGSSAN  70

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDKSSG GLVS+++YYYGFF+AAIKLP+G + GVVVAFY+SN D YPHNHDEIDIELL
Sbjct  71    LALDKSSGSGLVSRNKYYYGFFSAAIKLPSGLSPGVVVAFYLSNADNYPHNHDEIDIELL  130

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+D R DW LQTN+Y NGS  TGREEKFYLWFDPT+  H YSI+WNSHHI+FLVDN+PVR
Sbjct  131   GHDMRNDWALQTNVYANGSTGTGREEKFYLWFDPTEQHHHYSIIWNSHHIVFLVDNVPVR  190

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC---  400
             E  ++++  +VYPSKPMS+Y TIWDGS+WATHGGKYPVNY YAPFV S   +E+ GC   
Sbjct  191   EFAHSSSYPSVYPSKPMSLYATIWDGSQWATHGGKYPVNYKYAPFVVSFAEMEMTGCIFN  250

Query  399   -TNSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
              T   + C++ +PS+   ++G  F +L+++Q + + WAR K MFYSYC D++R+K +P E
Sbjct  251   QTAIVTSCSKANPSSLDPVDGPEFARLSKEQSAAMDWARRKLMFYSYCNDRSRFKGMPPE  310

Query  225   C  223
             C
Sbjct  311   C  311



>emb|CDY20956.1| BnaA08g25690D [Brassica napus]
Length=317

 Score =   379 bits (972),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/293 (61%), Positives = 222/293 (76%), Gaps = 11/293 (4%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
             VS+    +T P+V R+TD+F++  +  G++  +G HNI +  NGS A L LDKSSG GLV
Sbjct  27    VSSHSRKFTTPNVTRVTDQFSRIAIESGFSKRFGDHNIIV--NGSLAKLTLDKSSGAGLV  84

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             +K+ Y+YGFF+A +KLPAGF SGVVVAFY+SN + YP  HDEIDIELLG  +R DW +QT
Sbjct  85    TKNTYHYGFFSARLKLPAGFASGVVVAFYLSNAESYPKTHDEIDIELLGRSRRDDWSIQT  144

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGS+KTGREEKFY WFDPTQA HDY+++WNSHHI+FLVDNIPVRE  N  A  + Y
Sbjct  145   NVYANGSLKTGREEKFYYWFDPTQAFHDYTLIWNSHHIVFLVDNIPVREFPNRGAFMSAY  204

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT--NSSSD----CTR  373
             PSKPMS+YVT+WDGSEWATHGGKYPVNY Y PFVAS+  V+L GC+  N SS     CT+
Sbjct  205   PSKPMSLYVTVWDGSEWATHGGKYPVNYKYGPFVASIADVKLSGCSVNNGSSSGPGPCTK  264

Query  372   RSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P EC
Sbjct  265   SGGSVSSLDPVDGQDFATLSKNQIAAMDWARRKLMFYSYCNDKSRYKVMPAEC  317



>ref|XP_008340024.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Malus domestica]
Length=307

 Score =   378 bits (970),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 227/315 (72%), Gaps = 14/315 (4%)
 Frame = -1

Query  1152  MGLFKNSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYG  973
             M  F    +F+    LIL  + ++     R   YT PSV RLTD F +  +  G++ ++G
Sbjct  1     MAFFXGKIHFWC--VLILCCMSLLVSSDRR---YTSPSVPRLTDVFPRVSIDRGFSKVFG  55

Query  972   GHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQD  793
             G NIQ+ N GS A L LDK+SG GL S ++++YGFF+AAIKLPAG TSGVVVAFY+SN D
Sbjct  56    GSNIQVIN-GSMATLALDKNSGSGLASVNKFHYGFFSAAIKLPAGLTSGVVVAFYLSNAD  114

Query  792   VYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWN  613
             V+PHNHDEIDIELLG+DKR DWV+QTN+Y NGSV TGREEKFYLWFDPT   H YSI+WN
Sbjct  115   VFPHNHDEIDIELLGHDKRNDWVIQTNIYANGSVNTGREEKFYLWFDPTLQHHQYSIIWN  174

Query  612   SHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFV  433
             +HH +FLVDN+PVRE  ++   S+ +PSKPMSVY TIWD SEWATHGGKYPVNY YAPF 
Sbjct  175   NHHTVFLVDNVPVREFQHS---SSFFPSKPMSVYATIWDASEWATHGGKYPVNYKYAPFR  231

Query  432   ASMGRVELEGC----TNSSSDCTRRSPST-SSLEGEGFVKLTQQQISGLQWARGKHMFYS  268
              S   +E+ GC    T + + C R +PS+   +EG  FVKL+ QQ   + WAR K MFYS
Sbjct  232   VSFAEMEMSGCISNPTGTVTSCARSNPSSVDPVEGPEFVKLSSQQSGAMDWARSKLMFYS  291

Query  267   YCKDKARYKVLPLEC  223
             YCKD  R+KV+P EC
Sbjct  292   YCKDTKRFKVMPPEC  306



>ref|XP_010491392.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Camelina sativa]
Length=319

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/293 (61%), Positives = 221/293 (75%), Gaps = 11/293 (4%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
             VS+    +T PSV RLTD+F++  +  G++  +G HNI +  NGS A L LDKSSG GL+
Sbjct  28    VSSHSRKFTTPSVTRLTDQFSKIAIERGFSRRFGDHNIVV--NGSLAKLTLDKSSGAGLM  85

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             SK++Y YGFF+A +KLPAGF SGVVVAFY+SN + YP +HDEIDIELLG  +R DW +QT
Sbjct  86    SKNKYQYGFFSARLKLPAGFASGVVVAFYLSNAESYPKSHDEIDIELLGRSRRDDWTIQT  145

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGS +TGREEKFY WFDPTQA HDY+++WNSHH +FLVDNIPVR+  N  A ++ Y
Sbjct  146   NVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFTSAY  205

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT--NSSSD----CTR  373
             PSKPMS+YVT+WDGSEWAT GGKYPVNY Y+PFV S+  VEL GC+  N SS     CT+
Sbjct  206   PSKPMSLYVTVWDGSEWATKGGKYPVNYKYSPFVVSVADVELSGCSVNNGSSTGTGPCTK  265

Query  372   RSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P EC
Sbjct  266   SGGSVSSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKSRYKVMPAEC  318



>ref|XP_010475924.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Camelina sativa]
Length=318

 Score =   376 bits (966),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/293 (61%), Positives = 221/293 (75%), Gaps = 11/293 (4%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
             VS+    +T PSV RLTD+F++  +  G++  +G HNI +  NGS A L LDKSSG GL+
Sbjct  27    VSSHSRKFTTPSVTRLTDQFSKIAIESGFSRRFGDHNIVV--NGSLAKLTLDKSSGAGLM  84

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             SK++Y YGFF+A +KLPAGF SGVVVAFY+SN + YP +HDEIDIELLG  +R DW +QT
Sbjct  85    SKNKYQYGFFSARLKLPAGFASGVVVAFYLSNAESYPKSHDEIDIELLGRSRRDDWTIQT  144

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGS +TGREEKFY WFDPTQA HDY+++WNSHH +FLVDNIPVR+  N  A ++ Y
Sbjct  145   NVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFTSAY  204

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT--NSSSD----CTR  373
             PSKPMS+YVT+WDGSEWAT GGKYPVNY Y+PFV S+  VEL GC+  N SS     CT+
Sbjct  205   PSKPMSLYVTVWDGSEWATKGGKYPVNYKYSPFVVSVADVELSGCSVNNGSSTGTGPCTK  264

Query  372   RSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P EC
Sbjct  265   SGGSVSSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKSRYKVMPAEC  317



>ref|XP_010458404.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Camelina sativa]
Length=319

 Score =   374 bits (959),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/293 (60%), Positives = 220/293 (75%), Gaps = 11/293 (4%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
             VS+    +T PSV RLTD+F++  +  G++  +G  NI +  NGS A L LDKSSG GL+
Sbjct  28    VSSHSRKFTTPSVTRLTDQFSKIAIESGFSRRFGDRNIVV--NGSLAKLTLDKSSGAGLM  85

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             SK++Y YGFF+A +KLPAGF SGVVVAFY+SN + YP +HDEIDIELLG  +R DW +QT
Sbjct  86    SKNKYQYGFFSARLKLPAGFASGVVVAFYLSNAESYPKSHDEIDIELLGRSRRDDWTIQT  145

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGS +TGREEKFY WFDPTQA HDY+++WNSHH +FLVDNIPVR+  N  A ++ Y
Sbjct  146   NVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFTSAY  205

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT--NSSSD----CTR  373
             PSKPMS+YVT+WDGSEWAT GGKYPVNY Y+PFV S+  VEL GC+  N SS     CT+
Sbjct  206   PSKPMSLYVTVWDGSEWATKGGKYPVNYKYSPFVVSVADVELSGCSVNNGSSTGTGPCTK  265

Query  372   RSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+RYKV+P EC
Sbjct  266   SGGSVSSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKSRYKVMPAEC  318



>gb|KHG29510.1| putative xyloglucan endotransglucosylase/hydrolase 33 -like protein 
[Gossypium arboreum]
Length=310

 Score =   373 bits (957),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 222/302 (74%), Gaps = 6/302 (2%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
               L LS+    + VS+    YT PSV RLTD F+   V++ ++ ++GG NI++ NNGS+A
Sbjct  9     LLLCLSLFCATSLVSSHNRHYTSPSVPRLTDLFSHVSVNKSFSNVFGGPNIKILNNGSTA  68

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
                LD++SG GL S ++Y YGFF+AAIKLPAG TSGVVVAFY+SN D+YPH+HDEIDIEL
Sbjct  69    TFALDRTSGSGLASWNKYNYGFFSAAIKLPAGLTSGVVVAFYLSNADMYPHSHDEIDIEL  128

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG DKR DWVLQTN+Y NG V TGREEKFY WF+PT   H YSILWNSHHI+FLVDNIPV
Sbjct  129   LGNDKRIDWVLQTNVYANG-VSTGREEKFYFWFNPTLQHHYYSILWNSHHIVFLVDNIPV  187

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-  397
             RE  NN   S  YPSKPMS+YVTIWDGS+WATHGGKYPVNY YAPFV S+  +E+ GC  
Sbjct  188   REFPNNGKFSAAYPSKPMSLYVTIWDGSQWATHGGKYPVNYKYAPFVTSLTDLEMVGCMV  247

Query  396   ----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPL  229
                  +SS  +    S   +EG  F KL+ QQ+S + WAR K MFYSYCKD +R+KVL  
Sbjct  248   NPKQPNSSCSSASVSSIDPVEGPDFFKLSNQQMSAMVWARRKLMFYSYCKDTSRFKVLLP  307

Query  228   EC  223
             EC
Sbjct  308   EC  309



>ref|XP_008446221.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Cucumis melo]
 gb|ADN33843.1| xyloglucan endotransglycosylase hydrolase [Cucumis melo subsp. 
melo]
Length=310

 Score =   373 bits (957),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 222/303 (73%), Gaps = 15/303 (5%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F+ L M+  +   S     YT PSV RLTD   +    + +  ++G  NIQL+NNGSS D
Sbjct  15    FIFLCMLFAVPSCSR---YYTAPSVPRLTDLVPRVSTDQCFAKIFGASNIQLRNNGSSVD  71

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LDK SG GLVS+++Y+YGFF+A+IKLP+G TSGVVVAFY+SN DVYP +HDEIDIELL
Sbjct  72    LTLDKVSGAGLVSRNKYHYGFFSASIKLPSGLTSGVVVAFYLSNADVYPDSHDEIDIELL  131

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G+DKR+DWV+QTN+Y NGSVKTGREEKFYLWFDP+   HDY+I+WN++H +FLVDN+PVR
Sbjct  132   GHDKRKDWVIQTNIYANGSVKTGREEKFYLWFDPSVKYHDYTIIWNNYHTVFLVDNVPVR  191

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEG----  403
             E+ N+      YP KPMSV+VTIWDGSEWATHGGKYPV+Y +AP+ AS   +E+ G    
Sbjct  192   ELRNSEVF---YPLKPMSVFVTIWDGSEWATHGGKYPVDYKHAPYTASFEEMEINGGILT  248

Query  402   ---CTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
                   S S      P T  +EG  F+KL+QQQ+  + WAR K MFYSYCKD +RYKVLP
Sbjct  249   PTATVPSGSKANVSGPDT--VEGPEFIKLSQQQVDAMDWARRKLMFYSYCKDTSRYKVLP  306

Query  231   LEC  223
              EC
Sbjct  307   PEC  309



>emb|CDY20621.1| BnaC08g14370D [Brassica napus]
Length=306

 Score =   372 bits (955),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/284 (61%), Positives = 214/284 (75%), Gaps = 4/284 (1%)
 Frame = -1

Query  1074  VSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLV  895
             VS+    +T P+V R+TD+F++  +  G++  +G HNI +  NGS A L LDKSSG GLV
Sbjct  27    VSSHSRKFTTPNVTRVTDQFSRIAIESGFSKRFGDHNIIV--NGSLAKLTLDKSSGAGLV  84

Query  894   SKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQT  715
             +K+ Y+YGFF+A +KLPAGF SGVVVAFY+SN ++YP  HDEIDIELLG  +R DW +QT
Sbjct  85    TKNTYHYGFFSARLKLPAGFASGVVVAFYLSNAEIYPKTHDEIDIELLGRSRRDDWSIQT  144

Query  714   NLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVY  535
             N+Y NGS+KTGREEKFY WFDPTQA HDY+++WNSHHI+FLVDNIPVRE  N  A  + Y
Sbjct  145   NVYANGSLKTGREEKFYYWFDPTQAFHDYTLIWNSHHIVFLVDNIPVREFPNRGAFMSAY  204

Query  534   PSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTS  355
             PSKPMS+YVT+WDGSEWATHGGKYPVNY Y PFVAS+  V+L GC+ ++   T   P T 
Sbjct  205   PSKPMSLYVTVWDGSEWATHGGKYPVNYKYGPFVASIADVKLSGCSVNNGSSTGPGPCTK  264

Query  354   SLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             S  G     L   QI+ + WAR K MFYSYC DK+RYKV+P EC
Sbjct  265   S--GGSVSSLDPNQIAAMDWARRKLMFYSYCNDKSRYKVMPAEC  306



>ref|XP_010682574.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Beta vulgaris subsp. vulgaris]
Length=324

 Score =   373 bits (957),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 187/315 (59%), Positives = 228/315 (72%), Gaps = 17/315 (5%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYT------PPSVD--RLTDRFTQTGVSEGYNVLYGGHNIQ  958
             + +IL M+++ T  S  G I T      P S +  RLT  F     +  ++ ++G  N+Q
Sbjct  12    YAIILYMILLQT--SKNGCIITINAQNSPSSSNTPRLTSLFPHLSFNNDFSQIFGDSNVQ  69

Query  957   LKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHN  778
             +  NGS A++ LDK +G G  SK+ Y YGFF+AAIKLP GFTSG+VVAFYMSN D +PHN
Sbjct  70    IYGNGSFANISLDKKTGSGFGSKNHYNYGFFSAAIKLPPGFTSGIVVAFYMSNSDRFPHN  129

Query  777   HDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHIL  598
             HDEID ELLG+ K R+WVLQTN+Y NGSVKTGREEKF LWFDPT   H+YSI+WNSHHI+
Sbjct  130   HDEIDFELLGHQKSRNWVLQTNMYGNGSVKTGREEKFRLWFDPTTQFHEYSIIWNSHHIV  189

Query  597   FLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGR  418
             FLVDNIPVREV+N   +S  YPSKPMSVY TIWD S+WATHGGKYPVNY YAPF AS+G+
Sbjct  190   FLVDNIPVREVLNTPVMSKSYPSKPMSVYATIWDASDWATHGGKYPVNYKYAPFTASLGQ  249

Query  417   VELEGCTNSSSDCTRRSPSTSS-------LEGEGFVKLTQQQISGLQWARGKHMFYSYCK  259
             +E+ GC    +D + +S S SS       ++G+ FVKL+ QQI GLQWAR K M YSYCK
Sbjct  250   MEMAGCVYDPTDLSGKSCSKSSSPSSLDPVDGQDFVKLSNQQIKGLQWARSKQMIYSYCK  309

Query  258   DKARYKVLPLECTAK  214
             DK RYKVLP EC  +
Sbjct  310   DKRRYKVLPPECNTR  324



>ref|XP_010913577.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Elaeis guineensis]
Length=319

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 220/313 (70%), Gaps = 13/313 (4%)
 Frame = -1

Query  1128  NFFSQFFLILSM---VVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQ  958
             +  S+ F + S+     +   +    PI  PPSV RLTDRF+     E ++  +GG N+Q
Sbjct  5     HILSRLFFVASLSSCATVTRSLQHDSPI--PPSVPRLTDRFSHLPFDEAFSEFFGGPNVQ  62

Query  957   LKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHN  778
               +NGS  +L LD SSG G  S+  YYYGFF+AAIKLPA +++GVVVAFYMSN DVYPHN
Sbjct  63    RVSNGSYINLKLDNSSGSGFKSRSMYYYGFFSAAIKLPADYSAGVVVAFYMSNADVYPHN  122

Query  777   HDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHIL  598
             HDEID ELLG++KR++WVLQTN+Y NGSV TGREEKFY+WFDPT   H+YSILWNSHHI+
Sbjct  123   HDEIDFELLGHEKRKEWVLQTNIYGNGSVGTGREEKFYMWFDPTADFHEYSILWNSHHIV  182

Query  597   FLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGR  418
             FLVDNIPVREV  + A+S  YPSKPMSVY TIWDGS+WATHGGK PVNY +APFVAS+  
Sbjct  183   FLVDNIPVREVNRSVAMSRAYPSKPMSVYATIWDGSQWATHGGKKPVNYKFAPFVASLKD  242

Query  417   VELEGCTNSSSDCTRRSPSTSSLEGEG--------FVKLTQQQISGLQWARGKHMFYSYC  262
              E+EGC  + +      P+ S   G G        F +L+ QQ  G+ WAR   MFYSYC
Sbjct  243   FEMEGCAWNQTKIAPPCPNNSQNSGLGLDPVGGQEFEELSDQQKVGMAWARNGFMFYSYC  302

Query  261   KDKARYKVLPLEC  223
              D+ R+ V+P EC
Sbjct  303   NDQNRFPVIPPEC  315



>ref|XP_006305398.1| hypothetical protein CARUB_v10009787mg [Capsella rubella]
 gb|EOA38296.1| hypothetical protein CARUB_v10009787mg [Capsella rubella]
Length=317

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 227/308 (74%), Gaps = 15/308 (5%)
 Frame = -1

Query  1107  LILSMVVI----ITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGS  940
             L+++ VV     ++ VS+    +T P+V RLTD+F++  +  G++  +G HNI +  NGS
Sbjct  12    LLVTAVVFCLCSLSLVSSHSRKFTTPTVTRLTDQFSKIAIESGFSRRFGAHNIVV--NGS  69

Query  939   SADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDI  760
              A L LDKSSG GLVSK++Y YGFF+A +KLPAGF SGVVVAFY+SN + YP NHDEIDI
Sbjct  70    LAKLTLDKSSGAGLVSKNKYQYGFFSARLKLPAGFASGVVVAFYLSNAESYPKNHDEIDI  129

Query  759   ELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNI  580
             ELLG  +R DW +QTN+Y NGS +TGREEKFY WFDPTQ+ HDY+++WNSHH +FL+DNI
Sbjct  130   ELLGRSRRDDWTIQTNVYANGSTRTGREEKFYFWFDPTQSFHDYTLIWNSHHTVFLIDNI  189

Query  579   PVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC  400
             PVR+  N  A ++ YPSKPMS+Y T+WDGSEWAT GGKYPVNY Y PFVAS+  VEL GC
Sbjct  190   PVRQFPNRGAFTSAYPSKPMSLYATVWDGSEWATKGGKYPVNYKYGPFVASVADVELSGC  249

Query  399   TNSSSD------CTRRSPSTSSL---EGEGFVKLTQQQISGLQWARGKHMFYSYCKDKAR  247
             + S S       CT+   S SSL   +G+ F  L++ QI+ + WAR K MFYSYC DK+R
Sbjct  250   SVSDSSSTGSRPCTKSGGSVSSLDPVDGQDFATLSKTQINAMDWARRKLMFYSYCSDKSR  309

Query  246   YKVLPLEC  223
             YKV+P EC
Sbjct  310   YKVMPAEC  317



>ref|XP_009391747.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 33 [Musa acuminata subsp. malaccensis]
Length=318

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 213/307 (69%), Gaps = 9/307 (3%)
 Frame = -1

Query  1116  QFFLILSMV-VIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGS  940
             +   +LS +  I   +S R     PP+  RLTDRF +      ++ L+GG NI+  +NGS
Sbjct  7     RLLFVLSFISCIAISMSMRHNTPIPPTTARLTDRFPRLVFDGAFSDLFGGQNIKKTSNGS  66

Query  939   SADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDI  760
                L+LDK+SG G  S D YYYGFF+AAIKLP  +++GVVVAFYMSN + YP NHDEID 
Sbjct  67    QVSLMLDKTSGSGFKSNDAYYYGFFSAAIKLPMDYSAGVVVAFYMSNSEAYPKNHDEIDF  126

Query  759   ELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNI  580
             ELLG++KR++W LQTN+Y +GS   GREEKF+LWFDPT   H+YS++WN HHI+FLVDN+
Sbjct  127   ELLGHEKRKEWALQTNVYGDGSTGIGREEKFFLWFDPTADFHEYSLIWNQHHIVFLVDNL  186

Query  579   PVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC  400
             PVREV ++ A++  YPSKPMS+Y TIWDGS+WATHGGK PVNY + PFVAS     + GC
Sbjct  187   PVREVNHSVAMARAYPSKPMSIYSTIWDGSQWATHGGKKPVNYKFGPFVASFKNFLVAGC  246

Query  399   ----TNSSSDCTRRSPS----TSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARY  244
                 T ++  CTR   S       +EG+ FVKL+  Q  G++W R K MFYSYC D +R+
Sbjct  247   AWNQTKAAPSCTRSGQSGRLALDPIEGDEFVKLSADQQRGMEWVRSKFMFYSYCNDLSRF  306

Query  243   KVLPLEC  223
              VLP EC
Sbjct  307   PVLPPEC  313



>ref|XP_006364060.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Solanum tuberosum]
Length=334

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 191/308 (62%), Gaps = 24/308 (8%)
 Frame = -1

Query  1128  NFFSQFFLILS-MVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLK  952
             N++  FF+ LS ++V+++  S   PI                   EGY+ L+G +N+ + 
Sbjct  3     NYYMFFFIFLSCILVLVSGFSRNLPI---------------LAFDEGYSHLFGDNNLMIL  47

Query  951   NNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHD  772
              +G S  + LDK +G G VS+D Y++GFF+A+IKLPA +T+GVVVAFYMSN D++  NHD
Sbjct  48    KDGKSVHISLDKRTGAGFVSQDLYFHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHD  107

Query  771   EIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFL  592
             EID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  H YSILW  + I+F 
Sbjct  108   EIDFEFLGNIRGKDWRIQTNIYGNGSTSVGREERYGLWFDPSEDFHQYSILWTENLIIFY  167

Query  591   VDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVE  412
             VDN+P+RE+    A+   +PSKPMS+  TIWDGS WAT+GGKY VNY YAP++A      
Sbjct  168   VDNVPIREIKRTKAMGGDFPSKPMSLIATIWDGSNWATNGGKYKVNYKYAPYIAEFSDFV  227

Query  411   LEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARY  244
             L GC       SS C   +P T S+       +T  Q   ++  R K M YSYC DK RY
Sbjct  228   LHGCAVDPIELSSKCENTTPKTPSIP----TGITLDQRRKMENFRKKQMQYSYCYDKTRY  283

Query  243   KVLPLECT  220
             KV P EC 
Sbjct  284   KVPPPECV  291



>gb|ABK23681.1| unknown [Picea sitchensis]
Length=352

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/279 (47%), Positives = 181/279 (65%), Gaps = 8/279 (3%)
 Frame = -1

Query  1032  RLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAI  853
             R+T+ F      EGY  L+G  N+++  +G +  L LDK +G GL+S+D Y YG F+A+I
Sbjct  36    RVTENFASLRFEEGYTSLFGEDNVKVAEDGKAVMLSLDKRTGSGLLSQDMYMYGLFSASI  95

Query  852   KLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREE  673
             KLP  +T+GVVVAFY SN D++   HDE+D E LG  + ++W +QTN+Y NGS   GREE
Sbjct  96    KLPDDYTAGVVVAFYTSNGDIFQGTHDELDFEFLGNIRGKEWRIQTNVYGNGSTAFGREE  155

Query  672   KFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDG  493
             ++ LWFDPT+  H Y+ILW     LF VD++P+RE+   AA+   YPSKPMSVY T+WDG
Sbjct  156   RYTLWFDPTEDFHQYTILWTDKRTLFFVDDVPIREIPRTAAMGAHYPSKPMSVYATVWDG  215

Query  492   SEWATHGGKYPVNYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFV  331
             S+WAT GG+Y VNY Y+PFV S+  + LEGC         +  C   + S+ SL    F 
Sbjct  216   SDWATKGGRYRVNYKYSPFVVSLSNLVLEGCAVDPLEQFHTVSCPADTTSSDSL--SQFS  273

Query  330   KLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECTAK  214
             +L++ Q + ++W RGK++ YSYC D  RY   P +C  +
Sbjct  274   ELSEDQKALMEWFRGKYISYSYCDDDVRYPTTPADCPPR  312



>ref|XP_010553506.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Tarenaya hassleriana]
Length=331

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 175/262 (67%), Gaps = 5/262 (2%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
             EGY+ L+G  N+ ++ +G S  L LD+ +G G VS D Y +GFF+A IKLPA +T+GVV
Sbjct  32   EEGYSHLFGDQNLAVRKDGKSVRLSLDERTGSGFVSNDLYLHGFFSAKIKLPADYTAGVV  91

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE+ YLWFDPT+ 
Sbjct  92   VAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERCYLWFDPTED  151

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW+  HI+F +DN+P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GGKY 
Sbjct  152  FHQYSILWSDSHIIFYIDNVPIREVKRTASMGGDFPSKPMSLYSTIWDGSKWATNGGKYG  211

Query  459  VNYNYAPFVASMGRVELEGCTNSSSDCTRRSPST--SSLEGEGFVKLTQQQISGLQWARG  286
            VNY YAPFVA      L GC   + D   + P    S  E     +LT  Q   ++  R 
Sbjct  212  VNYKYAPFVARFSDFVLHGC---AVDPIEQLPKCDFSGEELRRAAELTSSQRITMEDFRR  268

Query  285  KHMFYSYCKDKARYKVLPLECT  220
            KHM YSYC D+ RYKV+  EC 
Sbjct  269  KHMTYSYCYDQTRYKVVLPECV  290



>gb|ABK24235.1| unknown [Picea sitchensis]
Length=352

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 180/279 (65%), Gaps = 8/279 (3%)
 Frame = -1

Query  1032  RLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAI  853
             R+T+ F      EGY  L+G  N+++  +G +  L LDK +G GL+S+D Y YG F+A+I
Sbjct  36    RVTENFASLRFEEGYTSLFGEDNVKVAEDGKAVMLSLDKRTGSGLLSQDMYMYGLFSASI  95

Query  852   KLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREE  673
             KLP  +T+GVVVAFY SN D++   HDE+D E LG  + ++W +QTN+Y NGS   GREE
Sbjct  96    KLPDDYTAGVVVAFYTSNGDIFQGTHDELDFEFLGNIRGKEWRIQTNVYGNGSTAFGREE  155

Query  672   KFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDG  493
             ++ LWFDPT+  H Y+ILW     LF VD++P+RE+   AA+   YPSKPMSVY T+WDG
Sbjct  156   RYTLWFDPTEDFHQYTILWTDKRTLFFVDDVPIREIPRTAAMGAHYPSKPMSVYATVWDG  215

Query  492   SEWATHGGKYPVNYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFV  331
             S+WAT GG+Y VNY Y+PFV S+  + LEGC         +  C   + S+ SL    F 
Sbjct  216   SDWATKGGRYRVNYKYSPFVVSLSNLVLEGCAVDPLEQFHTVSCPADTTSSDSL--SQFS  273

Query  330   KLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECTAK  214
             +L++ Q + ++W R K++ YSYC D  RY   P +C  +
Sbjct  274   ELSEDQKALMEWFRSKYISYSYCDDDVRYPTTPADCPPR  312



>ref|XP_002875095.1| endoxyloglucan transferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51354.1| endoxyloglucan transferase [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 174/264 (66%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDFHQYSILWSDSHIIFFVDNVPIREVKRTASMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   R    ++++     ++T  Q   +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAVDIRAAQEITPSQRKKMDVFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              KHM YSYC D+ RYKV   EC  
Sbjct  269   RKHMTYSYCYDRTRYKVALSECVV  292



>ref|XP_010527818.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Tarenaya hassleriana]
Length=330

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/261 (51%), Positives = 175/261 (67%), Gaps = 5/261 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ ++ +G SA L LD+ +G G VS D Y +GFF+A IKLPA +T+GVV+
Sbjct  33   EGYTHLFGDQNLVVRKDGKSARLSLDERTGSGFVSNDLYLHGFFSAKIKLPADYTAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTHLGREERYNLWFDPTEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+  HI+F VDN+P+REV  + ++   +PSKPMS+Y TIWDGS+WAT GGKY V
Sbjct  153  HQYSILWSDSHIIFYVDNVPIREVKRSESMGGDFPSKPMSLYSTIWDGSKWATDGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPS--TSSLEGEGFVKLTQQQISGLQWARGK  283
            NY YAP++A      L GCT    D   + P+   S+ +     +LT  Q   ++  R K
Sbjct  213  NYKYAPYIAQFSEFVLHGCT---VDPIEQFPTCDASAEDLSHVAELTSSQRRKMENFRRK  269

Query  282  HMFYSYCKDKARYKVLPLECT  220
             M YSYC D+ RYKV P EC 
Sbjct  270  RMTYSYCYDQTRYKVAPPECV  290



>ref|XP_010496847.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Camelina sativa]
Length=333

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 173/264 (66%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   EGY  L+G  N+ +  +G S  L LD+ SG G  S D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERSGSGFASNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDFHQYSILWSDSHIIFFVDNVPIREVKRTASMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   R    ++ +     ++T  Q S +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDIRAAQEITPSQRSKMDIFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              KHM YSYC D+ RYKV   EC  
Sbjct  269   RKHMTYSYCYDRTRYKVALSECVV  292



>ref|XP_010554388.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Tarenaya hassleriana]
Length=336

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 176/260 (68%), Gaps = 1/260 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ ++ +G S  L LD+ +G G VS D Y +GFF+A IKLPA +T+GVVV
Sbjct  33   EGYTHLFGDQNLAVRKDGKSVRLSLDERTGSGFVSNDLYLHGFFSAKIKLPADYTAGVVV  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE+++LWFDP++  
Sbjct  93   AFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTHMGREERYHLWFDPSEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+  HI+F VD++ +REV   A++   +PSKPMS+Y T+WDGS+WAT+GGKY V
Sbjct  153  HQYSILWSDSHIIFYVDDVSIREVKRTASMGGDFPSKPMSLYATVWDGSKWATNGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLE-GEGFVKLTQQQISGLQWARGKH  280
            NY YAP+VA      L GC     +   +    S+ +  +   ++T  + S ++  RGKH
Sbjct  213  NYKYAPYVAQFSDFVLHGCAVDPIEQFPKCDDASAGDLRQAAAEMTSSRRSKMENFRGKH  272

Query  279  MFYSYCKDKARYKVLPLECT  220
            M YSYC D+ RYKV P EC 
Sbjct  273  MTYSYCYDQTRYKVAPPECV  292



>ref|XP_002892825.1| hypothetical protein ARALYDRAFT_471659 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69084.1| hypothetical protein ARALYDRAFT_471659 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 176/263 (67%), Gaps = 6/263 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  NG S  L LD+ +G G VS D Y +GFF+++IKLPA +++GVV+
Sbjct  33   EGYTHLFGDQNLIVHRNGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYLSNGDLYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEEF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+  HI+F VDN+P+REV   A++   +P+KPMS+Y TIWDGS+WAT GGKY V
Sbjct  153  HQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYATIWDGSKWATDGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF---VKLTQQQISGLQWARG  286
            NY YAP+VA    + L GC   + D T + PS    E E      ++T+ Q + ++  R 
Sbjct  213  NYKYAPYVAQFTDLILHGC---AVDPTEKFPSCEDEEVENLHLASEITESQRNKMEIFRR  269

Query  285  KHMFYSYCKDKARYKVLPLECTA  217
            KHM YSYC D  RYKV   EC  
Sbjct  270  KHMTYSYCYDHMRYKVALSECVV  292



>ref|XP_004228752.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Solanum lycopersicum]
Length=335

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/304 (45%), Positives = 189/304 (62%), Gaps = 16/304 (5%)
 Frame = -1

Query  1128  NFFSQFFLILS-MVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLK  952
             N++  FF+ LS ++V+++  S   PI                   EGY+ L+G +N+ + 
Sbjct  3     NYYMFFFIFLSCILVLVSGFSRNLPI---------------LAFDEGYSHLFGDNNLMIL  47

Query  951   NNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHD  772
              +G S  + LDK +G G VS+D Y++GFF+A+IKLPA +T+GVVVAFYMSN D++  NHD
Sbjct  48    KDGKSVHISLDKRTGAGFVSQDLYFHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHD  107

Query  771   EIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFL  592
             EID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  H YSILW  + I+F 
Sbjct  108   EIDFEFLGNIRGKDWRIQTNIYGNGSTNVGREERYGLWFDPSEDFHQYSILWTENLIIFY  167

Query  591   VDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVE  412
             VDN+P+RE+    A+   +PSKPMS+  TIWDGS WAT+GGKY VNY YAP++A      
Sbjct  168   VDNVPIREIKRTKAMGGDFPSKPMSLIATIWDGSNWATNGGKYKVNYKYAPYIAEFSDFI  227

Query  411   LEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
             L GC     + + +  +T+         +T  Q   ++  R K M YSYC DK RYKV P
Sbjct  228   LHGCAVDPIELSSKCDNTTPKTPTIPTDITLDQRRKMENFRKKQMQYSYCYDKTRYKVPP  287

Query  231   LECT  220
              EC 
Sbjct  288   PECV  291



>ref|XP_009390870.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=333

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 172/265 (65%), Gaps = 1/265 (0%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     EGY  L+G  N+ L  +G +  L LD+ +G G  S+D Y +G F+A+IKLP+ 
Sbjct  32    LTTLSFEEGYTQLFGDSNLMLHRDGMAVHLSLDQRTGAGFASQDLYLHGVFSASIKLPSD  91

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             + +GVVVAFYMSN DV+   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LW
Sbjct  92    YAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYGLW  151

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT+  H YSILW++  I+F +DNIP+REVV + A+   +PSKPMS+Y TIWDGS WAT
Sbjct  152   FDPTEDYHRYSILWSNRRIIFYIDNIPIREVVRSQAMGGDFPSKPMSLYATIWDGSNWAT  211

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQ  298
              GG+Y VNY +AP+VA    + L GC    SD  RR+   S  E    + ++  Q + ++
Sbjct  212   SGGRYKVNYKFAPYVAEFADLVLHGCAVDPSD-RRRACQASDAELYDAITMSADQRTTME  270

Query  297   WARGKHMFYSYCKDKARYKVLPLEC  223
               R KHM YSYC D+ RY   P EC
Sbjct  271   TLRKKHMTYSYCHDRIRYPAPPPEC  295



>ref|XP_006291465.1| hypothetical protein CARUB_v10017602mg [Capsella rubella]
 gb|EOA24363.1| hypothetical protein CARUB_v10017602mg [Capsella rubella]
Length=333

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 174/262 (66%), Gaps = 0/262 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VD++P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDFHQYSILWSDSHIIFFVDSVPIREVKRTASMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   R    ++ +     ++T  Q S +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDISAAQEITPTQRSKMDIFR  268

Query  288   GKHMFYSYCKDKARYKVLPLEC  223
              KHM YSYC D+ RYKV   EC
Sbjct  269   RKHMTYSYCYDRTRYKVALSEC  290



>ref|XP_009763784.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Nicotiana sylvestris]
Length=331

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 188/307 (61%), Gaps = 24/307 (8%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             N+    F+  S+V ++   S   PI                   EGY+ L+G +N+ +  
Sbjct  3     NYHLVIFIFFSVVELVYGSSRNLPI---------------LAFDEGYSHLFGDNNLMILK  47

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +G SA + LD+ +G G VS+D Y +GFF+A+IKLPA +T+GVVVAFYMSN D++  NHDE
Sbjct  48    DGKSAHISLDERTGAGFVSQDLYLHGFFSASIKLPADYTAGVVVAFYMSNVDMFEKNHDE  107

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             ID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  H YSILW  + I+F V
Sbjct  108   IDFEFLGNIRGKDWRIQTNIYGNGSTSFGREERYGLWFDPSEDFHHYSILWTENFIIFYV  167

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             DN+P+RE+    A+   +PSKPMS+Y TIWDGS WAT+GGKY VNY YAP++A      L
Sbjct  168   DNVPIREIKRTEAMGGDFPSKPMSLYATIWDGSGWATNGGKYKVNYKYAPYIAKFSDFVL  227

Query  408   EGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYK  241
              GC       SS C   +P TSS+       +T  Q   ++  R K M YSYC DK RYK
Sbjct  228   HGCAVDPIELSSKCD-TAPKTSSIP----TGITPDQRRKMENFRKKQMQYSYCYDKTRYK  282

Query  240   VLPLECT  220
             V P EC 
Sbjct  283   VPPTECV  289



>ref|XP_008466948.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Cucumis melo]
Length=333

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 172/263 (65%), Gaps = 9/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGYN L+G  N+ L  +G S  L LD+ +G G VS+D Y +GFF+A+IKLP+ +T+GVVV
Sbjct  35   EGYNPLFGDDNLVLLKDGKSVHLHLDERTGSGFVSQDLYLHGFFSASIKLPSDYTAGVVV  94

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  
Sbjct  95   AFYMSNGDMFAKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSIGREERYGLWFDPSEDF  154

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H+YSILW    I+F VDN+P+REV   A +   +PSKPM++Y TIWDGS WAT+GGKY V
Sbjct  155  HEYSILWTESLIIFYVDNVPIREVKRTATMGGDFPSKPMTLYATIWDGSTWATNGGKYKV  214

Query  456  NYNYAPFVASMGRVELEGC----TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP++A      L GC    T  SS C     S     G     +T  Q + ++  R
Sbjct  215  NYKYAPYIAEFSNFILHGCAVDPTEQSSSCDHSQKSIPIPSG-----MTPSQRAKMESLR  269

Query  288  GKHMFYSYCKDKARYKVLPLECT  220
             KH+ YSYC D+ RYK  P EC 
Sbjct  270  KKHLTYSYCYDRIRYKTPPSECV  292



>ref|XP_004162296.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cucumis sativus]
 emb|CCH26638.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=333

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 172/262 (66%), Gaps = 9/262 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGYN L+G  N+ L  +G S  L LD+ +G G VS+D Y +GFF+A+IKLP+ +T+GVVV
Sbjct  35   EGYNPLFGDDNLVLLKDGKSVHLHLDERTGSGFVSQDLYLHGFFSASIKLPSDYTAGVVV  94

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  
Sbjct  95   AFYMSNGDMFAKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSIGREERYGLWFDPSEDF  154

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H+YSILW    I+F VDN+P+REV   A +   +PSKPM++Y TIWDGS WAT+GGKY V
Sbjct  155  HEYSILWTESLIIFYVDNVPIREVKRTATMGGDFPSKPMTLYATIWDGSTWATNGGKYKV  214

Query  456  NYNYAPFVASMGRVELEGC----TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP++A      L GC    T  SS C     S     G     +T  Q + ++  R
Sbjct  215  NYKYAPYIAEFSDFILHGCTVDPTEQSSSCDHSQKSIPIPSG-----MTPSQRAKMESLR  269

Query  288  GKHMFYSYCKDKARYKVLPLEC  223
             KH+ YSYC D+ RYK  P EC
Sbjct  270  KKHLTYSYCYDRIRYKTPPSEC  291



>gb|ACD03223.1| xyloglucan endotransglucosylase/hydrolase 13 [Actinidia deliciosa]
Length=329

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 173/263 (66%), Gaps = 9/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLPA +T+GVVV
Sbjct  31   EGYSQLFGDENLMVLEDGKSVHLSLDERTGSGFVSHDLYLHGFFSASIKLPADYTAGVVV  90

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDE+D E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  
Sbjct  91   AFYMSNGDMHEKNHDELDFEFLGNIRGKDWRIQTNVYGNGSTSVGREERYGLWFDPSEDF  150

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  + I F VDN+P+RE+    A+   +PSKPMS+Y TIWDGS WAT+GG+Y V
Sbjct  151  HHYSILWTENQITFYVDNVPIREIKRTEAMGGDFPSKPMSLYATIWDGSNWATNGGRYRV  210

Query  456  NYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP++     + L GC       SS C     S S L G     +T  Q+S ++  R
Sbjct  211  NYKYAPYITQFSDLVLHGCAVDPIEQSSTCDLPPNSESILTG-----ITPDQLSKMENFR  265

Query  288  GKHMFYSYCKDKARYKVLPLECT  220
             KHM YSYC D+ RYKV P EC 
Sbjct  266  KKHMQYSYCYDRTRYKVPPSECA  288



>ref|XP_009621666.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Nicotiana tomentosiformis]
Length=331

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 175/263 (67%), Gaps = 9/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G SA + LD+ +G G VS+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  32   EGYSHLFGDDNLMILKDGKSAHISLDERTGAGFVSQDLYLHGFFSASIKLPADYTAGVVV  91

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  
Sbjct  92   AFYMSNVDMFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSVGREERYGLWFDPSEDF  151

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  + I+F VDN+P+RE+    A+   +PSKPMS+Y TIWDGS WAT+GGKY V
Sbjct  152  HHYSILWTENFIIFYVDNVPIREIKRTEAMGGDFPSKPMSLYATIWDGSGWATNGGKYKV  211

Query  456  NYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP++A      L GC       SS C   +P T+S+       +T  Q   ++  R
Sbjct  212  NYKYAPYIAKFSDFVLHGCAVDPIELSSKCD-TAPKTASIP----TGITPDQRRKMEKFR  266

Query  288  GKHMFYSYCKDKARYKVLPLECT  220
             K M YSYC DK RYKV P EC 
Sbjct  267  KKQMQYSYCYDKTRYKVPPPECV  289



>ref|XP_010424960.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Camelina sativa]
Length=333

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 172/264 (65%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   EGY  L+G  N+ +  +G S  L LD+ +G G  S D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERTGSGFASNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDFHQYSILWSDSHIIFFVDNVPIREVKRTASMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   R    ++       ++T  Q S +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEYIRAAQEITPSQRSKMDVFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              KHM YSYC D+ RYKV   EC  
Sbjct  269   RKHMTYSYCYDRTRYKVALSECVV  292



>ref|XP_011070536.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Sesamum indicum]
Length=337

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 192/313 (61%), Gaps = 23/313 (7%)
 Frame = -1

Query  1149  GLFKNSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGG  970
             G   ++ N F+  F    +V++++  S   PI +                 EGY+ L+G 
Sbjct  3     GTMNSNMNVFTFAFCSAFLVLMVSGFSRNLPILS---------------FDEGYSHLFGD  47

Query  969   HNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDV  790
              N+ +  +G S  + LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVVAFYMSN D+
Sbjct  48    DNLMVLRDGKSVHISLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDI  107

Query  789   YPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNS  610
             Y  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  H YSILW  
Sbjct  108   YEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSIGREERYGLWFDPSEDFHQYSILWTE  167

Query  609   HHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVA  430
             + I+F VDN+P+RE+    A+   +PSKPMS+Y TIWDGS+WAT+GGKY V+Y YAP++A
Sbjct  168   NFIVFYVDNVPIREIKRTEAMGGDFPSKPMSLYATIWDGSDWATNGGKYKVSYKYAPYIA  227

Query  429   SMGRVELEGCTN---SSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCK  259
                   L GC       S C   +   S   G     +T+QQ + +   R KHM YSYC 
Sbjct  228   EFSDFVLHGCAVDPIEQSKCDDAAKFASIPAG-----ITRQQRAKMVSFRNKHMQYSYCY  282

Query  258   DKARYKVLPLECT  220
             D++RYK+ P EC 
Sbjct  283   DRSRYKIPPSECV  295



>ref|XP_007222502.1| hypothetical protein PRUPE_ppa008275mg [Prunus persica]
 gb|EMJ23701.1| hypothetical protein PRUPE_ppa008275mg [Prunus persica]
Length=338

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 176/266 (66%), Gaps = 14/266 (5%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGYN L+G  N+ +  +G S  L LD+ +G G VS+D Y++GFF+A+IKLPA +T+GVVV
Sbjct  36   EGYNKLFGDDNLMILRDGKSVHLSLDERTGSGFVSQDLYHHGFFSASIKLPADYTAGVVV  95

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++P NHDEID E LG  + ++W +QTN+Y NGS  TGREE++ LWFDP+   
Sbjct  96   AFYMSNGDMFPKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTSTGREERYNLWFDPSDDF  155

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VD++P+REV    ++   +PSKPMS+Y TIWDGS+WAT+GGKY V
Sbjct  156  HQYSILWTDSQIIFYVDDVPIREVKRTESMGGDFPSKPMSLYATIWDGSDWATNGGKYRV  215

Query  456  NYNYAPFVASMGRVELEGCT-------NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQ  298
            NY YAP++A    + L GC        +   D TR S S  +    G  +L + ++    
Sbjct  216  NYKYAPYLAQFSDLVLHGCAVDPIEQLSKKCDNTRSSESVPT----GVTRLQRIKMDSF-  270

Query  297  WARGKHMFYSYCKDKARYKVLPLECT  220
              R KHM YSYC D+ RYK  P EC 
Sbjct  271  --RKKHMTYSYCYDRIRYKSPPPECV  294



>emb|CDP20286.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/306 (45%), Positives = 188/306 (61%), Gaps = 24/306 (8%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             NF   FF + + +V++   S   PI +                 EGY+ L+G  N+ +  
Sbjct  3     NFHLGFFALTTFIVLVCGASKNLPILS---------------FDEGYSQLFGDDNLMVVK  47

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +G S  L LD+ +G G VS+D Y  GFF+A+IKLPA +T+GVVVAFYMSN D++  NHDE
Sbjct  48    DGKSVHLTLDERTGSGFVSQDIYSQGFFSASIKLPADYTAGVVVAFYMSNGDMFQKNHDE  107

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             +D E LG  + +DW +QTN+Y NGS  TGREE++ LWFDP++  H YSILW  + I+F V
Sbjct  108   VDFEFLGNIRGKDWRMQTNIYGNGSTNTGREERYGLWFDPSEDFHQYSILWTENQIIFYV  167

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             DN+ +RE    A +   +PSKPMS+Y TIWDGS+WAT+GGK+ +NY YAP++A    + L
Sbjct  168   DNVTIREFKRTATMGGDFPSKPMSLYATIWDGSDWATNGGKFRINYKYAPYIAKFSDLVL  227

Query  408   EGC----TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYK  241
              GC    T  ++ C   +P   S+       +T +Q   +Q  R KHM YSYC D ARY 
Sbjct  228   HGCAVDPTEQATKCD-IAPKHDSIP----TGITPEQRIRMQNFRKKHMQYSYCYDCARYT  282

Query  240   VLPLEC  223
             V P EC
Sbjct  283   VPPAEC  288



>ref|XP_010513916.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Camelina sativa]
Length=333

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 172/264 (65%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   EGY  L+G  N+ +  +G S  L LD+ +G G  S D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERTGSGFASNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T   H YSILW+  HI+F VD++P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TDDFHQYSILWSDSHIIFFVDSVPIREVKRTASMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   R    ++ +     ++T  Q S +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDIRAAQEITPSQRSKMDIFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              KHM YSYC D+ RYKV   EC  
Sbjct  269   RKHMTYSYCYDRTRYKVALSECVV  292



>ref|XP_004142816.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cucumis sativus]
 gb|KGN51447.1| hypothetical protein Csa_5G548130 [Cucumis sativus]
Length=333

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 171/262 (65%), Gaps = 9/262 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGYN L+G  N+ L  +G S  L LD+ +G G VS+D Y +G F+A+IKLP+ +T+GVVV
Sbjct  35   EGYNPLFGDDNLVLLKDGKSVHLHLDERTGSGFVSQDLYLHGLFSASIKLPSDYTAGVVV  94

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  
Sbjct  95   AFYMSNGDMFAKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSIGREERYGLWFDPSEDF  154

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H+YSILW    I+F VDN+P+REV   A +   +PSKPM++Y TIWDGS WAT+GGKY V
Sbjct  155  HEYSILWTESLIIFYVDNVPIREVKRTATMGGDFPSKPMTLYATIWDGSTWATNGGKYKV  214

Query  456  NYNYAPFVASMGRVELEGC----TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP++A      L GC    T  SS C     S     G     +T  Q + ++  R
Sbjct  215  NYKYAPYIAEFSDFILHGCTVDPTEQSSSCDHSQKSIPIPSG-----MTPSQRAKMESLR  269

Query  288  GKHMFYSYCKDKARYKVLPLEC  223
             KH+ YSYC D+ RYK  P EC
Sbjct  270  KKHLTYSYCYDRIRYKTPPSEC  291



>emb|CDP05491.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/307 (45%), Positives = 188/307 (61%), Gaps = 24/307 (8%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             NF   FF + + +V++   S   PI +                 EGY+ L+G  N+ +  
Sbjct  3     NFHLGFFALTTFIVLVCGASKNLPILS---------------FDEGYSQLFGDDNLMVIK  47

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +G S  L LD+ +G G VS+D Y  GFF+A+IKLPA +T+GVVVAFYMSN +++  NHDE
Sbjct  48    DGKSVHLTLDERTGSGFVSQDIYSQGFFSASIKLPADYTAGVVVAFYMSNGEMFQKNHDE  107

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             +D E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  H YSILW    I+F V
Sbjct  108   VDFEFLGNIRGKDWRMQTNIYGNGSTNAGREERYGLWFDPSEDFHQYSILWTEDQIIFYV  167

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             DN+P+RE    A +   +PSKPMS+Y TIWDGS+WAT+GGK+ +NY YAP++A    + L
Sbjct  168   DNVPIREFERTATMGGDFPSKPMSLYATIWDGSDWATNGGKFRINYKYAPYIAKFSDLVL  227

Query  408   EGC----TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYK  241
              GC    T  ++ C   +P   S+       +T +Q   +Q  R KHM YSYC D+ARY 
Sbjct  228   HGCAVDPTEQATKCD-IAPKHDSIP----TGITPEQRIRMQSFRKKHMQYSYCYDRARYT  282

Query  240   VLPLECT  220
             V P EC 
Sbjct  283   VPPAECV  289



>ref|XP_004297402.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform 2 [Fragaria vesca subsp. vesca]
Length=330

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 173/260 (67%), Gaps = 4/260 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGYN L+G  N+ +  +G S  L LD+ +G G VS+D Y +GFF+A+IKLP  +T+GVVV
Sbjct  29   EGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIHGFFSASIKLPTDYTAGVVV  88

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++P NHDEID E LG  + ++W +QTN+Y NGS +TGREE++ LWFDP++  
Sbjct  89   AFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTETGREERYNLWFDPSEDY  148

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VDNIP+R V  + ++   YPSKPMS+Y TIWDGS WAT GGKY V
Sbjct  149  HQYSILWTDSQIIFYVDNIPIRVVKKSESMGGDYPSKPMSLYATIWDGSGWATDGGKYRV  208

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGK  283
            NY YAPF A    + L GC  +     + S      +G  ++   +T+ Q   ++  R +
Sbjct  209  NYKYAPFRAEFSDLVLHGC--AVDPIEQVSKKCDKTQGSEYIPTGVTRLQRMRMESFRKR  266

Query  282  HMFYSYCKDKARYKVLPLEC  223
             M YSYC D+ RYKV P EC
Sbjct  267  QMTYSYCYDRIRYKVAPPEC  286



>ref|XP_010043929.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Eucalyptus grandis]
 gb|KCW85954.1| hypothetical protein EUGRSUZ_B02660 [Eucalyptus grandis]
Length=332

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 173/261 (66%), Gaps = 5/261 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G +N+ L  +G S  L LD+ +G G  S+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  35   EGYTQLFGDNNLALHGDGQSVHLALDERTGSGFASQDLYLHGFFSASIKLPADYTAGVVV  94

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  95   AFYMSNGDMYEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSVGREERYGLWFDPSDDF  154

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y ILW    I+F VDN+P+RE     A+   +PSKPMS+Y TIWDGS+WAT+GGKY V
Sbjct  155  HQYGILWTDSQIIFYVDNVPIREFKRTEAMGGQFPSKPMSLYATIWDGSDWATNGGKYRV  214

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGK  283
            NY YAP+VA    + L GC   + D      S + +     +   ++ +Q + +++ R K
Sbjct  215  NYKYAPYVAKFSDLVLHGC---AVDPIEHQLSCNDVPSHKAIPQGISPRQRTKMEYFRKK  271

Query  282  HMFYSYCKDKARYKVLPLECT  220
            HM YSYC D+ARYKV P EC 
Sbjct  272  HMTYSYCYDRARYKVPPPECV  292



>ref|NP_178294.1| endoxyloglucan transferase A3 [Arabidopsis thaliana]
 sp|Q8LDS2.2|XTH27_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 27; Short=At-XTH27; Short=XTH-27; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA20289.1| endoxyloglucan transferase related protein [Arabidopsis thaliana]
 gb|AAD21783.1| xyloglucan endotransglycosylase (EXGT-A3) [Arabidopsis thaliana]
 gb|AAL24392.1| putative xyloglucan-specific glucanase [Arabidopsis thaliana]
 gb|AAP68259.1| At2g01850 [Arabidopsis thaliana]
 gb|AEC05508.1| endoxyloglucan transferase A3 [Arabidopsis thaliana]
Length=333

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 172/264 (65%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLP+ +T+
Sbjct  29    TSFEESYTQLFGDKNLFVHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIKLPSDYTA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS  +GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   A +   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   R    ++ +     ++T  Q S +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDMRAAQEITPSQRSKMDVFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              + M YSYC D+ARY V   EC  
Sbjct  269   RRLMTYSYCYDRARYNVALSECVV  292



>gb|AAD45125.1|AF163821_1 endoxyloglucan transferase [Arabidopsis thaliana]
Length=333

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 172/264 (65%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLP+ +T+
Sbjct  29    TSFEESYTQLFGDKNLFVHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIKLPSDYTA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS  +GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   A +   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDFHQYSILWSDSHIIFFVDNVPIREVKRTAQMGGHFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   R    ++ +     ++T  Q S +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDMRAAQEITPSQRSKMDVFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              + M YSYC D+ARY V   EC  
Sbjct  269   RRLMTYSYCYDRARYNVALSECVV  292



>ref|XP_002285140.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Vitis vinifera]
 emb|CBI26787.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 175/262 (67%), Gaps = 8/262 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G +  + LD+ +G G +S+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  32   EGYSPLFGDANLAILKDGETVHMSLDERTGSGFISQDLYLHGFFSASIKLPADYTAGVVV  91

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDE+D E LG  + +DW +QTN+Y NGS   GREE+++LWFDP++  
Sbjct  92   AFYMSNADMFEANHDELDFEFLGNIRGKDWRIQTNVYGNGSTNVGREERYHLWFDPSEDF  151

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+ + I+F VDN+P+RE+    A+   +PSKPMS+Y TIWDGSEWAT+GG+Y V
Sbjct  152  HQYSILWSDNLIIFYVDNVPIREIKRTEAMGGDFPSKPMSLYATIWDGSEWATNGGRYRV  211

Query  456  NYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP+VA    + L GC       S  C     S +S+       +  +Q S ++  R
Sbjct  212  NYKYAPYVAEFSNLVLHGCAVDPIEKSPKCDNGPTSKASIP----TGIMPEQRSKMEKFR  267

Query  288  GKHMFYSYCKDKARYKVLPLEC  223
              HM YSYC D+ RY V P EC
Sbjct  268  KTHMTYSYCYDRVRYTVPPSEC  289



>gb|AAM63050.1| putative xyloglucan-specific glucanase [Arabidopsis thaliana]
Length=333

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 172/264 (65%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLP+ +T+
Sbjct  29    TSFEESYTQLFGDKNLFVHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIKLPSDYTA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS  +GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   A +   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   R    ++ +     ++T  Q S +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDIRAAQEITPSQRSKMDVFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              + M YSYC D+ARY V   EC  
Sbjct  269   RRLMTYSYCYDRARYNVALSECVV  292



>ref|XP_008220940.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Prunus mume]
Length=335

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 176/262 (67%), Gaps = 6/262 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGYN L+G  N+ +  +G S  L LD+ +G G VS+D Y++GFF+A+IKLPA + +GVVV
Sbjct  36   EGYNKLFGDDNLMIVRDGKSVHLSLDERTGSGFVSQDLYHHGFFSASIKLPADYAAGVVV  95

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++P NHDEID E LG  + ++W +QTN+Y NGS  TGREE++ LWFDP+   
Sbjct  96   AFYMSNGDMFPKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTSTGREERYNLWFDPSDDF  155

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VD++P+REV    ++   +PSKPMS+Y TIWDGS+WAT+GGKY V
Sbjct  156  HQYSILWTDSQIIFYVDDVPIREVKRTESMGGDFPSKPMSLYATIWDGSDWATNGGKYRV  215

Query  456  NYNYAPFVASMGRVELEGCT-NSSSDCTRRSPSTSSLEG--EGFVKLTQQQISGLQWARG  286
            NY YAP++A    + L GC  +     +++  +T S E    G  +L + ++      R 
Sbjct  216  NYKYAPYLAQFSDLVLHGCAVDPIEHLSKKCDNTQSSESVPTGVTRLQRIKMDSF---RK  272

Query  285  KHMFYSYCKDKARYKVLPLECT  220
            KHM YSYC D+ RYK  P EC 
Sbjct  273  KHMTYSYCYDRIRYKSPPSECV  294



>gb|EYU45258.1| hypothetical protein MIMGU_mgv1a008549mg [Erythranthe guttata]
Length=370

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 174/264 (66%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E Y+ L+   NIQ   +  +A L+L++ SG G++S D Y YGFF+A+IK+P+ +T+G+VV
Sbjct  63   ESYSPLFSDFNIQRSPDDKTARLLLNRLSGSGIISSDYYKYGFFSASIKMPSRYTAGIVV  122

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN D +  NHDE+DIE LG  + + W  QTN+Y NGSV  GREE++ +WFDP++ S
Sbjct  123  AFYTSNVDTFERNHDELDIEFLGNVEGKAWRFQTNVYGNGSVSRGREERYRMWFDPSKDS  182

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F VD IP+REV+ NAA+   YPSKPMSVY TIWD S WAT GGK  V
Sbjct  183  HRYSILWTPTNIIFYVDEIPIREVIRNAAMRGDYPSKPMSVYATIWDASSWATSGGKKKV  242

Query  456  NYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            +Y Y PFVA    + LEGC         SS+CT     T++L    F  +T ++   + W
Sbjct  243  DYRYQPFVAEFRDLVLEGCIVDPVDQLLSSNCTD---ITAALMARDFAAVTPRRRQSMAW  299

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V P EC
Sbjct  300  FRQRYMYYSYCYDNVRYPVSPPEC  323



>ref|NP_172925.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 
[Arabidopsis thaliana]
 sp|Q38909.1|XTH28_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 28; Short=At-XTH28; Short=XTH-28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD45124.1|AF163820_1 endoxyloglucan transferase [Arabidopsis thaliana]
 gb|AAF79246.1|AC006917_31 F10B6.12 [Arabidopsis thaliana]
 gb|AAK60305.1|AF385714_1 At1g14720/F10B6_29 [Arabidopsis thaliana]
 gb|AAB18366.1| xyloglucan endotransglycosylase-related protein [Arabidopsis 
thaliana]
 dbj|BAA20290.1| endoxyloglucan transferase related protein [Arabidopsis thaliana]
 gb|AAM63068.1| xyloglucan endo-transglycosylase, putative [Arabidopsis thaliana]
 gb|AEE29214.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 
[Arabidopsis thaliana]
Length=332

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 176/263 (67%), Gaps = 6/263 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+++IKLPA +++GVV+
Sbjct  33   EGYTQLFGDQNLIVHRDGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + R+W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYLSNGDLYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERYNLWFDPTEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+  HI+F VDN+P+REV   A++   +P+KPMS+Y TIWDGS+WAT GGKY V
Sbjct  153  HQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYSTIWDGSKWATDGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF---VKLTQQQISGLQWARG  286
            NY YAP+V+    + L GC   + D T + PS      +      ++T+ Q + ++  R 
Sbjct  213  NYKYAPYVSQFTDLILHGC---AVDPTEKFPSCKDEAVQNLRLASEITESQRNKMEIFRQ  269

Query  285  KHMFYSYCKDKARYKVLPLECTA  217
            KHM YSYC D  RYKV+  EC  
Sbjct  270  KHMTYSYCYDHMRYKVVLSECVV  292



>ref|XP_009414788.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=349

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 170/258 (66%), Gaps = 1/258 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ L  NG +  L LD+ +G G  S+D Y +GFF+A+IKLP+ + +GVVV
Sbjct  55   EGYTQLFGDSNLMLHRNGRTVHLSLDQRTGAGFASQDLYLHGFFSASIKLPSDYAAGVVV  114

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  115  AFYMSNGDIFEKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAIGREERYGLWFDPTEDF  174

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+   ILF +DN P+REV+   A+   +PSKPMS+Y TIWDGS WAT GG+Y V
Sbjct  175  HQYSILWSHDKILFYIDNTPIREVIRTQAMGGQFPSKPMSLYATIWDGSNWATLGGRYKV  234

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP+VA  G + L GC    SD T+       L  +  + ++  Q S ++  R K+M
Sbjct  235  NYKYAPYVAEFGDLILHGCAVDPSDHTQSCQRPDVLLYDA-ITMSTVQRSAMEKFRKKYM  293

Query  276  FYSYCKDKARYKVLPLEC  223
             YSYC D+ RY+ L  EC
Sbjct  294  TYSYCHDRVRYQTLLPEC  311



>gb|ADE42489.1| xyloglucan endotransglucosylase/hydrolase 2 [Fragaria chiloensis]
Length=324

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 173/260 (67%), Gaps = 4/260 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGYN L+G  N+ +  +G S  L LD+ +G G VS+D Y +GFF+A+IKLP  +T+GVVV
Sbjct  29   EGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIHGFFSASIKLPTDYTAGVVV  88

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++P NHDEID E LG  + ++W +QTN+Y NGS +TGREE++ LWFDP++  
Sbjct  89   AFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTETGREERYNLWFDPSEDY  148

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VDNIP+R V  + ++   YPSKPMS+Y TIWDGS WAT GGKY V
Sbjct  149  HQYSILWTDSQIIFYVDNIPIRVVKKSESMGGDYPSKPMSLYATIWDGSGWATDGGKYRV  208

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGK  283
            NY YAPF A    + L GC  +     + S      +G  ++   +T+ Q   ++  R +
Sbjct  209  NYKYAPFRAEFSDLVLHGC--AVDPIEQVSKKCDKTQGSEYIPTGVTRLQRMRMESFRKR  266

Query  282  HMFYSYCKDKARYKVLPLEC  223
             M YSYC D+ RYKV P EC
Sbjct  267  QMTYSYCYDRIRYKVAPPEC  286



>ref|XP_008389143.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Malus domestica]
Length=336

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 188/304 (62%), Gaps = 16/304 (5%)
 Frame = -1

Query  1125  FFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNN  946
             FF     + +  V++  V A  P    P +             EGY  L+G  N+ +  +
Sbjct  3     FFHLGLFLCACQVLVLGVVASAPYGNLPIIP----------FDEGYTKLFGDDNLMILRD  52

Query  945   GSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEI  766
             G S  L LD+ +G G VS+D Y +GFF+A+IKLPA +T+GVVVAFYMSN D++P +HDEI
Sbjct  53    GKSVHLSLDERTGSGFVSQDLYQHGFFSASIKLPADYTAGVVVAFYMSNGDMFPKHHDEI  112

Query  765   DIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVD  586
             D E LG  + ++W +QTN+Y NGS  TGREE++ LWFDP+   H YSILW    I+F VD
Sbjct  113   DFEFLGNIRGKEWRVQTNIYGNGSTNTGREERYNLWFDPSDDYHQYSILWTDSQIIFYVD  172

Query  585   NIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELE  406
             N+P+RE     ++   +P+KPMS+Y TIWDGS+WAT+GGKY VNY Y+P++A    + L 
Sbjct  173   NVPIREFKKTESMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYSPYLAEFSDLVLH  232

Query  405   GCT-NSSSDCTRRSPSTSSLEG--EGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVL  235
             GC  +     +++  +T + E    G  +L + ++ GL   R KHM YSYC D+ RYK  
Sbjct  233   GCAVDPIEQLSKKCENTQNSESVPTGVTRLQRTKMEGL---RKKHMTYSYCYDRIRYKSP  289

Query  234   PLEC  223
             P EC
Sbjct  290   PSEC  293



>gb|KFK33417.1| hypothetical protein AALP_AA5G010000 [Arabis alpina]
Length=333

 Score =   271 bits (692),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 171/264 (65%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   EGY  L+G  N+ +  +G S  L LD+ +G G  S D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEEGYTQLFGDKNLIVHKDGKSVRLTLDERTGSGFASNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T   H YSILW++ HI+F VDN+P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TDDFHQYSILWSASHIIFYVDNVPIREVKRTASMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   +    ++ +     ++T  Q   +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCAVDPIEQFPKCDEGAAEDIRSMQEITPSQRGKMDIFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              KHM YSYC D+ RY V   EC  
Sbjct  269   RKHMTYSYCYDRTRYNVALPECVV  292



>gb|KFK43745.1| hypothetical protein AALP_AA1G167300 [Arabis alpina]
Length=322

 Score =   270 bits (691),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 176/263 (67%), Gaps = 6/263 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+++IKLP+ +++GVV+
Sbjct  23   EGYTQLFGDQNLIVHRDGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPSDYSAGVVI  82

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  83   AFYLSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEDF  142

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YS+LW+  HI+F VD+IP+REV   A++   +P+KPMS+Y TIWDGS+WAT+GGKY V
Sbjct  143  HQYSVLWSPSHIIFNVDDIPIREVKRTASMGGDFPTKPMSLYATIWDGSKWATNGGKYSV  202

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF---VKLTQQQISGLQWARG  286
            NY YAP+VA    + L GC   + D T + PS      E      ++T  Q S ++  R 
Sbjct  203  NYKYAPYVAQFTDLILHGC---AVDPTEKLPSCEDGAAEDLWLASEITVSQRSKMESFRR  259

Query  285  KHMFYSYCKDKARYKVLPLECTA  217
            KHM YSYC D  RYKV+  EC  
Sbjct  260  KHMTYSYCYDHMRYKVVLSECVV  282



>gb|ADE42491.1| xyloglucan endotransglucosylase/hydrolase 2 [Fragaria x ananassa]
Length=269

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 172/260 (66%), Gaps = 4/260 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGYN L+G  N+ +  +G S  L LD+ +G G VS+D Y +GFF+A+IKLP  +T+GVVV
Sbjct  8    EGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIHGFFSASIKLPTDYTAGVVV  67

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++P NHDEID E LG  + ++W +QTN+Y NGS +TGREE++ LWFDP++  
Sbjct  68   AFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTETGREERYNLWFDPSEDY  127

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VDNI +R V  + ++   YPSKPMS+Y TIWDGS WAT GGKY V
Sbjct  128  HQYSILWTDSQIIFYVDNISIRVVKKSESMGGDYPSKPMSLYATIWDGSGWATDGGKYRV  187

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGK  283
            NY YAPF A    + L GC  +     + S      +G  ++   +T+ Q   ++  R +
Sbjct  188  NYKYAPFKAEFSDLVLHGC--AVDPIEQVSKKCDKTQGSEYIPTGVTRLQRMRMESFRKR  245

Query  282  HMFYSYCKDKARYKVLPLEC  223
             M YSYC D+ RYKV P EC
Sbjct  246  QMTYSYCYDRIRYKVAPPEC  265



>emb|CDX81665.1| BnaC08g39360D [Brassica napus]
Length=328

 Score =   270 bits (691),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 173/260 (67%), Gaps = 0/260 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L+LD+ +G G VS D Y +GFF+++IKLPA +++GVV+
Sbjct  33   EGYTHLFGDQNMIVNRDGKSVRLILDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYLSNGDIYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSI+W+  HI+F VDNIP+REV   A++   +P+KPMS+Y TIWDGS+WAT+GGKY V
Sbjct  153  HQYSIMWSHSHIIFYVDNIPIREVKRTASMGGDFPAKPMSLYATIWDGSKWATNGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY +AP+VA    + L GC     +        ++ +     ++T+ Q   +   R KHM
Sbjct  213  NYKFAPYVAQFADLILHGCAVDPIEKVLSCQDGAAEDLRLASEITESQRKKMDSLRRKHM  272

Query  276  FYSYCKDKARYKVLPLECTA  217
             YSYC D+ RYKV   EC  
Sbjct  273  TYSYCYDRTRYKVALPECVV  292



>gb|AAK30204.1|AF349963_1 endoxyloglucan transferase [Daucus carota]
Length=330

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 185/306 (60%), Gaps = 24/306 (8%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             N +   F++ S+VV+    S   PI +                 EGY+ L+G  N+ +  
Sbjct  3     NLYVNLFVMCSVVVLAHGSSRNLPIVS---------------FEEGYSQLFGDSNLMILQ  47

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +G SA L LD+ +G G VS D Y +GFF+A+IKLPA +T+GVVVAFYMSN D++  NHDE
Sbjct  48    DGKSAHLSLDERTGSGFVSHDLYKHGFFSASIKLPADYTAGVVVAFYMSNVDMFAKNHDE  107

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             ID E LG  + ++W LQTN+Y NGS   GREE++ LWFDP+   H YSILW+   I+F +
Sbjct  108   IDFEFLGNIRGKEWRLQTNVYGNGSTGAGREERYGLWFDPSDDFHQYSILWSKDRIIFYI  167

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             DN+P+REV    A+   +PSKPMS+Y TIWDGS WAT+GGKY VNY Y+P++A      L
Sbjct  168   DNVPIREVKKTEAMGGDFPSKPMSLYATIWDGSNWATNGGKYKVNYKYSPYIAEFSDFVL  227

Query  408   EGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYK  241
              GC       S+ C     S S   G      T++  + +Q  R K+M YSYC D  RY+
Sbjct  228   HGCAVDPIEMSTSCDTAPKSQSVPTG-----TTKESRTKMQNLRKKYMQYSYCYDTTRYQ  282

Query  240   VLPLEC  223
             V P EC
Sbjct  283   VPPSEC  288



>ref|XP_007045473.1| Xyloglucan endotransglucosylase/hydrolase 28 [Theobroma cacao]
 gb|EOY01305.1| Xyloglucan endotransglucosylase/hydrolase 28 [Theobroma cacao]
Length=336

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 173/259 (67%), Gaps = 2/259 (1%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G +  L L++ +G G VS+D Y +G+F+A+IKLPA +T+GVVV
Sbjct  37   EGYSQLFGDDNLAIHRDGKAVHLSLNERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVV  96

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP    
Sbjct  97   AFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTSVGREERYNLWFDPADDF  156

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+ILW    I+F VDN P+REV   AA+   +PSKPMS+Y TIWDGS+WAT+GGKY V
Sbjct  157  HQYTILWTDSKIIFYVDNTPIREVKRTAAMGGDFPSKPMSLYATIWDGSDWATNGGKYRV  216

Query  456  NYNYAPFVASMGRVELEGCTNSSSD-CTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKH  280
            NY YAP+VA    + L GC     +  ++R  +  SLE E    +T  Q S +   R K+
Sbjct  217  NYKYAPYVAKFSDLILHGCAVDPIEFSSKRCDTAQSLE-ELSTTITPSQRSKMDSFRRKY  275

Query  279  MFYSYCKDKARYKVLPLEC  223
            M YSYC D+ RYK  P EC
Sbjct  276  MTYSYCYDQTRYKGPPPEC  294



>emb|CDY33745.1| BnaA09g45510D [Brassica napus]
Length=328

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 173/260 (67%), Gaps = 0/260 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L+LD+ +G G VS D Y +GFF+++IKLPA +++GVV+
Sbjct  33   EGYTHLFGDQNMIVNRDGKSVRLILDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYLSNGDIYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSI+W+  HI+F VDNIP+REV   A++   +P+KPMS+Y TIWDGS+WAT+GGKY V
Sbjct  153  HQYSIMWSHSHIIFYVDNIPIREVKRTASMGGDFPAKPMSLYATIWDGSKWATNGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY +AP+VA    + L GC     +        ++ +     ++T+ Q   +   R KHM
Sbjct  213  NYKFAPYVAQFTDMILHGCAVDPIEKVLSCQDGAAEDLRLASEITESQRKKMDSLRRKHM  272

Query  276  FYSYCKDKARYKVLPLECTA  217
             YSYC D+ RYKV   EC  
Sbjct  273  TYSYCYDRTRYKVALPECVV  292



>ref|XP_010261561.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nelumbo nucifera]
Length=346

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 178/270 (66%), Gaps = 9/270 (3%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGY+ L+G  N+   ++G S  L+LD+ +G G +S   Y +GFF+A IKLPA +
Sbjct  36    TTIRFDEGYSPLFGDSNVVRSSDGKSVHLLLDRYTGSGFISSSLYNHGFFSAKIKLPADY  95

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+GVVVAFY SN DV+   HDE+D E LG    ++W  QTN+Y NGS   GREE++YLWF
Sbjct  96    TAGVVVAFYTSNGDVFEKTHDELDFEFLGNIHGKEWRFQTNVYGNGSTHRGREERYYLWF  155

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPT+  H YSILW +++I+F VD++P+R+VV N A+   YPSKPMS+Y TIWD S WAT 
Sbjct  156   DPTREFHRYSILWTANNIIFYVDDVPIRQVVRNDAMGGDYPSKPMSLYATIWDASNWATS  215

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTS------SLEGEGFVKLTQQQ  313
             GGKY VNY YAPFV+    + L+GC    SD  ++ P+ S       LE   +  +TQ++
Sbjct  216   GGKYKVNYEYAPFVSHFSDLVLQGC---PSDPIQQLPTGSCAEKDAELESADYAVITQER  272

Query  312   ISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
              + ++  R ++M+YSYC D  RY V P EC
Sbjct  273   RAAMKNFRQRYMYYSYCYDSLRYPVPPPEC  302



>ref|XP_010476541.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Camelina sativa]
Length=332

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 173/263 (66%), Gaps = 6/263 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+++IKLPA +++GVV+
Sbjct  33   EGYTQLFGDQNLIVHRDGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYLSNGDLYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEEF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+  HI+F VDN+P+REV   A++   +P+KPMS+Y TIWDGS+WAT GGKY V
Sbjct  153  HQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYATIWDGSKWATDGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF---VKLTQQQISGLQWARG  286
            NY YAP+V     + L GC   + D T + PS      E      ++T  Q   ++  R 
Sbjct  213  NYKYAPYVTQFTDLILHGC---AVDPTEKFPSCEDEAVESLRLASEITVSQRKQMESFRR  269

Query  285  KHMFYSYCKDKARYKVLPLECTA  217
            KHM YSYC D  RYKV+  EC  
Sbjct  270  KHMTYSYCYDHMRYKVVLSECVV  292



>ref|XP_011070344.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Sesamum indicum]
Length=353

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 173/264 (66%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E Y+ L+   NI+   +  +  L+L++ SG G++S D Y YGFF+A+IK+P+ +T+G+VV
Sbjct  45   ESYSPLFSKFNIRRSPDDRTVSLLLNRLSGSGIISSDYYNYGFFSASIKMPSKYTAGIVV  104

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN D +  NHDE+DIE LG    + W  QTN+Y NGSV  GREE++ +WFDP++ S
Sbjct  105  AFYTSNVDTFEKNHDELDIEFLGNVPGKAWRFQTNMYGNGSVSRGREERYRMWFDPSKDS  164

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F VD IP+REVV NAA+   YPSKPMSVY TIWD S WAT GGK  V
Sbjct  165  HRYSILWTPTNIIFYVDEIPIREVVRNAAMRGDYPSKPMSVYATIWDASSWATSGGKRKV  224

Query  456  NYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            NY + PF+A    + LEGC         SS+CT    + ++L  + +  +T +    ++W
Sbjct  225  NYRFQPFIAEFKDLVLEGCIVDPVDQILSSNCTD---TAAALMAKDYSTVTPETRKSMRW  281

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R +HM+YSYC D  RY V P EC
Sbjct  282  FRQRHMYYSYCYDTRRYPVPPPEC  305



>emb|CAN74084.1| hypothetical protein VITISV_018042 [Vitis vinifera]
Length=332

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 174/262 (66%), Gaps = 8/262 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G +  + LD+ +G G +S+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  32   EGYSPLFGDANLAILKDGKTVHMSLDERTGSGFISQDLYLHGFFSASIKLPADYTAGVVV  91

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDE+D E LG  + +DW +QTN+Y NGS   GREE+++LWFDP++  
Sbjct  92   AFYMSNADMFEANHDELDFEFLGNIRGKDWRIQTNVYGNGSTNVGREERYHLWFDPSEDF  151

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+ + I+F VDN+P+RE+    A+   +PSKPMS+Y TIWDGSEWAT+GG+Y V
Sbjct  152  HQYSILWSDNLIIFYVDNVPIREIKRTEAMGGDFPSKPMSLYATIWDGSEWATNGGRYRV  211

Query  456  NYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP+ A    + L GC       S  C     S +S+       +  +Q S ++  R
Sbjct  212  NYKYAPYEAEFSNLVLHGCAVDPIEKSPKCDNGPTSKASIP----TGIMPEQRSKMEKFR  267

Query  288  GKHMFYSYCKDKARYKVLPLEC  223
              HM YSYC D+ RY V P EC
Sbjct  268  KTHMTYSYCYDRVRYTVPPSEC  289



>ref|XP_009390348.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 isoform X2 [Musa acuminata subsp. malaccensis]
Length=332

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 169/265 (64%), Gaps = 1/265 (0%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     EGY  L+G  N+ L  +G +  L LD+ +G G  S+D Y +GFF+A+IKLP+ 
Sbjct  32    LTTLSFEEGYTQLFGDSNLLLHRDGRAVHLALDQRTGAGFASQDLYLHGFFSASIKLPSD  91

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             + +GVVVAFYMSN DV+  +HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LW
Sbjct  92    YAAGVVVAFYMSNGDVFEKSHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYQLW  151

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT+  H YSILW+   I+F +DNIP+REVV   A+   +PSKPMS+Y TIWDGS WAT
Sbjct  152   FDPTEDYHQYSILWSHERIIFYIDNIPIREVVRTQAMGGDFPSKPMSLYATIWDGSTWAT  211

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQ  298
              GG+Y VNY  AP+VA    + L GC    SD       + ++  +  + ++  Q + + 
Sbjct  212   SGGRYKVNYKLAPYVADFADLILHGCAVDPSDHKTACQRSDAVLYDA-ITMSADQRTAMA  270

Query  297   WARGKHMFYSYCKDKARYKVLPLEC  223
               R KHM YSYC D+ RY   P EC
Sbjct  271   KFRKKHMTYSYCHDRIRYPTPPPEC  295



>ref|XP_008454733.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Cucumis melo]
Length=337

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 171/260 (66%), Gaps = 2/260 (1%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E YN L+G  N+ L N+G S  L LD+ +G G +S+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  39   EAYNHLFGDANLLLLNHGKSVHLYLDERTGAGFLSQDLYLHGFFSASIKLPADYTAGVVV  98

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP +  
Sbjct  99   AFYMSNGDMFENNHDEIDFEFLGNIRGKEWRVQTNIYGNGSTNVGREERYGLWFDPAEDF  158

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VD +P+REV   A++   +PSKPM++Y TIWDGS WAT+GGKY V
Sbjct  159  HQYSILWTDSRIIFYVDEVPIREVKRTASMGGEFPSKPMTLYATIWDGSSWATNGGKYKV  218

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFV--KLTQQQISGLQWARGK  283
            NY Y+P++A      L GCT    +   R    +    E  +   +T  + + ++  R K
Sbjct  219  NYKYSPYIAEFSEFVLHGCTVDPIEQVFRKCDLTPQISEAAIPNNITTAKRTKMESFRRK  278

Query  282  HMFYSYCKDKARYKVLPLEC  223
            HM YSYC D  RYK+ P EC
Sbjct  279  HMTYSYCYDHLRYKIPPAEC  298



>ref|XP_009117879.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Brassica rapa]
Length=328

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 171/260 (66%), Gaps = 0/260 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L+LD+ +G G VS D Y +GFF+++IKLPA +++GVV+
Sbjct  33   EGYTHLFGDQNLIVHRDGKSVRLILDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYLSNGDIYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSI+W+  HI+F VDNIP+REV   A++   +P+KPMS+Y TIWDGS+WAT+GGKY V
Sbjct  153  HQYSIMWSHSHIIFYVDNIPIREVKRTASMGGDFPAKPMSLYATIWDGSKWATNGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY +AP+VA    + L GC     +        +  +     ++T  Q   +   R KHM
Sbjct  213  NYKFAPYVAQFTDMILHGCAVDPIEKVLSCQDGAEEDLRLASEITDSQRKKMDSLRRKHM  272

Query  276  FYSYCKDKARYKVLPLECTA  217
             YSYC D+ RYKV   EC  
Sbjct  273  TYSYCYDRTRYKVALPECVV  292



>ref|XP_008652681.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Zea mays]
 tpg|DAA61339.1| TPA: hypothetical protein ZEAMMB73_897061 [Zea mays]
 tpg|DAA61340.1| TPA: hypothetical protein ZEAMMB73_897061 [Zea mays]
Length=342

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 176/297 (59%), Gaps = 8/297 (3%)
 Frame = -1

Query  1101  LSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVL  922
             LS+ VI+  + ARG    PP               EGY  ++G  N+ L  +G    L L
Sbjct  14    LSLAVILLALCARGGEARPPPP---LHGVRPLAFDEGYTQIFGSANLALLRDGRRVRLTL  70

Query  921   DKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYD  742
             D+S+G G  S+D + +GFF+AAIKLPA + +GVVVAFY+SN DVY   HDE+D E LG  
Sbjct  71    DESTGAGFASQDVFLHGFFSAAIKLPADYAAGVVVAFYLSNGDVYEKTHDELDFEFLGNV  130

Query  741   KRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVV  562
             + R+W +QTN+Y NGS   GREE++ L FDPT   H YSILW S  I+F VD  P+REVV
Sbjct  131   RGREWRVQTNVYGNGSTDAGREERYDLPFDPTDDFHHYSILWTSDRIIFYVDETPIREVV  190

Query  561   NNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSD  382
               AA+   +PSKPMS+Y TIWDGS WAT GG+Y VNY YAPFVA    + ++GC   + D
Sbjct  191   RTAAMGAAFPSKPMSLYATIWDGSAWATLGGRYRVNYKYAPFVAEFADLAIQGC---AVD  247

Query  381   CTRRSPSTSSLEGEGFVKL--TQQQISGLQWARGKHMFYSYCKDKARYKVLPLECTA  217
                     S   G G   L  + +Q S +   R  H  YSYC D+ RY V   EC A
Sbjct  248   PAADHAVASCGAGLGLAPLAVSAEQRSAMAAFRRAHTSYSYCHDRRRYPVALSECGA  304



>ref|XP_004142294.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cucumis sativus]
 gb|KGN49677.1| hypothetical protein Csa_5G057140 [Cucumis sativus]
Length=331

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 172/263 (65%), Gaps = 9/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E YN L+G  N+ L N+G S  L LD+ +G G +S+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  34   EAYNHLFGDANLLLLNHGKSVHLHLDERTGAGFLSQDLYLHGFFSASIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP +  
Sbjct  94   AFYMSNGDMFENNHDEIDFEFLGNIRGKEWRVQTNIYGNGSTNVGREERYGLWFDPAEDF  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VD +P+REV   A++   +PSKPM++Y TIWDGS WAT+GGKY V
Sbjct  154  HQYSILWTDSRIIFYVDEVPIREVKRTASMGGEFPSKPMTLYATIWDGSSWATNGGKYKV  213

Query  456  NYNYAPFVASMGRVELEGCTNSSSD-----CTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAP++A      L GCT    +     C     S +S+       +T  + + ++  
Sbjct  214  NYKYAPYIAEFSEFVLHGCTVDPIEQVFPKCDLTQISEASIPN----NITTAKRTKMESF  269

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R KHM YSYC D  RYK+ P EC
Sbjct  270  RRKHMTYSYCYDHLRYKIPPAEC  292



>ref|XP_010066550.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Eucalyptus grandis]
 gb|KCW64460.1| hypothetical protein EUGRSUZ_G02075 [Eucalyptus grandis]
Length=335

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 175/260 (67%), Gaps = 5/260 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  41   EGYAHLFGDDNLVIHGDGKSVHLTLDERTGSGFVSQDLYLHGFFSASIKLPADYTAGVVV  100

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++   HDEID E LG  + ++W +QTN+Y NGSV  GREE++ LWFDP+   
Sbjct  101  AFYMSNGDMFEKTHDEIDFEFLGNIRGKEWRVQTNVYGNGSVGVGREERYNLWFDPSDDF  160

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VDN+P+REV    A+   +PSKPM++Y TIWDGS WAT+GGKY V
Sbjct  161  HQYSILWTDSLIVFYVDNVPIREVKRTKAMGGDFPSKPMTLYATIWDGSSWATNGGKYRV  220

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFV--KLTQQQISGLQWARGK  283
            +Y YAP++     + L GC   + D   RS +  ++   G +   +T++Q   ++  R +
Sbjct  221  SYKYAPYIVEFSDLVLHGC---AVDPIERSSACDAVLPSGSIPTAITREQRVQMESFRKR  277

Query  282  HMFYSYCKDKARYKVLPLEC  223
            HM YSYC D+ARYK+ P EC
Sbjct  278  HMTYSYCYDRARYKIPPPEC  297



>ref|XP_008365814.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Malus domestica]
 gb|ACD03234.1| xyloglucan endotransglucosylase/hydrolase 10 [Malus domestica]
Length=336

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/300 (45%), Positives = 185/300 (62%), Gaps = 11/300 (4%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F  L + +   +V   G + + PS      +       EGY  L+G  N+ +  +G S  
Sbjct  3     FFHLGLFLCACQVLVLGVVASAPS-----GKLPIIPFDEGYTKLFGDDNLMILRDGKSVH  57

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LD+ +G G VS+D Y +GFF+A+IKLPA +T+GVVVAFYMSN D++P  HDEID E L
Sbjct  58    LSLDERTGSGFVSQDLYQHGFFSASIKLPADYTAGVVVAFYMSNGDMFPKYHDEIDFEFL  117

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G  + ++W +QTN+Y NGS  TGREE++ LWFDP+   H YSILW    I+F VDN+P+R
Sbjct  118   GNIRGKEWRVQTNIYGNGSTNTGREERYNLWFDPSDDYHQYSILWTDIQIIFYVDNVPIR  177

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-N  394
             E     ++   +P+KPMS+Y TIWDGS+WAT+GGKY VNY YAP++A    + L GC  +
Sbjct  178   EFKKTKSMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYLAEFSDLVLHGCAVD  237

Query  393   SSSDCTRRSPSTSSLEG--EGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
                  +++  +T S E    G  +L + ++      R KHM YSYC D+ RYK  P EC 
Sbjct  238   PIEQLSKKCENTQSSESVPTGVTRLQRMKMESF---RKKHMTYSYCYDRIRYKSPPSECV  294



>gb|KDP38168.1| hypothetical protein JCGZ_04811 [Jatropha curcas]
Length=323

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 183/302 (61%), Gaps = 19/302 (6%)
 Frame = -1

Query  1119  SQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGS  940
             S F LILS+  ++   S R    T P +             EGY  L+G  N+ +  +G 
Sbjct  8     SGFLLILSLFAVLVSGSQR----TLPII----------SFDEGYTHLFGDDNLVIHKDGK  53

Query  939   SADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDI  760
                L+LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVVAFYMSN D++  NHDEID 
Sbjct  54    RVHLLLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDF  113

Query  759   ELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNI  580
             E LG  + +DW +QTN+Y NGS   GREE++ LWFDP+   H YSILW    I+F VDN+
Sbjct  114   EFLGNIRGKDWRIQTNIYGNGSTSVGREERYNLWFDPSDDFHQYSILWTDSQIIFYVDNV  173

Query  579   PVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC  400
              +REV    ++   +PSKPMS+Y TIWDGS+WAT+GGKY VNY YAP+V       L GC
Sbjct  174   TIREVKRTESMGGDFPSKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGC  233

Query  399   TNSSSDCTRRSPSTSSLEG--EGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
                  +   +  +  + +    G  +L + Q++     R K M YSYC DKARYK+ P E
Sbjct  234   AVDPIEQISKCDTLQNSQAVPTGVTRLQRIQMNSF---RRKFMTYSYCYDKARYKIPPSE  290

Query  225   CT  220
             C 
Sbjct  291   CV  292



>ref|XP_004156140.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cucumis sativus]
 emb|CCH26641.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=331

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 172/263 (65%), Gaps = 9/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E YN L+G  N+ L N+G S  L LD+ +G G +S+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  34   EAYNHLFGDANLLLLNHGKSVHLHLDERTGAGFLSQDLYLHGFFSASIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP +  
Sbjct  94   AFYMSNGDMFENNHDEIDFEFLGNIRGKEWRVQTNIYGNGSTNVGREERYGLWFDPAEDL  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VD +P+REV   A++   +PSKPM++Y TIWDGS WAT+GGKY V
Sbjct  154  HQYSILWTDSRIIFYVDEVPIREVKRTASMGGEFPSKPMTLYATIWDGSSWATNGGKYKV  213

Query  456  NYNYAPFVASMGRVELEGCTNSSSD-----CTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAP++A      L GCT    +     C     S +S+       +T  + + ++  
Sbjct  214  NYKYAPYIAEFSEFVLHGCTVDPIEQVFPKCDLTQISEASIPN----NITTAKRTKMESF  269

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R KHM YSYC D  RYK+ P EC
Sbjct  270  RRKHMTYSYCYDHLRYKIPPAEC  292



>ref|XP_010677382.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Beta vulgaris subsp. vulgaris]
Length=350

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 172/268 (64%), Gaps = 13/268 (5%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+   NI+  ++G +A+L L++ +G G +S   Y YGFF+A IKLP  +T+GVVV
Sbjct  38   EGYTPLFADFNIKKSDDGRAANLHLNRYAGSGFISSKYYDYGFFSARIKLPGNYTAGVVV  97

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  98   AFYTSNADVWEKRHDELDIEFLGNLKGKPWRFQTNMYGNGSTNRGREERYRLWFDPTKDF  157

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  ++I+F VDN+P+RE+V N A+ + +PSKPMS+Y TIWD S WAT GG+Y V
Sbjct  158  HQYSILWTRNNIIFYVDNVPIREIVRNEAMGSDFPSKPMSLYATIWDASSWATAGGRYKV  217

Query  456  NYNYAPFVASMGRVELEGC----------TNSSSDCTRRSPSTSSLEGEGFVKLTQQQIS  307
             Y + PFV+      L+GC          T SSSDC  +      +E + + ++T     
Sbjct  218  KYEFEPFVSEFTDFVLDGCPVDPIEQVAGTTSSSDCATKK---DEIENKEYSQVTPGGRR  274

Query  306  GLQWARGKHMFYSYCKDKARYKVLPLEC  223
             ++W R K+M+YSYC D  RY V P EC
Sbjct  275  AMKWFREKYMYYSYCYDMVRYPVPPPEC  302



>ref|XP_003555818.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Glycine max]
 gb|KHN32264.1| Putative xyloglucan endotransglucosylase/hydrolase protein 28 
[Glycine soja]
Length=343

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 172/259 (66%), Gaps = 1/259 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            +GY  L+G HN+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLPA +T+GVVV
Sbjct  42   DGYTPLFGDHNLAIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPADYTAGVVV  101

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP +  
Sbjct  102  AFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTSIGREERYGLWFDPAEDF  161

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VD++P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY V
Sbjct  162  HQYSILWTDSKIIFYVDDVPIREVKRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRV  221

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP+VA    + L GC     +   +  S    E E    +TQ QI+ ++  R +HM
Sbjct  222  NYKYAPYVAEFSDLVLHGCAVDPIEHVAKCDSALGSE-EVPSGVTQVQITKMRNFRLRHM  280

Query  276  FYSYCKDKARYKVLPLECT  220
             YSYC D  RYKV P EC 
Sbjct  281  TYSYCYDTVRYKVPPPECV  299



>ref|XP_006305074.1| hypothetical protein CARUB_v10009442mg, partial [Capsella rubella]
 gb|EOA37972.1| hypothetical protein CARUB_v10009442mg, partial [Capsella rubella]
Length=381

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 174/263 (66%), Gaps = 6/263 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+++IKLPA +++GVV+
Sbjct  82   EGYTHLFGDQNLVVHRDGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVI  141

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  142  AFYLSNGDLYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEEF  201

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+  HI+F VDN+P+REV   A++   +P+KPMS+Y TIWDGS+WAT GGKY V
Sbjct  202  HQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYATIWDGSKWATDGGKYGV  261

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF---VKLTQQQISGLQWARG  286
            NY YAP+V     + L GC   + D T + P+      E      ++T  Q + ++  R 
Sbjct  262  NYKYAPYVTHFTDLILHGC---AVDPTEKFPACQDEAVEDLRLASEITVSQRNKMEIFRR  318

Query  285  KHMFYSYCKDKARYKVLPLECTA  217
            KHM YSYC D  RYKV+  EC  
Sbjct  319  KHMTYSYCYDHMRYKVVLSECVV  341



>ref|XP_008466018.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Cucumis melo]
Length=348

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 173/266 (65%), Gaps = 10/266 (4%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+    +G S  L+LD+ +G G +S   Y +GFF+A IKLP+ +T+G+VV
Sbjct  44   EGYSPLFGDGNLVRSPDGKSVRLLLDRFTGSGFISSKMYNHGFFSARIKLPSDYTAGIVV  103

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+  NHDE+D E LG  + + W  QTNLY NGS   GREE++ LWFDPT+  
Sbjct  104  AFYTSNGDVFEKNHDELDFEFLGNIEGKPWRFQTNLYGNGSTNRGREERYRLWFDPTKEF  163

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW +++I+F +D +P+REVV N A+   YPSKPMS+Y TIWD S WAT GGKY V
Sbjct  164  HRYSILWTANNIIFYIDEVPIREVVRNEAMGGDYPSKPMSLYATIWDASNWATSGGKYKV  223

Query  456  NYNYAPFVASMGRVELEGCTN-------SSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQ  298
            NY YAPFV+    + LEGC +         SDC   S + + L  + F  +T ++ + ++
Sbjct  224  NYKYAPFVSEFKDLVLEGCPSDPIQEVLEPSDC---SDTIARLNAQDFATITPERRAAMR  280

Query  297  WARGKHMFYSYCKDKARYKVLPLECT  220
              R  +M+YSYC D  RY V P EC 
Sbjct  281  NFRQHYMYYSYCYDTLRYSVPPPECV  306



>ref|XP_010496455.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 isoform X1 [Camelina sativa]
 ref|XP_010496463.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 isoform X2 [Camelina sativa]
Length=333

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 173/263 (66%), Gaps = 7/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF++ IKLPA +++GVV+
Sbjct  33   EGYTQLFGDQNLFVHRDGKSVRLTLDERTGSGFVSNDIYLHGFFSSFIKLPADYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYLSNGDLYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEEF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+  HI+F VDN+P+REV   A++   +P+KPMS+Y TIWDGS+WAT GGKY V
Sbjct  153  HQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYATIWDGSKWATDGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF---VKLTQQQISGLQWARG  286
            NY YAP+V     + L GC   + D T + PS      E      ++T  Q   ++  R 
Sbjct  213  NYKYAPYVTQFTDLILHGC---AVDPTEKFPSCEDEAVESLRLASEITSSQRKQMENFRR  269

Query  285  KHMFYSYCKDKARYKVLPL-ECT  220
            KHM YSYC D  RYKV+ L EC 
Sbjct  270  KHMTYSYCYDHMRYKVVLLSECV  292



>ref|XP_006416979.1| hypothetical protein EUTSA_v10008160mg [Eutrema salsugineum]
 gb|ESQ35332.1| hypothetical protein EUTSA_v10008160mg [Eutrema salsugineum]
Length=332

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 172/260 (66%), Gaps = 0/260 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+++IKLPA +++GVV+
Sbjct  33   EGYTQLFGDQNLIVHRDGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YS+LW+  HI+F VD++P+REV   A +   +P+KPMS+Y TIWDGS+WAT+GGKY V
Sbjct  153  HRYSVLWSHSHIIFYVDDVPIREVKRTATMGGDFPAKPMSLYATIWDGSKWATNGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP++A    + L GC    +D        ++       ++T  + + ++  R KH+
Sbjct  213  NYKYAPYIAQFTDLILHGCAVDPTDKISSCEDGAAKNLRVASEITMSERNKMKSFRRKHL  272

Query  276  FYSYCKDKARYKVLPLECTA  217
             YSYC D  RYKV+  EC  
Sbjct  273  TYSYCYDHTRYKVVLSECVV  292



>ref|XP_002315842.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
 gb|EEF02013.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
Length=336

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 169/259 (65%), Gaps = 1/259 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G    L LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVV
Sbjct  38   EGYTQLFGDDNLVMYRDGKRVHLSLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVV  97

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  98   AFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSAGREERYSLWFDPSDDF  157

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW +  I+F VDNIP+REV    ++   +PSKPMS+Y TIWDGS+WAT+GGKY V
Sbjct  158  HQYSILWTNSQIIFYVDNIPIREVKRTESMGADFPSKPMSLYATIWDGSDWATNGGKYRV  217

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP+VA    + L GC     +   R  +T S +      +T  Q   ++  R K M
Sbjct  218  NYKYAPYVAEFSDLVLHGCAVDPVEQFPRCDNTESSQAIP-TGVTPVQRIKMESFRAKFM  276

Query  276  FYSYCKDKARYKVLPLECT  220
             YSYC D+ RY+  P EC 
Sbjct  277  TYSYCYDRVRYRAPPSECV  295



>ref|XP_010458984.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Camelina sativa]
Length=332

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 172/263 (65%), Gaps = 6/263 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G  S D Y +GFF+++IKLP+ +++GVV+
Sbjct  33   EGYTQLFGDQNLFVHRDGKSVRLTLDERTGSGFASNDIYLHGFFSSSIKLPSDYSAGVVI  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  93   AFYLSNGDLYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTEEF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW+  HI+F VDN+P+REV   A++   +P+KPMS+Y TIWDGS+WAT GGKY V
Sbjct  153  HQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYATIWDGSKWATDGGKYGV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF---VKLTQQQISGLQWARG  286
            NY YAP+V     + L GC   + D T + PS      E      ++T  Q   ++  R 
Sbjct  213  NYKYAPYVTQFTDLILHGC---AVDPTEKFPSCEDEAVENLRLASEITVSQRKQMESFRR  269

Query  285  KHMFYSYCKDKARYKVLPLECTA  217
            KHM YSYC D  RYKV+  EC  
Sbjct  270  KHMTYSYCYDHMRYKVVLSECVV  292



>ref|XP_010055251.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Eucalyptus grandis]
 gb|KCW71714.1| hypothetical protein EUGRSUZ_E00225 [Eucalyptus grandis]
Length=353

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 173/265 (65%), Gaps = 9/265 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E Y  L+G  N+    +G S  L+LD+ SG G +S + Y YGFF+A IKLP+ +T+G+VV
Sbjct  50   EAYAPLFGDSNVVRSGDGKSVRLLLDRFSGSGFISSNLYKYGFFSARIKLPSDYTAGIVV  109

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTN+Y NGS   GREE++ LWFDPT+A 
Sbjct  110  AFYTSNGDVFEKTHDELDIEFLGNIKGKKWRFQTNVYGNGSTSRGREERYTLWFDPTRAF  169

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW +++I+F VD +P+RE++ N A+   +P+KPM++Y TIWD S+WAT GG+Y V
Sbjct  170  HRYSILWTANNIIFYVDEVPIREIIRNDAMGGDFPAKPMALYATIWDASDWATSGGRYKV  229

Query  456  NYNYAPFVASMGRVELEGC------TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            NY YAPFVA    + L+GC        SS  C  +    + LE + F  +T Q+ + ++ 
Sbjct  230  NYKYAPFVAEFKDLVLQGCPVDPIDQYSSGHCYDK---LALLEAQDFATVTAQRHAAMRR  286

Query  294  ARGKHMFYSYCKDKARYKVLPLECT  220
             R  +M+YSYC D  RY + P EC 
Sbjct  287  FRQNYMYYSYCYDTIRYAIPPPECV  311



>gb|KHN25480.1| Putative xyloglucan endotransglucosylase/hydrolase protein 28 
[Glycine soja]
Length=333

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 172/261 (66%), Gaps = 5/261 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            +GY  L+G HN+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLPA +T+GVVV
Sbjct  32   DGYTPLFGDHNLAIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPADYTAGVVV  91

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN +++ +NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP +  
Sbjct  92   AFYMSNGEMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTSIGREERYGLWFDPAEDF  151

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VDN+P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY V
Sbjct  152  HQYSILWTDSKIIFYVDNVPIREVKRTESMGGDFPSKPMTMYATIWDASDWATNGGKYRV  211

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGK  283
            NY YAP+VA    + L GC   + D         S +G   V   +T  QI+ ++  R K
Sbjct  212  NYKYAPYVAEFSDLILHGC---AVDPIEHVAKCESAQGSEKVPSGVTPVQITKMRNFRLK  268

Query  282  HMFYSYCKDKARYKVLPLECT  220
            HM YSYC D  RYKV P EC 
Sbjct  269  HMAYSYCYDTVRYKVPPPECV  289



>ref|XP_004504585.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cicer arietinum]
Length=331

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 169/263 (64%), Gaps = 9/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G +N+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLPA +T+GVVV
Sbjct  33   EGYTPLFGDNNVFVHTDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPADYTAGVVV  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D+Y  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP +  
Sbjct  93   AFYMSNGDMYEKNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTSIGREERYGLWFDPAEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VDNIP+REV    ++   +P+KPM++Y TIWD S+WAT+GGKY V
Sbjct  153  HQYSILWTDSLIIFYVDNIPIREVTRTESMGGDFPAKPMTLYATIWDASDWATNGGKYRV  212

Query  456  NYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP++A    + L GC        + C   S S S   G     +T  Q   ++  R
Sbjct  213  NYKYAPYIAKFSDLVLHGCAVDPIEHVAKCDTASDSKSVPSG-----VTPVQRIKMENFR  267

Query  288  GKHMFYSYCKDKARYKVLPLECT  220
             KHM YSYC DK RYK  P EC 
Sbjct  268  KKHMTYSYCYDKIRYKAPPSECA  290



>ref|XP_003529235.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform X1 [Glycine max]
 ref|XP_006583754.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform X2 [Glycine max]
 ref|XP_006583755.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform X3 [Glycine max]
Length=338

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 172/261 (66%), Gaps = 5/261 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            +GY  L+G HN+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLPA +T+GVVV
Sbjct  37   DGYTPLFGDHNLAIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPADYTAGVVV  96

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN +++ +NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP +  
Sbjct  97   AFYMSNGEMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTSIGREERYGLWFDPAEDF  156

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VDN+P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY V
Sbjct  157  HQYSILWTDSKIIFYVDNVPIREVKRTESMGGDFPSKPMTMYATIWDASDWATNGGKYRV  216

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGK  283
            NY YAP+VA    + L GC   + D         S +G   V   +T  QI+ ++  R K
Sbjct  217  NYKYAPYVAEFSDLILHGC---AVDPIEHVAKCESAQGSEKVPSGVTPVQITKMRNFRLK  273

Query  282  HMFYSYCKDKARYKVLPLECT  220
            HM YSYC D  RYKV P EC 
Sbjct  274  HMAYSYCYDTVRYKVPPPECV  294



>gb|AGZ15408.1| xyloglucan endotransglucosylase/hydrolase protein 28 [Phaseolus 
vulgaris]
Length=327

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 183/304 (60%), Gaps = 19/304 (6%)
 Frame = -1

Query  1125  FFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNN  946
             FFS FF +         +++ G +   P +             +GY  L+G HN+ +  +
Sbjct  3     FFSAFFAV---------IASSGSLANLPII----------AFEDGYTHLFGDHNLVIHRD  43

Query  945   GSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEI  766
             G S  L LD+ +G G VS D Y +G+F+A+IKLP+ +T+GVVVAFY+SN D++  NHDEI
Sbjct  44    GKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPSDYTAGVVVAFYLSNGDMFQKNHDEI  103

Query  765   DIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVD  586
             D E LG  + +DW +QTN+Y NGS  TGREE+  LWFDP +  H YSILW    I+FLVD
Sbjct  104   DFEFLGNIRGKDWRVQTNVYGNGSTNTGREERCGLWFDPAEDFHQYSILWTDSKIIFLVD  163

Query  585   NIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELE  406
             ++P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY VNY YAPFVA    + L 
Sbjct  164   DVPIREVKRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRVNYKYAPFVAEFSDLVLH  223

Query  405   GCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
             GC     +   +  S++         +T  Q + +   R KHM YSYC D  RYKV P E
Sbjct  224   GCAVDPIEHVTKCDSSAQDFEAVPSGITPVQRTKMGNFRLKHMTYSYCYDTVRYKVPPPE  283

Query  225   CTAK  214
             C  K
Sbjct  284   CVIK  287



>gb|AGV54504.1| xyloglucan endotransglucosylase/hydrolase protein 28-like protein 
[Phaseolus vulgaris]
Length=327

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 183/304 (60%), Gaps = 19/304 (6%)
 Frame = -1

Query  1125  FFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNN  946
             FFS FF +         +++ G +   P +             +GY  L+G HN+ +  +
Sbjct  3     FFSAFFAV---------IASSGSLANLPII----------AFEDGYTHLFGDHNLVIHRD  43

Query  945   GSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEI  766
             G S  L LD+ +G G VS D Y +G+F+A+IKLP+ +T+GV+VAFY+SN D++  NHDEI
Sbjct  44    GKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPSDYTAGVLVAFYLSNGDMFQKNHDEI  103

Query  765   DIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVD  586
             D E LG  + +DW +QTN+Y NGS  TGREE+  LWFDP +  H YSILW    I+FLVD
Sbjct  104   DFEFLGNIRGKDWRVQTNVYGNGSTNTGREERCGLWFDPAEDFHQYSILWTDSKIIFLVD  163

Query  585   NIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELE  406
             ++P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY VNY YAPFVA    + L 
Sbjct  164   DVPIREVKRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRVNYKYAPFVAEFSDLVLH  223

Query  405   GCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLE  226
             GC     +   +  S++         +T  Q + +   R KHM YSYC D  RYKV P E
Sbjct  224   GCAVDPIEHVTKCDSSAQDSEAVPSGITPVQRTKMGNFRLKHMTYSYCYDTVRYKVPPPE  283

Query  225   CTAK  214
             C  K
Sbjct  284   CVIK  287



>ref|XP_009351584.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Pyrus x bretschneideri]
Length=336

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 184/300 (61%), Gaps = 11/300 (4%)
 Frame = -1

Query  1110  FLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSAD  931
             F  L + +   +V   G + + PS      +       EGY  L+G  N+ +  +G S  
Sbjct  3     FFYLGLFLCACQVLVLGVVASAPS-----GKLPIIPFDEGYTKLFGEDNLMILRDGKSVH  57

Query  930   LVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELL  751
             L LD+ +G G VS+D Y +GFF+A+IKLPA +T+GVVVAFYMSN D++P  HDEID E L
Sbjct  58    LSLDERTGSGFVSQDLYQHGFFSASIKLPADYTAGVVVAFYMSNGDMFPKYHDEIDFEFL  117

Query  750   GYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVR  571
             G  + ++W +QTN+Y N S  TGREE++ LWFDP+   H YSILW    I+F VDN+P+R
Sbjct  118   GNIRGKEWRVQTNIYGNRSTNTGREERYNLWFDPSDDYHQYSILWTDSQIIFYVDNVPIR  177

Query  570   EVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-N  394
             E     ++   +P+KPMS+Y TIWDGS+WAT+GGKY VNY YAP++A    + L GC  +
Sbjct  178   EFKKTESMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYLAEFSDLVLHGCAVD  237

Query  393   SSSDCTRRSPSTSSLEG--EGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
                  +++  +T S E    G  +L + ++      R KHM YSYC D+ RYK  P EC 
Sbjct  238   PIEQLSKKCENTRSSESVPTGVTRLQRMKMESF---RKKHMTYSYCYDRIRYKSPPSECV  294



>ref|XP_006849428.1| hypothetical protein AMTR_s00024p00025540 [Amborella trichopoda]
 gb|ERN11009.1| hypothetical protein AMTR_s00024p00025540 [Amborella trichopoda]
Length=325

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 175/260 (67%), Gaps = 3/260 (1%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+GG N+ +  +G +A ++LDKS+G G +S+D + +GFF+A+IKLPA +T+GVVV
Sbjct  27   EGYSRLFGGDNLIVSKDGKTAQILLDKSTGAGFLSQDLFLHGFFSASIKLPADYTAGVVV  86

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDE+D E LG  + ++W +QTN+Y NGS   GREE+F LWFDP++  
Sbjct  87   AFYMSNGDIFEKNHDELDFEFLGNIRGKEWRVQTNVYGNGSTNVGREERFDLWFDPSEDF  146

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F +DN+P+RE +    + T YPSKPMS+Y TIWDGS+WAT GG++ V
Sbjct  147  HAYSILWTEDQIVFYIDNVPIRE-MKREGMGTHYPSKPMSLYATIWDGSDWATSGGRFKV  205

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAPFVA    + L+GCT             S        +++ +  S ++  R KHM
Sbjct  206  NYKYAPFVAQFSDLVLDGCTVDPIQQLSSCEDHSRPFHLPMPEISPELRSAMRKIRTKHM  265

Query  276  FYSYCKDKARY-KVLPLECT  220
             YSYC D+ RY K LP EC 
Sbjct  266  AYSYCYDRERYSKPLP-ECV  284



>gb|KDO60844.1| hypothetical protein CISIN_1g019909mg [Citrus sinensis]
Length=334

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 170/264 (64%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLPA +T+GVVV
Sbjct  34   EGYSHLFGHDNLVVHTDGKSVHLSLDERTGSGFVSHDLYLHGFFSASIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  94   AFYMSNGDMFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSIGREERYNLWFDPSDDF  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F +D IP+RE    A++   +P+KPMS+Y TIWDGS+WAT+GGKY V
Sbjct  154  HQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRV  213

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAP+V       L GC+      +SS C     S  S+       ++  Q   ++  
Sbjct  214  NYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIP----TGVSPSQRIKMENF  269

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R KHM YSYC D+ RYKV P EC 
Sbjct  270  RRKHMTYSYCYDQIRYKVPPFECV  293



>ref|XP_007153190.1| hypothetical protein PHAVU_003G014400g [Phaseolus vulgaris]
 gb|ESW25184.1| hypothetical protein PHAVU_003G014400g [Phaseolus vulgaris]
Length=338

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 170/261 (65%), Gaps = 0/261 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            +GY  L+G HN+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLP+ +T+GVVV
Sbjct  38   DGYTHLFGDHNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPSDYTAGVVV  97

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D++  NHDEID E LG  + +DW +QTN+Y NGS  TGREE+  LWFDP +  
Sbjct  98   AFYLSNGDMFQKNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNTGREERCGLWFDPAEDF  157

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+FLVD++P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY V
Sbjct  158  HQYSILWTDSKIIFLVDDVPIREVKRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRV  217

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAPFVA    + L GC     +   +  S++         +T  Q + +   R KHM
Sbjct  218  NYKYAPFVAEFSDLVLHGCAVDPIEHVTKCDSSAQDSEAVPSGITPVQRTKMGNFRLKHM  277

Query  276  FYSYCKDKARYKVLPLECTAK  214
             YSYC D  RYKV P EC  K
Sbjct  278  TYSYCYDTVRYKVPPPECVIK  298



>ref|XP_004297401.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform 1 [Fragaria vesca subsp. vesca]
Length=335

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 173/265 (65%), Gaps = 9/265 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSG-----CGLVSKDRYYYGFFNAAIKLPAGFT  832
            EGYN L+G  N+ +  +G S  L LD+ +G      G VS+D Y +GFF+A+IKLP  +T
Sbjct  29   EGYNKLFGDDNLMILKDGKSVHLTLDERTGPLCFRSGFVSQDLYIHGFFSASIKLPTDYT  88

Query  831  SGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFD  652
            +GVVVAFYMSN D++P NHDEID E LG  + ++W +QTN+Y NGS +TGREE++ LWFD
Sbjct  89   AGVVVAFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTETGREERYNLWFD  148

Query  651  PTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHG  472
            P++  H YSILW    I+F VDNIP+R V  + ++   YPSKPMS+Y TIWDGS WAT G
Sbjct  149  PSEDYHQYSILWTDSQIIFYVDNIPIRVVKKSESMGGDYPSKPMSLYATIWDGSGWATDG  208

Query  471  GKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQ  298
            GKY VNY YAPF A    + L GC  +     + S      +G  ++   +T+ Q   ++
Sbjct  209  GKYRVNYKYAPFRAEFSDLVLHGC--AVDPIEQVSKKCDKTQGSEYIPTGVTRLQRMRME  266

Query  297  WARGKHMFYSYCKDKARYKVLPLEC  223
              R + M YSYC D+ RYKV P EC
Sbjct  267  SFRKRQMTYSYCYDRIRYKVAPPEC  291



>ref|XP_006395846.1| hypothetical protein EUTSA_v10004560mg [Eutrema salsugineum]
 gb|ESQ33132.1| hypothetical protein EUTSA_v10004560mg [Eutrema salsugineum]
Length=333

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 170/264 (64%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N+ +  +G S  L LD+ +G G  S D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEESYTQLFGDKNLLVHKDGKSVRLTLDERTGSGFASNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + +DW +QTN+Y NGS  +GREE+++LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTHSGREERYHLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H Y ILW+  HI+F VDN+P+REV    ++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDFHQYGILWSDSHIIFYVDNVPIREVKRTESMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP++A    + L GC     +   +    ++ +     ++T  Q   +   R
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGCAVDPIEQFPKCDEGAAEDIRAAQEITPSQRVKMGIFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              K M YSYC D+ RYKV   EC  
Sbjct  269   RKLMTYSYCYDRTRYKVALPECVV  292



>emb|CDY03100.1| BnaC07g21270D [Brassica napus]
Length=333

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 169/264 (64%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N  +  +G S  L LD+ +G G VS D Y +G F+A+IKLP+ +++
Sbjct  29    TSFEESYTQLFGDKNFFVHKDGKSVRLTLDERTGSGFVSNDLYLHGLFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE+  LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERSNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDNIP+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDYHQYSILWSDSHIIFFVDNIPIREVKRTASMGGHFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP+VA +  + L GC     +   +    +  +     +++  Q   +   R
Sbjct  209   KYGVNYKYAPYVAKLTDLVLHGCAVDPIEQFPKCDEGADEDIRAAQEISPSQRVKMGAFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              KHM YSYC D+ RYKV   EC  
Sbjct  269   RKHMTYSYCYDRNRYKVALPECVV  292



>emb|CDY17630.1| BnaA06g34490D [Brassica napus]
Length=333

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 170/264 (64%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N+ +  +G S  L LD+ +G G VS D Y +G F+A+IKLP+ +++
Sbjct  29    TSFEESYTQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGLFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE+  LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERSNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDYHQYSILWSDSHIIFFVDNVPIREVKRTASMGGHFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP+VA +  + L GC     +   +    +  +     +++  Q   +   R
Sbjct  209   KYGVNYKYAPYVAQLTDLVLHGCAVDPIEQFPKCDEGADEDIRAAQEISPSQRVKMGVFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              KHM YSYC D+ RYKV   EC  
Sbjct  269   RKHMTYSYCYDRNRYKVALPECVV  292



>ref|XP_011018473.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Populus euphratica]
Length=351

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 169/264 (64%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+    NG +A L+LD+ +G G +S   Y YGFF+A IKLP  +T+G+ V
Sbjct  45   EGYSPLFGDGNLVRSPNGRTARLLLDRFTGAGFISSKMYKYGFFSANIKLPGDYTAGLCV  104

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+D E LG  + + W  QTNLY NGS + GREE++ LWFDP++  
Sbjct  105  AFYTSNGDVFEKTHDELDFEFLGNTEGKPWRFQTNLYGNGSTRRGREERYRLWFDPSKQF  164

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F +D++P+REV+ +  +   YPSKPMS+Y TIWD S WAT GGKY V
Sbjct  165  HRYSILWTEKNIIFYIDDVPIREVIRSEEMGGEYPSKPMSLYATIWDASNWATSGGKYKV  224

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPST------SSLEGEGFVKLTQQQISGLQW  295
            NY YAPFV+      LEGC    SD     PS       S LE   +  +T++Q S ++ 
Sbjct  225  NYKYAPFVSEFKDFVLEGC---PSDPIEEFPSVECYESYSRLESADYATITRRQRSAMRK  281

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V P EC
Sbjct  282  FRQRYMYYSYCYDSLRYPVPPPEC  305



>gb|ABM91072.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-39 [Populus 
tremula]
Length=336

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 168/258 (65%), Gaps = 1/258 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G +  L LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVV
Sbjct  38   EGYTQLFGDDNLAIHRDGKTVHLSLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVV  97

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  
Sbjct  98   AFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSVGREERYSLWFDPSEDF  157

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I F VDN+P+RE     ++   +PSKPMS+Y TIWDGS WAT+GGKY V
Sbjct  158  HQYSILWTDSQITFYVDNVPIREFKRTESMGGDFPSKPMSLYATIWDGSGWATNGGKYRV  217

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP+V     + L GC     +   +  +T S E       T Q+I  ++  R K M
Sbjct  218  NYKYAPYVTEFSDLVLHGCAVDPIEQFPKCDNTESSEAIPTGVTTVQRIK-MESFRAKFM  276

Query  276  FYSYCKDKARYKVLPLEC  223
             YSYC D+ RYKV P EC
Sbjct  277  TYSYCYDRVRYKVPPSEC  294



>ref|XP_003524850.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Glycine max]
Length=338

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 170/263 (65%), Gaps = 8/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLP+ +T+GVVV
Sbjct  35   EGYAPLFGDSNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPSDYTAGVVV  94

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP    
Sbjct  95   AFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNIGREERYGLWFDPADDF  154

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+I+W    I+F VDN+P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY V
Sbjct  155  HQYTIVWTDSQIIFYVDNVPIREVTRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRV  214

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAP+VA    + L GC         + C     S +++   G   +T  Q   ++  
Sbjct  215  NYKYAPYVAEFSDLVLHGCAVDPIEQHVATCDNAQSSEATIPPSG---VTPAQRIKMENF  271

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R KHM YSYC DK RYKV P EC
Sbjct  272  RKKHMTYSYCYDKVRYKVPPSEC  294



>ref|XP_004163204.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Cucumis sativus]
 emb|CCH26637.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=348

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/319 (44%), Positives = 190/319 (60%), Gaps = 21/319 (7%)
 Frame = -1

Query  1158  MRMGLFKNSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVL  979
             M + L  N  +F + F L+  M+       A        S +  T RF      EGY+ L
Sbjct  1     MDVWLCSNGGSFSNLFLLLTLMIFCFCNFVANA------SFNVSTIRF-----DEGYSPL  49

Query  978   YGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSN  799
             +G  N+    +G S  L+LD+ +G G +S   Y +GFF+A IKLP+ +T+G+VVAFY SN
Sbjct  50    FGDGNLVRSPDGKSVRLLLDRFTGSGFISSKMYNHGFFSARIKLPSDYTAGIVVAFYTSN  109

Query  798   QDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSIL  619
              DV+  +HDE+D E LG  + + W  QTNLY NGS   GREE++ LWFDPT+  H YSIL
Sbjct  110   GDVFEKSHDELDFEFLGNIEGKPWRFQTNLYGNGSTNRGREERYRLWFDPTKEFHRYSIL  169

Query  618   WNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAP  439
             W ++ I+F +D +P+REVV N A+   +PSKPMS+Y TIWD S WAT GGKY VNY YAP
Sbjct  170   WTANIIIFYIDEVPIREVVRNEAMGGDFPSKPMSLYATIWDASNWATSGGKYKVNYKYAP  229

Query  438   FVASMGRVELEGCTN-------SSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKH  280
             FV+    + LEGC +         SDC   S + + L  + F  +T ++ + ++  R  +
Sbjct  230   FVSEFKDLVLEGCPSDPIQEVLEPSDC---SATITRLNAQDFTTITPERRAAMRNFRQHY  286

Query  279   MFYSYCKDKARYKVLPLEC  223
             M+YSYC D  RY V P EC
Sbjct  287   MYYSYCYDTLRYSVPPPEC  305



>gb|KHN25980.1| Putative xyloglucan endotransglucosylase/hydrolase protein 28 
[Glycine soja]
Length=337

 Score =   265 bits (678),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 170/263 (65%), Gaps = 8/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLP+ +T+GVVV
Sbjct  30   EGYAPLFGDSNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPSDYTAGVVV  89

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP    
Sbjct  90   AFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNIGREERYGLWFDPADDF  149

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+I+W    I+F VDN+P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY V
Sbjct  150  HQYTIVWTDSQIIFYVDNVPIREVTRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRV  209

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAP+VA    + L GC         + C     S +++   G   +T  Q   ++  
Sbjct  210  NYKYAPYVAEFSDLVLHGCAVDPIEQHVATCDNAQSSEATIPPSG---VTPAQRIKMENF  266

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R KHM YSYC DK RYKV P EC
Sbjct  267  RKKHMTYSYCYDKVRYKVPPSEC  289



>ref|XP_010911228.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Elaeis guineensis]
Length=330

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 172/268 (64%), Gaps = 5/268 (2%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     EGY  L+G  N+ L  +G +  L LD+ +G G  S+D Y +GFF+A IKLP+ 
Sbjct  30    LTTLSFEEGYTQLFGDSNLMLHRDGRAVHLSLDERTGAGFASQDLYLHGFFSANIKLPSD  89

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             + +GVVVAFYMSN DV+   HDE+D E LG  + ++W +QTN+Y NGS   GREE++ LW
Sbjct  90    YAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGKEWRVQTNIYGNGSTSIGREERYGLW  149

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT+  H YSILW+   I+F +DN+P+REVV   A+   +PSKPMS+Y TIWDGS WAT
Sbjct  150   FDPTEDFHKYSILWSHDRIIFYIDNVPIREVVRTEAMGGQFPSKPMSLYATIWDGSNWAT  209

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF--VKLTQQQISG  304
              GG+Y +NY YAP++A    + L GC     D T   P+ ++L  + +  + ++  Q   
Sbjct  210   SGGRYKINYKYAPYIAEFADLTLHGCAVDPMDHT---PTCNNLAADLYSTITVSADQRMA  266

Query  303   LQWARGKHMFYSYCKDKARYKVLPLECT  220
             ++  R K+M YSYC D+ RY V   EC+
Sbjct  267   MERFRKKYMTYSYCYDRVRYSVPLPECS  294



>ref|XP_009129188.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Brassica rapa]
Length=333

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 174/268 (65%), Gaps = 8/268 (3%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEESYMQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D Y  NHDEID E LG  + R+W +QTN+Y NGS   GREE+  LWFDP
Sbjct  89    GVVVAFYMSNGDTYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERCNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   +++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDYHQYSILWSDFHIIFYVDNVPIREVKRTSSMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQ----QISGL  301
             KY VNY YAP++A    + L GC   + D   + P       E +++  Q+    + + +
Sbjct  209   KYGVNYKYAPYIARFSDLVLHGC---AVDPIEQLPKCDEGAIE-YIRAAQEISLSERAKM  264

Query  300   QWARGKHMFYSYCKDKARYKVLPLECTA  217
             +  R KHM YSYC D+ RYKV   EC  
Sbjct  265   EVFRRKHMTYSYCYDRTRYKVSLPECVV  292



>ref|XP_010276803.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nelumbo nucifera]
Length=341

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/271 (48%), Positives = 174/271 (64%), Gaps = 9/271 (3%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T  G  EGY  L+G  NI   ++G S  L+L++ SG G +S   Y +GFF+A IKLP+ 
Sbjct  33    LTTIGFDEGYTPLFGDFNILRSSDGKSVSLLLNRYSGSGFISSSLYNHGFFSAKIKLPSD  92

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             +T+GVVVAFY SN DV+   HDE+D E LG  + ++W  QTN+Y NGS   GREE++ LW
Sbjct  93    YTAGVVVAFYTSNADVFEKTHDELDFEFLGNVQGKEWRFQTNVYGNGSTNRGREERYTLW  152

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT+  H YSILW + +I+F VD +P+REVV + A+   YPSKPM++Y TIWD S WAT
Sbjct  153   FDPTREFHRYSILWTAKNIIFYVDEVPIREVVRSDAMGGDYPSKPMALYATIWDASNWAT  212

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTN------SSSDCTRRSPSTSSLEGEGFVKLTQQ  316
              GGKY VNY YAPFV+    + L+GC +      SS+ C   +   + LE   +  +T +
Sbjct  213   AGGKYKVNYKYAPFVSDFSDLVLQGCQSDPIQEFSSTIC---ADEDAELERAEYAVITPE  269

Query  315   QISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             +   ++  R K+M+YSYC D  RY V P EC
Sbjct  270   RRRAMRVFRQKYMYYSYCYDILRYPVPPPEC  300



>ref|XP_008798384.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Phoenix dactylifera]
Length=335

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 170/269 (63%), Gaps = 5/269 (2%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     EGY  L+G  N+ L  +G    L LD+ +G G  S+D Y +GFF+AAIKLP+ 
Sbjct  35    LTSLSFEEGYTQLFGDSNLMLHRDGRGVHLSLDERTGAGFASQDLYLHGFFSAAIKLPSD  94

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             + +GVVVAFYMSN DV+   HDE+D E LG  + ++W +QTN+Y NGS   GREE++ LW
Sbjct  95    YAAGVVVAFYMSNGDVFERTHDELDFEFLGNIRGKEWRVQTNIYGNGSTAIGREERYGLW  154

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT+  H YSILW+   I+F +DN+P+REV     +   +PSKPMS+Y TIWDGS WAT
Sbjct  155   FDPTEDFHKYSILWSHDRIIFYIDNVPIREVARTEVLGGQFPSKPMSLYATIWDGSNWAT  214

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF--VKLTQQQISG  304
              GG+Y +NY YAP++A    + L+GC     D T   P+ + L  + +  + ++  Q   
Sbjct  215   SGGRYKINYKYAPYIAEFADLILDGCAVDPMDHT---PTCNGLVADLYDTITISTDQRLA  271

Query  303   LQWARGKHMFYSYCKDKARYKVLPLECTA  217
             ++  R KHM YSYC D+ RY     EC+A
Sbjct  272   MERFRKKHMTYSYCYDRIRYSTPLPECSA  300



>ref|XP_009101303.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Brassica rapa]
Length=333

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 170/264 (64%), Gaps = 0/264 (0%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N+ +  +G +  L LD+ +G G VS D Y +G F+A+IKLP+ +++
Sbjct  29    TSFEESYTQLFGDKNLFVHKDGKTVRLTLDERTGSGFVSNDLYLHGLFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + ++W +QTN+Y NGS   GREE+  LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERSNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   A++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDYHQYSILWSDSHIIFFVDNVPIREVKRTASMGGHFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
             KY VNY YAP+VA +  + L GC     +   +    +  +     +++  Q   +   R
Sbjct  209   KYGVNYKYAPYVAQLTDLVLHGCAVDPIEQFPKCDEGADEDIRAAQEISPSQRVKMGVFR  268

Query  288   GKHMFYSYCKDKARYKVLPLECTA  217
              KHM YSYC D+ RYKV   EC  
Sbjct  269   RKHMTYSYCYDRNRYKVALPECVV  292



>ref|XP_010105548.1| putative xyloglucan endotransglucosylase/hydrolase protein 27 
[Morus notabilis]
 gb|EXC05043.1| putative xyloglucan endotransglucosylase/hydrolase protein 27 
[Morus notabilis]
Length=340

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 169/262 (65%), Gaps = 9/262 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G +  L L++ +G G VS+D Y +GFF+A+IKLP  +T+GVVV
Sbjct  42   EGYTQLFGDDNLLIHRDGKTVHLTLNERTGSGFVSQDLYLHGFFSASIKLPPDYTAGVVV  101

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  102  AFYMSNGDMFEKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTSVGREERYNLWFDPSDDF  161

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H +SILW    I+F VDN+P+REV    ++   +PSKPMS+Y TIWDGS+WAT+GGKY V
Sbjct  162  HHFSILWTDSLIIFYVDNVPIREVKRTESMGGDFPSKPMSLYATIWDGSDWATNGGKYRV  221

Query  456  NYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP+V     + L GC        S C     S S   G     +T  Q + ++  R
Sbjct  222  NYKYAPYVTEFSDLVLHGCAVDPIEQFSKCDNSQDSESVPTG-----VTPMQRTRMEGIR  276

Query  288  GKHMFYSYCKDKARYKVLPLEC  223
             KHM YSYC D+ RYKV P EC
Sbjct  277  KKHMTYSYCYDRVRYKVPPPEC  298



>ref|XP_009390346.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 isoform X1 [Musa acuminata subsp. malaccensis]
Length=335

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 169/268 (63%), Gaps = 4/268 (1%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSS---GCGLVSKDRYYYGFFNAAIKL  847
              T     EGY  L+G  N+ L  +G +  L LD+ +   G G  S+D Y +GFF+A+IKL
Sbjct  32    LTTLSFEEGYTQLFGDSNLLLHRDGRAVHLALDQRTALLGAGFASQDLYLHGFFSASIKL  91

Query  846   PAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKF  667
             P+ + +GVVVAFYMSN DV+  +HDE+D E LG  + R+W +QTN+Y NGS   GREE++
Sbjct  92    PSDYAAGVVVAFYMSNGDVFEKSHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERY  151

Query  666   YLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSE  487
              LWFDPT+  H YSILW+   I+F +DNIP+REVV   A+   +PSKPMS+Y TIWDGS 
Sbjct  152   QLWFDPTEDYHQYSILWSHERIIFYIDNIPIREVVRTQAMGGDFPSKPMSLYATIWDGST  211

Query  486   WATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQIS  307
             WAT GG+Y VNY  AP+VA    + L GC    SD       + ++  +  + ++  Q +
Sbjct  212   WATSGGRYKVNYKLAPYVADFADLILHGCAVDPSDHKTACQRSDAVLYDA-ITMSADQRT  270

Query  306   GLQWARGKHMFYSYCKDKARYKVLPLEC  223
              +   R KHM YSYC D+ RY   P EC
Sbjct  271   AMAKFRKKHMTYSYCHDRIRYPTPPPEC  298



>gb|KHN28876.1| Putative xyloglucan endotransglucosylase/hydrolase protein 28 
[Glycine soja]
Length=341

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 172/266 (65%), Gaps = 11/266 (4%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLP+ +T+GVVV
Sbjct  36   EGYAPLFGDSNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPSDYTAGVVV  95

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP    
Sbjct  96   AFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNIGREERYGLWFDPADDF  155

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+I+W    I+F VDN+P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY V
Sbjct  156  HQYTIVWTDSQIIFYVDNVPIREVTRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRV  215

Query  456  NYNYAPFVASMGRVELEGCT--------NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGL  301
            NY YAP+VA    + L GC             +  + S +T+++   G   +T  Q   +
Sbjct  216  NYKYAPYVAEFSDLVLHGCAVDPIEQHVAKCDNAPQSSEATTTIPSSG---VTPAQRIKM  272

Query  300  QWARGKHMFYSYCKDKARYKVLPLEC  223
            +  R KHM YSYC DK RYKV P EC
Sbjct  273  ENFRKKHMTYSYCYDKVRYKVPPSEC  298



>ref|XP_003576504.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Brachypodium distachyon]
Length=338

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 168/263 (64%), Gaps = 2/263 (1%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  ++G  N+ L+  G    L LD+S+G G  S+D + +GFF+AA+KLPA + +GVVV
Sbjct  49   EGYTQIFGRDNLALRREGKRVHLSLDESTGAGFASQDLFLHGFFSAAVKLPADYAAGVVV  108

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ L FDPT   
Sbjct  109  AFYLSNGDVYEKTHDELDFEFLGNVRGREWRVQTNVYGNGSTSAGREERYDLPFDPTDDF  168

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD  P+REVV   ++   +PSKPMS+Y TIWDGS WAT GG+Y V
Sbjct  169  HHYSILWTQHRIIFYVDETPIREVVRTESMGAAFPSKPMSLYATIWDGSAWATLGGRYRV  228

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF--VKLTQQQISGLQWARGK  283
            NY YAPFVA  G + L+GC  +  D +  + +T+      +  V L+ +Q   +   R  
Sbjct  229  NYKYAPFVAEFGDLVLQGCPVNPIDNSASASATACGATPWYEPVALSAEQGVAMAGFRRG  288

Query  282  HMFYSYCKDKARYKVLPLECTAK  214
            HM YSYC D+ RY V   EC  +
Sbjct  289  HMSYSYCHDRLRYPVALTECDGR  311



>ref|XP_004136205.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Cucumis sativus]
 gb|KGN60351.1| hypothetical protein Csa_3G900960 [Cucumis sativus]
Length=348

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 190/320 (59%), Gaps = 21/320 (7%)
 Frame = -1

Query  1158  MRMGLFKNSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVL  979
             M + L  N  +F + F L+  M+     + A        S +  T RF      EGY+ L
Sbjct  1     MDVWLCSNGGSFSNLFLLLTLMIFCFCNIVANA------SFNVSTIRF-----DEGYSPL  49

Query  978   YGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSN  799
             +G  N+    +G S  L+LD+ +G G +S   Y +GFF+A IKLP+ +T+G+VVAFY SN
Sbjct  50    FGDGNLVRSPDGKSVRLLLDRFTGSGFISSKMYNHGFFSARIKLPSDYTAGIVVAFYTSN  109

Query  798   QDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSIL  619
              DV+  +HDE+D E LG  + + W  QTNLY NGS   GREE++ LWFDPT+  H YSIL
Sbjct  110   GDVFEKSHDELDFEFLGNIEGKPWRFQTNLYGNGSTNRGREERYRLWFDPTKEFHRYSIL  169

Query  618   WNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAP  439
             W ++ I+F +D +P+REVV N A+   +PSKPMS+Y TIWD S WAT GGKY VNY YAP
Sbjct  170   WTANIIIFYIDEVPIREVVRNEAMGGDFPSKPMSLYATIWDASNWATSGGKYKVNYKYAP  229

Query  438   FVASMGRVELEGCTN-------SSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKH  280
             FV+    + LEGC +          DC   S + + L  + F  +T ++ + ++  R  +
Sbjct  230   FVSEFKDLVLEGCPSDPIQEVLEPFDC---SATITRLNAQDFTTITPERRAAMRNFRQHY  286

Query  279   MFYSYCKDKARYKVLPLECT  220
             M+YSYC D  RY V P EC 
Sbjct  287   MYYSYCYDTLRYSVPPPECV  306



>ref|XP_010906322.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Elaeis guineensis]
Length=336

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 182/300 (61%), Gaps = 11/300 (4%)
 Frame = -1

Query  1122  FSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNG  943
             F  FF I S + + +  +A   I +  +V             EGY   +G  N+ L  +G
Sbjct  7     FVLFFFIASPLFLFSSSAAISVIESSSTV----------SFEEGYTQTFGDGNLMLLRHG  56

Query  942   SSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEID  763
              +  + LD+ +G G  S+D Y +GFF+A+IKLP+ + +GVVVAFYMSN DV+   HDE+D
Sbjct  57    KTVHIALDERTGAGFASQDLYLHGFFSASIKLPSDYAAGVVVAFYMSNGDVFEKTHDELD  116

Query  762   IELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDN  583
              E LG  + R+W +QTN+Y NGS   GREE++ LWFDPT+  H YSILW+   I+F +DN
Sbjct  117   FEFLGNIRGREWRVQTNVYGNGSTAIGREERYDLWFDPTEDFHQYSILWSHDRIIFYIDN  176

Query  582   IPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEG  403
             IP+RE+V   ++   +PSKPMS+Y TIWDGS WAT GG+Y VNY YAP++A    + L G
Sbjct  177   IPIREIVRTESMGGQFPSKPMSLYATIWDGSNWATSGGRYKVNYKYAPYIAEFADLILNG  236

Query  402   CTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             CT +  D +     + S   +  V ++  + + ++  R KHM Y YC D+ RY   P EC
Sbjct  237   CTVNPMDHSSACEGSDSARYDS-VTMSSDRRAQMESFRKKHMTYFYCYDRNRYTNPPSEC  295



>ref|XP_003531138.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Glycine max]
Length=341

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 172/266 (65%), Gaps = 11/266 (4%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLP+ +T+GVVV
Sbjct  36   EGYAPLFGDSNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPSDYTAGVVV  95

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP    
Sbjct  96   AFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNIGREERYGLWFDPADDF  155

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+I+W    I+F VDN+P+REV    ++   +PSKPM++Y TIWD S+WAT+GGKY V
Sbjct  156  HQYTIVWTDSQIIFYVDNVPIREVTRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRV  215

Query  456  NYNYAPFVASMGRVELEGCT--------NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGL  301
            NY YAP+VA    + L GC             +  + S +T+++   G   +T  Q   +
Sbjct  216  NYKYAPYVAEFSDLVLHGCAVDPIEQHVAKCDNAPQSSEATTTIPSSG---VTPAQRIKM  272

Query  300  QWARGKHMFYSYCKDKARYKVLPLEC  223
            +  R KHM YSYC DK RYKV P EC
Sbjct  273  ENFRKKHMTYSYCYDKVRYKVPPSEC  298



>emb|CDY70985.1| BnaAnng35740D [Brassica napus]
Length=333

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 173/268 (65%), Gaps = 8/268 (3%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   E Y  L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLP+ +++
Sbjct  29    TSFEESYTQLFGAKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIKLPSDYSA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D Y  NHDEID E LG  + R+W +QTN+Y NGS   GREE+  LWFDP
Sbjct  89    GVVVAFYMSNGDTYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERCNLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
             T+  H YSILW+  HI+F VDN+P+REV   +++   +PSKPMS+Y TIWDGS+WAT+GG
Sbjct  149   TEDYHQYSILWSDSHIIFYVDNVPIREVKRTSSMGGDFPSKPMSLYTTIWDGSKWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQ----QISGL  301
             KY VNY Y P++A    + L GC   + D   + P       E +++  Q+    + + +
Sbjct  209   KYGVNYKYGPYIARFSDLVLHGC---AVDPIEQFPKCEERAIE-YIRAAQEISPSERAKM  264

Query  300   QWARGKHMFYSYCKDKARYKVLPLECTA  217
             +  R KHM YSYC D+ RYKV   +C  
Sbjct  265   EVFRRKHMTYSYCYDRTRYKVSLPDCVV  292



>ref|XP_006469297.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Citrus sinensis]
Length=334

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 170/264 (64%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLPA +T+GVVV
Sbjct  34   EGYSHLFGHDNLVVHRDGKSVHLSLDERTGSGFVSHDLYLHGFFSASIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  94   AFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDF  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F +D IP+RE    A++   +P+KPMS+Y TIWDGS+WAT+GGKY V
Sbjct  154  HQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRV  213

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAP+V       L GC+      +SS C     S  S+       ++  Q   ++  
Sbjct  214  NYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIP----TGVSPSQRIKMENF  269

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R KHM YSYC D+ RYKV P EC 
Sbjct  270  RRKHMTYSYCYDQIRYKVPPFECV  293



>ref|XP_010053644.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Eucalyptus grandis]
 gb|KCW77986.1| hypothetical protein EUGRSUZ_D02229 [Eucalyptus grandis]
Length=356

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 172/270 (64%), Gaps = 9/270 (3%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGY  L+G  N+     G    ++LD+ +G G +S D Y +GFF+A IKLP+ +
Sbjct  46    TPISFDEGYRPLFGDGNVVRSPAGDGVRILLDRFTGSGFISSDMYQHGFFSAKIKLPSDY  105

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+GVVVAFY SN DV+   HDE+DIE LG  + + W  QTN+Y NGS   GREE++ LWF
Sbjct  106   TAGVVVAFYTSNGDVFEKTHDELDIEFLGNIRGKPWRFQTNVYGNGSTSRGREERYTLWF  165

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPT+  H YSILW ++ I+F VD +P+RE+V + A+   +PSKPMS+Y TIWD S+WAT 
Sbjct  166   DPTKEYHRYSILWTANKIIFYVDEVPIREIVKSEAMGGDFPSKPMSLYATIWDASDWATS  225

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPST------SSLEGEGFVKLTQQQ  313
             GG+Y VNY YAPFVA    + LEGC    +D  R+ P++      + LE   F  +T  Q
Sbjct  226   GGRYKVNYKYAPFVAEFKDLVLEGCM---ADPIRQLPASGCHAKDAQLEARDFATITSSQ  282

Query  312   ISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                ++  R ++M+YSYC D  RY V P EC
Sbjct  283   RRAMRRFRERYMYYSYCYDTLRYPVPPPEC  312



>ref|XP_009380067.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=342

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 167/267 (63%), Gaps = 5/267 (2%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     EGY  L+G  N+ L  +G S  L LD+ +G G  S+D Y +GFF+A+IKLPA 
Sbjct  43    LTTLAFEEGYTQLFGDSNLMLHRDGRSVHLSLDRRTGAGFASQDLYRHGFFSASIKLPAD  102

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             + +GVVVAFYMSN DV+   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LW
Sbjct  103   YAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYGLW  162

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT+  H YSILW+   I+F +D+IP+REVV   A+   +PSKPMS+Y TIWDGS WAT
Sbjct  163   FDPTEDYHQYSILWSGERIIFYIDDIPIREVVRTQAMGGDFPSKPMSLYATIWDGSTWAT  222

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGF--VKLTQQQISG  304
              GG+Y VNY YAP+ A    + L GC   + D      +    +   +  + ++  Q + 
Sbjct  223   SGGRYKVNYKYAPYEAEFADLVLHGC---AVDPIEHRTTCLGYDAAVYDSITMSADQRTA  279

Query  303   LQWARGKHMFYSYCKDKARYKVLPLEC  223
             +   R KH+ YSYC D+ RY   P EC
Sbjct  280   MDKFRKKHITYSYCHDRVRYPTPPPEC  306



>ref|XP_004236920.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Solanum lycopersicum]
Length=330

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/305 (43%), Positives = 184/305 (60%), Gaps = 20/305 (7%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             NF  + F+   +VV+++  S               +    +  +EGY+ L+G  N+ +  
Sbjct  3     NFLLEIFIFCYVVVLVSGFS---------------ENLETSSFNEGYSQLFGHDNLMVIQ  47

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +G S  + LD+ +G G VS+D Y +G F+A+IKLP  +T+GVVVAFYMSN D++  NHDE
Sbjct  48    DGKSVHISLDERTGAGFVSQDLYLHGLFSASIKLPEDYTAGVVVAFYMSNGDMFEKNHDE  107

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             ID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  H Y+ILW   HI+F V
Sbjct  108   IDFEFLGNIRAKNWRIQTNIYGNGSTNVGREERYGLWFDPTEDFHTYTILWTDSHIIFYV  167

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             DN+P+RE+    A+S  +PSKPMS+Y TIWDGS WAT+GGKY VNY YAP+VA      L
Sbjct  168   DNVPIREIKRTQAMSEDFPSKPMSLYGTIWDGSSWATNGGKYKVNYKYAPYVAKFSDFVL  227

Query  408   EGCTNSSSDCTRRSPSTSSLEGEGFV--KLTQQQISGLQWARGKHMFYSYCKDKARYKVL  235
              GC     D    SP    +     +  +++  Q   ++  R K++ YSYC D+ RY V 
Sbjct  228   HGC---GVDPIELSPKCDIVLDSASIPTRISPDQRRKMERFRNKYLQYSYCYDRTRYNVP  284

Query  234   PLECT  220
               EC 
Sbjct  285   QSECV  289



>ref|XP_011021731.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Populus euphratica]
Length=335

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 168/258 (65%), Gaps = 1/258 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G    L LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVV
Sbjct  37   EGYTQLFGDDNLVMYRDGKRVHLSLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVV  96

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  97   AFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSAGREERYSLWFDPSDDF  156

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW +  I+F VDNIP+REV    ++   +PSKPMS+Y TIWDGS+WAT+GGKY V
Sbjct  157  HQYSILWTNSQIIFYVDNIPIREVKRTESMGADFPSKPMSLYATIWDGSDWATNGGKYRV  216

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP+VA    + L GC     +   R  +T S +         Q+I  ++  R K M
Sbjct  217  NYKYAPYVAEFSDLVLHGCAVDPVEQLPRCDNTDSSQAIPTGATPVQRIK-MESFRAKFM  275

Query  276  FYSYCKDKARYKVLPLEC  223
             YSYC D+ RY+    EC
Sbjct  276  TYSYCYDRVRYRAPLSEC  293



>gb|KDP30712.1| hypothetical protein JCGZ_15540 [Jatropha curcas]
Length=341

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 171/273 (63%), Gaps = 11/273 (4%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     EGY  L+G  N+    NG S  L+LD+ +G G +S   Y YGFF+A IKLP+ 
Sbjct  30    LTTISFDEGYAPLFGDGNLVRSPNGRSVRLLLDRFTGSGFISSKMYKYGFFSANIKLPSD  89

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             +T+G+ VAFY SNQDV+   HDE+D E LG  + + W  QTNLY NGS   GREE++ LW
Sbjct  90    YTAGLCVAFYTSNQDVFEKTHDELDFEFLGNVEGKPWRFQTNLYGNGSTSHGREERYRLW  149

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDP++  H YSILW  + I+F +D++P+REV+  + + + YPSKPMS+Y TIWD S WAT
Sbjct  150   FDPSKEFHRYSILWTEYKIIFFIDDVPIREVLRTSEMGSEYPSKPMSLYATIWDASNWAT  209

Query  477   HGGKYPVNYNYAPFVASMGRVELEGC--------TNSSSDCTRRSPSTSSLEGEGFVKLT  322
              GG+Y VNY YAPFV+    + +EGC          +S+ C   S S + LE   +  +T
Sbjct  210   SGGRYKVNYKYAPFVSEYKDLVIEGCPVDPIQQFPVASTSC---SESNARLESAEYATIT  266

Query  321   QQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             ++Q   ++  R + M+YSYC D  RY V P EC
Sbjct  267   RRQRMAMRRFRQRLMYYSYCYDTLRYSVPPPEC  299



>ref|XP_002311545.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
 gb|EEE88912.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
Length=336

 Score =   263 bits (673),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 167/260 (64%), Gaps = 5/260 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G +  L LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVV
Sbjct  38   EGYTQLFGDDNLAIHRDGKTVHLSLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVV  97

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  98   AFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSVGREERYSLWFDPSDDF  157

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I F VDN+P+RE     ++   +PSKPMS+Y TIWDGS WAT+GGKY V
Sbjct  158  HQYSILWTDSQITFYVDNVPIREFKRTESMGGDFPSKPMSLYATIWDGSGWATNGGKYRV  217

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGK  283
            NY YAP+V     + L GC   + D   + P   + E    +   +T  Q   ++  R K
Sbjct  218  NYKYAPYVTEFSDLVLHGC---AVDPIEQFPKCDNSESSEVIPTGVTTVQRIKMESFRAK  274

Query  282  HMFYSYCKDKARYKVLPLEC  223
             M YSYC D+ RYKV P EC
Sbjct  275  FMTYSYCYDRVRYKVPPSEC  294



>gb|ABK92940.1| unknown [Populus trichocarpa]
Length=336

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 167/260 (64%), Gaps = 5/260 (2%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G +  L LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVV
Sbjct  38   EGYTQLFGDDNLAIHRDGKTVHLSLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVV  97

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  98   AFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSVGREERYSLWFDPSDDF  157

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I F VDN+P+RE     ++   +PSKPMS+Y TIWDGS WAT+GGKY V
Sbjct  158  HQYSILWTDSQITFYVDNVPIREFKRTESMGGDFPSKPMSLYATIWDGSGWATNGGKYRV  217

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGK  283
            NY YAP+V     + L GC   + D   + P   + E    +   +T  Q   ++  R K
Sbjct  218  NYKYAPYVTEFSDLVLHGC---AVDPIEQFPKCDNSESSEVIPTGVTTVQRIKMESFRAK  274

Query  282  HMFYSYCKDKARYKVLPLEC  223
             M YSYC D+ RYKV P EC
Sbjct  275  FMTYSYCYDRVRYKVPPSEC  294



>dbj|BAK04928.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 167/266 (63%), Gaps = 16/266 (6%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ L+  G    L LD+S+G G  S+DR+ +GFF+AA+KLPA + +GVVV
Sbjct  51   EGYTQLFGSGNLALRREGKRVHLALDESTGSGFASQDRFLHGFFSAAVKLPADYAAGVVV  110

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ L FDPT   
Sbjct  111  AFYLSNADVYEKTHDELDFEFLGNVRGREWRVQTNVYGNGSTGAGREERYDLPFDPTDDF  170

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD  P+REVV   A+   +PSKPMS+Y TIWDGS WAT GG+Y  
Sbjct  171  HHYSILWTQHRIIFYVDETPIREVVRTEAMGAAFPSKPMSLYATIWDGSAWATLGGRYRA  230

Query  456  NYNYAPFVASMGRVELEGCT------NSSSDCTRR--SPSTSSLEGEGFVKLTQQQISGL  301
            NY YAPFVA  G + L  C       ++++ C      P  ++L GE       Q+ S  
Sbjct  231  NYKYAPFVAEFGDLVLHACPVNRIYHSAAAACGTPWYEPVAAALSGE-------QRASMS  283

Query  300  QWARGKHMFYSYCKDKARYKVLPLEC  223
             + RG HM YSYC D+ RY V   EC
Sbjct  284  AFRRG-HMSYSYCHDRRRYPVALSEC  308



>ref|XP_009621345.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Nicotiana tomentosiformis]
Length=330

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 188/306 (61%), Gaps = 22/306 (7%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             NF  + F++ S +V++   S +  + T P               EGY+ L+G  N+ +  
Sbjct  3     NFRLEIFILCSFLVLVCGSSKQ--LQTLP-------------FDEGYSQLFGHDNLMVLE  47

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +G S  L LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVVAFYMSN D++  NHDE
Sbjct  48    DGKSVHLSLDERTGAGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDE  107

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             ID E LG  + + W +QTN+Y NGS   GREE++ LWFDP++  H YSILW    I+F V
Sbjct  108   IDFEFLGNIRAKKWRIQTNIYGNGSTNVGREERYGLWFDPSEDFHQYSILWTESQIIFYV  167

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             DNIP+RE+    A+   +PSKPMS+Y TIWDGS WAT+GGKY VNY YAP+VA      L
Sbjct  168   DNIPIREIKRTKAMGGDFPSKPMSLYATIWDGSSWATNGGKYKVNYKYAPYVAKFSDFIL  227

Query  408   EGCTNSSSDCTRR---SPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKV  238
              GC     + + +   +P+++S+       ++  Q   ++  R K++ YSYC D+ RY V
Sbjct  228   HGCAVDPIELSPKCDTTPNSASIP----TSISPDQRRKMESFRKKYLQYSYCYDRTRYNV  283

Query  237   LPLECT  220
                EC 
Sbjct  284   PLSECV  289



>ref|XP_011081425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Sesamum indicum]
Length=345

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 165/262 (63%), Gaps = 3/262 (1%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E Y+ L+   NI    +  +  L+L++ SG G++S D Y YGFF+A+IK+P+   +G+VV
Sbjct  39   EAYSPLFSKFNIHPSPDDKTVRLLLNRFSGSGIISSDYYNYGFFSASIKMPSQHAAGIVV  98

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN D +  NHDE+DIE LG  K + W  QTN+Y NGSV  GREE++ +WFDPT  S
Sbjct  99   AFYTSNVDTFEKNHDELDIEFLGNIKGKPWRFQTNMYGNGSVSRGREERYRMWFDPTTHS  158

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F VDNIP+REVV  A +   YPSKPMSVY TIWD S WAT GGK  V
Sbjct  159  HRYSILWTPTNIIFYVDNIPIREVVRTAGMRGDYPSKPMSVYATIWDASSWATDGGKEKV  218

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPST---SSLEGEGFVKLTQQQISGLQWARG  286
            NY Y PFV     + LEGC    +D    S  T   + L  + +  +T +    ++W R 
Sbjct  219  NYKYEPFVTEFKDLVLEGCIVDPTDQILSSNCTDNIAELMAKDYSNITSEGRKSMKWFRE  278

Query  285  KHMFYSYCKDKARYKVLPLECT  220
            K+M+YSYC D  RY V P EC 
Sbjct  279  KYMYYSYCYDNIRYPVPPPECV  300



>gb|AFR46578.1| xyloglucan endotransglucosylase/hydrolase 9, partial [Rosa x 
borboniana]
Length=292

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 167/250 (67%), Gaps = 4/250 (2%)
 Frame = -1

Query  966  NIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVY  787
            N+ +  +G S  L L++ +G G VS+D Y +GFF+A+IKLP  +T+G+VVAFYMSN D++
Sbjct  1    NLMILRDGKSVHLTLNERTGSGFVSQDLYIHGFFSASIKLPTDYTAGIVVAFYMSNADMF  60

Query  786  PHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSH  607
            P NHDEID E LG  + ++W +QTN+Y NGS  TGREE++ LWFDP++  H YSILW   
Sbjct  61   PKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTDTGREERYNLWFDPSEDYHQYSILWTDS  120

Query  606  HILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVAS  427
            HI+F VDNIP+R V  +  +   YPSKPMS+Y TIWDGS+WAT+GGKY VNY YAPF A 
Sbjct  121  HIIFYVDNIPIRVVKKSEGMGGDYPSKPMSLYATIWDGSDWATNGGKYRVNYKYAPFKAE  180

Query  426  MGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGKHMFYSYCKDK  253
               + L GC  +     + S      +G  ++   +T+ Q   ++  R + M YSYC D+
Sbjct  181  FSDLVLHGC--AVDPIEQVSKKCDKTQGSEYIPTGVTRLQRMRMESFRKRQMTYSYCYDR  238

Query  252  ARYKVLPLEC  223
             RYKV P EC
Sbjct  239  IRYKVAPPEC  248



>ref|XP_006448095.1| hypothetical protein CICLE_v10015872mg [Citrus clementina]
 gb|ESR61335.1| hypothetical protein CICLE_v10015872mg [Citrus clementina]
Length=334

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 170/264 (64%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G S  L LD+ +G G VS D Y +GFF+A+IKLPA +T+GVVV
Sbjct  34   EGYSHLFGHDNLVVHRDGKSVHLSLDERTGSGFVSHDLYLHGFFSASIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  94   AFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDF  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F +D IP+RE    A++   +P+KPMS+Y TIWDGS+WAT+GGKY V
Sbjct  154  HQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRV  213

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAP+V       L GC+      +SS C     S  S+       ++  Q   ++  
Sbjct  214  NYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIP----TGVSPSQRIKMENF  269

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R KHM YSYC D+ RYKV P EC 
Sbjct  270  RRKHMTYSYCYDQIRYKVPPSECV  293



>ref|XP_002304356.2| hypothetical protein POPTR_0003s09590g [Populus trichocarpa]
 gb|EEE79335.2| hypothetical protein POPTR_0003s09590g [Populus trichocarpa]
Length=348

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 170/264 (64%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+    +G SA L+LD+ +G G +S   Y YGFF+A IKLP  +T+G+ V
Sbjct  39   EGYSPLFGDGNLVRSPDGRSARLLLDRFTGAGFISSRMYKYGFFSANIKLPGYYTAGLCV  98

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K   W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  99   AFYTSNGDVFKKTHDELDIEFLGNTKGEPWRFQTNLYGNGSTSHGREERYRLWFDPSKEF  158

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW + +I+F +D++P+REV+ N  + + +PSKPMS+Y TIWD S WAT GGKY V
Sbjct  159  HRYSILWTAKNIIFYIDDVPIREVIRNEEMGSEFPSKPMSLYATIWDASNWATSGGKYKV  218

Query  456  NYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            NY YAPFV+    + LEGC +       S DC       + LE   +  +T++Q S ++ 
Sbjct  219  NYKYAPFVSEFKDLALEGCPSDPIEEFPSFDCYES--DIARLENADYATITRRQRSAMRR  276

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V   EC
Sbjct  277  FRQRYMYYSYCYDALRYPVPLPEC  300



>ref|XP_011024575.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Populus euphratica]
Length=336

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 166/258 (64%), Gaps = 1/258 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G +  L LD+ +G G  S+D Y +G+F+A+IKLPA +T+GVVV
Sbjct  38   EGYTQLFGDDNLAIHRDGKTVHLSLDERTGSGFASQDLYLHGYFSASIKLPADYTAGVVV  97

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP+   
Sbjct  98   AFYMSNGDIFETNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSVGREERYSLWFDPSDDF  157

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I F VDN+P+RE     ++   +PSKPMS+Y TIWDGS WAT+GGKY V
Sbjct  158  HQYSILWTDSQITFYVDNVPIREFKRTESMGGDFPSKPMSLYATIWDGSGWATNGGKYRV  217

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP+V     + L GC     +   +  +T S E       T Q+I  ++  R K M
Sbjct  218  NYKYAPYVTEFSDLVLHGCAVDPIEQFPKCDNTESSEAIPTGVTTVQRIK-MESFRAKFM  276

Query  276  FYSYCKDKARYKVLPLEC  223
             YSYC D+ RYKV P EC
Sbjct  277  TYSYCYDRVRYKVPPSEC  294



>ref|XP_002462345.1| hypothetical protein SORBIDRAFT_02g024120 [Sorghum bicolor]
 gb|EER98866.1| hypothetical protein SORBIDRAFT_02g024120 [Sorghum bicolor]
Length=343

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/285 (47%), Positives = 174/285 (61%), Gaps = 5/285 (2%)
 Frame = -1

Query  1071  SARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVS  892
             SARG    PP               EGY  ++G  N+ L  +G    L LD+S+G G  S
Sbjct  24    SARGAEARPPPP---LHGVRPLAFDEGYTQIFGSANLALLRDGRRVRLTLDESTGAGFAS  80

Query  891   KDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTN  712
             +D + +GFF+AAIKLPA + +GVVVAFY+SN DVY   HDE+D E LG  + R+W +QTN
Sbjct  81    QDVFLHGFFSAAIKLPADYAAGVVVAFYLSNGDVYEKTHDELDFEFLGNVRGREWRVQTN  140

Query  711   LYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYP  532
             +Y NGS   GREE++ L FDPT   H YSILW +  I+F VD  P+REVV  +A+   +P
Sbjct  141   VYGNGSTHAGREERYDLPFDPTDDFHHYSILWTNDRIIFYVDETPIREVVRTSAMGAAFP  200

Query  531   SKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSS  352
             SKPMS+Y TIWDGS WAT GG+Y VNY YAPFVA    + ++GC    +D +  S + S 
Sbjct  201   SKPMSLYATIWDGSSWATLGGRYRVNYKYAPFVAEFADLAIQGCAVDPTDLSSASAAASC  260

Query  351   LEGEG--FVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
               G G   V ++ +Q++ +   R  H  YSYC D+ RY V   EC
Sbjct  261   GAGLGALAVSVSAEQLAAMAAFRRAHTSYSYCHDRRRYPVALSEC  305



>gb|ABM91070.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-3 [Populus 
tremula x Populus tremuloides]
Length=348

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 169/264 (64%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+    +G SA L+LD+ +G G +S   Y YGFF+A IKLP  +T+G+ V
Sbjct  39   EGYSPLFGDGNLVRSPDGRSARLLLDRFTGAGFISSRMYKYGFFSANIKLPGYYTAGLCV  98

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K   W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  99   AFYTSNGDVFKKTHDELDIEFLGNTKGEPWRFQTNLYGNGSTSHGREERYRLWFDPSKEF  158

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW +  I+F +D++P+REV+ N  + + +PSKPMS+Y TIWD S WAT GGKY V
Sbjct  159  HRYSILWTAKTIIFYIDDVPIREVIRNEEMGSEFPSKPMSLYATIWDASNWATSGGKYKV  218

Query  456  NYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            NY YAPFV+    + LEGC +       S DC       + LE   +  +T++Q S ++ 
Sbjct  219  NYKYAPFVSEFKDLALEGCPSDPIEEFPSFDC--HESDIARLENADYATITRRQRSAMRR  276

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V   EC
Sbjct  277  FRQRYMYYSYCYDALRYPVPLPEC  300



>ref|XP_006368348.1| xyloglucan endotransglycosylase 2 family protein [Populus trichocarpa]
 gb|ERP64917.1| xyloglucan endotransglycosylase 2 family protein [Populus trichocarpa]
Length=346

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 169/264 (64%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+    +G +A L+LD+ +G G +S   Y YGFF+A IKLP  +T+G+ V
Sbjct  40   EGYSPLFGDGNLVRSPDGRTARLLLDRFTGAGFISSKMYKYGFFSANIKLPGDYTAGLCV  99

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+D E LG  + + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  100  AFYTSNGDVFEKTHDELDFEFLGNTEGKPWRFQTNLYGNGSTSRGREERYRLWFDPSKQF  159

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW + + +F +D++P+REV+ +  +   YPSKPMS+Y TIWD S WAT GGKY V
Sbjct  160  HRYSILWTAKNTIFYIDDVPIREVIRSEEMGGEYPSKPMSLYATIWDASNWATSGGKYKV  219

Query  456  NYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            NY YAPFV+      LEGC +       S DC     S S LE   +  +T++Q S ++ 
Sbjct  220  NYKYAPFVSEFKDFVLEGCPSDPIEEFPSVDCYE---SYSRLESADYATITRRQRSAMRK  276

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V P EC
Sbjct  277  FRQRYMYYSYCYDSLRYPVPPPEC  300



>ref|XP_007158788.1| hypothetical protein PHAVU_002G182000g [Phaseolus vulgaris]
 gb|ESW30782.1| hypothetical protein PHAVU_002G182000g [Phaseolus vulgaris]
Length=332

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 176/298 (59%), Gaps = 15/298 (5%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
             F L  SM+      S+R               F      EGY  L+G  N+ +  +G S 
Sbjct  8     FLLFSSMLFAFLSASSRN--------------FPIIPFDEGYQPLFGDTNLVIHRDGKSV  53

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
              L LD+ +G G VS D Y +G+F+A+IKLPA +T+GVVVAFYMSN D++ +NHDEID E 
Sbjct  54    HLSLDERTGSGFVSHDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDMFQNNHDEIDFEF  113

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG  + ++W +QTN+Y NGS   GREE++ LWFDP    H YSI+W    I+F VDN+P+
Sbjct  114   LGNIRGKNWRIQTNVYGNGSTNIGREERYGLWFDPADDFHQYSIVWTDSQIIFYVDNVPI  173

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTN  394
             REV    ++   +PSKPM++Y TIWD S+WAT+GGKY VNY YAP+VA    + L GC  
Sbjct  174   REVKRTESMGGDFPSKPMTLYATIWDASDWATNGGKYRVNYKYAPYVAKFSDLVLHGCAV  233

Query  393   SSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
                +   +  +  S E         Q+I  ++  R KHM YSYC D+ RYK  P EC 
Sbjct  234   DPIEQVGKCENDQSSEAIPSSVTAAQRIK-MENFRKKHMTYSYCYDRLRYKAAPSECV  290



>ref|XP_009777519.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Nicotiana sylvestris]
Length=330

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 186/305 (61%), Gaps = 20/305 (7%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             NF    F++ S +V+++  S +  + T P               EGY+ L+G  N+ +  
Sbjct  3     NFRLGIFILCSFLVLVSGSSKK--LQTLP-------------FDEGYSQLFGHDNLMVLE  47

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +G S  + LD+ +G G VS+D Y +G+F+A+IKLPA +T+GVVVAFYMSN D++  +HDE
Sbjct  48    DGKSVHISLDERTGAGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDMFEKSHDE  107

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             ID E LG  + ++W +QTN+Y NGS   GREE++ LWFDP++  H Y+ILW    I+F V
Sbjct  108   IDFEFLGNIRAKNWRIQTNIYGNGSTNVGREERYGLWFDPSEDFHQYTILWTESQIIFYV  167

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             DNIP+RE+    A+   +PSKPMS+Y TIWDGS WAT+GGKY VNY YAP+VA      L
Sbjct  168   DNIPIREIKRTKAMGGDFPSKPMSLYATIWDGSSWATNGGKYKVNYKYAPYVAKFSDFVL  227

Query  408   EGCTNSSSDCTRRSPSTSSLEGEGFVK--LTQQQISGLQWARGKHMFYSYCKDKARYKVL  235
              GC   + D    SP   +     FV   ++  Q   ++  R K++ YSYC D+ RY V 
Sbjct  228   HGC---AVDPIELSPKCDTAPKSAFVPTGISPDQRRKMESFRKKYLQYSYCYDRTRYNVP  284

Query  234   PLECT  220
               EC 
Sbjct  285   LSECV  289



>ref|XP_010271176.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Nelumbo nucifera]
Length=336

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 169/266 (64%), Gaps = 10/266 (4%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ L  +G +  L LD+ +G G VS+D Y +GFF+A+IKLPA +T+GVVV
Sbjct  33   EGYSQLFGEDNLMLLRDGKTVHLSLDERTGAGFVSQDLYLHGFFSASIKLPADYTAGVVV  92

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++  NHDEID E LG  + ++W +QTN+Y NGS   GREE++  WFDP++  
Sbjct  93   AFYMSNGDIFERNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTTVGREERYSFWFDPSEDF  152

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  +HI+F VD  P+RE+     +   +PSKPMS+Y TIWDGS WAT+GG+Y V
Sbjct  153  HQYSILWTENHIIFYVDETPIREIQRTKEMGGDFPSKPMSLYATIWDGSNWATNGGRYKV  212

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVK-------LTQQQISGLQ  298
            NY YAP++A    + L GC   + D   +SP       +           +T +Q   + 
Sbjct  213  NYKYAPYIAEFSDLVLHGC---AVDPIEQSPKCDQAVLDALFAGPLPVAGITSKQRVEMV  269

Query  297  WARGKHMFYSYCKDKARYKVLPLECT  220
              R K+M YSYC D+ RY + P EC 
Sbjct  270  NFRKKYMTYSYCYDRLRYSIPPSECV  295



>ref|XP_007040721.1| Xyloglucan endotransglucosylase/hydrolase protein 30 [Theobroma 
cacao]
 gb|EOY25222.1| Xyloglucan endotransglucosylase/hydrolase protein 30 [Theobroma 
cacao]
Length=352

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 172/273 (63%), Gaps = 12/273 (4%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     EGY+ L+G  N+    +G S  L+LD  +G G +S   Y +GFF+A IKLP+ 
Sbjct  35    LTTLSFDEGYSPLFGDGNLVRSPDGHSVRLLLDVYTGSGFISSSMYQHGFFSAKIKLPSD  94

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             +T+G+VVAFY SN DV+  NHDE+D E LG  + + W  QTNLY NGS   GREE++ LW
Sbjct  95    YTAGIVVAFYTSNGDVFEKNHDELDFEFLGNIEGKPWRFQTNLYGNGSTNRGREERYSLW  154

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDP++  H YSILW   +I+F +D +P+REVV N  +   YPSKPMS+Y TIWD S WAT
Sbjct  155   FDPSKEFHRYSILWTVKNIIFYIDEVPIREVVRNDEMGGDYPSKPMSLYATIWDASSWAT  214

Query  477   HGGKYPVNYNYAPFVASMGRVELEGC--------TNSSSDCTRRSPSTSSLEGEGFVKLT  322
              GGKY VNY YAPF +    + LEGC        TN+S+ C+ R    + LE   +  +T
Sbjct  215   SGGKYKVNYKYAPFTSEFKELVLEGCPTDPIQEFTNASA-CSDRH---AWLESRDYALIT  270

Query  321   QQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
              +Q + ++  R ++M+YSYC D  RY V P EC
Sbjct  271   PEQRAAMRRFRQRYMYYSYCYDSLRYPVTPPEC  303



>dbj|BAK07675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 166/258 (64%), Gaps = 9/258 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N++L  +G    + LD+ +G G  S+  Y++GFF+A+IKLP+ + +GVVV
Sbjct  43   EGYTQLFGDSNLRLHGDGKRVHISLDERTGSGFASQGAYFHGFFSASIKLPSDYAAGVVV  102

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN DVY   HDE+D E LG  + ++W +QTN+Y +GS   GREE++ LWFDPT   
Sbjct  103  AFYMSNGDVYEKTHDELDFEFLGNVRGKEWRVQTNVYGDGSTAVGREERYGLWFDPTHDF  162

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+ILW +  I+F VD  P+REVV + A+   +PSKPMS+Y TIWDGS WAT GG+Y V
Sbjct  163  HRYAILWTNRTIVFYVDGTPIREVVRSEAMGAQFPSKPMSLYATIWDGSSWATSGGRYKV  222

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
             Y YAP+VA    +EL GC +      R  P++   EG     +  +Q + ++  R +HM
Sbjct  223  EYKYAPYVAEFTDLELRGCASHD----RAQPASCEPEG-----MPARQRAAMERVRARHM  273

Query  276  FYSYCKDKARYKVLPLEC  223
             Y YC D+ARY     EC
Sbjct  274  TYGYCYDRARYPAPLPEC  291



>ref|XP_011093429.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Sesamum indicum]
Length=339

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 176/270 (65%), Gaps = 9/270 (3%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             + T  ++G++ L+G  N+    +G S  L L++ +G G  S D Y +GFF+A IKLP+ +
Sbjct  27    SATPFTKGFSPLFGESNVFPSADGRSVQLHLNQYTGSGFKSSDLYSHGFFSAKIKLPSNY  86

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+G+VVAFY +N D++   HDE+D E LG  + + W  QTN+Y NGS   GREE++YLWF
Sbjct  87    TAGIVVAFYTTNGDMFRKTHDELDFEFLGNIRGKAWRFQTNMYGNGSTSRGREERYYLWF  146

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DP++  H Y+ILW +++I+F +D++P+RE+V N A+   +PSKPM++Y TIWD S+WAT 
Sbjct  147   DPSKHFHRYTILWTTNNIIFYIDDVPIREIVRNDAMGADFPSKPMALYATIWDASDWATS  206

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQ  313
             GGKY  NY YAPFVA    + L GC         ++ C+ R    +S E   F  +T +Q
Sbjct  207   GGKYRANYKYAPFVAEFTDLVLHGCPTDPLEEVVAASCSDRDDELTSSE---FASITPKQ  263

Query  312   ISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                ++  RGKH++YSYC D+ RY V P EC
Sbjct  264   RLAMKEFRGKHIYYSYCYDRLRYPVPPPEC  293



>ref|XP_010674965.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Beta vulgaris subsp. vulgaris]
Length=339

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 171/259 (66%), Gaps = 0/259 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+G  N+ +  +G S  L L++ +G G +S D Y +GFF+A+IKLPA +T+GVVV
Sbjct  40   EGYSHLFGDDNLMVLRDGKSVLLSLNERTGSGFMSHDLYLHGFFSASIKLPADYTAGVVV  99

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D+Y +NHDE+D E LG  + ++W +QTN+Y NGS   GREE++ LWFDP++  
Sbjct  100  AFYMSNGDMYENNHDELDFEFLGNIRGKEWRIQTNVYGNGSTNVGREERYTLWFDPSEEF  159

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VD++P+RE+    A+   +PSKPMS+Y TIWD S WAT+GGKY V
Sbjct  160  HRYSILWVEDQIIFYVDDVPIREIRRVKAMKHDFPSKPMSLYSTIWDASTWATNGGKYKV  219

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            +Y YAP+VA    + L GC     + +R+     S+ G     +T  Q   +   R K +
Sbjct  220  DYRYAPYVAEFSDLVLHGCAVDPIERSRKCDDIKSISGSVPHGITPLQRIKMADFRKKFL  279

Query  276  FYSYCKDKARYKVLPLECT  220
             YSYC DK+RYK+ P EC 
Sbjct  280  TYSYCYDKSRYKLPPSECV  298



>ref|XP_003638758.1| Xyloglucan endotransglycosylase/hydrolase [Medicago truncatula]
 gb|AFK34428.1| unknown [Medicago truncatula]
Length=332

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 169/267 (63%), Gaps = 10/267 (4%)
 Frame = -1

Query  1008  TGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTS  829
             T   EGY  L+G +N+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLPA +T+
Sbjct  29    TAFDEGYTPLFGDNNVFVHRDGKSVHLSLDERTGSGFVSHDIYLHGYFSASIKLPADYTA  88

Query  828   GVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDP  649
             GVVVAFYMSN D+Y  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP
Sbjct  89    GVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTSIGREERYGLWFDP  148

Query  648   TQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGG  469
              +  H YSILW    I+F VDNIP+REV    ++   +P+KPM++Y TIWD S+WAT+GG
Sbjct  149   AEDFHQYSILWTDSRIIFYVDNIPIREVTRTKSMGGDFPAKPMTLYATIWDASDWATNGG  208

Query  468   KYPVNYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGL  301
             KY VNY YAP+VA    + L GC        + C     S S   G     +T  Q   +
Sbjct  209   KYRVNYKYAPYVAKFSDLVLHGCAVDPIEHVAKCDTAQSSKSIPSG-----ITPVQKIKM  263

Query  300   QWARGKHMFYSYCKDKARYKVL-PLEC  223
             +  R K+M YSYC DK RY+   P EC
Sbjct  264   ENFRKKYMTYSYCYDKIRYRAAPPSEC  290



>ref|XP_002518990.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
 gb|EEF43523.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
Length=350

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 167/265 (63%), Gaps = 10/265 (4%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+    NG S  L+LD+ +G G +S   Y YGFF+A IKLP  +T+G+ V
Sbjct  43   EGYTPLFGDGNLVRSPNGRSVRLLLDRFTGSGFISSKMYEYGFFSANIKLPGDYTAGLCV  102

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SNQ+ +   HDE+D E LG  + + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  103  AFYTSNQEAFEKTHDELDFEFLGNIEGKPWRFQTNLYGNGSTNRGREERYRLWFDPSKEF  162

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F +D++P+REVV N  + + YPSKPMS+Y TIWD S WAT GGKY V
Sbjct  163  HRYSILWTERNIIFFIDDVPIREVVRNDEMGSEYPSKPMSLYATIWDASNWATSGGKYKV  222

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSS-------LEGEGFVKLTQQQISGLQ  298
            NY YAPFV+    + LEGC     D  ++ P TSS       L    +  +T++Q   ++
Sbjct  223  NYKYAPFVSEYKDLVLEGC---PIDPIQQIPLTSSCYESNARLLAADYATITRKQRQAMR  279

Query  297  WARGKHMFYSYCKDKARYKVLPLEC  223
              R + M+YSYC D  RY + P EC
Sbjct  280  RFRQRFMYYSYCYDTLRYPLPPPEC  304



>emb|CDP11680.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 180/296 (61%), Gaps = 23/296 (8%)
 Frame = -1

Query  1092  VVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKS  913
             + I T VSA          +R T RF      EGY  L+   NI    +  +  L+L++ 
Sbjct  26    ITITTTVSA---------FNRTTIRF-----DEGYTPLFSDFNIDRSPDDKTVRLLLNRL  71

Query  912   SGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRR  733
             SG G++S D Y +GFF+A IK+PA +++G+VVAFY SN D +  NHDE+D E LG    R
Sbjct  72    SGSGIISSDYYNHGFFSARIKMPANYSAGIVVAFYTSNIDTWEKNHDELDFEFLGNVNDR  131

Query  732   DWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNA  553
              W  QTN+Y  GSV  GREE++ LWFDP++ SH YSI W+  +I+F VD+IP+REV+++ 
Sbjct  132   PWRFQTNMYGGGSVSRGREERYRLWFDPSKESHQYSIFWSPKNIIFYVDDIPIREVIHHP  191

Query  552   AISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC------TNS  391
              +   YPSKPMS+Y TIWD S WAT+GGK  VNY Y PF A    + LEGC        S
Sbjct  192   DLGGDYPSKPMSLYATIWDASSWATNGGKAKVNYEYEPFAAEFKDLVLEGCRVDPIEQIS  251

Query  390   SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             S++CT R    + L  + +  +  +    ++W R ++M+YSYC D  RYKV P EC
Sbjct  252   STNCTDR---IARLIAQEYATIKPEGRKAMKWFRERYMYYSYCYDNLRYKVPPPEC  304



>ref|XP_008341063.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Malus domestica]
Length=355

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 183/309 (59%), Gaps = 18/309 (6%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             N  S FF  L ++ +I             +VD      T     +GY  L+G  N+    
Sbjct  12    NGVSLFFQPLRLIPLILVCVG--------NVDAAFYNLTTIPFDQGYTPLFGDGNLVRSP  63

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +G    L+LD+ +G G +S + Y +GFF+A IKLP+ +T+G+ VAFY SN DV+  NHDE
Sbjct  64    DGKGVRLLLDRFTGSGFISSNLYNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKNHDE  123

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             +DIE LG  + + W  QTNLY NGS   GREE++ LWFDPT+  H YSILW   + +F V
Sbjct  124   LDIEFLGNTEGKPWRFQTNLYGNGSTNRGREERYRLWFDPTKDFHRYSILWTPENTIFYV  183

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             D +P+REVV N  +   YPSKPMS+Y TIWD S WAT GG+Y VNY YAPFVA    + L
Sbjct  184   DEVPIREVVRNEEMGADYPSKPMSLYTTIWDASSWATSGGQYKVNYKYAPFVAEFKDLVL  243

Query  408   EGCTNSSSDCTRRSPSTSS-------LEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKA  250
             EGC    +D  ++ P+  +       L  + +  +T+Q+ + ++  R ++M+YSYC D  
Sbjct  244   EGC---PADPIQQIPAAEACAEHYTHLATQDYSVITRQRRAAMRRFRQRYMYYSYCYDSL  300

Query  249   RYKVLPLEC  223
             RY V P EC
Sbjct  301   RYPVPPSEC  309



>ref|XP_002527547.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
 gb|EEF34856.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
Length=338

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 181/303 (60%), Gaps = 18/303 (6%)
 Frame = -1

Query  1119  SQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGS  940
             S  FL+ S + ++  VS  G   T   +             EGY  L+G  N+ +  +G 
Sbjct  8     SCLFLLNSSLFVLLAVSVSGSQTTTLPI---------IPFDEGYAHLFGDDNLVIHKDGK  58

Query  939   SADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDI  760
             +  L+L++ +G G VS+D Y +G+F+A+IKLPA +T+GVVVAFYMSN D++  NHDEID 
Sbjct  59    TVYLLLNERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDF  118

Query  759   ELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNI  580
             E LG  + +DW +QTN+Y NGS   GREE++ LWFDP+   H YSILW    I+F VDN+
Sbjct  119   EFLGNIRGKDWRIQTNIYGNGSTSIGREERYSLWFDPSDDFHQYSILWTDSQIIFYVDNV  178

Query  579   PVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGC  400
             P+REV    ++   +PSKPMS+Y TIWDGS+WAT+GGKY VNY YAP+V       L GC
Sbjct  179   PIREVKRTVSMGGDFPSKPMSLYATIWDGSDWATNGGKYRVNYRYAPYVTQFSDFVLHGC  238

Query  399   T----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
                     S C     S +   G     +T  Q   ++  R K+M YSYC D+ RYK  P
Sbjct  239   AVDPIEQISKCDAAQSSQAIPTG-----VTPLQKIKMENFRTKYMTYSYCYDRVRYKNPP  293

Query  231   LEC  223
              EC
Sbjct  294   SEC  296



>ref|XP_009413224.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 isoform X1 [Musa acuminata subsp. malaccensis]
Length=331

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 172/269 (64%), Gaps = 4/269 (1%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     +G++ L+G  N+    +G  A L LD+SSG G +S D Y +GFF+A+IKLP+ 
Sbjct  31    LTTLSFDDGFSHLFGNENLIRSPDGRGARLTLDRSSGSGFISNDLYDHGFFSASIKLPSD  90

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             +++GVVVAFY SN DV+   HDE+D E LG  + +DW +QTN+Y NGS   GREE+++L 
Sbjct  91    YSAGVVVAFYTSNGDVFQKTHDELDFEFLGNIRGKDWRIQTNVYGNGSTSRGREERYFLP  150

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT  +H YSILW S HI+F +D+ P+REVV + A+   YPSKPMS+Y TIWDGS WAT
Sbjct  151   FDPTAEAHRYSILWTSDHIIFYIDDTPIREVVRSDAMGGDYPSKPMSIYATIWDGSTWAT  210

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTNS---SSDCTRR-SPSTSSLEGEGFVKLTQQQI  310
               G+Y VNY YAPFVA +  + L GC        D  RR + +   L    F ++T  + 
Sbjct  211   ANGRYKVNYKYAPFVAELSDLVLRGCRVDPIQQVDSARRCAEANEDLLAADFAQMTPLKR  270

Query  309   SGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             + ++  R ++M YS+C D  RY V   +C
Sbjct  271   AAMRRFRERYMTYSFCYDANRYPVTFPDC  299



>ref|XP_009804856.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nicotiana sylvestris]
Length=361

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 188/303 (62%), Gaps = 11/303 (4%)
 Frame = -1

Query  1107  LILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVS--EGYNVLYGGHNIQLKNNGSSA  934
             ++ S+   +T  S    +Y  P+    T  F  + ++  EGY+ L+   NI+   + +S 
Sbjct  5     VLSSLSKSLTPFSLLLLLYIFPAAAATTRAFNLSTITYEEGYSPLFSDFNIERSPDDTSF  64

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
              L+L++ SG G++S + Y YGFF+A+IKLPA +T+G+VVAFY SN D +  NHDE+DIE 
Sbjct  65    RLLLNRFSGSGVISTEYYNYGFFSASIKLPAIYTAGIVVAFYTSNVDTFEKNHDELDIEF  124

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG    + W  QTNLY NGSV  GREE++ +WFDP++  H YSILW   +I+F +D  P+
Sbjct  125   LGNVNGQPWRFQTNLYGNGSVSRGREERYRMWFDPSKDFHHYSILWTPKNIIFYIDETPI  184

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTN  394
             REV  N A+   +PSKPMS+Y TIWD S WAT+GGK  V+Y + PF A    + LEGC  
Sbjct  185   REVNRNPAMGGDFPSKPMSLYATIWDASSWATNGGKAKVDYKHEPFAAEFKDLVLEGCIV  244

Query  393   ------SSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLP  232
                   SS++CT R    + L  + +  +T ++   ++W R ++M+YSYC D  RY V P
Sbjct  245   DPIEQISSTNCTDR---IAKLLAQNYSIMTPERRKSMKWFRERYMYYSYCYDNIRYPVPP  301

Query  231   LEC  223
              EC
Sbjct  302   PEC  304



>ref|XP_006355045.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27-like [Solanum tuberosum]
Length=330

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 183/305 (60%), Gaps = 20/305 (7%)
 Frame = -1

Query  1128  NFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKN  949
             NF  + F+   ++V+++  S +  + T P               EGY+ L+G  N+ +  
Sbjct  3     NFLLEIFIFCYVLVLVSGFSEK--LETLP-------------FHEGYSQLFGHDNLMVLQ  47

Query  948   NGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDE  769
             +  S  + LD+ +G G VS+D Y  G F+A+IKLP  +T+GVVVAFYMSN D++  NHDE
Sbjct  48    DEKSVHISLDERTGAGFVSQDLYLLGLFSASIKLPEDYTAGVVVAFYMSNGDMFEKNHDE  107

Query  768   IDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLV  589
             ID E LG  + ++W +QTN+Y NGS   GREE++ LWFDPT+  H Y+ILW   HI+F V
Sbjct  108   IDFEFLGNIRAKNWRIQTNIYGNGSTNVGREERYGLWFDPTEDFHTYTILWTDSHIIFYV  167

Query  588   DNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVEL  409
             DN+P+RE+    A+   +PSKPMS+Y TIWDGS WAT+GGKY VNY YAP+V       L
Sbjct  168   DNVPIREIKRTQAMGGDFPSKPMSLYATIWDGSSWATNGGKYKVNYKYAPYVTKFSDFVL  227

Query  408   EGCTNSSSDCTRRSPSTSSLEGEGFV--KLTQQQISGLQWARGKHMFYSYCKDKARYKVL  235
              GC   + D    SP    ++    +  +++  Q   ++  R KH+ YSYC D+ RY V 
Sbjct  228   HGC---AVDPIELSPKCDIVQDSASIPTEISPDQRRKMERFRKKHLQYSYCYDRTRYNVP  284

Query  234   PLECT  220
               EC 
Sbjct  285   LSECV  289



>gb|ACU19067.1| unknown [Glycine max]
Length=333

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 168/263 (64%), Gaps = 8/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ +  +G S  L LD+ +G G VS D Y +G+F+A+IKLP+ +T+GVVV
Sbjct  30   EGYAPLFGDSNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPSDYTAGVVV  89

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN D++ +NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP    
Sbjct  90   AFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNIGREERYGLWFDPADDF  149

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+I+W    I+F VDN+P+REV    ++   +P KPM++Y TIWD S+WAT+GGKY V
Sbjct  150  HQYTIVWTDSQIIFYVDNVPIREVTRTESMGGDFPFKPMTLYATIWDASDWATNGGKYRV  209

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAP+VA    + L GC         + C       +++   G   +T  Q   ++  
Sbjct  210  NYKYAPYVAEFSDLVLHGCAVDPIEQHVATCDNAQSFEATIPPFG---VTPAQRIKMENF  266

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R KHM YSYC DK RYKV P EC
Sbjct  267  RKKHMTYSYCYDKVRYKVPPSEC  289



>dbj|BAA88668.1| ETAG-A3 [Solanum lycopersicum]
Length=314

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 173/274 (63%), Gaps = 5/274 (2%)
 Frame = -1

Query  1038  VDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNA  859
             V   ++    +  +EGY+ L+G  N+ +  +G S  + LD+ +G G VS+D Y +G F+A
Sbjct  2     VSGFSENLETSSFNEGYSQLFGHDNLMVIQDGKSVHISLDERTGAGFVSQDLYLHGLFSA  61

Query  858   AIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGR  679
             +IKLP  +T+GVVVAFYMSN D++  NHDEID E LG  + ++W +QTN+Y NGS   G 
Sbjct  62    SIKLPEDYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRAKNWRIQTNIYGNGSTNVGG  121

Query  678   EEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIW  499
             EE++ LWFDPT+  H Y+ILW   HI+F VDN+P+RE+    A+S  +PSKPMS+Y TIW
Sbjct  122   EERYGLWFDPTEDFHTYTILWTDSHIIFYVDNVPIREIKRTQAMSEDFPSKPMSLYGTIW  181

Query  498   DGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFV--KL  325
             DGS WAT+GGKY VNY YAP+VA      L GC     D    SP    +     +  ++
Sbjct  182   DGSSWATNGGKYKVNYKYAPYVAKFSDFVLHGC---GVDPIELSPKCDIVLDSASIPTRI  238

Query  324   TQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             +  Q   ++  R K++ YSYC D+ RY V   EC
Sbjct  239   SPDQRRKMERFRNKYLQYSYCYDRTRYNVPQSEC  272



>ref|XP_009107996.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Brassica rapa]
 emb|CDY41742.1| BnaA08g06970D [Brassica napus]
Length=342

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 167/264 (63%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LDK +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  34   ESLSPLFGDGNLVRSPDDLSVRLLLDKYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  94   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEF  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ + A+   YP+KPMS+Y TIWD S+WAT GGKY  
Sbjct  154  HRYSILWTPHKIIFWVDDVPIREVIRSEAMGADYPAKPMSLYATIWDASDWATSGGKYKA  213

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAPFVA      L+GC+        +DC   S S   LE + +  +  +Q + ++  
Sbjct  214  NYKYAPFVAEFKSFSLDGCSVDPIQEVPTDC---SDSVDFLESQDYFSINSRQRAAMRRF  270

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY   P EC 
Sbjct  271  RQRFMYYSYCYDTVRYPEAPPECV  294



>gb|KHG00933.1| putative xyloglucan endotransglucosylase/hydrolase 30 -like protein 
[Gossypium arboreum]
Length=355

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 172/273 (63%), Gaps = 9/273 (3%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGYN L+G  N+    +G S  L+LD  +G G +S   Y +GFF+A IKLP+ +
Sbjct  34    TTLAFDEGYNPLFGDGNLVRSPDGHSVRLLLDVYTGSGFISSRMYQHGFFSAKIKLPSDY  93

Query  834   TSGVVVAFYM-----SNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEK  670
             T+G+VVAFY+     SN DV+  NHDE+DIE LG  + + W  QTN+Y NGS   GREE+
Sbjct  94    TAGIVVAFYLWSNQTSNGDVFEKNHDELDIEFLGNIEGKPWRFQTNVYGNGSTNRGREER  153

Query  669   FYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGS  490
             + LWFDP++  H YSILW + +I+F VD +P+REVV N A+   YPSKPMS+Y TIWD S
Sbjct  154   YNLWFDPSKEFHRYSILWTAKNIIFYVDEVPIREVVRNDAMGGDYPSKPMSLYATIWDAS  213

Query  489   EWATHGGKYPVNYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLT  322
              WAT+GGKY VNY YAPF +    + L+GC         + T  S + + LE   +  +T
Sbjct  214   SWATNGGKYKVNYEYAPFTSEFKDLVLDGCAIDPIQKFPNSTACSETDTWLESRDYAIIT  273

Query  321   QQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
              +  S ++  R ++M+YSYC D  RY + P EC
Sbjct  274   PKSRSAMRRFRQRYMYYSYCYDNVRYPITPPEC  306



>ref|XP_004513237.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cicer arietinum]
Length=341

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 169/275 (61%), Gaps = 1/275 (0%)
 Frame = -1

Query  1044  PSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFF  865
             PS       F      EGY  L+G HN+ +  N  +  L LD+SSG G  S D Y +G+F
Sbjct  23    PSCSVSPKNFPIIPFDEGYTPLFGDHNLIIHTNSKTVHLSLDESSGSGFASHDLYLHGYF  82

Query  864   NAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKT  685
             +A+IKLP  +T+GVVVAFY+SN D+Y  NHDEID E LG  + +DW +QTN+Y NGS   
Sbjct  83    SASIKLPYDYTAGVVVAFYLSNGDMYEKNHDEIDFEFLGNIRGKDWRVQTNVYGNGSTNI  142

Query  684   GREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVT  505
             GREE++ LWFDP +  H YSILW    I+F VD++P+RE+    ++   +PSKPM++Y T
Sbjct  143   GREERYGLWFDPAEDFHQYSILWTDSKIIFYVDDVPIREIKRTESMKGDFPSKPMTLYAT  202

Query  504   IWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-NSSSDCTRRSPSTSSLEGEGFVK  328
             IWD S WAT+GGKY VNY YAP+VA      L GC+ N     T    +T+ +       
Sbjct  203   IWDASNWATNGGKYKVNYKYAPYVAEFTDFVLHGCSVNPIDHVTTNCDNTAQISDNVSFG  262

Query  327   LTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             +T  +   ++  R KHM YSYC D+ RYKV   EC
Sbjct  263   VTPLEKIKMENFRLKHMTYSYCYDRIRYKVPLPEC  297



>ref|XP_010478638.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Camelina sativa]
Length=346

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/279 (46%), Positives = 172/279 (62%), Gaps = 11/279 (4%)
 Frame = -1

Query  1032  RLTDRFTQTGV---SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFN  862
             RL+  FT        E  + L+G  N+    +  S  L+LD+ +G G +S + Y +GF++
Sbjct  24    RLSLAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYS  83

Query  861   AAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTG  682
             + IKLPA +T+GVVVAFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS + G
Sbjct  84    SMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTQRG  143

Query  681   REEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTI  502
             REE++ LWFDP++  H YSILW  H I+F VD++P+REV+ N A+   YP+KPMS+Y TI
Sbjct  144   REERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMSLYATI  203

Query  501   WDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEG  337
             WD S+WAT GGKY  NY +APFVA      L+GC+         DC   S S   LE + 
Sbjct  204   WDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPVDC---SDSVDFLESQD  260

Query  336   FVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
             +  +  +Q + ++  R + M+YSYC D  RY   P EC 
Sbjct  261   YSTINSRQRAAMRRFRQRFMYYSYCYDTVRYPEAPPECV  299



>ref|NP_001049503.1| Os03g0239000 [Oryza sativa Japonica Group]
 gb|ABF94871.1| xyloglucan endotransglucosylase/hydrolase protein 28precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11417.1| Os03g0239000 [Oryza sativa Japonica Group]
 gb|EAZ26213.1| hypothetical protein OsJ_10080 [Oryza sativa Japonica Group]
 dbj|BAG87835.1| unnamed protein product [Oryza sativa Japonica Group]
Length=338

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 163/266 (61%), Gaps = 10/266 (4%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGY  L+G  N+ L  +G    + LD+ +G G  S+  Y++GFF+A+IKLPA  
Sbjct  43    TALSFEEGYTQLFGDSNLMLHGDGKRVHISLDERTGAGFASQGAYHHGFFSASIKLPADH  102

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+GVVVAFYMSN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LWF
Sbjct  103   TAGVVVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAAGREERYGLWF  162

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPTQ  H Y+I W+   I+F VD  P+REVV  A++   +PSKPMS+Y TIWDGS WAT 
Sbjct  163   DPTQDFHRYAIRWSHDTIIFYVDETPIREVVRTASMGAQFPSKPMSLYATIWDGSSWATS  222

Query  474   GGKYPVNYNYAPFVASMGRVELEGC-TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQ  298
             GG+Y VNY YAP+VA    + L GC   S   C   + S +   G         Q S ++
Sbjct  223   GGRYKVNYKYAPYVAEFTDLLLHGCPAGSPPPCEGAAASATMPPG---------QRSAME  273

Query  297   WARGKHMFYSYCKDKARYKVLPLECT  220
               R +HM Y YC D+ RY     EC+
Sbjct  274   RFRARHMTYGYCYDRVRYHAPLPECS  299



>ref|XP_004514368.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cicer arietinum]
Length=341

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 170/275 (62%), Gaps = 1/275 (0%)
 Frame = -1

Query  1044  PSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFF  865
             PS       F      EGY  L+G HN+ + ++  +  L LD+SSG G  S D Y +G+F
Sbjct  23    PSCSVSPQNFPIIPFDEGYTPLFGDHNLIIHSDSKTVHLSLDESSGSGFASHDLYLHGYF  82

Query  864   NAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKT  685
             +A+IKLP  +T+GVVVAFY+SN D+Y  NHDEID E LG  + +DW +QTN+Y NGS   
Sbjct  83    SASIKLPYDYTAGVVVAFYLSNGDMYEKNHDEIDFEFLGNIRGKDWRVQTNVYGNGSTNI  142

Query  684   GREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVT  505
             GREE++ LWFDP Q  H YSILW    I+F VD++P+RE+    ++   +PSKPM++Y T
Sbjct  143   GREERYGLWFDPAQDFHQYSILWTDSKIIFYVDDVPIRELKRTESMKGDFPSKPMTLYAT  202

Query  504   IWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-NSSSDCTRRSPSTSSLEGEGFVK  328
             IWD S WAT+GGKY VNY YAP+VA      L GC+ N     T    +T+ +       
Sbjct  203   IWDASNWATNGGKYKVNYKYAPYVAEFTDFVLHGCSVNPIDHVTTNCDNTAQISDNVSFG  262

Query  327   LTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             +T  +   ++  R KHM YSYC D+ RYKV   EC
Sbjct  263   VTPLEKIKMENFRLKHMTYSYCYDRIRYKVPLPEC  297



>gb|KEH40692.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=328

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 168/259 (65%), Gaps = 1/259 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G HN+ + ++  +  L+LD+SSG G  S D Y +G+F+A+IKLP+ +T+GVVV
Sbjct  35   EGYTPLFGDHNLIIHSDSKAVHLLLDESSGSGFASHDLYLHGYFSASIKLPSDYTAGVVV  94

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN D+Y  NHDEID E LG  + +DW +QTN+Y NGS   GREE++ LWFDP++  
Sbjct  95   AFYLSNGDMYEKNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNIGREERYGLWFDPSEEF  154

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW    I+F VD++P+REV    ++   +PSK M++Y TIWD S WAT+GGKY V
Sbjct  155  HHYSILWTDSKIIFYVDDVPIREVKRTESMRGDFPSKAMTLYSTIWDASTWATNGGKYKV  214

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP++A      L GC     +   +  S  S E      +TQ +   ++  R KHM
Sbjct  215  NYKYAPYIAEFSDFVLHGCAVDPIEHVTKCDSAQSSETVP-SDVTQLERIKMENFRLKHM  273

Query  276  FYSYCKDKARYKVLPLECT  220
             YSYC DK RYKV   EC 
Sbjct  274  TYSYCYDKTRYKVPLPECV  292



>ref|XP_009409244.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=337

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 169/278 (61%), Gaps = 9/278 (3%)
 Frame = -1

Query  1041  SVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFN  862
             +V  + D        EGY  L+G  N+ L  +G    L LD+ +G G  S+D Y +GFF+
Sbjct  23    AVTTVIDSLPTLSFEEGYTQLFGDGNLMLLRDGKRVHLSLDERTGAGFASQDLYLHGFFS  82

Query  861   AAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTG  682
             A+IKLP+ +T+GVVVAFYMSN D +   HDE+D E LG  + R+W +QTN+Y NGS   G
Sbjct  83    ASIKLPSDYTAGVVVAFYMSNGDAFEKTHDELDFEFLGNVRGREWRVQTNVYGNGSTAVG  142

Query  681   REEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTI  502
             REE+  LWFDPT+  H YSILWN   I+F VD+ P+RE+V   A   V+P+KPMS+Y TI
Sbjct  143   REERCDLWFDPTEDFHHYSILWNHDRIIFYVDDTPIREIVRAEAAGGVFPAKPMSLYATI  202

Query  501   WDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGF  334
             WDGS WAT GG+Y V Y YAP+VA    + L GC     + SS C R  P  +  +    
Sbjct  203   WDGSNWATSGGRYKVKYKYAPYVAEFSELVLHGCAVDPIDHSSPCER--PENARYDT---  257

Query  333   VKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
             + ++  Q + +   R  HM Y YC D+ RY   P EC+
Sbjct  258   LTMSSDQRARMTSFRRNHMQYLYCYDRDRYPTPPPECS  295



>ref|XP_009405165.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=340

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/270 (47%), Positives = 168/270 (62%), Gaps = 9/270 (3%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T     EGY  L+G  N+ L  +G +  L LD+ +G G  S+  Y +GFF+A+IKLPA 
Sbjct  41    LTTLSFEEGYTQLFGDSNLILHLDGRTVHLSLDQRTGAGFASQGLYLHGFFSASIKLPAD  100

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             + +GVVVAFYMSN DV+   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LW
Sbjct  101   YAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYGLW  160

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT+  H YSILW++  I+F +DN P+REVV    +   +PSKPMS+Y TIWDGS WAT
Sbjct  161   FDPTEDYHQYSILWSNERIIFYIDNTPIREVVRTQTMGGDFPSKPMSLYATIWDGSTWAT  220

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFV----KLTQQQI  310
              GG+Y VNY +AP+VA    + L GC    S+  R     + LE    V     ++  Q 
Sbjct  221   SGGRYKVNYKFAPYVAEFTDLVLHGCVVDPSNHNR-----TCLESNAGVYNAMMISTDQR  275

Query  309   SGLQWARGKHMFYSYCKDKARYKVLPLECT  220
             + ++  R KHM YSYC D+ RY     EC+
Sbjct  276   AAMERFRKKHMTYSYCHDRIRYLTPSPECS  305



>ref|XP_006303176.1| hypothetical protein CARUB_v10009628mg [Capsella rubella]
 gb|EOA36074.1| hypothetical protein CARUB_v10009628mg [Capsella rubella]
Length=344

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/264 (47%), Positives = 167/264 (63%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LD+ +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  37   ESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  96

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS + GREE++ LWFDP++  
Sbjct  97   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTQRGREERYRLWFDPSKEF  156

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ N A+   YP+KPMS+Y TIWD S+WAT GGKY  
Sbjct  157  HRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMSLYATIWDASDWATSGGKYKA  216

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APFVA      L+GC+         DC   S S   LE + +  +  +Q + ++  
Sbjct  217  NYKFAPFVAEFKSFSLDGCSVDPIQEVPVDC---SDSVDFLESQDYSTINSRQRAAMRRF  273

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY   P EC 
Sbjct  274  RQRFMYYSYCYDTVRYPQAPPECV  297



>emb|CDY60254.1| BnaCnng35910D [Brassica napus]
Length=342

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 166/264 (63%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LDK +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  34   ESLSPLFGDGNLVRSPDDLSVRLLLDKYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  94   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEF  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ + A+   YP+KPMS+Y TIWD S+WAT GGKY  
Sbjct  154  HRYSILWTPHKIIFWVDDVPIREVIRSEAMGADYPAKPMSLYATIWDASDWATSGGKYKA  213

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY YAPFVA      L+GC+        +DC   S S   LE + +  +   Q + ++  
Sbjct  214  NYKYAPFVAEFKSFSLDGCSVDPIQEVPTDC---SDSVDFLESQDYFSINSLQRASMRRF  270

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY   P EC 
Sbjct  271  RQRFMYYSYCYDTVRYPEAPPECV  294



>ref|XP_010499761.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Camelina sativa]
Length=346

 Score =   258 bits (660),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 167/263 (63%), Gaps = 8/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LD+ +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  39   ESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  98

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS + GREE++ LWFDP++  
Sbjct  99   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTQRGREERYRLWFDPSKEF  158

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ N A+   YP+KPMS+Y TIWD S+WAT GGKY  
Sbjct  159  HRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMSLYATIWDASDWATSGGKYKA  218

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APFVA      L+GC+         DC   S S   LE + +  +  +Q + ++  
Sbjct  219  NYKFAPFVAEFKSFSLDGCSVDPIQEVPVDC---SDSVDFLESQDYSTINSRQRAAMRRF  275

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R + M+YSYC D  RY   P EC
Sbjct  276  RQRFMYYSYCYDTVRYPEAPPEC  298



>gb|EAY89191.1| hypothetical protein OsI_10687 [Oryza sativa Indica Group]
Length=338

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 163/266 (61%), Gaps = 10/266 (4%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGY  L+G  N+ L  +G    + LD+ +G G  S+  Y++GFF+A+IKLPA  
Sbjct  43    TALSFEEGYTQLFGDSNLMLHGDGKRVHISLDERTGAGFASQGAYHHGFFSASIKLPADH  102

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+GVVVAFYMSN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LWF
Sbjct  103   TAGVVVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAAGREERYGLWF  162

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPTQ  H Y+I W+   I+F VD  P+REVV  A++   +PSKPMS+Y TIWDGS WAT 
Sbjct  163   DPTQDFHRYAIRWSHDTIIFYVDETPIREVVRTASMGAQFPSKPMSLYATIWDGSSWATS  222

Query  474   GGKYPVNYNYAPFVASMGRVELEGC-TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQ  298
             GG+Y VNY YAP+VA    + L GC   S   C   + S +   G         Q S ++
Sbjct  223   GGRYKVNYKYAPYVAEFTDLLLHGCPAGSPPPCEGAAASATMPPG---------QRSAME  273

Query  297   WARGKHMFYSYCKDKARYKVLPLECT  220
               R +HM Y YC D+ RY     EC+
Sbjct  274   RFRTRHMTYGYCYDRVRYHAPLPECS  299



>gb|EPS64838.1| xyloglucan endotransglucosylase/hydrolase 14, partial [Genlisea 
aurea]
Length=326

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/271 (49%), Positives = 167/271 (62%), Gaps = 9/271 (3%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T    +E Y+ L+   NI    +  +  L+L++ SG G+VS D Y +GFF+AAIK+P+  
Sbjct  21    TTLKFNEAYSPLFSKFNIHPSADDRAVRLLLNRLSGSGIVSSDYYSHGFFSAAIKMPSEH  80

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+GVVVAFY SN D +  NHDE+DIE LG  K + W  QTN Y NGSV  GREE++ LWF
Sbjct  81    TAGVVVAFYTSNVDTFERNHDELDIEFLGNVKGKPWRFQTNAYGNGSVSRGREERYRLWF  140

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPT  SH YSILW    ++F VD IP+RE+    A+   +P+KPMSVY TIWD S WAT+
Sbjct  141   DPTADSHRYSILWTPITVVFYVDEIPIREIRRCVAMRGDFPAKPMSVYATIWDASSWATN  200

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNSSSD------CTRRSPSTSSLEGEGFVKLTQQQ  313
             GG+  VNY Y PFVA    + L GC    SD      CT    STSSL  E F  ++ Q 
Sbjct  201   GGREKVNYRYEPFVAEFTDLVLRGCIVDPSDQIPSSNCT---DSTSSLMAEDFAAVSPQG  257

Query  312   ISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
                ++  R K+M+YSYC D  RY V P EC 
Sbjct  258   RRWMKRFREKYMYYSYCYDVVRYPVRPPECV  288



>ref|XP_006415244.1| hypothetical protein EUTSA_v10008109mg [Eutrema salsugineum]
 gb|ESQ33597.1| hypothetical protein EUTSA_v10008109mg [Eutrema salsugineum]
Length=343

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 178/303 (59%), Gaps = 20/303 (7%)
 Frame = -1

Query  1113  FFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSA  934
             FFLI   +++   +  R   +T                 E  + L+G  N+    +  S 
Sbjct  10    FFLI---IIVFLGLGLRSSAFT---------NLNTLSFEESLSPLFGDANLVRSPDDLSV  57

Query  933   DLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIEL  754
              L+LD+ +G G +S + Y +GF+++ IKLPA +T+GVVVAFY SN DV+   HDE+DIE 
Sbjct  58    RLLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEF  117

Query  753   LGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPV  574
             LG  K + W  QTNLY NGS   GREE++ LWFDP++  H YSILW  H I+F VD++P+
Sbjct  118   LGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPI  177

Query  573   REVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT-  397
             REV+ + A+   YP+KPMS+Y TIWD S+WAT GGKY  NY +APFVA      L+GC+ 
Sbjct  178   REVIRSEAMGADYPAKPMSLYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSV  237

Query  396   ----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPL  229
                    +DC   S S   LE + +  +  +Q + ++  R + M+YSYC D  RY   P 
Sbjct  238   DPIQEVPTDC---SDSVEFLESQDYSSINSRQRAAMRRFRQRFMYYSYCYDTVRYPEPPP  294

Query  228   ECT  220
             EC 
Sbjct  295   ECV  297



>ref|XP_009344136.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Pyrus x bretschneideri]
Length=355

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/312 (42%), Positives = 183/312 (59%), Gaps = 21/312 (7%)
 Frame = -1

Query  1137  NSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQ  958
             N  + FSQ   ++ ++++              +VD      T     + Y  L+G  N+ 
Sbjct  12    NGVSLFSQPLRLILLILVCVG-----------NVDAAFYNLTTIPFDQSYTPLFGDGNLV  60

Query  957   LKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHN  778
                +G    L+LD+ +G G +S + Y +GFF+A IKLP+ +T+GV VAFY SN DV+  N
Sbjct  61    RSPDGKGVRLLLDRFTGSGFISSNLYNHGFFSANIKLPSDYTAGVCVAFYTSNADVFEKN  120

Query  777   HDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHIL  598
             HDE+DIE LG  + + W  QTNLY NGS   GREE++ LWFDPT+  H YSILW   + +
Sbjct  121   HDELDIEFLGNTEGKPWRFQTNLYGNGSTNRGREERYRLWFDPTKDFHRYSILWTPENTI  180

Query  597   FLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGR  418
             F VD +P+REVV N  +   YPSKPMS+Y TIWD S WAT GG+Y VNY YAPFVA    
Sbjct  181   FYVDEVPIREVVRNEEMGADYPSKPMSLYTTIWDASSWATSGGQYKVNYKYAPFVAEFKD  240

Query  417   VELEGCTNSSSDCTRRSPSTSS-------LEGEGFVKLTQQQISGLQWARGKHMFYSYCK  259
             + LEGC    +D   + P+  +       L  + +  +T+Q+ + ++  R ++M+YSYC 
Sbjct  241   LVLEGC---PADPILQIPAAEACAEHYTHLATQDYSVITRQRRAAMRRFRQRYMYYSYCY  297

Query  258   DKARYKVLPLEC  223
             D  RY V P EC
Sbjct  298   DSLRYPVPPPEC  309



>gb|AIL30514.1| xyloglucan endotransglucosylase-hydrolase XTH5 [Nicotiana tabacum]
Length=342

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 167/263 (63%), Gaps = 4/263 (2%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            S+G++ L+G  NI    +  S  L L++ +G G  S D Y +GFF+A IKLP+ +T+G+V
Sbjct  35   SDGFSHLFGEGNILHATDDKSLQLHLNQRTGSGFKSSDLYTHGFFSAKIKLPSDYTAGIV  94

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY +N D++   HDE+D E LG  + + W  QTN+Y NGS   GREE++YLWFDP++ 
Sbjct  95   VAFYTTNGDLFTKTHDELDFEFLGSIRGKAWRFQTNMYGNGSTSRGREERYYLWFDPSKE  154

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW   +I+F +D++P+RE+V N A+   YPSKPM +Y TIWD S+WAT GGKY 
Sbjct  155  FHRYSILWTIKNIIFYIDDVPIREIVRNDAMGGDYPSKPMGLYATIWDASDWATSGGKYK  214

Query  459  VNYNYAPFVASMGRVELEGCTNSSSDCTRRSPST----SSLEGEGFVKLTQQQISGLQWA  292
             NY YAPF+A    + L GC     +    +PS       L+   F ++T +Q   ++  
Sbjct  215  TNYKYAPFIAEFTDLVLNGCAMDPLEQVVNNPSCDEKDDELQKADFSRITPRQRMAMKRF  274

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R K+M+YSYC D  RY V P EC
Sbjct  275  RSKYMYYSYCYDSLRYSVPPPEC  297



>ref|XP_008795338.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Phoenix dactylifera]
Length=337

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/298 (41%), Positives = 183/298 (61%), Gaps = 11/298 (4%)
 Frame = -1

Query  1101  LSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVL  922
             L+ +V+   +++   +++  +   + +  +     EGY   +G  N+ L  +G +  + L
Sbjct  5     LAPLVLFFFIASPLFLFSSSATTSVIESSSTVSFEEGYTQTFGDSNLMLLRHGKTVHIAL  64

Query  921   DKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYD  742
             D+ +G G  S+D Y +GFF+A+IKLP+ + +GVVVAFYMSN DV+   HDE+D E LG  
Sbjct  65    DERTGAGFASQDLYLHGFFSASIKLPSDYAAGVVVAFYMSNGDVFEKTHDELDFEFLGNI  124

Query  741   KRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVV  562
             + R+W +QTN+Y NGS   GREE++ LWFDPT   H YSILW+   I+F +D++P+RE+V
Sbjct  125   RGREWRVQTNVYGNGSTAIGREERYDLWFDPTDDFHQYSILWSHDRIIFYIDSVPIREIV  184

Query  561   NNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSD  382
                ++   +PSKPMS+Y TIWDGS WAT GG+Y VNY YAP++A    + L GC  +  D
Sbjct  185   RTESMGGQFPSKPMSLYATIWDGSNWATSGGRYKVNYRYAPYIAEFADLILNGCAVNPMD  244

Query  381   CTRRSPSTSSLEGEGFVK-----LTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
                    +S+ EG    +     ++ +Q + ++  R KH+ Y YC D+ RY   P EC
Sbjct  245   ------HSSACEGRAAARYDSATMSSEQRAQMESFRRKHVTYFYCYDRNRYPNPPPEC  296



>ref|XP_009764906.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nicotiana sylvestris]
Length=343

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 167/263 (63%), Gaps = 4/263 (2%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            S+G++ L+G  NI    +  S  L L++ +G G  S D Y +GFF+A IKLP+ +T+G+V
Sbjct  35   SDGFSHLFGEGNILHATDDKSLQLHLNQRTGSGFKSSDLYTHGFFSAKIKLPSDYTAGIV  94

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY +N D++   HDE+D E LG  + + W  QTN+Y NGS   GREE++YLWFDP++ 
Sbjct  95   VAFYTTNGDLFTKTHDELDFEFLGNIRGKAWRFQTNMYGNGSTSRGREERYYLWFDPSKE  154

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW   +I+F +D++P+RE+V N A+   YPSKPM +Y TIWD S+WAT GGKY 
Sbjct  155  FHRYSILWTIKNIIFYIDDVPIREIVRNDAMGGDYPSKPMGLYATIWDASDWATSGGKYK  214

Query  459  VNYNYAPFVASMGRVELEGCTNSSSDCTRRSPST----SSLEGEGFVKLTQQQISGLQWA  292
             NY YAPF+A    + L GC     +    +PS       L+   F ++T +Q   ++  
Sbjct  215  TNYKYAPFIAEFTDLVLNGCAMDPLEQVVNNPSCDEKDDELQKADFSRITPRQRMAMKRF  274

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R K+M+YSYC D  RY V P EC
Sbjct  275  RSKYMYYSYCYDSLRYSVPPPEC  297



>ref|NP_001234470.1| xyloglucan endotransglucosylase-hydrolase XTH5 precursor [Solanum 
lycopersicum]
 gb|AAS46240.1| xyloglucan endotransglucosylase-hydrolase XTH5 [Solanum lycopersicum]
Length=337

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 171/266 (64%), Gaps = 10/266 (4%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            ++G++ L+G  NI   N+ +S  L L++++G G  S D Y +GFF+A IKLP+ +T+G+V
Sbjct  28   NKGFSHLFGDGNILHANDDNSLQLHLNQNTGSGFKSSDLYNHGFFSAKIKLPSDYTAGIV  87

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY +NQDV+   HDE+D E LG  K + W  QTN+Y NGS   GREE++ LWFDP++ 
Sbjct  88   VAFYTTNQDVFKKTHDELDFEFLGNIKGKAWRFQTNMYGNGSTHRGREERYTLWFDPSKE  147

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW + +I+F +D++P+RE+V N A+   YPSKPM +Y TIWD S+WAT GGKY 
Sbjct  148  FHRYSILWTNKNIIFYIDDVPIREIVRNDAMGGDYPSKPMGLYATIWDASDWATSGGKYK  207

Query  459  VNYNYAPFVASMGRVELEGCTN-------SSSDCTRRSPSTSSLEGEGFVKLTQQQISGL  301
             NY YAPF+A    + L GC         + S C  +      L+   F ++T +Q   +
Sbjct  208  TNYKYAPFIAEFTDLVLNGCAMDPLEQVVNPSLCDEKD---VELQKSDFSRITSRQRMSM  264

Query  300  QWARGKHMFYSYCKDKARYKVLPLEC  223
            +  R K+M+YSYC D  RY V P EC
Sbjct  265  KRFRAKYMYYSYCYDSLRYSVPPPEC  290



>ref|XP_008373536.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Malus domestica]
Length=355

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 179/309 (58%), Gaps = 22/309 (7%)
 Frame = -1

Query  1125  FFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNN  946
             FF    L+L ++V    V A    Y            T     +GY  L+G  N+    +
Sbjct  17    FFHPLRLVLLILVCFGNVGA--AFYN----------LTTIPFDQGYIPLFGDGNLVRSPD  64

Query  945   GSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEI  766
             G    L+LD+ +G G +S + Y +GFF+A IKLP+ +T+G+ VAFY SN DV+  +HDE+
Sbjct  65    GKGVRLLLDRFTGSGFISSNLYNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKSHDEL  124

Query  765   DIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVD  586
             DIE LG  + + W  QTN+Y NGS   GREE++ LWFDPT+  H YSILW    I+F VD
Sbjct  125   DIEFLGNTEGKPWRFQTNIYGNGSTNRGREERYRLWFDPTKDFHRYSILWTPEKIIFYVD  184

Query  585   NIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELE  406
              +P+REVV N  +   YPSKPMS+Y TIWD S WAT GGKY VNY YAPFVA    + LE
Sbjct  185   EVPIREVVRNEEMGADYPSKPMSLYTTIWDASSWATSGGKYKVNYKYAPFVAEFKDLALE  244

Query  405   GCTNSSSDCTRRSPSTSS-------LEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKAR  247
             GC    +D  ++ P   +       L  + +  ++ Q+ + +   R ++M+YSYC D  R
Sbjct  245   GC---PADPIQQIPPAEACAEHYTHLATQDYSVISPQRRAAMSRFRQRYMYYSYCYDSLR  301

Query  246   YKVLPLECT  220
             Y V P EC 
Sbjct  302   YPVPPPECV  310



>ref|XP_007158243.1| hypothetical protein PHAVU_002G136200g [Phaseolus vulgaris]
 gb|ESW30237.1| hypothetical protein PHAVU_002G136200g [Phaseolus vulgaris]
Length=346

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 166/263 (63%), Gaps = 4/263 (2%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            ++GY+ L+G  N+    +G  A L+LD+ +G G +S + Y+YGFF+A IKLP+ +T+G+ 
Sbjct  40   NDGYSTLFGDSNVVRSADGYGAQLLLDRFTGSGFISSNMYHYGFFSARIKLPSNYTAGIC  99

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY SN DV+  +HDE+D E LG    + W  QTNLY NGS   GREE++ LWFDPT+ 
Sbjct  100  VAFYTSNGDVFEKSHDELDFEFLGNIAGKPWRFQTNLYGNGSTNRGREERYRLWFDPTKE  159

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW + +++F VD +P+REV+ +  +   YPSKPMS+Y TIWD S WAT GGKY 
Sbjct  160  YHRYSILWTAKNVIFYVDEVPIREVLRSEEMGGDYPSKPMSLYSTIWDASNWATSGGKYK  219

Query  459  VNYNYAPFVASMGRVELEGC----TNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            VNY YAPFV     + L+GC         D    S     LE + +  +T  +   ++  
Sbjct  220  VNYKYAPFVTEFKDLVLKGCPADPIQEIFDLNSCSDQYEDLEAQDYAVITPTRRLAMRRF  279

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R ++M+YSYC D  RY V P EC
Sbjct  280  RQRYMYYSYCYDTLRYNVPPPEC  302



>dbj|BAO02542.1| endo-(1,4)-beta-D-glucanase ortholog, partial [Nicotiana alata]
Length=329

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 171/264 (65%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+   NI+   + +S  L+L++ SG G++S + Y YGFF+A+IKLPA +T+G+VV
Sbjct  45   EGYSPLFSDFNIERSPDDTSFRLLLNRFSGSGVISTEYYNYGFFSASIKLPAIYTAGIVV  104

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN D +  NHDE+DIE LG    + W  QTNLY NGSV  GREE++ +WFDP++  
Sbjct  105  AFYTSNVDTFEKNHDELDIEFLGNVNGQPWRFQTNLYGNGSVSRGREERYRMWFDPSKDF  164

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F +D  P+REV  N A+   +PSKPMS+Y TIWD S WAT+GGK  V
Sbjct  165  HHYSILWTPRNIIFYIDETPIREVNRNPAMGGDFPSKPMSLYATIWDASSWATNGGKAKV  224

Query  456  NYNYAPFVASMGRVELEGCTN------SSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            +Y + PF      + L+GC        SS++CT R    + L  + +  +T ++   ++W
Sbjct  225  DYKHEPFATEFKDLVLQGCIVDPIEQISSTNCTDR---IAKLLAQNYSIMTPERRKSMKW  281

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V P EC
Sbjct  282  FRERYMYYSYCYDNIRYPVPPPEC  305



>ref|XP_006354588.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Solanum tuberosum]
Length=342

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 171/266 (64%), Gaps = 10/266 (4%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            ++G++ L+G  NI   N+ +S  L L++++G G  S D Y +GFF+A IKLP+ +T+G+V
Sbjct  33   NKGFSHLFGDGNILHANDDNSLQLHLNQNTGSGFKSSDLYNHGFFSAKIKLPSDYTAGIV  92

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY +NQDV+   HDE+D E LG  + + W  QTN+Y NGS   GREE++ LWFDP++ 
Sbjct  93   VAFYTTNQDVFKKTHDELDFEFLGNIRGKAWRFQTNMYGNGSTHRGREERYTLWFDPSKE  152

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW + +I+F +D++P+RE+V N A+   YPSKPM +Y TIWD S+WAT GGKY 
Sbjct  153  FHRYSILWTNKNIIFYIDDVPIREIVRNDAMGGDYPSKPMGLYATIWDASDWATSGGKYK  212

Query  459  VNYNYAPFVASMGRVELEGCTN-------SSSDCTRRSPSTSSLEGEGFVKLTQQQISGL  301
             NY YAPF+A    + L GC         + S C  +      L+   F ++T +Q   +
Sbjct  213  TNYKYAPFIAEFTDLVLNGCAMDPLEQVVNPSLCDEKD---VELQKADFSRITSRQRMAM  269

Query  300  QWARGKHMFYSYCKDKARYKVLPLEC  223
            +  R K+M+YSYC D  RY V P EC
Sbjct  270  KRFRAKYMYYSYCYDSLRYSVPPPEC  295



>ref|XP_010933426.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Elaeis guineensis]
Length=339

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 171/272 (63%), Gaps = 10/272 (4%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGY+ L+G  N+    +G +  L+L++ SG G +S D Y +GFF+A+IKLP+ +
Sbjct  29    TTLAFDEGYSHLFGEGNLVRSPDGRTVRLLLNRYSGAGFISSDLYNHGFFSASIKLPSDY  88

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+GVVVAFY SN D++P  HDE+D E LG  +   W +QTN+Y NGS+  GREE++ L F
Sbjct  89    TAGVVVAFYTSNGDIFPKTHDELDFEFLGNIRGEKWRIQTNVYGNGSIGRGREERYILPF  148

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPT+ +H YSILW + HI+F VD+ P+REVV + A+   YPSKPMSVY TIWDGS WAT 
Sbjct  149   DPTKEAHRYSILWTATHIIFYVDHTPIREVVRSDAMGGEYPSKPMSVYATIWDGSTWATA  208

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPST-------SSLEGEGFVKLTQQ  316
             GG Y + Y YAPFVA    + L GC     D  ++ PST       + L    F  +T +
Sbjct  209   GGAYKIKYKYAPFVAEFSDLVLRGC---RVDPIQQRPSTDHCTDADAELMAADFAIMTPR  265

Query  315   QISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
             + + ++  R ++M YS C D  RY     +CT
Sbjct  266   KRAAMRRFRERYMIYSVCYDTLRYPNTLPDCT  297



>gb|EAZ09009.1| hypothetical protein OsI_31270 [Oryza sativa Indica Group]
Length=332

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 164/277 (59%), Gaps = 3/277 (1%)
 Frame = -1

Query  1050  TPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYG  871
             TPP   RL     +    EGY  ++G  N+ +  +G    L LD+S+G G  S+D + +G
Sbjct  29    TPPPPLRLVRGALRVAFDEGYTRMFGDGNLAVLRDGRRVRLTLDESTGAGFASQDVFLHG  88

Query  870   FFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSV  691
             FF+AA+KLPA + +GVVVAFY+SN D Y   HDE+D E LG  + R+W +QTN+Y NGS 
Sbjct  89    FFSAAVKLPAYYAAGVVVAFYLSNGDTYEKTHDEVDFEFLGNVRGREWRVQTNVYGNGST  148

Query  690   KTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVY  511
               GREE++ L FDPT   H YSILW    I+F VD  P+REVV  AA+   +P+KPMSVY
Sbjct  149   AAGREERYDLPFDPTDELHHYSILWTRRRIIFYVDETPIREVVRTAAMGAAFPAKPMSVY  208

Query  510   VTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFV  331
              TIWDGS WAT GG+Y VNY YAPFVA    + L GC   + D      S S  + E   
Sbjct  209   ATIWDGSAWATLGGRYRVNYRYAPFVAEFADLVLHGC---AVDPLAVEHSASCGDEEEEA  265

Query  330   KLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
                    + +   R  HM YSYC D+ RY V   EC 
Sbjct  266   AEAVVSSAAMAAFRRGHMSYSYCHDRRRYPVALSECA  302



>ref|XP_009348482.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Pyrus x bretschneideri]
Length=355

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 183/312 (59%), Gaps = 21/312 (7%)
 Frame = -1

Query  1137  NSPNFFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQ  958
             N  + FSQ   ++ ++++              +VD      T     + Y  L+G  N+ 
Sbjct  12    NGVSLFSQPLRLILLILVCVG-----------NVDAAFYNLTTIPFDQSYTPLFGDGNLV  60

Query  957   LKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHN  778
                +G    L+LD+ +G G +S + Y +GFF+A IKLP+ +T+G+ VAFY SN DV+  N
Sbjct  61    RSPDGKGVRLLLDRFTGSGFISSNLYNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKN  120

Query  777   HDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHIL  598
             HDE+DIE LG  + + W  QTNLY NGS   GREE++ LWFDPT+  H YSILW   + +
Sbjct  121   HDELDIEFLGNTEGKPWRFQTNLYGNGSTNRGREERYRLWFDPTKDFHRYSILWTPENTI  180

Query  597   FLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGR  418
             F VD +P+REVV N  +    PSKPMS+Y TIWD S WAT GG+Y VNY YAPFVA    
Sbjct  181   FYVDEVPIREVVRNEEMGADSPSKPMSLYTTIWDASSWATSGGQYKVNYKYAPFVAEFKD  240

Query  417   VELEGCTNSSSDCTRRSPSTSS-------LEGEGFVKLTQQQISGLQWARGKHMFYSYCK  259
             + LEGC    +D  ++ P+  +       L  + +  +T+Q+ + ++  R ++M+YSYC 
Sbjct  241   LVLEGC---PADPIQQIPAAEACAEHYTHLATQDYSVITRQRRAAMRRFRQRYMYYSYCY  297

Query  258   DKARYKVLPLEC  223
             D  RY V P EC
Sbjct  298   DSLRYPVPPPEC  309



>ref|XP_009607215.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nicotiana tomentosiformis]
Length=365

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 170/264 (64%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+   NI+   + +S  L+L++ SG G++S + Y YGFF+A+IKLPA +T+G+VV
Sbjct  48   EGYSPLFSDFNIERSPDDTSFRLLLNRFSGSGVISTEYYNYGFFSASIKLPAIYTAGIVV  107

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN D +  NHDE+DIE LG    + W  QTNLY NGSV  GREE++ +WFDP+   
Sbjct  108  AFYTSNVDTFEKNHDELDIEFLGNVNGQPWRFQTNLYGNGSVSRGREERYRMWFDPSNDF  167

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F VD  P+REV  N A+   +PSKPMS+Y TIWD S WAT+GGK  V
Sbjct  168  HHYSILWTPKNIIFYVDETPIREVNRNPAMGGDFPSKPMSLYATIWDASSWATNGGKAKV  227

Query  456  NYNYAPFVASMGRVELEGCTN------SSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            +Y + PF      + LEGC        SS++CT R    + L  + +  +T ++   ++W
Sbjct  228  DYKHEPFATEFKDLVLEGCIVDPIEQISSTNCTDR---IARLLSQNYSIMTPERRKSMKW  284

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V P EC
Sbjct  285  FRERYMYYSYCYDNIRYPVPPPEC  308



>gb|ACD03224.1| xyloglucan endotransglucosylase/hydrolase 14 [Actinidia deliciosa]
Length=342

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 172/265 (65%), Gaps = 9/265 (3%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            ++GY  L+G +N+   ++  S +LVL++ +G G  S D Y +GFF+A IKLP+ +T+G+V
Sbjct  37   NKGYYPLFGDNNVVRSSDDKSVNLVLNQYTGSGFKSSDLYNHGFFSAKIKLPSDYTAGIV  96

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY SN D++   HDE+D E LG  + + W  QTN+Y NGS   GREE++YLWFDP++ 
Sbjct  97   VAFYTSNGDIFEKTHDELDFEFLGNIRGKRWRFQTNVYGNGSTSRGREERYYLWFDPSKE  156

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW + +I+F +D +P+RE+V + A+   +PSKPMS+Y TIWD S WAT GGKY 
Sbjct  157  FHRYSILWTNSNIIFYIDEVPIREIVRSEAMGGDFPSKPMSLYATIWDASNWATSGGKYK  216

Query  459  VNYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQ  298
            VNY Y+PFVA    + L GC         S+ C+++      L+   +  +T +Q S ++
Sbjct  217  VNYKYSPFVAKFTDLALHGCAVDPIQEVLSTSCSQKD---DQLKSADYASITPKQRSTMK  273

Query  297  WARGKHMFYSYCKDKARYKVLPLEC  223
              R K+M+YSYC D  RY +   EC
Sbjct  274  KFRQKYMYYSYCYDIIRYPIAQPEC  298



>ref|XP_004985060.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27-like [Setaria italica]
Length=333

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 158/265 (60%), Gaps = 8/265 (3%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGY  L+G  N+ L  +G    + LD+ +G G  S+  Y +G F+A IKLPA  
Sbjct  40    TSLSFREGYTQLFGDSNLALHGDGKRVHITLDERTGAGFASQGAYLHGLFSARIKLPADH  99

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+GVVVAFYMSN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LWF
Sbjct  100   TAGVVVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAAGREERYGLWF  159

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPT+  H Y+ILW+   I+F VD  P+REVV   ++   +PSKPMS+Y TIWDGS WAT 
Sbjct  160   DPTEDFHRYAILWSHDRIIFYVDETPIREVVRTGSMGAQFPSKPMSLYATIWDGSSWATS  219

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
             GG+Y V+Y YAP+VA    + L GC      C           G     ++  + S ++ 
Sbjct  220   GGRYKVDYKYAPYVAEFADLALRGCAVGRRACEE--------PGSAATAMSPAERSAMEA  271

Query  294   ARGKHMFYSYCKDKARYKVLPLECT  220
              R ++M Y YC D+ RY     EC+
Sbjct  272   FRARYMTYGYCYDRLRYLAPLPECS  296



>ref|XP_009608904.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nicotiana tomentosiformis]
Length=339

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 167/263 (63%), Gaps = 4/263 (2%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            S+G++ L+G  NI    +  S  L L++ +G G  S D Y +GFF+A IKLP+ +T+G+V
Sbjct  32   SDGFSHLFGEGNILHATDDKSLQLHLNQRTGSGFKSSDLYNHGFFSAKIKLPSDYTAGIV  91

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY +N D++   HDE+D E LG  + + W  QTN+Y NGS   GREE++YLWFDP++ 
Sbjct  92   VAFYTTNGDLFTQTHDELDFEFLGNIRGKAWRFQTNMYGNGSTSRGREERYYLWFDPSKE  151

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW + +I+F +D++P+RE+V N A+   YPSKPM +Y TIWD S+WAT GGKY 
Sbjct  152  FHRYSILWTNKNIIFYIDDVPIREIVRNDAMGGDYPSKPMGLYATIWDASDWATSGGKYK  211

Query  459  VNYNYAPFVASMGRVELEGCTNSSSDCTRRSPST----SSLEGEGFVKLTQQQISGLQWA  292
             NY YAPF+A    + L GC     +    +PS       L+     ++T +Q   ++  
Sbjct  212  TNYKYAPFIAEFTDLVLNGCAMDPLEQVVNNPSCDEKDDELQKADVSRITPRQRMAMKRF  271

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R K+M+YSYC D  RY V P EC
Sbjct  272  RSKYMYYSYCYDSLRYSVPPPEC  294



>ref|XP_010919979.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Elaeis guineensis]
Length=337

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 169/271 (62%), Gaps = 10/271 (4%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGY+ L+G  N+    +G +  LVL++ SG G +S D YY+GFF+A+IKLP+ +
Sbjct  27    TTRAFDEGYSHLFGEGNLVRSPDGRTVRLVLNRYSGAGFISSDLYYHGFFSASIKLPSDY  86

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+G+VVAFY SN D++P  HDE+D E LG  +   W +QTN+Y NGS   GREE++ L F
Sbjct  87    TAGIVVAFYTSNGDIFPKTHDELDFEFLGSIRGERWRIQTNVYGNGSTNRGREERYILPF  146

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPT+ +H YSILW + HI+F +DN P+REV  + A+   +PSKPMS+Y TIWDGS WAT 
Sbjct  147   DPTKDAHRYSILWTATHIIFYIDNTPIREVARSDAMGGDFPSKPMSLYATIWDGSTWATS  206

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTS-------SLEGEGFVKLTQQ  316
             GGKY V Y YAPF+A    + L GC     D  ++ PST         L    F  +T +
Sbjct  207   GGKYKVKYKYAPFIAEFSDLVLHGC---RVDPIQQVPSTEHCMEANDELMAADFAIMTPR  263

Query  315   QISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             + + ++  R ++M YS C D  RY     +C
Sbjct  264   KRAAMRRFRERYMTYSVCYDTLRYSDTLPDC  294



>emb|CDY29941.1| BnaC05g28950D [Brassica napus]
Length=343

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 165/264 (63%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LDK +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  37   ESLSPLFGDANLVRSPDDLSVRLLLDKYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  96

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  97   AFYTSNGDVFQKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTPRGREERYRLWFDPSKEF  156

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ + A+   YP+KPM++Y TIWD S+WAT GGKY  
Sbjct  157  HRYSILWTPHKIIFWVDDVPIREVIRSEAMGADYPAKPMALYATIWDASDWATSGGKYKA  216

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APFVA      L+GC+         DC   + S   LE + +  +   Q + ++  
Sbjct  217  NYKFAPFVAEFKSFSLDGCSVDPIQEVPVDC---ADSVEFLESQDYSAINSHQRAAMRRF  273

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY   P EC 
Sbjct  274  RQRFMYYSYCYDTVRYPEPPPECV  297



>emb|CDY35550.1| BnaA05g16360D [Brassica napus]
Length=343

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 165/264 (63%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LDK +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  37   ESLSPLFGDANLVRSPDDLSVRLLLDKYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  96

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  97   AFYTSNGDVFQKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTPRGREERYRLWFDPSKEF  156

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ + A+   YP+KPM++Y TIWD S+WAT GGKY  
Sbjct  157  HRYSILWTPHKIIFWVDDVPIREVIRSEAMGADYPAKPMALYATIWDASDWATSGGKYKA  216

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APFVA      L+GC+         DC   + S   LE + +  +   Q + ++  
Sbjct  217  NYKFAPFVAEFKSFSLDGCSVDPIQEVPVDC---ADSVEFLESQDYSAINSHQRAAMRRF  273

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY   P EC 
Sbjct  274  RQRFMYYSYCYDTVRYPEPPPECV  297



>ref|XP_008800080.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Phoenix dactylifera]
Length=341

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 173/272 (64%), Gaps = 10/272 (4%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EGY+ L+G  N+   ++G +  L+L++ SG G +S D Y++GFF+A+IKLP+ +
Sbjct  31    TTLAFDEGYSHLFGEGNLVRSSDGRTVRLLLNRYSGAGFISSDLYHHGFFSASIKLPSDY  90

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+G+VVAFY SN D++P  HDE+D E LG  +   W +QTN+Y NGS   GREE++ L F
Sbjct  91    TAGIVVAFYTSNGDIFPKTHDELDFEFLGNIRGERWRIQTNVYGNGSTSRGREERYVLPF  150

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPT+ +H YSILW + HI+F +D  P+REVV + A+   YPSKPMS+Y TIWDGS WAT 
Sbjct  151   DPTKEAHRYSILWTATHIIFYIDKTPIREVVRSDAMGGDYPSKPMSLYATIWDGSTWATS  210

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTS-SLEGEG------FVKLTQQ  316
             GGKY V Y YAPFVA    + L GC     D  +  PST   +E +G      F  +T +
Sbjct  211   GGKYKVKYKYAPFVAEFSDLVLRGC---RIDPIQPVPSTDHCMEADGDLMAADFAIMTPR  267

Query  315   QISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
             + + ++  R ++M YS C D  RY     +C+
Sbjct  268   KRAAMRRFRERYMTYSVCYDALRYSGALPDCS  299



>gb|KHN04842.1| Putative xyloglucan endotransglucosylase/hydrolase protein 30 
[Glycine soja]
Length=347

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 165/263 (63%), Gaps = 4/263 (2%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            ++GY+ L+G  N+    +G+   L LD+ +G G +S   Y YGFF+A IKLP+ +T+G+ 
Sbjct  41   NDGYSPLFGDSNVVRSEDGNGVQLRLDRYTGSGFISSSMYQYGFFSARIKLPSNYTAGIC  100

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY SN DV+  +HDE+D E LG    + W  QTNLY NGS K GREE++ LWFDPT+ 
Sbjct  101  VAFYTSNGDVFEKSHDELDFEFLGNVAGKPWRFQTNLYGNGSTKRGREERYRLWFDPTKE  160

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW + +++F +D +P+REV+ +  +   YPSKPMS+Y TIWD S WAT GGKY 
Sbjct  161  FHRYSILWTAKNVIFYIDEVPIREVLQSEEMGGDYPSKPMSLYATIWDASNWATSGGKYK  220

Query  459  VNYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            VNY YAPFV     + L+GC+       S     S   + LE + +  +T  +   +Q  
Sbjct  221  VNYKYAPFVTEFKDLVLKGCSADPIQEVSGTESCSDQHADLEAQDYATVTPMRRLAMQRF  280

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R ++M+YSYC D  RY V   EC
Sbjct  281  RQRYMYYSYCYDTLRYPVPQPEC  303



>ref|XP_003516952.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Glycine max]
Length=347

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 165/263 (63%), Gaps = 4/263 (2%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            ++GY+ L+G  N+    +G+   L LD+ +G G +S   Y YGFF+A IKLP+ +T+G+ 
Sbjct  41   NDGYSPLFGDSNVVRSEDGNGVQLRLDRYTGSGFISSSMYQYGFFSARIKLPSNYTAGIC  100

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY SN DV+  +HDE+D E LG    + W  QTNLY NGS K GREE++ LWFDPT+ 
Sbjct  101  VAFYTSNGDVFEKSHDELDFEFLGNVAGKPWRFQTNLYGNGSTKRGREERYRLWFDPTKE  160

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW + +++F +D +P+REV+ +  +   YPSKPMS+Y TIWD S WAT GGKY 
Sbjct  161  FHRYSILWTAKNVIFYIDEVPIREVLRSEEMGGDYPSKPMSLYATIWDASNWATSGGKYK  220

Query  459  VNYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            VNY YAPFV     + L+GC+       S     S   + LE + +  +T  +   +Q  
Sbjct  221  VNYKYAPFVTEFKDLVLKGCSADPIQEVSGTESCSDQHADLEAQDYAAVTPMRRLAMQRF  280

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R ++M+YSYC D  RY V   EC
Sbjct  281  RQRYMYYSYCYDTLRYPVPQPEC  303



>ref|XP_002973138.1| hypothetical protein SELMODRAFT_232041 [Selaginella moellendorffii]
 gb|EFJ25512.1| hypothetical protein SELMODRAFT_232041 [Selaginella moellendorffii]
Length=266

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 168/266 (63%), Gaps = 5/266 (2%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
             F  T  S+ ++V++G  + ++  NG    L LD +SG G+ S + Y +GFFN+A+KLPA 
Sbjct  2     FDTTSFSQHFSVVWGFDHSEVSENGMEVTLKLDSTSGSGIRSHNNYTFGFFNSAVKLPAN  61

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             ++SGVV  FY+SN+D +P  HDEID+E LG      +++QTN+Y NGS  TGRE++F LW
Sbjct  62    YSSGVVSTFYVSNEDSFPFTHDEIDLEFLGAASGDLYIIQTNIYSNGSTSTGREQRFKLW  121

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDPT   H+YSI W  +HI+F VD+IP+REV+ +  +   YP KPM+V+ TIWD S+WAT
Sbjct  122   FDPTAGFHNYSIFWTPYHIVFFVDDIPIREVLKSEELGEDYPLKPMNVFATIWDASQWAT  181

Query  477   HGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPS-TSSLEGEGFVKLTQQQISGL  301
              GG+  V+Y+YAPF      + L  C   SS      PS  SS+  +  +  +Q  +  L
Sbjct  182   DGGRSTVDYSYAPFATEYSNLILSDC--HSSTLAEECPSGASSVVPQALLSESQHHL--L  237

Query  300   QWARGKHMFYSYCKDKARYKVLPLEC  223
              W R  +M Y YC+DK+RY     EC
Sbjct  238   HWIRANYMIYDYCEDKSRYPQALPEC  263



>ref|XP_009373460.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Pyrus x bretschneideri]
Length=364

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 179/318 (56%), Gaps = 31/318 (10%)
 Frame = -1

Query  1125  FFSQFFLILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNN  946
             FF    L+L ++V    V A    Y            T     +GY  L+G  N+    +
Sbjct  17    FFHPLRLVLLILVCFGNVGA--AFYN----------LTTIPFDQGYIPLFGDGNLVRSPD  64

Query  945   GSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEI  766
             G    L+LD+ +G G +S + Y +GFF+A IKLP+ +T+G+ VAFY SN DV+  +HDE+
Sbjct  65    GKGVRLLLDRFTGSGFISSNLYNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKSHDEL  124

Query  765   DIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVD  586
             DIE LG  + + W  QTNLY NGS   GREE++ LWFDPT+  H YSILW    I+F VD
Sbjct  125   DIEFLGNTEGKPWRFQTNLYGNGSTNRGREERYRLWFDPTKDFHRYSILWTPEKIIFYVD  184

Query  585   NIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELE  406
              +P+REVV N  +   YPSKPMS+Y TIWD S WAT GGKY VNY YAPFVA    + LE
Sbjct  185   EVPIREVVRNEEMGADYPSKPMSLYTTIWDASSWATSGGKYKVNYKYAPFVAEFIDLALE  244

Query  405   GCTNSSSDCTRRSPST----------------SSLEGEGFVKLTQQQISGLQWARGKHMF  274
             GC    +D  ++ P                  + L  + +  +T Q+ + +   R ++M+
Sbjct  245   GC---PADPIQQIPPAXXXXXXXXXXACAEHYTHLATQDYSVITPQRRAAMSRFRQRYMY  301

Query  273   YSYCKDKARYKVLPLECT  220
             YSYC D  RY V P EC 
Sbjct  302   YSYCYDSLRYPVPPPECV  319



>ref|XP_007210518.1| hypothetical protein PRUPE_ppa007685mg [Prunus persica]
 gb|EMJ11717.1| hypothetical protein PRUPE_ppa007685mg [Prunus persica]
Length=359

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 184/302 (61%), Gaps = 16/302 (5%)
 Frame = -1

Query  1107  LILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADL  928
             LI+++++I   ++  G      +VD      T    ++GY+ L+G  N+    +G    L
Sbjct  22    LIITVLIISMCMANIG------NVDAAFSNLTTIPFNQGYSPLFGDGNLVRSPDGKGVRL  75

Query  927   VLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLG  748
             +LD+ +G G +S + Y +GFF+A IKLP+ +T+G+ VAFY SN DV+  +HDE+DIE LG
Sbjct  76    LLDRFTGSGFISSNLYNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKSHDELDIEFLG  135

Query  747   YDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVRE  568
               + + W  QTN+Y NGS   GREE++ LWFDPT+  H YSILW     +F VD++P+RE
Sbjct  136   NTEGKPWRFQTNIYGNGSTNRGREERYRLWFDPTKDFHRYSILWTPQITIFYVDDVPIRE  195

Query  567   VVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSS  388
             V     +   YPSKPMS+Y TIWD S WAT GGKY VNY YAPFVA    + L+GC    
Sbjct  196   VERREEMGGDYPSKPMSLYTTIWDASNWATSGGKYKVNYKYAPFVAEFKDLVLDGC---P  252

Query  387   SDCTRRSPSTSS-------LEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPL  229
             +D  ++ P+  +       L  + +  +T Q+ + ++  R ++M+YSYC D  RY V P 
Sbjct  253   ADPIQQIPAAEACAEKYALLATQDYSVITPQRRAAMRRFRQRYMYYSYCYDSLRYPVPPP  312

Query  228   EC  223
             EC
Sbjct  313   EC  314



>gb|KFK44960.1| hypothetical protein AALP_AA1G325900 [Arabis alpina]
Length=342

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 164/263 (62%), Gaps = 8/263 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LDK +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  37   ESLSPLFGDSNLVRSPDDLSVRLLLDKYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  96

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  97   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEF  156

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ + A+   YP+KPMS+Y TIWD S+WAT GGKY  
Sbjct  157  HRYSILWTPHKIIFWVDDVPIREVIRSDAMGADYPAKPMSLYATIWDASDWATSGGKYKA  216

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APF A      L+GC         +DC   S S   LE + +  +  +Q + ++  
Sbjct  217  NYKFAPFTAEFKSFSLDGCAVEPIQEVPTDC---SDSVEFLESQDYSSINSRQRAAMRRF  273

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R + M+YSYC D  RY     EC
Sbjct  274  RQRFMYYSYCYDTVRYPSPLPEC  296



>ref|XP_006651207.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27-like [Oryza brachyantha]
Length=304

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 161/254 (63%), Gaps = 9/254 (4%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ L   G    + LD+ +G G  S+  Y++GFF+A+IKLPA + +GVVV
Sbjct  51   EGYTQLFGDSNLMLHGGGKRVHIALDERTGAGFASRGAYHHGFFSASIKLPADYAAGVVV  110

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LWFDPTQ  
Sbjct  111  AFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAAGREERYGLWFDPTQDF  170

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+ILW+   I F VD  P+REVV   ++   +PSKPMS+Y TIWDGS WAT GG+Y V
Sbjct  171  HRYAILWSHDRITFYVDETPIREVVRTTSMGAQFPSKPMSLYATIWDGSSWATSGGRYKV  230

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAP+VA    + L GC  +++D +   P  ++        +   Q S ++  R ++M
Sbjct  231  NYKYAPYVAEFTDLGLHGCP-AAADGSPAQPCEAT--------MPPGQRSAMERFRARYM  281

Query  276  FYSYCKDKARYKVL  235
             Y YC+ +  Y V+
Sbjct  282  TYGYCQTEVVYDVM  295



>ref|XP_010663022.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Vitis vinifera]
 emb|CBI33819.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 168/264 (64%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            +GY  L+G  N+   ++G S  L+LD+ +G G +S + Y +GFF+A IKLP+ +T+GVVV
Sbjct  36   QGYTHLFGEGNLVRSSDGRSVRLLLDRYTGSGFISANLYNHGFFSANIKLPSEYTAGVVV  95

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+D E LG  K + W  QTN+Y NGS   GREE++ LWFDP++  
Sbjct  96   AFYTSNGDVFEKTHDELDFEFLGNVKGKPWRFQTNVYGNGSTSRGREERYRLWFDPSKEF  155

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW + +I+F VD +P+REV+ N A+   YPSKPM++Y TIWD S WAT GGKY V
Sbjct  156  HRYSILWTAKNIIFYVDEVPIREVIRNEAMGGDYPSKPMALYATIWDASNWATSGGKYKV  215

Query  456  NYNYAPFVASMGRVELEGCT------NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            +YNYAPFV+      L+GC        S+  C+ +    + LE   +  +T  +   ++ 
Sbjct  216  DYNYAPFVSEFSDFVLDGCPADPLQLASAGGCSDKD---AELESNDYSAITPLRRISMRK  272

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R K+M+YSYC D  RY     EC
Sbjct  273  FRQKYMYYSYCYDTLRYATPLPEC  296



>ref|XP_004956750.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Setaria italica]
Length=345

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 161/259 (62%), Gaps = 0/259 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  ++G  N+ L  +G    L LD+++G G  S+D + +GFF+AAIKLPA + +GVVV
Sbjct  48   EGYAQIFGSSNLALLRDGRRVHLALDETTGAGFASQDLFLHGFFSAAIKLPADYAAGVVV  107

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY+SN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ L FDPT   
Sbjct  108  AFYLSNGDVYEKTHDELDFEFLGNVRGREWRVQTNVYGNGSTHAGREERYDLPFDPTDDF  167

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW S  I+F VD  P+REVV  AA+   +PSKPMS+Y TIWDGS WAT GG+Y V
Sbjct  168  HHYSILWTSRRIVFYVDETPIREVVRTAAMGAAFPSKPMSLYATIWDGSAWATLGGRYRV  227

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            NY YAPFVA    + ++GC    +D    + +  +      + +   Q + +   R  H 
Sbjct  228  NYKYAPFVAEFTDLAIQGCAVDPTDDRLSAAACDARASLESLAVPAGQRAAMAAFRRAHT  287

Query  276  FYSYCKDKARYKVLPLECT  220
             YSYC D+ RY     +C 
Sbjct  288  SYSYCHDRRRYPAALPDCA  306



>ref|XP_003612793.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES95751.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
 gb|AFK43016.1| unknown [Medicago truncatula]
Length=349

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 166/263 (63%), Gaps = 4/263 (2%)
 Frame = -1

Query  999  SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVV  820
            ++GY+ L+G  N+   ++G+   L+LD+ +G G +S + Y +GFF+A IKLP+ +++G+ 
Sbjct  43   NDGYSHLFGDGNVVRSSDGNGVQLLLDRYTGSGFISSNMYQHGFFSANIKLPSNYSAGIC  102

Query  819  VAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQA  640
            VAFY SN DV+   HDE+D E LG    + W  QTNLY NGS   GREE++ LWFDPT+ 
Sbjct  103  VAFYTSNGDVFEKTHDELDFEFLGNIAGKPWRFQTNLYGNGSTHRGREERYRLWFDPTKG  162

Query  639  SHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYP  460
             H YSILW + +++F +D +P+REV+ N  + + YP KPMS+Y TIWD S WAT GGKY 
Sbjct  163  YHRYSILWTAKNVIFYIDEVPIREVLRNEEMGSEYPVKPMSLYATIWDASNWATSGGKYK  222

Query  459  VNYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            VNY YAPFV     + L+GC+       SD    S     LE + +  +T  +   ++  
Sbjct  223  VNYKYAPFVVEFKDLVLKGCSVDPIQEVSDNDVCSDQNVDLEAQDYANVTPMRRLAMRRF  282

Query  291  RGKHMFYSYCKDKARYKVLPLEC  223
            R + M+YSYC D  RY V P EC
Sbjct  283  RQRFMYYSYCYDTIRYPVPPPEC  305



>ref|XP_006352933.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Solanum tuberosum]
Length=389

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 171/264 (65%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+   NI+   +  S  L+L+K SG G++S + Y YGFF+A+IKLPA +T+G+VV
Sbjct  65   EGYSPLFSDFNIERSPDDRSFRLLLNKFSGSGVISTEYYNYGFFSASIKLPAIYTAGIVV  124

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN D +  NHDE+DIE LG    + W  QTN+Y NGSV  GREE++ +WFDP++  
Sbjct  125  AFYTSNADTFEKNHDELDIEFLGNVNGQPWRFQTNMYGNGSVSRGREERYRMWFDPSKDF  184

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F +D  P+RE+  + A+   +PSKPMS+Y TIWD S WAT+GGK  V
Sbjct  185  HQYSILWTPKNIIFYIDETPLREINRHPAMGGDFPSKPMSLYATIWDASSWATNGGKAKV  244

Query  456  NYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            +Y + PF   +  + LEGC         S++CT RS   + L  + +  +T ++   +++
Sbjct  245  DYKFEPFATELKDLVLEGCIVDPTEQIPSTNCTDRS---AKLLAQDYSNITTERRKSMKF  301

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V P EC
Sbjct  302  FRERYMYYSYCYDNLRYPVPPPEC  325



>gb|AAB18365.1| xyloglucan endotransglycosylase-related protein, partial [Arabidopsis 
thaliana]
Length=341

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 164/264 (62%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LD+ +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  32   ESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  91

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  92   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEF  151

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ N A+   YP+KPM++Y TIWD S+WAT GGKY  
Sbjct  152  HRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMALYATIWDASDWATSGGKYKA  211

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APFVA      L+GC+         DC   S S   LE + +  +   Q + ++  
Sbjct  212  NYKFAPFVAEFKSFSLDGCSVDPIQEVPMDC---SDSVDFLESQDYSSINSHQRAAMRRF  268

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY     EC 
Sbjct  269  RQRFMYYSYCYDTLRYPEPLPECV  292



>ref|XP_002890971.1| hypothetical protein ARALYDRAFT_473398 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67230.1| hypothetical protein ARALYDRAFT_473398 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 164/264 (62%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LD+ +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  37   ESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  96

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  97   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEF  156

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ N A+   YP+KPM++Y TIWD S+WAT GGKY  
Sbjct  157  HRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMALYATIWDASDWATSGGKYKA  216

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APFVA      L+GC+         DC   S S   LE + +  +   Q + ++  
Sbjct  217  NYKFAPFVAEFKSFSLDGCSVDPIQEVPVDC---SDSVDFLESQDYSSINAHQRAAMRRF  273

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY     EC 
Sbjct  274  RQRFMYYSYCYDTLRYPEPLPECV  297



>ref|NP_174496.1| probable xyloglucan endotransglucosylase/hydrolase 30 [Arabidopsis 
thaliana]
 sp|Q38908.2|XTH30_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 30; Short=At-XTH30; Short=XTH-30; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG23439.1|AC084165_5 endoxyloglucan transferase, putative [Arabidopsis thaliana]
 gb|AAL32776.1| endoxyloglucan transferase, putative [Arabidopsis thaliana]
 gb|AEE31443.1| probable xyloglucan endotransglucosylase/hydrolase 30 [Arabidopsis 
thaliana]
Length=343

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 164/264 (62%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LD+ +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  34   ESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  94   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEF  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ N A+   YP+KPM++Y TIWD S+WAT GGKY  
Sbjct  154  HRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMALYATIWDASDWATSGGKYKA  213

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APFVA      L+GC+         DC   S S   LE + +  +   Q + ++  
Sbjct  214  NYKFAPFVAEFKSFSLDGCSVDPIQEVPMDC---SDSVDFLESQDYSSINSHQRAAMRRF  270

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY     EC 
Sbjct  271  RQRFMYYSYCYDTLRYPEPLPECV  294



>gb|EYU43720.1| hypothetical protein MIMGU_mgv1a0191281mg, partial [Erythranthe 
guttata]
Length=280

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 154/233 (66%), Gaps = 9/233 (4%)
 Frame = -1

Query  903  GLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWV  724
            G++S D Y YGFF+A+IK+P+  T+G+VVAFY SN D +  NHDE+DIE LG  K + W 
Sbjct  2    GIISSDYYNYGFFSASIKMPSEHTAGIVVAFYTSNVDTFERNHDELDIEFLGNTKGKPWR  61

Query  723  LQTNLYCNGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAIS  544
             QTN+Y NGSV  GREE++ +WFDPT  SH YSILW   +I+F VD IP+REV+ N  + 
Sbjct  62   FQTNMYGNGSVSRGREERYRMWFDPTIDSHRYSILWTPRNIIFYVDEIPIREVIRNKEMK  121

Query  543  TVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNS------SSD  382
              YPSKPMSVY TIWD S WAT+GG+  V+Y Y PF+A    + LEGC         SS+
Sbjct  122  GDYPSKPMSVYATIWDASSWATNGGQEKVDYKYQPFIAEFTDLVLEGCIVDPTDQLLSSN  181

Query  381  CTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
            CT    S S+L G+ +  +T      ++W R K+M+YSYC D  RY + P EC
Sbjct  182  CTD---SISALIGKEYSTITSDGRKSMKWFREKYMYYSYCYDNLRYPIPPPEC  231



>ref|XP_010519083.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Tarenaya hassleriana]
Length=318

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 164/275 (60%), Gaps = 13/275 (5%)
 Frame = -1

Query  1017  FTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAG  838
              T +   E  + L+G  N+    +  S  L+LD+ +G G +S + Y +GFF+A +KLPA 
Sbjct  25    LTSSIFEETLSPLFGDSNLVRSPDDRSVRLLLDRYTGSGFISSNMYQHGFFSAMVKLPAD  84

Query  837   FTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLW  658
             + +GVVVAFY SN DV+   HDE+D E LG  K + W  QTNLY NGS   GREE++ LW
Sbjct  85    YPAGVVVAFYTSNGDVFEKTHDELDFEFLGNIKGKPWRFQTNLYGNGSTWRGREERYRLW  144

Query  657   FDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWAT  478
             FDP++  H YSILW SH I+F VD++P+REVV + A+   YP KPM++Y TIWD S+WAT
Sbjct  145   FDPSKEFHRYSILWTSHKIIFWVDDVPIREVVRSEAMGGEYPQKPMALYATIWDASDWAT  204

Query  477   HGGKYPVNYNYAPFVASMGRVELEGC----------TNSSSDCTRRSPSTSSLEGEGFVK  328
              GGK+  NY YAPFVA      L GC          ++S  DC   + S   L    F  
Sbjct  205   SGGKFKANYKYAPFVADFKSFSLHGCAVDPIQQLPGSDSDPDC---ADSDDLLRSSDFST  261

Query  327   LTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
             +T  Q S ++  R  +M+YSYC D  RY     EC
Sbjct  262   ITPHQRSAMRRFRQHYMYYSYCYDSVRYPEPLPEC  296



>ref|XP_002465580.1| hypothetical protein SORBIDRAFT_01g041510 [Sorghum bicolor]
 gb|EER92578.1| hypothetical protein SORBIDRAFT_01g041510 [Sorghum bicolor]
Length=341

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 167/266 (63%), Gaps = 9/266 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N+ L   G    + LD+ +G G  S+  Y +G F+A IKLPA  T+GVVV
Sbjct  43   EGYTQLFGDSNLALHGGGKRVHISLDERTGAGFASQAAYLHGSFSARIKLPADHTAGVVV  102

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ L FDPT+  
Sbjct  103  AFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAVGREERYGLPFDPTEDF  162

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+I W+ H I+F VD+ P+REVV   A+   +PSKPMS+Y TIWDGS WAT GG+Y V
Sbjct  163  HRYAIHWSRHRIIFYVDDTPIREVVRTEAMGAQFPSKPMSLYATIWDGSSWATSGGRYKV  222

Query  456  NYNYAPFVASMGRVELEGCT---NSSSDCTRRSPSTSSLEGEGFVK----LTQQQISGLQ  298
            +Y YAP+VA    + L GC     S+S C   +P ++S + + + +    ++  + S ++
Sbjct  223  DYKYAPYVAEFADLALRGCAVGPASASACA--TPGSASDDDDAYGRAADAISPARRSAME  280

Query  297  WARGKHMFYSYCKDKARYKVLPLECT  220
              R ++M Y YC D+ RY     EC+
Sbjct  281  AFRARYMTYGYCYDRLRYPAPLPECS  306



>ref|XP_003561836.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Brachypodium distachyon]
Length=328

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 164/258 (64%), Gaps = 7/258 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY  L+G  N++L  +G    + LD+ +G G  S+  Y +GFF+A IKLP+ + +GVVV
Sbjct  46   EGYTQLFGDSNLRLHGDGKRVHISLDERTGAGFASQGAYLHGFFSARIKLPSDYAAGVVV  105

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYM+N DVY   HDE+D E LG  + ++W +QTN+Y +GS   GREE++ L FDPTQ  
Sbjct  106  AFYMTNGDVYEKTHDELDFEFLGNVRGKEWRVQTNVYGDGSTSVGREERYGLPFDPTQDY  165

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H Y+ILW +  I+F VD  P+REVV + A+   +PSKPMS+Y TIWDGS WAT GG+Y V
Sbjct  166  HRYAILWTNRTIVFYVDETPIREVVRSEAMGLQFPSKPMSLYATIWDGSSWATSGGRYKV  225

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            +Y YAP+VA    + L GC +SSS       ST + E      +   + S ++  R +H+
Sbjct  226  DYKYAPYVAEFDDLLLRGCASSSS-------STGACELPEEDYMDSGERSAMERFRARHL  278

Query  276  FYSYCKDKARYKVLPLEC  223
             Y YC D+ARY     EC
Sbjct  279  TYGYCYDRARYPAPLSEC  296



>ref|XP_002973430.1| hypothetical protein SELMODRAFT_56616, partial [Selaginella moellendorffii]
 gb|EFJ25804.1| hypothetical protein SELMODRAFT_56616, partial [Selaginella moellendorffii]
Length=254

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 167/260 (64%), Gaps = 10/260 (4%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            + Y++L+G  N     +G S  LVLD+ SG G  SK+ +  GFF+A+IKLP+ +T+GVV 
Sbjct  3    DAYSILWGHSNANELEDGKSIQLVLDRHSGSGFKSKEAFQGGFFSASIKLPSNYTAGVVT  62

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN D +P  HDEID E LG      +VLQTN+Y NGSV+TGREE+  LWFDP+   
Sbjct  63   AFYASNSDKFPDRHDEIDFEFLGVVPGMPYVLQTNVYGNGSVRTGREERIRLWFDPSLEF  122

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YS+ WN HHI+F VD++P+R+++        YP KPMSV  TIWDGS WAT GGK+PV
Sbjct  123  HRYSVFWNQHHIVFFVDDVPIRQMIKTKEAED-YPCKPMSVLATIWDGSNWATSGGKFPV  181

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGE-GFVKLTQQQISGLQWARGKH  280
            +YN APFVAS   ++L   ++  S   R S      EGE G   L+  Q S L W R K 
Sbjct  182  DYNRAPFVASFTGLKLFRDSSVYSINYRIS------EGEFGKQGLSGTQKSRLAWVRRKF  235

Query  279  MFYSYCKDKARY-KVLPLEC  223
            + YSYC DK RY K LP EC
Sbjct  236  LSYSYCNDKMRYPKPLP-EC  254



>ref|XP_009417676.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=341

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 173/264 (66%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            +GY  L+G  N+ L  +G    + LD+ +G G  S+D Y +GFF+A+IKLP+ + +GVVV
Sbjct  43   QGYTQLFGDGNLMLLRDGKRVHISLDERTGAGFASQDLYLHGFFSASIKLPSDYAAGVVV  102

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFYMSN DVY   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ LWFDPT+  
Sbjct  103  AFYMSNGDVYAKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYDLWFDPTEDF  162

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSI+WN   I+F +DNIP+RE+V   AI   +PSKPM++Y TIWDGS WAT GG+Y V
Sbjct  163  HQYSIIWNHERIIFSIDNIPIREIVRTGAIGGCFPSKPMTLYATIWDGSTWATSGGRYKV  222

Query  456  NYNYAPFVASMGRVELEGCT----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWAR  289
            NY YAP+VA    + + GC     + SSDC +  P T+  +    + ++ +Q + +   R
Sbjct  223  NYKYAPYVAEFEDLIIGGCAVNPMDHSSDCEK--PDTAISDS---LTMSLEQQALMDRFR  277

Query  288  GKHMFYSYCKDKARYKVLPLECTA  217
             +HM Y YC D+ RY + P EC A
Sbjct  278  RRHMTYYYCYDRDRYPIPPPECNA  301



>ref|XP_002976477.1| hypothetical protein SELMODRAFT_56624, partial [Selaginella moellendorffii]
 gb|EFJ22146.1| hypothetical protein SELMODRAFT_56624, partial [Selaginella moellendorffii]
Length=254

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 165/257 (64%), Gaps = 8/257 (3%)
 Frame = -1

Query  990  YNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAF  811
            Y++L+G  N     +G S  LVLD+ SG G  SK+ +  GFF+A+IKLP+ +T+GVV AF
Sbjct  5    YSILWGHSNANELEDGKSIQLVLDRHSGSGFKSKEAFQGGFFSASIKLPSNYTAGVVTAF  64

Query  810  YMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQASHD  631
            Y SN D +P  HDEID E LG      +VLQTN+Y NGSV+TGREE+  LWFDP+   H 
Sbjct  65   YASNSDKFPDKHDEIDFEFLGVVPGMPYVLQTNVYGNGSVRTGREERIRLWFDPSLEFHR  124

Query  630  YSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNY  451
            YS+LWN HHI+F VD++P+R+++        YP KPMSV  TIWDGS WAT GGK+PV+Y
Sbjct  125  YSVLWNQHHIVFFVDDVPIRQMIKTKEAED-YPWKPMSVLATIWDGSNWATSGGKFPVDY  183

Query  450  NYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHMFY  271
            N APFVAS   ++L   ++  S   R S +    +G     L   Q S L W R K + Y
Sbjct  184  NRAPFVASFTNLKLFRDSSVYSINDRISEAEFGKQG-----LRGTQKSRLAWVRRKFLSY  238

Query  270  SYCKDKARY-KVLPLEC  223
            +YC DK RY K LP EC
Sbjct  239  TYCNDKMRYPKPLP-EC  254



>ref|XP_009384131.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Musa acuminata subsp. malaccensis]
Length=335

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 173/277 (62%), Gaps = 8/277 (3%)
 Frame = -1

Query  1029  LTDRFTQTGV--SEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAA  856
             +T  F  T V   EG++ L+G  N+   ++G +A L L++ SG G VS D Y++GFF+A+
Sbjct  16    VTAAFDVTAVPFDEGFSHLFGNDNLVRSSDGRTAHLSLNRYSGSGFVSNDMYHHGFFSAS  75

Query  855   IKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGRE  676
             IKLP+ +T+GVVVAFY SN D++   HDE+D E LG  + +DW +QTN+Y NGS   GRE
Sbjct  76    IKLPSDYTAGVVVAFYTSNGDLFEKTHDELDFEFLGNVRGKDWRIQTNVYGNGSTSRGRE  135

Query  675   EKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWD  496
             E++ L FDPT  +H YSILW S  I+F VD+ P+REVV + A+   YPSKPMSVY TIWD
Sbjct  136   ERYVLPFDPTAEAHRYSILWTSQLIIFYVDDTPIREVVRSDAMGGDYPSKPMSVYATIWD  195

Query  495   GSEWATHGGKYPVNYNYAPFVASMGRVELEGCTN------SSSDCTRRSPSTSSLEGEGF  334
             GS WAT  GKY VNY Y PFV+    + L GC         S+   R + +   L    F
Sbjct  196   GSTWATGNGKYKVNYKYEPFVSDFSDLVLRGCRADPIQQVDSAAARRCAEANDELLAADF  255

Query  333   VKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLEC  223
               +T ++ + ++  R ++M YS C D  RY V   +C
Sbjct  256   ALMTPKKRAAMRRFRERYMTYSCCYDTNRYPVAFPDC  292



>emb|CDX78912.1| BnaA01g09790D [Brassica napus]
Length=339

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 166/259 (64%), Gaps = 1/259 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EG + L+G  N+    +  S  L+LDK +G G +S + Y +GFF++ IKLP  +T+G+VV
Sbjct  42   EGLSHLFGESNLIRSPDDRSVRLLLDKYTGSGFISSNMYQHGFFSSLIKLPGAYTAGLVV  101

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+  NHDE+DIE LG  + + W  QTN+Y NGS   GREE++ LWFDP++  
Sbjct  102  AFYTSNGDVFVKNHDELDIEFLGNVEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSKEF  161

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILWN   I+F VD++P+RE++    +   YP KPMS+Y TIWD S WAT GGK+ V
Sbjct  162  HRYSILWNPTKIIFWVDDVPIREIIRKEEMKGDYPQKPMSLYATIWDASSWATSGGKFGV  221

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            +Y ++PFV+    V L+GC N S      + +T  L    +  ++ +Q + ++  R ++M
Sbjct  222  DYAFSPFVSEFKDVALDGC-NVSDSFPNNNNNTVDLMASDYSTISPKQAAAMRRFRERYM  280

Query  276  FYSYCKDKARYKVLPLECT  220
            +YSYC D  RY V P EC 
Sbjct  281  YYSYCYDTVRYAVPPPECV  299



>ref|XP_004245964.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Solanum lycopersicum]
Length=372

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/264 (45%), Positives = 172/264 (65%), Gaps = 9/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EGY+ L+   NI+   +  S  L+L+K SG G++S + Y YGFF+A+IKLPA +T+G+VV
Sbjct  48   EGYSPLFSDFNIERSPDDRSFRLLLNKFSGSGVISTEYYNYGFFSASIKLPAIYTAGIVV  107

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN D +  NHDE+DIE LG    + W  QTN+Y NGSV  GREE++ +WFDP++  
Sbjct  108  AFYTSNADTFEKNHDELDIEFLGNVNGQPWRFQTNMYGNGSVSRGREERYRMWFDPSKDF  167

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW   +I+F +D  P+RE+  + A+   +P+KPM++Y TIWD S WAT+GGK  V
Sbjct  168  HQYSILWTPKNIIFYIDETPLREINRHPAMGGDFPAKPMALYATIWDASSWATNGGKAKV  227

Query  456  NYNYAPFVASMGRVELEGCTNS------SSDCTRRSPSTSSLEGEGFVKLTQQQISGLQW  295
            +Y Y PF   +  + LEGC         S++CT R+   + L  + +  +T ++ + +++
Sbjct  228  DYKYEPFATELKDLVLEGCIVDPSEQIPSTNCTDRN---AKLLAQDYSNITPERRNNMKF  284

Query  294  ARGKHMFYSYCKDKARYKVLPLEC  223
             R ++M+YSYC D  RY V P EC
Sbjct  285  FRERYMYYSYCYDNLRYPVPPPEC  308



>ref|XP_008238168.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Prunus mume]
Length=362

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 184/305 (60%), Gaps = 19/305 (6%)
 Frame = -1

Query  1107  LILSMVVIITKVSARGPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADL  928
             LI+S ++I   ++  G      +VD      T    ++GY+ L+G  N+    +G    L
Sbjct  22    LIISFLIIFMCMANIG------NVDAAFSNLTTIPFNQGYSPLFGDGNLVRSPDGKGVRL  75

Query  927   VLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLG  748
             +LD+ +G G +S + Y +GFF+A IKLP+ +T+G+ VAFY SN DV+  +HDE+DIE LG
Sbjct  76    LLDRFTGSGFISSNLYNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKSHDELDIEFLG  135

Query  747   YDKRRDWVLQTNLYCNGSVKTGR---EEKFYLWFDPTQASHDYSILWNSHHILFLVDNIP  577
               + + W  QTN+Y NGS   GR   +E++ LWFDPT+  H YSILW     +F VD++P
Sbjct  136   NTEGKPWRFQTNVYGNGSTNRGRPRRKERYRLWFDPTRDFHRYSILWTPQITIFYVDDVP  195

Query  576   VREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCT  397
             +REVV    +   YPSKPMS+Y TIWD S WAT GGKY VNY YAPFVA    + L+GC 
Sbjct  196   IREVVRREEMGGDYPSKPMSLYTTIWDASNWATSGGKYKVNYKYAPFVAEFKDLVLDGC-  254

Query  396   NSSSDCTRRSPSTSS-------LEGEGFVKLTQQQISGLQWARGKHMFYSYCKDKARYKV  238
                +D  ++ P+  +       L  + +  +T Q+ + ++  R ++M+YSYC D  RY V
Sbjct  255   --PADPIQQVPAAEACAEKYALLATQDYSVITPQRRAAVRRFRQRYMYYSYCYDSLRYPV  312

Query  237   LPLEC  223
              P EC
Sbjct  313   PPPEC  317



>ref|XP_009401243.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Musa acuminata subsp. malaccensis]
Length=338

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 169/268 (63%), Gaps = 4/268 (1%)
 Frame = -1

Query  1014  TQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGF  835
             T     EG+  L+G  N+    +G SA L+L++ SG G +S D Y +GFF+A+IKLP+ +
Sbjct  27    TTLPFDEGFCHLFGDDNLVRSPDGRSARLILNRYSGSGFISNDLYDHGFFSASIKLPSDY  86

Query  834   TSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWF  655
             T+GVVVAFY SN D++   HDE+D E LG  + R+W +QTN+Y NGS   GREE++ L F
Sbjct  87    TAGVVVAFYTSNGDIFEKTHDELDFEFLGNTRGREWRIQTNVYGNGSTSRGREERYLLPF  146

Query  654   DPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATH  475
             DPT  +H YSILW S  I+F +D+ P+REVV + A+   YPSKPMSVY TIWDGS WAT 
Sbjct  147   DPTVEAHRYSILWTSDFIIFYIDDTPIREVVRSDAMGGDYPSKPMSVYATIWDGSTWATG  206

Query  474   GGKYPVNYNYAPFVASMGRVELEGCTNS---SSDCTRR-SPSTSSLEGEGFVKLTQQQIS  307
              GKY VNY YAPFV+    + L GC        D  RR + +   L    F  +T ++ +
Sbjct  207   NGKYKVNYKYAPFVSDFSDLVLRGCRVDPIQQPDSARRCAEANEDLLTADFAVMTPKKRA  266

Query  306   GLQWARGKHMFYSYCKDKARYKVLPLEC  223
              ++  R ++M Y++C D  RY +   +C
Sbjct  267   AMRRFRERYMTYAFCYDTNRYPLTFPDC  294



>emb|CDX99402.1| BnaC01g11500D [Brassica napus]
Length=340

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 165/259 (64%), Gaps = 0/259 (0%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            EG + L+G  N+    +  S  L+LDK +G G +S + Y +GFF++ IKLP  +T+G+VV
Sbjct  42   EGLSHLFGESNLIRSPDDRSVRLLLDKYTGSGFISSNMYQHGFFSSLIKLPGAYTAGLVV  101

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  + + W  QTN+Y NGS   GREE++ LWFDP++  
Sbjct  102  AFYTSNGDVFVKTHDELDIEFLGNVEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSKEF  161

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILWN   I+F VD++P+RE++    +   YP KPMS+Y TIWD S WAT GGK+ V
Sbjct  162  HRYSILWNPTKIIFWVDDVPIREIIRKEEMKGDYPQKPMSLYATIWDASSWATSGGKFGV  221

Query  456  NYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWARGKHM  277
            +Y ++PFV+    V L+GC  S S     + +T  L    +  ++ +Q + ++  R ++M
Sbjct  222  DYAFSPFVSEFKDVALDGCNVSDSFPNNNNNNTVDLMTSDYSTISPKQAAAMRRFRERYM  281

Query  276  FYSYCKDKARYKVLPLECT  220
            +YSYC D  RY V P EC 
Sbjct  282  YYSYCYDTVRYAVPPPECV  300



>gb|AGT17403.1| hypothetical protein SHCRBa_230_N09_R_40 [Saccharum hybrid cultivar 
R570]
Length=333

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/284 (43%), Positives = 167/284 (59%), Gaps = 14/284 (5%)
 Frame = -1

Query  1062  GPIYTPPSVDRLTDRFTQTGVSEGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDR  883
             G +  PP    L+         EGY  L+G  N+ L   G    + LD+ +G G      
Sbjct  26    GKLLPPPETPSLS-------FGEGYTQLFGDSNLALHGGGKRVHISLDERTGAGFA----  74

Query  882   YYYGFFNAAIKLPAGFTSGVVVAFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYC  703
             Y +G F+A IKLPA  T+GVVVAFYMSN DVY   HDE+D E LG  + R+W +QTN+Y 
Sbjct  75    YLHGHFSARIKLPADHTAGVVVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYG  134

Query  702   NGSVKTGREEKFYLWFDPTQASHDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKP  523
             NGS   GREE++ LWFDPT+  H Y+I W+ H I+F VD+ P+REVV   A+   +PSKP
Sbjct  135   NGSTAVGREERYGLWFDPTEDFHRYAIHWSRHRIIFYVDDTPIREVVRTEAMGAQFPSKP  194

Query  522   MSVYVTIWDGSEWATHGGKYPVNYNYAPFVASMGRVELEGCTNSSSDCTRRSPSTSSLEG  343
             MS+Y TIWDGS WAT GG+Y V+Y YAP+VA    + L GC    +  T  +   S+ + 
Sbjct  195   MSLYATIWDGSSWATSGGRYKVDYKYAPYVAEFADLALRGCAVGPASATACATPGSASDD  254

Query  342   EGF---VKLTQQQISGLQWARGKHMFYSYCKDKARYKVLPLECT  220
             + +     ++  + S ++  R ++M Y YC D+ RY     EC+
Sbjct  255   DAYGHAAAISPARRSAMEAFRARYMTYGYCYDRLRYPAPLPECS  298



>gb|AAM67311.1| endoxyloglucan transferase, putative [Arabidopsis thaliana]
Length=343

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 163/264 (62%), Gaps = 8/264 (3%)
 Frame = -1

Query  996  EGYNVLYGGHNIQLKNNGSSADLVLDKSSGCGLVSKDRYYYGFFNAAIKLPAGFTSGVVV  817
            E  + L+G  N+    +  S  L+LD+ +G G +S + Y +GF+++ IKLPA +T+GVVV
Sbjct  34   ESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVV  93

Query  816  AFYMSNQDVYPHNHDEIDIELLGYDKRRDWVLQTNLYCNGSVKTGREEKFYLWFDPTQAS  637
            AFY SN DV+   HDE+DIE LG  K + W  QTNLY NGS   GREE++ LWFDP++  
Sbjct  94   AFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEF  153

Query  636  HDYSILWNSHHILFLVDNIPVREVVNNAAISTVYPSKPMSVYVTIWDGSEWATHGGKYPV  457
            H YSILW  H I+F VD++P+REV+ N A+   YP+KPM++Y TIWD  +WAT GGKY  
Sbjct  154  HRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMALYATIWDAFDWATSGGKYKA  213

Query  456  NYNYAPFVASMGRVELEGCT-----NSSSDCTRRSPSTSSLEGEGFVKLTQQQISGLQWA  292
            NY +APFVA      L+GC+         DC   S S   LE + +  +   Q + ++  
Sbjct  214  NYKFAPFVAEFKSFSLDGCSVDPIQEVPMDC---SDSVDFLESQDYSSINSHQRAAMRRF  270

Query  291  RGKHMFYSYCKDKARYKVLPLECT  220
            R + M+YSYC D  RY     EC 
Sbjct  271  RQRFMYYSYCYDTLRYPEPLPECV  294



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2905088742028