BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c66089_g1_i1 len=120 path=[1:0-119]

Length=120
                                                                      Score     E

ref|WP_009640328.1|  dihydroorotase                                   85.9    9e-19   
dbj|GAE79101.1|  dihydroorotase                                       85.1    1e-18   
gb|EFT02237.1|  dihydroorotase                                        85.5    2e-18   
ref|WP_002536983.1|  MULTISPECIES: dihydroorotase                     85.9    2e-18   
ref|WP_013069507.1|  dihydroorotase                                   85.9    2e-18   
ref|WP_002520469.1|  MULTISPECIES: dihydroorotase                     85.9    2e-18   
ref|WP_002547280.1|  dihydroorotase                                   85.9    2e-18   
ref|WP_002525001.1|  dihydroorotase                                   85.9    2e-18   
ref|WP_002513720.1|  MULTISPECIES: dihydroorotase                     85.9    2e-18   
dbj|GAE67047.1|  dihydroorotase                                       85.9    2e-18   
ref|WP_002544504.1|  dihydroorotase                                   85.9    2e-18   
ref|WP_002531413.1|  MULTISPECIES: dihydroorotase                     85.9    2e-18   
ref|WP_024513557.1|  dihydroorotase                                   85.9    2e-18   
ref|WP_002533084.1|  dihydroorotase                                   85.9    2e-18   
ref|WP_002517994.1|  dihydroorotase                                   85.9    3e-18   
ref|WP_002515650.1|  MULTISPECIES: dihydroorotase                     85.9    3e-18   
ref|WP_002539278.1|  dihydroorotase                                   85.9    3e-18   
ref|WP_002548524.1|  dihydroorotase                                   84.0    1e-17   
ref|WP_002527383.1|  dihydroorotase                                   84.0    1e-17   
ref|WP_014166918.1|  dihydroorotase                                   82.4    4e-17   
ref|WP_015582838.1|  dihydroorotase                                   77.8    2e-15   
ref|WP_023032625.1|  MULTISPECIES: hypothetical protein               77.8    2e-15   
ref|WP_016667485.1|  dihydroorotase                                   77.8    2e-15   
ref|WP_004811599.1|  MULTISPECIES: dihydroorotase                     77.8    2e-15   
ref|WP_036924238.1|  dihydroorotase                                   74.3    3e-14   
ref|WP_036981445.1|  dihydroorotase                                   73.6    7e-14   
ref|WP_015070226.1|  Dihydroorotase                                   70.9    5e-13   
ref|WP_036938455.1|  dihydroorotase                                   70.9    6e-13   
ref|WP_021105491.1|  Dihydroorotase                                   66.2    2e-11   
ref|WP_023035463.1|  hypothetical protein                             66.2    2e-11   
ref|WP_021103195.1|  Dihydroorotase                                   66.2    2e-11   
ref|WP_022796957.1|  dihydroorotase                                   62.0    9e-10   
gb|EGF34128.1|  dihydroorotase                                        56.6    5e-09   
ref|WP_017796606.1|  dihydroorotase                                   58.2    2e-08   
ref|WP_025904584.1|  dihydroorotase                                   57.4    4e-08   
ref|WP_017000573.1|  dihydroorotase                                   57.4    4e-08   
ref|WP_037587563.1|  dihydroorotase                                   57.0    4e-08   
ref|WP_016911060.1|  hypothetical protein                             57.0    4e-08   
ref|WP_008463109.1|  dihydroorotase                                   56.6    7e-08   
ref|WP_009558384.1|  dihydroorotase                                   56.6    7e-08   
ref|WP_003615098.1|  dihydroorotase                                   56.6    7e-08   
ref|WP_016396658.1|  dihydroorotase                                   56.6    7e-08   
ref|WP_003619711.1|  dihydroorotase                                   56.6    7e-08   
ref|WP_013439522.1|  dihydroorotase                                   56.6    7e-08   
ref|WP_003614861.1|  dihydroorotase                                   56.2    8e-08   
ref|WP_035164888.1|  dihydroorotase                                   56.2    8e-08   
ref|WP_035161098.1|  dihydroorotase                                   56.2    8e-08   
gb|ETC92978.1|  hypothetical protein T481_03770                       54.3    8e-08   
ref|WP_005879673.1|  dihydroorotase                                   55.8    1e-07   
ref|WP_002350636.1|  dihydroorotase                                   55.8    1e-07   
ref|WP_010751021.1|  dihydroorotase                                   55.8    1e-07   
ref|WP_010719214.1|  dihydroorotase                                   55.8    1e-07   
ref|WP_034697867.1|  dihydroorotase                                   55.8    1e-07   
ref|WP_010737536.1|  MULTISPECIES: dihydroorotase                     55.8    1e-07   
ref|WP_016381534.1|  dihydroorotase                                   53.1    1e-07   
ref|WP_018369158.1|  hypothetical protein                             55.5    2e-07   
ref|WP_014116558.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_029377531.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_038678328.1|  dihydroorotase                                   55.5    2e-07   
gb|EOH56355.1|  dihydroorotase                                        55.5    2e-07   
ref|WP_002372430.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_024635173.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_002335695.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_019902308.1|  dihydroorotase                                   53.1    2e-07   
ref|WP_002315061.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_002329183.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_010722511.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_002344205.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_002313786.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_002309322.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_010724050.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_002345918.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_002327924.1|  dihydroorotase                                   55.5    2e-07   
ref|WP_002288875.1|  MULTISPECIES: dihydroorotase                     55.1    2e-07   
ref|WP_010722790.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_002318756.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_002339315.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_002327046.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_010728367.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_002323286.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_002306761.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_019723657.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_034688203.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_010735515.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_016620156.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_010748373.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_016609311.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_015509725.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_005226117.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_016611753.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_005235986.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_010488291.1|  dihydroorotase                                   55.1    2e-07   
ref|WP_015694872.1|  dihydroorotase                                   55.1    3e-07   
ref|WP_029328401.1|  dihydroorotase                                   54.3    3e-07   
ref|WP_035239745.1|  dihydroorotase                                   55.1    3e-07   
ref|WP_016424847.1|  dihydroorotase                                   54.7    3e-07   
ref|WP_016370758.1|  dihydroorotase                                   52.4    3e-07   
ref|WP_022079789.1|  dihydroorotase                                   54.7    3e-07   
ref|WP_038560014.1|  dihydroorotase                                   54.7    3e-07   
ref|WP_016176696.1|  dihydroorotase                                   54.7    3e-07   
ref|WP_035406840.1|  dihydroorotase                                   54.7    3e-07   
ref|WP_010780777.1|  dihydroorotase                                   54.7    3e-07   
ref|WP_024305608.1|  dihydroorotase                                   54.7    4e-07   
ref|WP_019469329.1|  dihydroorotase                                   54.7    4e-07   
ref|WP_002507918.1|  MULTISPECIES: dihydroorotase                     54.7    4e-07   
ref|WP_021338703.1|  dihydroorotase                                   54.7    4e-07   
ref|WP_023468787.1|  MULTISPECIES: dihydroorotase                     54.7    4e-07   
ref|WP_025896388.1|  dihydroorotase                                   54.7    4e-07   
ref|WP_029342126.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_016171983.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_026827949.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010815991.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002405691.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_033625714.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010830260.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010707524.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002407807.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_005685855.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_024041785.1|  Dihydroorotase                                   54.3    4e-07   
ref|WP_010773742.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010820863.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010819415.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010717329.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002379495.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002364044.1|  MULTISPECIES: dihydroorotase                     54.3    4e-07   
gb|KHJ56862.1|  dihydroorotase                                        54.3    4e-07   
ref|WP_029607192.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_005710474.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_014569648.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_005689381.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002357412.1|  MULTISPECIES: dihydroorotase                     54.3    4e-07   
ref|WP_010828229.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010827467.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010817937.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002393366.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002366770.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_016616871.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_016618342.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010713358.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002420140.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_016626636.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010715248.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_014862181.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010753750.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_010816556.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002394498.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_002480618.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_029888221.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_033601002.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_033571329.1|  dihydroorotase                                   54.3    4e-07   
ref|WP_007208294.1|  dihydroorotase                                   54.3    5e-07   
gb|KGY36229.1|  dihydroorotase                                        54.3    5e-07   
ref|WP_025787524.1|  dihydroorotase                                   53.9    5e-07   
ref|WP_002510927.1|  MULTISPECIES: dihydroorotase                     53.9    6e-07   
emb|CEI84367.1|  Dihydroorotase                                       53.9    6e-07   
ref|WP_016185463.1|  dihydroorotase                                   53.9    6e-07   
ref|WP_002455449.1|  dihydroorotase                                   53.9    6e-07   
ref|WP_002448747.1|  dihydroorotase                                   53.9    6e-07   
ref|WP_002879172.1|  dihydroorotase                                   53.9    6e-07   
ref|WP_010772397.1|  dihydroorotase                                   53.9    6e-07   
ref|WP_017174558.1|  MULTISPECIES: dihydroorotase                     53.9    6e-07   
ref|WP_025869031.1|  dihydroorotase                                   53.9    7e-07   
ref|WP_028105985.1|  dihydroorotase                                   53.9    7e-07   
ref|WP_035184401.1|  dihydroorotase                                   53.9    7e-07   
ref|WP_010761465.1|  dihydroorotase                                   53.9    7e-07   
ref|WP_026832573.1|  dihydroorotase                                   53.9    7e-07   
ref|WP_037552351.1|  dihydroorotase                                   53.5    7e-07   
ref|WP_010765033.1|  dihydroorotase                                   53.5    7e-07   
ref|WP_037536299.1|  dihydroorotase                                   53.5    7e-07   
ref|WP_037545901.1|  dihydroorotase                                   53.5    7e-07   
ref|WP_002459345.1|  dihydroorotase                                   53.5    7e-07   
ref|WP_011275998.1|  MULTISPECIES: dihydroorotase                     53.5    7e-07   
ref|WP_023606248.1|  dihydroorotase                                   53.5    7e-07   
ref|WP_010744829.1|  dihydroorotase                                   53.5    7e-07   
ref|WP_002493090.1|  dihydroorotase                                   53.5    7e-07   
ref|WP_008379867.1|  dihydroorotase                                   53.5    8e-07   
ref|WP_015900067.1|  dihydroorotase                                   53.5    8e-07   
ref|WP_033193764.1|  dihydroorotase                                   53.5    8e-07   
ref|WP_034877146.1|  dihydroorotase                                   53.5    8e-07   
ref|WP_010739183.1|  dihydroorotase                                   53.5    8e-07   
ref|WP_016180208.1|  dihydroorotase                                   53.5    8e-07   
ref|WP_013774048.1|  dihydroorotase                                   53.5    8e-07   
ref|WP_019165550.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_015729004.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_037544242.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_014614156.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_039838273.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_027963126.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_002456590.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_002485025.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_011303313.1|  dihydroorotase                                   53.1    9e-07   
ref|WP_001830129.1|  MULTISPECIES: dihydroorotase                     53.1    9e-07   
ref|WP_021984962.1|  dihydroorotase                                   53.5    9e-07   
ref|WP_002483527.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_016371260.1|  dihydroorotase                                   52.8    1e-06   
ref|WP_039066836.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_017724230.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_034530953.1|  dihydroorotase                                   53.1    1e-06   
gb|AID43043.1|  Dihydroorotase                                        53.1    1e-06   
ref|WP_003594504.1|  MULTISPECIES: dihydroorotase                     53.1    1e-06   
ref|WP_011065890.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_034534052.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_003602305.1|  MULTISPECIES: dihydroorotase                     53.1    1e-06   
ref|WP_013489160.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_015904630.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_016625171.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_009765571.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_016182717.1|  dihydroorotase                                   53.1    1e-06   
gb|EPC50664.1|  dihydroorotase                                        52.8    1e-06   
ref|WP_016363374.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_016369441.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_003579187.1|  MULTISPECIES: dihydroorotase                     53.1    1e-06   
ref|WP_010767674.1|  dihydroorotase                                   53.1    1e-06   
ref|WP_003575120.1|  MULTISPECIES: dihydroorotase                     52.8    1e-06   
ref|WP_016379713.1|  dihydroorotase                                   52.8    1e-06   
ref|WP_013245745.1|  MULTISPECIES: dihydroorotase                     52.8    1e-06   
ref|WP_015454939.1|  Dihydroorotase                                   52.0    1e-06   
gb|EPC70586.1|  dihydroorotase                                        52.8    1e-06   
ref|WP_039232019.1|  dihydroorotase                                   52.8    1e-06   
ref|WP_016363934.1|  dihydroorotase                                   52.4    1e-06   
ref|WP_016837483.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_000767026.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_019887399.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_039041874.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_001824134.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_017186654.1|  hypothetical protein                             52.8    2e-06   
ref|WP_020587576.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_031907270.1|  dihydroorotase                                   52.8    2e-06   
gb|KIG07304.1|  Dihydroorotase                                        52.8    2e-06   
gb|EVC50041.1|  dihydroorotase                                        52.8    2e-06   
ref|WP_003598753.1|  MULTISPECIES: dihydroorotase                     52.8    2e-06   
ref|WP_016372633.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_003605160.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_006366653.1|  dihydroorotase                                   52.8    2e-06   
ref|WP_022156361.1|  dihydroorotase                                   52.4    2e-06   
gb|KIG08732.1|  Dihydroorotase                                        52.8    2e-06   
gb|EFM06160.1|  putative dihydroorotase                               52.0    2e-06   
ref|WP_032090439.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_025598899.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_003565520.1|  MULTISPECIES: dihydroorotase                     52.4    2e-06   
ref|WP_025012375.1|  MULTISPECIES: dihydroorotase                     52.4    2e-06   
ref|WP_002464927.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767032.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031899697.1|  dihydroorotase                                   52.4    2e-06   
emb|CDR58352.1|  dihydroorotase                                       52.4    2e-06   
ref|WP_000767024.1|  dihydroorotase                                   52.4    2e-06   
emb|CDR53739.1|  dihydroorotase                                       52.4    2e-06   
gb|EVZ25734.1|  dihydroorotase                                        52.4    2e-06   
gb|EIK06530.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_031845117.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767036.1|  dihydroorotase                                   52.4    2e-06   
gb|EFU24480.1|  dihydroorotase                                        52.4    2e-06   
gb|EYP55981.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_031870445.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767033.1|  dihydroorotase                                   52.4    2e-06   
gb|KDP62394.1|  dihydroorotase                                        52.4    2e-06   
gb|KAG38815.1|  dihydroorotase                                        52.4    2e-06   
gb|EVU66657.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_031928030.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031927418.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031918523.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031909240.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031906788.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031789720.1|  dihydroorotase                                   52.4    2e-06   
gb|EFB50238.1|  dihydroorotase                                        52.4    2e-06   Staphylococcus aureus subsp. aureus D139
ref|WP_000767022.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767030.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767018.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767028.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_025174215.1|  dihydroorotase                                   52.4    2e-06   
gb|EZI08604.1|  dihydroorotase                                        52.4    2e-06   
gb|EXN69577.1|  dihydroorotase                                        52.4    2e-06   
gb|EWM98090.1|  dihydroorotase                                        52.4    2e-06   
gb|EUR21725.1|  dihydroorotase                                        52.4    2e-06   
gb|ENI85083.1|  dihydroorotase                                        52.4    2e-06   
gb|EHM59874.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_014533102.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_001805075.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767029.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031906401.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031888179.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031860470.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031811512.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031784605.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767025.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_003126611.1|  dihydroorotase                                   52.4    2e-06   
emb|CEH25937.1|  Dihydroorotase                                       52.4    2e-06   
ref|WP_025173904.1|  dihydroorotase                                   52.4    2e-06   
gb|EYR08678.1|  dihydroorotase                                        52.4    2e-06   
gb|EYQ41046.1|  dihydroorotase                                        52.4    2e-06   
gb|EWI65730.1|  dihydroorotase                                        52.4    2e-06   
gb|EWB79003.1|  dihydroorotase                                        52.4    2e-06   
gb|EVU28116.1|  dihydroorotase                                        52.4    2e-06   
gb|EVD26084.1|  dihydroorotase                                        52.4    2e-06   
gb|EUJ85723.1|  dihydroorotase                                        52.4    2e-06   
gb|ETD14815.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_015581823.1|  Dihydroorotase                                   52.4    2e-06   
ref|WP_001622408.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_001792642.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_001643395.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_001548511.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031929654.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031922021.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031769281.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031764401.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767035.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_005473168.1|  dihydroorotase                                   52.4    2e-06   
gb|EHM82514.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_000767021.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767031.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_020977182.1|  dihydroorotase PyrC                              52.4    2e-06   
ref|WP_001566027.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_003590837.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_033532930.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031929824.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031929577.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031790877.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767020.1|  dihydroorotase                                   52.4    2e-06   
gb|EYM95894.1|  dihydroorotase                                        52.4    2e-06   
gb|ETD08458.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_003725669.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031644840.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031921439.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_014929994.1|  dihydroorotase                                   52.4    2e-06   
gb|EHY62170.1|  Dihydroorotase                                        52.4    2e-06   
gb|EFR87336.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_012681353.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031695244.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031670152.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031665090.1|  dihydroorotase                                   52.4    2e-06   
emb|CDR63276.1|  dihydroorotase                                       52.4    2e-06   
ref|WP_001807809.1|  dihydroorotase                                   52.4    2e-06   
gb|KAI61104.1|  dihydroorotase                                        52.4    2e-06   
gb|EXL19650.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_023548681.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_003769315.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031627532.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031646082.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_012581111.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_011702626.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_022466239.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031645627.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767027.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_029486819.1|  dihydroorotase                                   52.4    2e-06   
gb|EGA99922.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_010991678.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_003767462.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_012951791.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_033918456.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_000767034.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_003723081.1|  dihydroorotase                                   52.4    2e-06   
gb|KAI83025.1|  dihydroorotase                                        52.4    2e-06   
gb|EZZ71739.1|  dihydroorotase                                        52.4    2e-06   
emb|CDR60274.1|  dihydroorotase                                       52.4    2e-06   
gb|KEX85822.1|  dihydroorotase                                        52.4    2e-06   
ref|WP_003729513.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_033859499.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031912033.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_011524948.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_002450607.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_031694525.1|  dihydroorotase                                   52.4    2e-06   
emb|CDR65479.1|  dihydroorotase                                       52.4    2e-06   
emb|CDR24203.1|  dihydroorotase                                       52.4    2e-06   
emb|CDR51640.1|  dihydroorotase                                       52.4    2e-06   
ref|WP_017637154.1|  MULTISPECIES: dihydroorotase                     52.4    2e-06   
ref|WP_003748449.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_023375139.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_017464309.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_012985979.1|  dihydroorotase                                   52.4    2e-06   
ref|WP_015084906.1|  Dihydroorotase                                   52.4    2e-06   
ref|WP_010759038.1|  dihydroorotase                                   52.0    2e-06   
ref|WP_021149672.1|  Dihydroorotase                                   52.0    2e-06   
emb|CDQ35916.1|  Dihydroorotase                                       52.0    3e-06   
ref|WP_031868660.1|  dihydroorotase                                   52.0    3e-06   
gb|EVH87110.1|  dihydroorotase                                        52.0    3e-06   
ref|WP_019376538.1|  hypothetical protein                             52.0    3e-06   
ref|WP_013042497.1|  dihydroorotase                                   52.0    3e-06   
ref|WP_022143900.1|  dihydroorotase                                   52.0    3e-06   
ref|WP_009488738.1|  Dihydroorotase                                   52.0    3e-06   
ref|WP_018932744.1|  hypothetical protein                             52.0    3e-06   
ref|WP_003354509.1|  dihydroorotase                                   52.0    3e-06   
ref|WP_034313840.1|  dihydroorotase                                   52.0    3e-06   
emb|CEG31764.1|  dihydroorotase                                       52.0    3e-06   
ref|WP_017753658.1|  dihydroorotase                                   52.0    3e-06   
ref|WP_029330894.1|  dihydroorotase                                   52.0    3e-06   
ref|WP_034445320.1|  hypothetical protein                             51.6    3e-06   
ref|WP_003265440.1|  Dihydroorotase                                   49.7    3e-06   
ref|WP_015076408.1|  dihydroorotase                                   51.6    3e-06   
ref|WP_010053783.1|  dihydroorotase                                   51.6    3e-06   
ref|WP_014970749.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_003199821.1|  dihydroorotase                                   51.2    4e-06   
ref|WP_002453035.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_016252242.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_002435237.1|  MULTISPECIES: dihydroorotase                     51.6    4e-06   
ref|WP_002442456.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_006302863.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_033796376.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_002496461.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_026680824.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_018764747.1|  MULTISPECIES: dihydroorotase                     51.6    4e-06   
ref|WP_028398941.1|  dihydroorotase                                   51.6    4e-06   
gb|AIF43825.1|  dihydroorotase                                        51.6    4e-06   
ref|WP_026559423.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_022764769.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_035421806.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_020059226.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_016201034.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_020711250.1|  hypothetical protein                             51.6    4e-06   
dbj|GAF16453.1|  LOW QUALITY PROTEIN: dihydroorotase                  51.6    4e-06   
ref|WP_033672155.1|  dihydroorotase                                   51.6    4e-06   
ref|WP_017151198.1|  dihydroorotase                                   51.2    4e-06   
ref|WP_002446243.1|  dihydroorotase                                   51.2    4e-06   
ref|WP_002486627.1|  dihydroorotase                                   51.2    4e-06   
ref|WP_016116014.1|  dihydroorotase                                   51.2    4e-06   
ref|WP_011890139.1|  dihydroorotase                                   51.2    5e-06   
dbj|BAQ10451.1|  dihydroorotase                                       51.2    5e-06   
ref|WP_026590266.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_036826267.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_025785119.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_026487464.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_031551405.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_010932720.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_012502216.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_026498450.1|  MULTISPECIES: dihydroorotase                     51.2    5e-06   
ref|WP_006351548.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_006364525.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_012370815.1|  dihydroorotase                                   51.2    5e-06   
ref|WP_002466208.1|  dihydroorotase                                   51.2    6e-06   
ref|WP_002472878.1|  dihydroorotase                                   51.2    6e-06   
ref|WP_026674348.1|  dihydroorotase                                   51.2    6e-06   
gb|KGA97757.1|  dihydroorotase                                        51.2    6e-06   
ref|WP_027296213.1|  dihydroorotase                                   51.2    6e-06   
gb|EWJ24978.1|  dihydroorotase                                        51.2    6e-06   
ref|WP_031873801.1|  dihydroorotase                                   50.8    6e-06   
ref|WP_003146941.1|  dihydroorotase                                   50.8    6e-06   
ref|WP_004264480.1|  dihydroorotase                                   50.8    6e-06   
ref|WP_029052354.1|  dihydroorotase                                   50.8    6e-06   
ref|WP_027207348.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_036141162.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_022756833.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_027726112.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_020046150.1|  hypothetical protein                             50.8    7e-06   
emb|CEA02645.1|  Dihydroorotase                                       50.8    7e-06   
ref|WP_026519067.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_025028491.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_017380799.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_014974216.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_004072012.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_022628230.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_035455232.1|  dihydroorotase                                   50.8    7e-06   
ref|WP_018659137.1|  hypothetical protein                             50.8    8e-06   
ref|WP_031534342.1|  dihydroorotase                                   50.8    8e-06   
ref|WP_012875314.1|  dihydroorotase, multifunctional complex type     50.8    8e-06   
ref|WP_032963477.1|  dihydroorotase                                   50.8    8e-06   
ref|WP_021941117.1|  dihydroorotase                                   50.8    8e-06   
ref|WP_022839921.1|  MULTISPECIES: dihydroorotase                     50.4    9e-06   
ref|WP_028672773.1|  hypothetical protein                             50.4    9e-06   
ref|WP_028663385.1|  hypothetical protein                             50.4    9e-06   
ref|WP_036099523.1|  dihydroorotase                                   50.4    9e-06   
ref|WP_028119711.1|  dihydroorotase                                   50.4    9e-06   
ref|WP_010193089.1|  dihydroorotase                                   50.4    9e-06   
ref|WP_003463102.1|  dihydroorotase                                   50.4    9e-06   
pdb|3GRI|A  Chain A, The Crystal Structure Of A Dihydroorotase Fr...  50.4    9e-06   
ref|WP_013277876.1|  dihydroorotase                                   50.4    9e-06   
ref|WP_003350273.1|  dihydroorotase                                   50.4    9e-06   
ref|WP_017548470.1|  hypothetical protein                             50.4    9e-06   
ref|WP_003329708.1|  dihydroorotase                                   50.4    9e-06   
ref|WP_031558516.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_003348931.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_010265618.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_012880507.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_010268178.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_037352590.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_035062455.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_035018036.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_029506298.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_027432534.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_004634160.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_035402996.1|  dihydroorotase                                   50.4    1e-05   
ref|WP_036064531.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_010286530.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_027130952.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_038048423.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_022289610.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_035201541.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_010301705.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_013172606.1|  dihydroorotase [                                 50.1    1e-05   
ref|WP_016297547.1|  dihydroorotase, multifunctional complex type     50.1    1e-05   
ref|WP_011247178.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_012959461.1|  dihydroorotase                                   50.1    1e-05   
gb|AHF19234.1|  Dihydroorotase                                        50.1    1e-05   
gb|EQB43296.1|  hypothetical protein CGLO_18059                       47.0    1e-05   
ref|WP_035340471.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_012094978.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_011679935.1|  dihydroorotase                                   50.1    1e-05   
ref|WP_035189267.1|  dihydroorotase                                   49.7    2e-05   
ref|WP_014324818.1|  dihydroorotase                                   49.7    2e-05   
ref|WP_014124764.1|  dihydroorotase                                   49.7    2e-05   
ref|WP_022668510.1|  dihydroorotase                                   49.7    2e-05   
ref|WP_036091200.1|  dihydroorotase                                   49.7    2e-05   



>ref|WP_009640328.1| dihydroorotase, partial [Propionibacterium sp. 434-HC2]
 gb|EGL41006.1| dihydroorotase, partial [Propionibacterium sp. 434-HC2]
Length=365

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>dbj|GAE79101.1| dihydroorotase [Propionibacterium acnes JCM 18920]
Length=269

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  172  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  211



>gb|EFT02237.1| dihydroorotase, partial [Propionibacterium acnes HL002PA1]
Length=370

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  218  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  257



>ref|WP_002536983.1| MULTISPECIES: dihydroorotase [Propionibacterium]
 gb|EFS50693.1| dihydroorotase [Propionibacterium acnes HL025PA1]
 gb|EGL46934.1| dihydroorotase [Propionibacterium sp. 409-HC1]
 gb|EGR91080.1| dihydroorotase [Propionibacterium sp. CC003-HC2]
Length=430

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_013069507.1| dihydroorotase [Propionibacterium acnes]
 ref|YP_003581221.1| Dihydroorotase [Propionibacterium acnes SK137]
 gb|ADE01122.1| dihydroorotase [Propionibacterium acnes SK137]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002520469.1| MULTISPECIES: dihydroorotase [Propionibacterium]
 ref|YP_007887498.1| dihydroorotase [Propionibacterium acnes HL096PA1]
 gb|EFS38091.1| amidohydrolase family protein [Propionibacterium acnes HL074PA1]
 gb|EFS47710.1| amidohydrolase family protein [Propionibacterium acnes HL083PA1]
 gb|EFS68031.1| amidohydrolase family protein [Propionibacterium acnes HL007PA1]
 gb|EFS71406.1| amidohydrolase family protein [Propionibacterium acnes HL056PA1]
 gb|EFT17418.1| amidohydrolase family protein [Propionibacterium acnes HL053PA1]
 gb|EFT20095.1| amidohydrolase family protein [Propionibacterium acnes HL045PA1]
 gb|EFT28072.1| amidohydrolase family protein [Propionibacterium acnes HL005PA1]
 gb|EFT68213.1| amidohydrolase family protein [Propionibacterium acnes HL038PA1]
 gb|EGE67940.1| amidohydrolase family protein [Propionibacterium acnes HL096PA2]
 gb|EGE92617.1| amidohydrolase family protein [Propionibacterium acnes HL043PA2]
 gb|EGE94712.1| amidohydrolase family protein [Propionibacterium acnes HL043PA1]
 gb|EGF74195.1| dihydroorotase [Propionibacterium acnes HL099PA1]
 gb|EGR95933.1| dihydroorotase [Propionibacterium acnes SK182]
 gb|AGJ79996.1| dihydroorotase [Propionibacterium acnes HL096PA1]
 gb|ERS20104.1| hypothetical protein HMPREF1303_01032 [Propionibacterium sp. 
KPL2009]
 gb|ERS35012.1| hypothetical protein HMPREF1280_01035 [Propionibacterium sp. 
KPL1854]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002547280.1| dihydroorotase [Propionibacterium acnes]
 gb|EFS86854.1| dihydroorotase [Propionibacterium acnes HL001PA1]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002525001.1| dihydroorotase [Propionibacterium acnes]
 ref|YP_004946498.1| dihydroorotase [Propionibacterium acnes TypeIA2 P.acn17]
 ref|YP_004955426.1| dihydroorotase [Propionibacterium acnes TypeIA2 P.acn33]
 gb|EFS35856.1| dihydroorotase [Propionibacterium acnes HL013PA1]
 gb|EFS53745.1| dihydroorotase [Propionibacterium acnes HL059PA1]
 gb|EFS65453.1| dihydroorotase [Propionibacterium acnes HL063PA2]
 gb|EFS79316.1| dihydroorotase [Propionibacterium acnes HL005PA4]
 gb|EFS82062.1| dihydroorotase [Propionibacterium acnes HL050PA1]
 gb|EFS83875.1| dihydroorotase [Propionibacterium acnes HL050PA3]
 gb|EFS95889.1| dihydroorotase [Propionibacterium acnes HL067PA1]
 gb|EFT00329.1| dihydroorotase [Propionibacterium acnes HL027PA1]
 gb|EFT70475.1| dihydroorotase [Propionibacterium acnes HL059PA2]
 gb|EFT73120.1| dihydroorotase [Propionibacterium acnes HL046PA1]
 gb|EFT80340.1| dihydroorotase [Propionibacterium acnes HL030PA2]
 gb|EGE97473.1| dihydroorotase [Propionibacterium acnes HL087PA3]
 gb|EGF00490.1| dihydroorotase [Propionibacterium acnes HL083PA2]
 gb|EGF67855.1| dihydroorotase [Propionibacterium acnes HL087PA1]
 gb|EGF68127.1| dihydroorotase [Propionibacterium acnes HL025PA2]
 gb|AEW81308.1| dihydroorotase [Propionibacterium acnes TypeIA2 P.acn17]
 gb|AEW79063.1| dihydroorotase [Propionibacterium acnes TypeIA2 P.acn33]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002513720.1| MULTISPECIES: dihydroorotase [Propionibacterium]
 ref|YP_005986400.1| dihydroorotase [Propionibacterium acnes ATCC 11828]
 gb|EFB88887.1| dihydroorotase [Propionibacterium acnes J139]
 gb|EFT10896.1| dihydroorotase [Propionibacterium acnes HL082PA2]
 gb|EFT65260.1| dihydroorotase [Propionibacterium acnes HL060PA1]
 gb|EFT75435.1| dihydroorotase [Propionibacterium acnes HL050PA2]
 gb|EGE69400.1| dihydroorotase [Propionibacterium acnes HL103PA1]
 gb|AER06389.1| dihydroorotase [Propionibacterium acnes ATCC 11828]
 gb|ERS32725.1| hypothetical protein HMPREF1277_00997 [Propionibacterium sp. 
KPL1847]
 gb|ERS67088.1| hypothetical protein HMPREF1278_00644 [Propionibacterium sp. 
KPL1849]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>dbj|GAE67047.1| dihydroorotase [Propionibacterium acnes JCM 18909]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002544504.1| dihydroorotase [Propionibacterium acnes]
 gb|EFT11894.1| dihydroorotase [Propionibacterium acnes HL037PA1]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002531413.1| MULTISPECIES: dihydroorotase [Propionibacterium]
 ref|YP_055708.1| dihydroorotase [Propionibacterium acnes KPA171202]
 ref|YP_005944599.1| dihydroorotase [Propionibacterium acnes 6609]
 gb|AAT82750.1| dihydroorotase [Propionibacterium acnes KPA171202]
 gb|EFT77396.1| dihydroorotase [Propionibacterium acnes HL030PA1]
 gb|AEH29320.1| dihydroorotase [Propionibacterium acnes 6609]
 gb|ERS21498.1| hypothetical protein HMPREF1302_01031 [Propionibacterium sp. 
KPL2008]
 gb|ESS80526.1| dihydroorotase [Propionibacterium acnes PA2]
 dbj|GAE75948.1| dihydroorotase [Propionibacterium acnes JCM 18918]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_024513557.1| dihydroorotase [Propionibacterium acnes]
 gb|KEY35690.1| dihydroorotase [Propionibacterium acnes]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002533084.1| dihydroorotase [Propionibacterium acnes]
 gb|EFT25229.1| dihydroorotase [Propionibacterium acnes HL110PA3]
 gb|EFT63935.1| dihydroorotase [Propionibacterium acnes HL110PA4]
 gb|ESK59887.1| dihydroorotase [Propionibacterium acnes HL042PA3]
 gb|KFC15337.1| dihydroorotase [Propionibacterium acnes HL202PA1]
Length=445

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002517994.1| dihydroorotase [Propionibacterium acnes]
 gb|EFD03240.1| dihydroorotase [Propionibacterium acnes SK187]
 gb|EFS40281.1| dihydroorotase [Propionibacterium acnes HL110PA1]
 gb|EFS43103.1| dihydroorotase [Propionibacterium acnes HL110PA2]
 gb|EFS76409.1| dihydroorotase [Propionibacterium acnes HL086PA1]
 gb|EFT06938.1| dihydroorotase [Propionibacterium acnes HL082PA1]
 gb|EFT50105.1| dihydroorotase [Propionibacterium acnes HL053PA2]
 gb|EGE71968.1| dihydroorotase [Propionibacterium acnes HL097PA1]
 gb|EGE99757.1| dihydroorotase [Propionibacterium acnes HL092PA1]
 gb|EIA10991.1| dihydroorotase [Propionibacterium acnes PRP-38]
 gb|ESS87096.1| dihydroorotase [Propionibacterium acnes P6]
Length=445

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002515650.1| MULTISPECIES: dihydroorotase [Propionibacterium]
 ref|YP_005942245.1| dihydroorotase [Propionibacterium acnes 266]
 ref|YP_006851035.1| dihydroorotase [Propionibacterium acnes C1]
 gb|EFD07915.1| dihydroorotase [Propionibacterium acnes J165]
 gb|EFS45967.1| amidohydrolase family protein [Propionibacterium acnes HL087PA2]
 gb|EFS56238.1| amidohydrolase family protein [Propionibacterium acnes HL046PA2]
 gb|EFS58005.1| amidohydrolase family protein [Propionibacterium acnes HL036PA1]
 gb|EFS60615.1| amidohydrolase family protein [Propionibacterium acnes HL036PA2]
 gb|EFS62880.1| amidohydrolase family protein [Propionibacterium acnes HL063PA1]
 gb|EFS89008.1| amidohydrolase family protein [Propionibacterium acnes HL036PA3]
 gb|EFT04141.1| amidohydrolase family protein [Propionibacterium acnes HL002PA2]
 gb|EFT22556.1| amidohydrolase family protein [Propionibacterium acnes HL072PA2]
 gb|EFT32254.1| amidohydrolase family protein [Propionibacterium acnes HL005PA2]
 gb|EFT34058.1| amidohydrolase family protein [Propionibacterium acnes HL005PA3]
 gb|EFT52655.1| amidohydrolase family protein [Propionibacterium acnes HL078PA1]
 gb|EFT57669.1| amidohydrolase family protein [Propionibacterium acnes HL002PA3]
 gb|EFT60862.1| amidohydrolase family protein [Propionibacterium acnes HL072PA1]
 gb|EGE73711.1| amidohydrolase family protein [Propionibacterium acnes HL096PA3]
 gb|EGE89830.1| amidohydrolase family protein [Propionibacterium acnes HL013PA2]
 gb|EGF67123.1| amidohydrolase family protein [Propionibacterium acnes HL020PA1]
 gb|AEE72214.1| dihydroorotase [Propionibacterium acnes 266]
 gb|EHC26440.1| hypothetical protein HMPREF1003_01493 [Propionibacterium sp. 
5_U_42AFAA]
 gb|AFU40804.1| dihydroorotase [Propionibacterium acnes C1]
 gb|EMF64288.1| dihydroorotase [Propionibacterium acnes FZ1/2/0]
 gb|ERS27834.1| hypothetical protein HMPREF1299_01002 [Propionibacterium sp. 
KPL2003]
 dbj|GAE70859.1| dihydroorotase [Propionibacterium acnes JCM 18916]
 gb|AID35775.1| dihydroorotase [Propionibacterium acnes hdn-1]
 gb|KEY33793.1| dihydroorotase [Propionibacterium acnes]
Length=445

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002539278.1| dihydroorotase [Propionibacterium acnes]
 gb|EFT56328.1| amidohydrolase family protein [Propionibacterium acnes HL027PA2]
Length=445

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_002548524.1| dihydroorotase [Propionibacterium acnes]
 gb|EGR97559.1| dihydroorotase [Propionibacterium acnes SK182B-JCVI]
Length=445

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFR+AAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRNAAFGVITN  332



>ref|WP_002527383.1| dihydroorotase [Propionibacterium humerusii]
 gb|EFS74901.1| dihydroorotase [Propionibacterium [Propionibacterium [acnes] 
HL037PA2]
 gb|EFS91624.1| dihydroorotase [Propionibacterium [Propionibacterium [acnes] 
HL044PA1]
 gb|EFT16057.1| dihydroorotase [Propionibacterium [Propionibacterium [acnes] 
HL037PA3]
 gb|EGG27023.1| dihydroorotase [Propionibacterium humerusii P08]
Length=445

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHAAEEKACSFR+AAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRNAAFGVITN  332



>ref|WP_014166918.1| dihydroorotase [Propionibacterium acnes]
 ref|YP_004944257.1| dihydroorotase [Propionibacterium acnes TypeIA2 P.acn31]
 gb|AEW83574.1| dihydroorotase [Propionibacterium acnes TypeIA2 P.acn31]
Length=445

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGL DGTLTCIATDNAPHAAEEKACSFRDAAFGVITN
Sbjct  293  AMVEGLYDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  332



>ref|WP_015582838.1| dihydroorotase [Propionibacterium avidum]
 ref|YP_007871185.1| dihydroorotase [Propionibacterium avidum 44067]
 gb|AGJ77821.1| dihydroorotase [Propionibacterium avidum 44067]
Length=445

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHA  EK CSFR+AAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAGAEKDCSFRNAAFGVITN  332



>ref|WP_023032625.1| MULTISPECIES: hypothetical protein [Propionibacterium]
 gb|ERS24181.1| hypothetical protein HMPREF1301_01996 [Propionibacterium sp. 
KPL2005]
 gb|ERS26133.1| hypothetical protein HMPREF1297_01708 [Propionibacterium sp. 
KPL2000]
Length=445

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHA  EK CSFR+AAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAGAEKDCSFRNAAFGVITN  332



>ref|WP_016667485.1| dihydroorotase [Propionibacterium sp. HGH0353]
 gb|EPH01802.1| dihydroorotase [Propionibacterium sp. HGH0353]
Length=445

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHA  EK CSFR+AAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAGAEKDCSFRNAAFGVITN  332



>ref|WP_004811599.1| MULTISPECIES: dihydroorotase [Propionibacterium]
 gb|EGY77012.1| dihydroorotase [Propionibacterium avidum ATCC 25577]
 gb|ERF55870.1| dihydroorotase [Propionibacterium avidum TM16]
 gb|ERS37167.1| hypothetical protein HMPREF1271_01704 [Propionibacterium sp. 
KPL1838]
 gb|ERS66341.1| hypothetical protein HMPREF1279_01690 [Propionibacterium sp. 
KPL1852]
Length=445

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTLTCIATDNAPHA  EK CSFR+AAFGVITN
Sbjct  293  AMVEGLCDGTLTCIATDNAPHAGAEKDCSFRNAAFGVITN  332



>ref|WP_036924238.1| dihydroorotase [Propionibacterium thoenii]
Length=445

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AM+EGLCDGTL  IATDNAPH A+EK CSFRDAAFGVITN
Sbjct  293  AMIEGLCDGTLCAIATDNAPHTAQEKDCSFRDAAFGVITN  332



>ref|WP_036981445.1| dihydroorotase [Propionibacterium jensenii]
Length=447

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            AMVEGLCDGTL  IATDNAPH A EK CSFRDAAFGVITN
Sbjct  293  AMVEGLCDGTLCAIATDNAPHTAAEKDCSFRDAAFGVITN  332



>ref|WP_015070226.1| Dihydroorotase [Propionibacterium acidipropionici]
 ref|YP_006980675.1| dihydroorotase [Propionibacterium acidipropionici ATCC 4875]
 gb|AFV89320.1| Dihydroorotase [Propionibacterium acidipropionici ATCC 4875]
Length=443

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EGLCDGT+  IATDNAPH A EK CSFRDAAFGVITN
Sbjct  297  AIIEGLCDGTIDAIATDNAPHTAAEKDCSFRDAAFGVITN  336



>ref|WP_036938455.1| dihydroorotase, partial [Propionibacterium acidipropionici]
Length=425

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EGLCDGT+  IATDNAPH A EK CSFRDAAFGVITN
Sbjct  292  AIIEGLCDGTIDAIATDNAPHTAAEKDCSFRDAAFGVITN  331



>ref|WP_021105491.1| Dihydroorotase [Propionibacterium granulosum]
 gb|ERF66932.1| Dihydroorotase [Propionibacterium granulosum TM11]
Length=433

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A+V GLCDGT+  IATDNAPH A EK CS RDAAFGVITN
Sbjct  292  AIVAGLCDGTIDAIATDNAPHTAAEKNCSMRDAAFGVITN  331



>ref|WP_023035463.1| hypothetical protein [Propionibacterium sp. KPL1844]
 gb|ERS33467.1| hypothetical protein HMPREF1275_01672 [Propionibacterium sp. 
KPL1844]
Length=433

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A+V GLCDGT+  IATDNAPH A EK CS RDAAFGVITN
Sbjct  292  AIVAGLCDGTIGAIATDNAPHTAAEKNCSMRDAAFGVITN  331



>ref|WP_021103195.1| Dihydroorotase [Propionibacterium granulosum]
 gb|ERF58379.1| Dihydroorotase [Propionibacterium granulosum DSM 20700]
Length=433

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A+V GLCDGT+  IATDNAPH A EK CS RDAAFGVITN
Sbjct  292  AIVAGLCDGTIGAIATDNAPHTAAEKNCSMRDAAFGVITN  331



>ref|WP_022796957.1| dihydroorotase [Bavariicoccus seileri]
Length=435

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CI+TD+APH  EEK CSFR A FG++
Sbjct  293  ALIEGLLDGTIDCISTDHAPHGKEEKCCSFRQAPFGIV  330



>gb|EGF34128.1| dihydroorotase [Lactobacillus rhamnosus MTCC 5462]
Length=98

 Score = 56.6 bits (135),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  53   ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  90



>ref|WP_017796606.1| dihydroorotase [Oceanobacillus kimchii]
Length=430

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+ EGL DGTL  IATD+APHAAEEKA  F++A FG++
Sbjct  288  ALFEGLMDGTLDLIATDHAPHAAEEKALGFKEAPFGIV  325



>ref|WP_025904584.1| dihydroorotase [Staphylococcus sciuri]
Length=424

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEK  S  DA FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHAKEEKEVSMVDAPFGIV  324



>ref|WP_017000573.1| dihydroorotase [Staphylococcus lentus]
Length=427

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEK  S  DA FG++
Sbjct  287  ALIEGLIDGTIDCIATDHAPHAKEEKEASMVDAPFGIV  324



>ref|WP_037587563.1| dihydroorotase [Staphylococcus aureus]
 gb|EZX26449.1| dihydroorotase [Staphylococcus aureus C0673]
Length=424

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEK  S  DA FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHAKEEKEVSMVDAPFGIV  324



>ref|WP_016911060.1| hypothetical protein [Staphylococcus vitulinus]
Length=424

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEK  S  DA FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHAKEEKEVSMIDAPFGIV  324



>ref|WP_008463109.1| dihydroorotase [Lactobacillus equicursoris]
 emb|CCK86288.1| Dihydroorotase [Lactobacillus equicursoris DSM 19284 = JCM 14600 
= CIP 110162]
Length=425

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EGL DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  289  AVIEGLLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  328



>ref|WP_009558384.1| dihydroorotase [Lactobacillus equicursoris]
 emb|CCK84218.1| Dihydroorotase [Lactobacillus equicursoris 66c]
Length=425

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EGL DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  289  AVIEGLLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  328



>ref|WP_003615098.1| dihydroorotase [Lactobacillus delbrueckii]
 gb|EGD28259.1| dihydroorotase [Lactobacillus delbrueckii subsp. lactis DSM 20072]
Length=409

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>ref|WP_016396658.1| dihydroorotase [Lactobacillus delbrueckii]
 gb|EPB98534.1| dihydroorotase [Lactobacillus delbrueckii subsp. lactis CRL581]
Length=427

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>ref|WP_003619711.1| dihydroorotase [Lactobacillus delbrueckii]
 gb|EHE89919.1| Dihydroorotase [Lactobacillus delbrueckii subsp. bulgaricus CNCM 
I-1632]
Length=427

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>ref|WP_013439522.1| dihydroorotase [Lactobacillus delbrueckii]
 ref|YP_004033953.1| dihydroorotase [Lactobacillus delbrueckii subsp. bulgaricus ND02]
 gb|ADQ60976.1| Dihydroorotase [Lactobacillus delbrueckii subsp. bulgaricus ND02]
Length=427

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>ref|WP_003614861.1| dihydroorotase [Lactobacillus delbrueckii]
 gb|EFK31018.1| dihydroorotase [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4]
Length=427

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>ref|WP_035164888.1| dihydroorotase [Lactobacillus delbrueckii]
 emb|CDR82680.1| Dihydroorotase [Lactobacillus delbrueckii subsp. lactis]
 emb|CDR77408.1| Dihydroorotase [Lactobacillus delbrueckii subsp. lactis]
Length=427

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>ref|WP_035161098.1| dihydroorotase [Lactobacillus delbrueckii]
 emb|CDR80234.1| Dihydroorotase [Lactobacillus delbrueckii subsp. lactis]
Length=427

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>gb|ETC92978.1| hypothetical protein T481_03770 [Enterococcus faecalis PF3]
Length=189

 Score = 54.3 bits (129),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  51   ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  88



>ref|WP_005879673.1| dihydroorotase [Enterococcus durans]
 gb|EMS74995.1| dihydroorotase [Enterococcus durans IPLA 655]
Length=426

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF ++ FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSKSFLESPFGIV  326



>ref|WP_002350636.1| dihydroorotase [Enterococcus faecium]
 gb|EJX52630.1| dihydroorotase [Enterococcus faecium R496]
Length=426

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSLSFMKSPFGIV  326



>ref|WP_010751021.1| dihydroorotase [Enterococcus villorum]
 gb|EOH89832.1| dihydroorotase [Enterococcus villorum ATCC 700913]
 gb|EOW78064.1| dihydroorotase [Enterococcus villorum ATCC 700913]
Length=426

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF ++ FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSKSFLESPFGIV  326



>ref|WP_010719214.1| dihydroorotase [Enterococcus hirae]
 gb|EOF59988.1| dihydroorotase [Enterococcus hirae EnGen0127]
Length=426

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF ++ FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSKSFLESPFGIV  326



>ref|WP_034697867.1| dihydroorotase [Enterococcus hirae]
 gb|KDR93189.1| dihydroorotase [Enterococcus hirae]
Length=426

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF ++ FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSKSFLESPFGIV  326



>ref|WP_010737536.1| MULTISPECIES: dihydroorotase [Enterococcus]
 ref|YP_006488183.1| dihydroorotase [Enterococcus hirae ATCC 9790]
 gb|AFM71292.1| dihydroorotase [Enterococcus hirae ATCC 9790]
 gb|EOH71364.1| dihydroorotase [Enterococcus hirae ATCC 9790]
 gb|EOU07676.1| dihydroorotase [Enterococcus hirae ATCC 9790]
Length=426

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF ++ FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSKSFLESPFGIV  326



>ref|WP_016381534.1| dihydroorotase, partial [Lactobacillus paracasei]
 gb|EPC83412.1| dihydroorotase, partial [Lactobacillus paracasei subsp. paracasei 
CNCM I-4649]
Length=155

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  19   ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  56



>ref|WP_018369158.1| hypothetical protein [Streptococcus entericus]
Length=420

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+  IATD+APHA EEK CS   AAFG++
Sbjct  284  ALIEGLLDGTIDIIATDHAPHAPEEKNCSMTQAAFGIV  321



>ref|WP_014116558.1| dihydroorotase [Oscillibacter valericigenes]
 ref|YP_004880371.1| dihydroorotase [Oscillibacter valericigenes Sjm18-20]
 dbj|BAK97865.1| dihydroorotase [Oscillibacter valericigenes Sjm18-20]
Length=427

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH AEEK+   R +AFG++
Sbjct  286  ALIEGLLDGTVDCIATDHAPHCAEEKSRGLRQSAFGIV  323



>ref|WP_029377531.1| dihydroorotase [Staphylococcus xylosus]
Length=424

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAAEEKAQPMTKAPFGIV  324



>ref|WP_038678328.1| dihydroorotase [Staphylococcus xylosus]
 gb|AID01132.1| dihydroorotase [Staphylococcus xylosus]
Length=424

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAAEEKAQPMTKAPFGIV  324



>gb|EOH56355.1| dihydroorotase [Enterococcus faecium EnGen0263]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002372430.1| dihydroorotase [Enterococcus faecium]
 gb|EJY48014.1| dihydroorotase [Enterococcus faecium 505]
 gb|AII39411.1| dihydroorotase [Enterococcus faecium T110]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_024635173.1| dihydroorotase [Enterococcus faecium]
 gb|KEI50716.1| dihydroorotase [Enterococcus faecium UC8668]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002335695.1| dihydroorotase [Enterococcus faecium]
 gb|ELB06165.1| dihydroorotase [Enterococcus faecium EnGen0028]
 gb|ELB08885.1| dihydroorotase [Enterococcus faecium EnGen0029]
 gb|ELB32166.1| dihydroorotase [Enterococcus faecium EnGen0042]
 gb|ELB41270.1| dihydroorotase [Enterococcus faecium EnGen0026]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_019902308.1| dihydroorotase, partial [Lactobacillus paracasei]
 gb|EPD02942.1| dihydroorotase, partial [Lactobacillus paracasei subsp. paracasei 
Lpp70]
Length=148

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  12   ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  49



>ref|WP_002315061.1| dihydroorotase [Enterococcus faecium]
 gb|EEV61593.1| dihydroorotase [Enterococcus faecium Com15]
 gb|KEI51410.1| dihydroorotase [Enterococcus faecium UC7256]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002329183.1| dihydroorotase [Enterococcus faecium]
 gb|EFF38701.1| dihydroorotase [Enterococcus faecium E980]
 gb|ELA70220.1| dihydroorotase [Enterococcus faecium EnGen0015]
 gb|ELB36148.1| dihydroorotase [Enterococcus faecium EnGen0033]
 gb|EPI11902.1| dihydroorotase [Enterococcus faecium SD2A-2]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_010722511.1| dihydroorotase [Enterococcus faecium]
 gb|EOG37474.1| dihydroorotase [Enterococcus faecium EnGen0184]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002344205.1| dihydroorotase [Enterococcus faecium]
 gb|ELB52004.1| dihydroorotase [Enterococcus faecium EnGen0038]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002313786.1| dihydroorotase [Enterococcus faecium]
 gb|EEI60389.1| amidohydrolase family protein [Enterococcus faecium TX1330]
 gb|EEV58964.1| dihydroorotase [Enterococcus faecium Com12]
 gb|EFF62062.1| dihydroorotase [Enterococcus faecium PC4.1]
 gb|EJV54829.1| dihydroorotase [Enterococcus faecium TX1337RF]
 gb|ELB57238.1| dihydroorotase [Enterococcus faecium EnGen0056]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002309322.1| dihydroorotase [Enterococcus faecium]
 gb|EEV50469.1| dihydroorotase [Enterococcus faecium 1,141,733]
 gb|ELB02910.1| dihydroorotase [Enterococcus faecium EnGen0003]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_010724050.1| dihydroorotase [Enterococcus faecium]
 gb|EOH45834.1| dihydroorotase [Enterococcus faecium EnGen0191]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002345918.1| dihydroorotase [Enterococcus faecium]
 gb|ELB61175.1| dihydroorotase [Enterococcus faecium EnGen0047]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002327924.1| dihydroorotase [Enterococcus faecium]
 gb|ELA65487.1| dihydroorotase [Enterococcus faecium EnGen0019]
 gb|EOL08802.1| dihydroorotase [Enterococcus faecium EnGen0160]
Length=426

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002288875.1| MULTISPECIES: dihydroorotase [Enterococcus]
 ref|YP_005354171.1| Dihydroorotase [Enterococcus faecium Aus0004]
 ref|YP_006375957.1| dihydroorotase [Enterococcus faecium DO]
 ref|YP_007394533.1| Dihydroorotase [Enterococcus faecium NRRL B-2354]
 ref|YP_008394900.1| Dihydroorotase [Enterococcus faecium Aus0085]
 gb|EAN09248.1| Dihydroorotase multifunctional complex type [Enterococcus faecium 
DO]
 gb|EEV41216.1| dihydroorotase [Enterococcus faecium 1,230,933]
 gb|EEV43976.1| dihydroorotase [Enterococcus faecium 1,231,502]
 gb|EEV52558.1| dihydroorotase [Enterococcus faecium 1,231,410]
 gb|EEV55474.1| dihydroorotase [Enterococcus faecium 1,231,408]
 gb|EEW62327.1| dihydroorotase [Enterococcus faecium C68]
 gb|EEW65896.1| dihydroorotase [Enterococcus faecium TC 6]
 gb|EFD09834.1| dihydroorotase [Enterococcus faecium D344SRF]
 gb|EFF19475.1| dihydroorotase [Enterococcus faecium E1071]
 gb|EFF22281.1| dihydroorotase [Enterococcus faecium E1636]
 gb|EFF27115.1| dihydroorotase [Enterococcus faecium E1679]
 gb|EFF29788.1| dihydroorotase [Enterococcus faecium U0317]
 gb|EFF36108.1| dihydroorotase [Enterococcus faecium E1162]
 gb|EFR68952.1| amidohydrolase family protein [Enterococcus faecium TX0133a01]
 gb|EFR72266.1| amidohydrolase family protein [Enterococcus faecium TX0133B]
 gb|EFR74357.1| amidohydrolase family protein [Enterococcus faecium TX0133A]
 gb|EFR78283.1| amidohydrolase family protein [Enterococcus faecium TX0133C]
 gb|EFS05546.1| amidohydrolase family protein [Enterococcus faecium TX0133a04]
 gb|EFS09868.1| amidohydrolase family protein [Enterococcus faecium TX0082]
 gb|EHM31777.1| dihydroorotase [Enterococcus faecium E4453]
 gb|AFC63053.1| Dihydroorotase [Enterococcus faecium Aus0004]
 gb|AFK58975.1| dihydroorotase [Enterococcus faecium DO]
 gb|EJX39334.1| dihydroorotase [Enterococcus faecium R501]
 gb|EJX41269.1| dihydroorotase [Enterococcus faecium V689]
 gb|EJX44994.1| dihydroorotase [Enterococcus faecium S447]
 gb|EJX48885.1| dihydroorotase [Enterococcus faecium R499]
 gb|EJX49409.1| dihydroorotase [Enterococcus faecium R497]
 gb|EJX56723.1| dihydroorotase [Enterococcus faecium R494]
 gb|EJX65652.1| dihydroorotase [Enterococcus faecium R446]
 gb|EJX66298.1| dihydroorotase [Enterococcus faecium P1190]
 gb|EJX68005.1| dihydroorotase [Enterococcus faecium P1140]
 gb|EJX69163.1| dihydroorotase [Enterococcus faecium P1986]
 gb|EJX71922.1| dihydroorotase [Enterococcus faecium P1137]
 gb|EJX74888.1| dihydroorotase [Enterococcus faecium P1123]
 gb|EJX77633.1| dihydroorotase [Enterococcus faecium P1139]
 gb|EJX80147.1| dihydroorotase [Enterococcus faecium ERV99]
 gb|EJX88063.1| dihydroorotase [Enterococcus faecium ERV69]
 gb|EJX89178.1| dihydroorotase [Enterococcus faecium ERV38]
 gb|EJX92068.1| dihydroorotase [Enterococcus faecium ERV26]
 gb|EJX97191.1| dihydroorotase [Enterococcus faecium ERV168]
 gb|EJY01866.1| dihydroorotase [Enterococcus faecium ERV165]
 gb|EJY04790.1| dihydroorotase [Enterococcus faecium ERV161]
 gb|EJY05404.1| dihydroorotase [Enterococcus faecium ERV102]
 gb|EJY09070.1| dihydroorotase [Enterococcus faecium ERV1]
 gb|EJY13973.1| dihydroorotase [Enterococcus faecium E417]
 gb|EJY15621.1| dihydroorotase [Enterococcus faecium E422]
 gb|EJY20706.1| dihydroorotase [Enterococcus faecium C621]
 gb|EJY22736.1| dihydroorotase [Enterococcus faecium C1904]
 gb|EJY24341.1| dihydroorotase [Enterococcus faecium C497]
 gb|EJY29258.1| dihydroorotase [Enterococcus faecium 515]
 gb|EJY30660.1| dihydroorotase [Enterococcus faecium 514]
 gb|EJY32927.1| dihydroorotase [Enterococcus faecium 513]
 gb|EJY39570.1| dihydroorotase [Enterococcus faecium 511]
 gb|EJY40392.1| dihydroorotase [Enterococcus faecium 506]
 gb|EJY42510.1| dihydroorotase [Enterococcus faecium 510]
 gb|EJY45106.1| dihydroorotase [Enterococcus faecium 509]
 gb|EJY53758.1| dihydroorotase [Enterococcus faecium 503]
 gb|EJZ99965.1| Dihydroorotase [Enterococcus sp. GMD4E]
 gb|EKA03106.1| Dihydroorotase [Enterococcus sp. GMD3E]
 gb|EKA07821.1| Dihydroorotase [Enterococcus sp. GMD2E]
 gb|EKA12902.1| Dihydroorotase [Enterococcus sp. GMD1E]
 gb|EKQ76014.1| dihydroorotase [Enterococcus sp. GMD5E]
 gb|EKU86958.1| dihydroorotase [Enterococcus faecium FB129-CNAB4]
 gb|ELA50156.1| dihydroorotase [Enterococcus faecium EnGen0005]
 gb|ELA53310.1| dihydroorotase [Enterococcus faecium EnGen0012]
 gb|ELA55896.1| dihydroorotase [Enterococcus faecium EnGen0010]
 gb|ELA60218.1| dihydroorotase [Enterococcus faecium EnGen0013]
 gb|ELA60482.1| dihydroorotase [Enterococcus faecium EnGen0022]
 gb|ELA68582.1| dihydroorotase [Enterococcus faecium EnGen0008]
 gb|ELA72941.1| dihydroorotase [Enterococcus faecium EnGen0017]
 gb|ELA76939.1| dihydroorotase [Enterococcus faecium EnGen0011]
 gb|ELA79328.1| dihydroorotase [Enterococcus faecium EnGen0002]
 gb|ELA85533.1| dihydroorotase [Enterococcus faecium EnGen0021]
 gb|ELA88183.1| dihydroorotase [Enterococcus faecium EnGen0016]
 gb|ELA89308.1| dihydroorotase [Enterococcus faecium EnGen0009]
 gb|ELA93230.1| dihydroorotase [Enterococcus faecium EnGen0020]
 gb|ELA95901.1| dihydroorotase [Enterococcus faecium EnGen0018]
 gb|ELA98098.1| dihydroorotase [Enterococcus faecium EnGen0001]
 gb|ELB00138.1| dihydroorotase [Enterococcus faecium EnGen0007]
 gb|ELB10755.1| dihydroorotase [Enterococcus faecium EnGen0027]
 gb|ELB13663.1| dihydroorotase [Enterococcus faecium EnGen0032]
 gb|ELB15641.1| dihydroorotase [Enterococcus faecium EnGen0031]
 gb|ELB22044.1| dihydroorotase [Enterococcus faecium EnGen0035]
 gb|ELB26316.1| dihydroorotase [Enterococcus faecium EnGen0040]
 gb|ELB31924.1| dihydroorotase [Enterococcus faecium EnGen0036]
 gb|ELB41084.1| dihydroorotase [Enterococcus faecium EnGen0024]
 gb|ELB43841.1| dihydroorotase [Enterococcus faecium EnGen0044]
 gb|ELB46804.1| dihydroorotase [Enterococcus faecium EnGen0043]
 gb|ELB50442.1| dihydroorotase [Enterococcus faecium EnGen0034]
 gb|ELB56044.1| dihydroorotase [Enterococcus faecium EnGen0030]
 gb|ELB64928.1| dihydroorotase [Enterococcus faecium EnGen0048]
 gb|ELB71637.1| dihydroorotase [Enterococcus faecium EnGen0051]
 gb|ELB73240.1| dihydroorotase [Enterococcus faecium EnGen0050]
 gb|ELB77893.1| dihydroorotase [Enterococcus faecium EnGen0046]
 gb|ELB79787.1| dihydroorotase [Enterococcus faecium EnGen0057]
 gb|ELB82927.1| dihydroorotase [Enterococcus faecium EnGen0049]
 gb|ELB83536.1| dihydroorotase [Enterococcus faecium EnGen0045]
 gb|AGE30472.1| Dihydroorotase [Enterococcus faecium NRRL B-2354]
 gb|EOD84791.1| dihydroorotase [Enterococcus faecium EnGen0041]
 gb|EOF54838.1| dihydroorotase [Enterococcus faecium EnGen0131]
 gb|EOF58427.1| dihydroorotase [Enterococcus faecium EnGen0124]
 gb|EOF62421.1| dihydroorotase [Enterococcus faecium EnGen0133]
 gb|EOF65914.1| dihydroorotase [Enterococcus faecium EnGen0126]
 gb|EOF68168.1| dihydroorotase [Enterococcus faecium EnGen0135]
 gb|EOF69357.1| dihydroorotase [Enterococcus faecium EnGen0130]
 gb|EOF72010.1| dihydroorotase [Enterococcus faecium EnGen0132]
 gb|EOF74799.1| dihydroorotase [Enterococcus faecium EnGen0128]
 gb|EOF79726.1| dihydroorotase [Enterococcus faecium EnGen0138]
 gb|EOF80530.1| dihydroorotase [Enterococcus faecium EnGen0136]
 gb|EOF81220.1| dihydroorotase [Enterococcus faecium EnGen0137]
 gb|EOF84805.1| dihydroorotase [Enterococcus faecium EnGen0140]
 gb|EOF89911.1| dihydroorotase [Enterococcus faecium EnGen0161]
 gb|EOF91077.1| dihydroorotase [Enterococcus faecium EnGen0162]
 gb|EOF95691.1| dihydroorotase [Enterococcus faecium EnGen0168]
 gb|EOF98585.1| dihydroorotase [Enterococcus faecium EnGen0169]
 gb|EOG03603.1| dihydroorotase [Enterococcus faecium EnGen0171]
 gb|EOG05816.1| dihydroorotase [Enterococcus faecium EnGen0170]
 gb|EOG06924.1| dihydroorotase [Enterococcus faecium EnGen0175]
 gb|EOG14782.1| dihydroorotase [Enterococcus faecium EnGen0177]
 gb|EOG18626.1| dihydroorotase [Enterococcus faecium EnGen0178]
 gb|EOG20157.1| dihydroorotase [Enterococcus faecium EnGen0179]
 gb|EOG25338.1| dihydroorotase [Enterococcus faecium EnGen0180]
 gb|EOG27229.1| dihydroorotase [Enterococcus faecium EnGen0181]
 gb|EOG29366.1| dihydroorotase [Enterococcus faecium EnGen0182]
 gb|EOG35205.1| dihydroorotase [Enterococcus faecium EnGen0183]
 gb|EOH35499.1| dihydroorotase [Enterococcus faecium EnGen0185]
 gb|EOH42182.1| dihydroorotase [Enterococcus faecium EnGen0189]
 gb|EOH43105.1| dihydroorotase [Enterococcus faecium EnGen0190]
 gb|EOH51870.1| dihydroorotase [Enterococcus faecium EnGen0257]
 gb|EOH53157.1| dihydroorotase [Enterococcus faecium EnGen0264]
 gb|EOH62450.1| dihydroorotase [Enterococcus faecium EnGen0265]
 gb|EOH68224.1| dihydroorotase [Enterococcus faecium ATCC 8459]
 gb|EOI38428.1| dihydroorotase [Enterococcus faecium EnGen0267]
 gb|EOI41223.1| dihydroorotase [Enterococcus faecium EnGen0313]
 gb|EOI45036.1| dihydroorotase [Enterococcus faecium EnGen0315]
 gb|EOI51098.1| dihydroorotase [Enterococcus faecium EnGen0317]
 gb|EOI54778.1| dihydroorotase [Enterococcus faecium EnGen0322]
 gb|EOI60891.1| dihydroorotase [Enterococcus faecium EnGen0314]
 gb|EOI62408.1| dihydroorotase [Enterococcus faecium EnGen0316]
 gb|EOI63202.1| dihydroorotase [Enterococcus faecium EnGen0318]
 gb|EOI69240.1| dihydroorotase [Enterococcus faecium EnGen0319]
 gb|EOI72038.1| dihydroorotase [Enterococcus faecium EnGen0321]
 gb|EOI74206.1| dihydroorotase [Enterococcus faecium EnGen0323]
 gb|EOI82947.1| dihydroorotase [Enterococcus faecium EnGen0312]
 gb|EOK11970.1| dihydroorotase [Enterococcus faecium EnGen0372]
 gb|EOK16725.1| dihydroorotase [Enterococcus faecium EnGen0371]
 gb|EOK67566.1| dihydroorotase [Enterococcus faecium EnGen0125]
 gb|EOK68846.1| dihydroorotase [Enterococcus faecium EnGen0129]
 gb|EOK70994.1| dihydroorotase [Enterococcus faecium EnGen0134]
 gb|EOK74077.1| dihydroorotase [Enterococcus faecium EnGen0145]
 gb|EOK74756.1| dihydroorotase [Enterococcus faecium EnGen0142]
 gb|EOK80083.1| dihydroorotase [Enterococcus faecium EnGen0146]
 gb|EOK82122.1| dihydroorotase [Enterococcus faecium EnGen0147]
 gb|EOK82893.1| dihydroorotase [Enterococcus faecium EnGen0148]
 gb|EOK90342.1| dihydroorotase [Enterococcus faecium EnGen0151]
 gb|EOK97185.1| dihydroorotase [Enterococcus faecium EnGen0155]
 gb|EOK99184.1| dihydroorotase [Enterococcus faecium EnGen0152]
 gb|EOL00230.1| dihydroorotase [Enterococcus faecium EnGen0153]
 gb|EOL02402.1| dihydroorotase [Enterococcus faecium EnGen0156]
 gb|EOL07118.1| dihydroorotase [Enterococcus faecium EnGen0159]
 gb|EOL08114.1| dihydroorotase [Enterococcus faecium EnGen0158]
 gb|EOL70155.1| dihydroorotase [Enterococcus faecium EnGen0305]
 gb|EOL72571.1| dihydroorotase [Enterococcus faecium EnGen0320]
 gb|EOM02947.1| dihydroorotase [Enterococcus faecium EnGen0258]
 gb|EOM15708.1| dihydroorotase [Enterococcus faecium EnGen0262]
 gb|EOM19491.1| dihydroorotase [Enterococcus faecium EnGen0193]
 gb|EOM22388.1| dihydroorotase [Enterococcus faecium EnGen0192]
 gb|EOM33787.1| dihydroorotase [Enterococcus faecium EnGen0254]
 gb|EOM34216.1| dihydroorotase [Enterococcus faecium EnGen0255]
 gb|EOM38574.1| dihydroorotase [Enterococcus faecium EnGen0172]
 gb|EOM42736.1| dihydroorotase [Enterococcus faecium EnGen0256]
 gb|EOM45895.1| dihydroorotase [Enterococcus faecium EnGen0174]
 gb|EOM57841.1| dihydroorotase [Enterococcus faecium EnGen0186]
 gb|EOM59086.1| dihydroorotase [Enterococcus faecium EnGen0187]
 gb|EOM62892.1| dihydroorotase [Enterococcus faecium EnGen0188]
 gb|EOM66261.1| dihydroorotase [Enterococcus faecium EnGen0163]
 gb|EOM68275.1| dihydroorotase [Enterococcus faecium EnGen0164]
 gb|EOM68584.1| dihydroorotase [Enterococcus faecium EnGen0165]
 gb|EOT37279.1| dihydroorotase [Enterococcus faecium EnGen0376]
 gb|EOT54907.1| dihydroorotase [Enterococcus faecium EnGen0375]
 gb|EOT88948.1| dihydroorotase [Enterococcus faecium EnGen0375]
 gb|EOT95112.1| dihydroorotase [Enterococcus faecium EnGen0376]
 gb|EOT97432.1| dihydroorotase [Enterococcus faecium EnGen0377]
 gb|EOU02054.1| dihydroorotase [Enterococcus faecium EnGen0377]
 gb|EOU03095.1| dihydroorotase [Enterococcus faecium ATCC 8459]
 gb|EPI18126.1| dihydroorotase [Enterococcus faecium SD1C-2]
 gb|EPI23979.1| dihydroorotase [Enterococcus faecium OC2A-1]
 gb|EPI24798.1| dihydroorotase [Enterococcus faecium LA4B-2]
 gb|AGS75332.1| Dihydroorotase [Enterococcus faecium Aus0085]
 gb|EQI97904.1| dihydroorotase [Clostridium difficile Y384]
 gb|ERT32037.1| dihydroorotase [Enterococcus faecium BM4538]
 gb|ERT34680.1| dihydroorotase [Enterococcus faecium NEF1]
 gb|ERT51001.1| dihydroorotase [Enterococcus faecium 10/96A]
 gb|EZP91620.1| dihydroorotase [Enterococcus faecium VRE1044]
 gb|EZP93648.1| dihydroorotase [Enterococcus faecium VSE1036]
 gb|EZP97757.1| dihydroorotase [Enterococcus faecium VRE1261]
 gb|EZP99785.1| dihydroorotase [Enterococcus faecium VRE0576]
 gb|KEI55600.1| dihydroorotase [Enterococcus faecium UC8733]
 gb|KEI56583.1| dihydroorotase [Enterococcus faecium UC10237]
 gb|KEI60316.1| dihydroorotase [Enterococcus faecium UC7251]
 gb|KFO17041.1| dihydroorotase [Enterococcus faecium UC7267]
 gb|KGK75598.1| dihydroorotase [Enterococcus faecium]
 gb|KGK77561.1| dihydroorotase [Enterococcus faecium]
 gb|KGQ76771.1| dihydroorotase [Enterococcus faecium]
 gb|KGQ78401.1| dihydroorotase [Enterococcus faecium]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_010722790.1| dihydroorotase [Enterococcus faecium]
 gb|EOK87878.1| dihydroorotase [Enterococcus faecium EnGen0149]
 gb|EOK90670.1| dihydroorotase [Enterococcus faecium EnGen0150]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002318756.1| dihydroorotase [Enterococcus faecium]
 gb|EFF32592.1| dihydroorotase [Enterococcus faecium E1039]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002339315.1| dihydroorotase [Enterococcus faecium]
 gb|ELB26176.1| dihydroorotase [Enterococcus faecium EnGen0039]
 gb|ELB63129.1| dihydroorotase [Enterococcus faecium EnGen0052]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002327046.1| dihydroorotase [Enterococcus faecium]
 gb|EJY49606.1| dihydroorotase [Enterococcus faecium 504]
 gb|ELA63595.1| dihydroorotase [Enterococcus faecium EnGen0014]
 gb|EOL69313.1| dihydroorotase [Enterococcus faecium EnGen0308]
 gb|EOM04716.1| dihydroorotase [Enterococcus faecium EnGen0259]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_010728367.1| dihydroorotase [Enterococcus faecium]
 gb|EOG09027.1| dihydroorotase [Enterococcus faecium EnGen0176]
 gb|EOM39649.1| dihydroorotase [Enterococcus faecium EnGen0173]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002323286.1| dihydroorotase [Enterococcus faecium]
 gb|EHM35919.1| dihydroorotase [Enterococcus faecium E4452]
 gb|ELB19759.1| dihydroorotase [Enterococcus faecium EnGen0025]
 gb|ELB68164.1| dihydroorotase [Enterococcus faecium EnGen0054]
 gb|EOD85539.1| dihydroorotase [Enterococcus faecium EnGen0006]
 gb|EOF92713.1| dihydroorotase [Enterococcus faecium EnGen0166]
 gb|EOF97705.1| dihydroorotase [Enterococcus faecium EnGen0167]
 gb|EOM05767.1| dihydroorotase [Enterococcus faecium EnGen0260]
 gb|EOM12102.1| dihydroorotase [Enterococcus faecium EnGen0261]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_002306761.1| dihydroorotase [Enterococcus faecium]
 gb|EEV47633.1| dihydroorotase [Enterococcus faecium 1,231,501]
 gb|ELA81560.1| dihydroorotase [Enterococcus faecium EnGen0004]
 gb|EPI11954.1| dihydroorotase [Enterococcus faecium SD3B-2]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFMKSPFGIV  326



>ref|WP_019723657.1| dihydroorotase [Enterococcus mundtii]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFLQSPFGIV  326



>ref|WP_034688203.1| dihydroorotase [Enterococcus mundtii]
 gb|EYT96127.1| dihydroorotase [Enterococcus mundtii CRL35]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFLQSPFGIV  326



>ref|WP_010735515.1| dihydroorotase [Enterococcus mundtii]
 ref|YP_008824225.1| dihydroorotase [Enterococcus mundtii QU 25]
 gb|EOH61619.1| dihydroorotase [Enterococcus mundtii ATCC 882]
 gb|EOU12597.1| dihydroorotase [Enterococcus mundtii ATCC 882]
 dbj|BAO06896.1| dihydroorotase [Enterococcus mundtii QU 25]
Length=426

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSQSFLQSPFGIV  326



>ref|WP_016620156.1| dihydroorotase [Enterococcus faecalis]
 gb|EPH95015.1| dihydroorotase [Enterococcus faecalis 06-MB-DW-09]
Length=427

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGYEEKMQSFLKAPFGIV  326



>ref|WP_010748373.1| dihydroorotase [Enterococcus casseliflavus]
 gb|EOH83744.1| dihydroorotase [Enterococcus flavescens ATCC 49996]
 gb|EOU11239.1| dihydroorotase [Enterococcus flavescens ATCC 49996]
Length=427

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGYEEKMQSFLKAPFGIV  326



>ref|WP_016609311.1| dihydroorotase [Enterococcus casseliflavus]
 gb|EPH64315.1| dihydroorotase [Enterococcus casseliflavus 14-MB-W-14]
Length=427

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGYEEKMQSFLKAPFGIV  326



>ref|WP_015509725.1| dihydroorotase [Enterococcus casseliflavus]
 ref|YP_007752858.1| dihydroorotase [Enterococcus casseliflavus EC20]
 gb|EEV38723.1| dihydroorotase [Enterococcus casseliflavus EC20]
Length=427

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGYEEKMQSFLKAPFGIV  326



>ref|WP_005226117.1| dihydroorotase [Enterococcus casseliflavus]
 gb|EEV29090.1| dihydroorotase [Enterococcus casseliflavus EC30]
 gb|EEV35421.1| dihydroorotase [Enterococcus casseliflavus EC10]
Length=427

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGYEEKMQSFLKAPFGIV  326



>ref|WP_016611753.1| dihydroorotase [Enterococcus faecium]
 gb|EPH67102.1| dihydroorotase [Enterococcus faecium 13.SD.W.09]
Length=427

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGYEEKMKSFLKAPFGIV  326



>ref|WP_005235986.1| dihydroorotase [Enterococcus casseliflavus]
 gb|EGC68907.1| amidohydrolase family protein [Enterococcus casseliflavus ATCC 
12755]
Length=427

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGYEEKMKSFLKAPFGIV  326



>ref|WP_010488291.1| dihydroorotase [Lactobacillus zeae]
Length=424

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK+ SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKSGSFKTAAFGIV  322



>ref|WP_015694872.1| dihydroorotase [Melissococcus plutonius]
 ref|YP_005319530.1| dihydroorotase [Melissococcus plutonius DAT561]
 dbj|BAL62035.1| dihydroorotase [Melissococcus plutonius DAT561]
Length=427

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGIEEKNQSFLKAPFGIV  326



>ref|WP_029328401.1| dihydroorotase, partial [Lactobacillus paracasei]
Length=310

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  209  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  246



>ref|WP_035239745.1| dihydroorotase [Desulfobacter vibrioformis]
Length=429

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGLCDGT+  IATD+APHA +EK   F  AAFG++
Sbjct  295  AIIEGLCDGTIDMIATDHAPHAEDEKQVEFDRAAFGIV  332



>ref|WP_016424847.1| dihydroorotase [Staphylococcus sp. HGB0015]
 gb|EPD52525.1| dihydroorotase [Staphylococcus sp. HGB0015]
Length=424

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAAEEKAQPMTRAPFGIV  324



>ref|WP_016370758.1| dihydroorotase, partial [Lactobacillus paracasei]
 gb|EPC56890.1| dihydroorotase, partial [Lactobacillus paracasei subsp. paracasei 
Lpp189]
Length=143

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  7    ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  44



>ref|WP_022079789.1| dihydroorotase [Ruminococcus sp. CAG:488]
 emb|CDA19104.1| dihydroorotase [Ruminococcus sp. CAG:488]
Length=422

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EG+CDGT+  IATD+APH+AEEK+   +D+A G++
Sbjct  286  ALIEGICDGTIDMIATDHAPHSAEEKSKGLKDSAMGIV  323



>ref|WP_038560014.1| dihydroorotase [Terribacillus aidingensis]
 gb|AIF66306.1| dihydroorotase [Terribacillus aidingensis]
Length=426

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+  IATD+APH AEEK  S  DA+FG++
Sbjct  287  ALIEGLLDGTIDMIATDHAPHTAEEKNVSMLDASFGIV  324



>ref|WP_016176696.1| dihydroorotase [Enterococcus durans]
 gb|EOT35361.1| dihydroorotase [Enterococcus durans ATCC 6056]
 gb|EOU19314.1| dihydroorotase [Enterococcus durans ATCC 6056]
Length=426

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK+ SF ++ FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKSKSFLESPFGIV  326



>ref|WP_035406840.1| dihydroorotase [Exiguobacterium sp. RIT341]
 gb|EZP60758.1| Dihydroorotase [Exiguobacterium sp. RIT341]
Length=423

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGV  10
            A++EGL DGT+ CIATD+APHAAEEKA     A FG+
Sbjct  283  ALLEGLADGTIDCIATDHAPHAAEEKALGIERAPFGI  319



>ref|WP_010780777.1| dihydroorotase [Enterococcus gilvus]
 gb|EOI56487.1| dihydroorotase [Enterococcus gilvus ATCC BAA-350]
 gb|EOW82263.1| dihydroorotase [Enterococcus gilvus ATCC BAA-350]
Length=426

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGFEEKNQSFLKAPFGIV  326



>ref|WP_024305608.1| dihydroorotase [Lactobacillus rhamnosus]
Length=424

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  322



>ref|WP_019469329.1| dihydroorotase [Staphylococcus sp. AL1]
Length=424

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_002507918.1| MULTISPECIES: dihydroorotase [Staphylococcus]
 emb|CCI60481.1| dihydroorotase [Staphylococcus equorum subsp. equorum Mu2]
 gb|EJX17666.1| dihydroorotase [Staphylococcus sp. OJ82]
Length=424

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHATEEKAQPMTKAPFGIV  324



>ref|WP_021338703.1| dihydroorotase [Staphylococcus equorum]
 gb|ERH35962.1| dihydroorotase [Staphylococcus equorum UMC-CNS-924]
Length=424

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHATEEKAQPMTKAPFGIV  324



>ref|WP_023468787.1| MULTISPECIES: dihydroorotase [Exiguobacterium]
 ref|YP_008801375.1| dihydroorotase [Exiguobacterium sp. MH3]
 gb|AHA30173.1| dihydroorotase [Exiguobacterium sp. MH3]
Length=423

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGV  10
            A++EGL DGT+ CIATD+APHAAEEKA     A FG+
Sbjct  283  ALLEGLADGTIDCIATDHAPHAAEEKALGIERAPFGI  319



>ref|WP_025896388.1| dihydroorotase [Lactobacillus delbrueckii]
Length=427

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   + AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMQKAAFGIIGN  326



>ref|WP_029342126.1| dihydroorotase [Exiguobacterium acetylicum]
Length=423

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGV  10
            A++EGL DGT+ CIATD+APHAAEEKA     A FG+
Sbjct  283  ALLEGLADGTIDCIATDHAPHAAEEKALGIERAPFGI  319



>ref|WP_016171983.1| dihydroorotase [Enterococcus dispar]
 gb|EOT43445.1| dihydroorotase [Enterococcus dispar ATCC 51266]
 gb|EOW85107.1| dihydroorotase [Enterococcus dispar ATCC 51266]
Length=426

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGFEEKNQSFLKAPFGIV  326



>ref|WP_026827949.1| dihydroorotase [Exiguobacterium sibiricum]
Length=423

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGV  10
            A++EGL DGT+ CIATD+APHAAEEKA     A FG+
Sbjct  283  ALLEGLLDGTIDCIATDHAPHAAEEKALGIERAPFGI  319



>ref|WP_010815991.1| dihydroorotase [Enterococcus faecalis]
 gb|EOL30738.1| dihydroorotase [Enterococcus faecalis EnGen0346]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002405691.1| dihydroorotase [Enterococcus faecalis]
 gb|EFQ16625.1| amidohydrolase family protein [Enterococcus faecalis EnGen0311]
 gb|EOI25130.1| dihydroorotase [Enterococcus faecalis EnGen0251]
 gb|EOI92923.1| dihydroorotase [Enterococcus faecalis EnGen0311]
 gb|EOL65774.1| dihydroorotase [Enterococcus faecalis EnGen0247]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_033625714.1| dihydroorotase [Enterococcus faecalis]
 gb|KAJ62021.1| Dihydroorotase [Enterococcus faecalis FL2]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010830260.1| dihydroorotase [Enterococcus faecalis]
 gb|EOL18951.1| dihydroorotase [Enterococcus faecalis EnGen0331]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010707524.1| dihydroorotase [Enterococcus faecalis]
 gb|EOK46633.1| dihydroorotase [Enterococcus faecalis EnGen0062]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002407807.1| dihydroorotase [Enterococcus faecalis]
 gb|EFQ69626.1| amidohydrolase family protein [Enterococcus faecalis TX0470]
 gb|EOK01750.1| dihydroorotase [Enterococcus faecalis EnGen0360]
 gb|KAJ65071.1| Dihydroorotase [Enterococcus faecalis MN16]
 gb|KAJ73815.1| Dihydroorotase [Enterococcus faecalis MD6]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_005685855.1| dihydroorotase [Lactobacillus rhamnosus]
 gb|EDY98774.1| Dihydroorotase [Lactobacillus rhamnosus HN001]
 gb|KFK47742.1| dihydroorotase [Lactobacillus rhamnosus]
Length=424

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  322



>ref|WP_024041785.1| Dihydroorotase [Enterococcus faecalis]
 gb|ETJ08907.1| Dihydroorotase [Enterococcus faecalis DORA_14]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010773742.1| dihydroorotase [Enterococcus faecalis]
 gb|EOL16358.1| dihydroorotase [Enterococcus faecalis EnGen0339]
 gb|EOL55994.1| dihydroorotase [Enterococcus faecalis EnGen0239]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010820863.1| dihydroorotase [Enterococcus faecalis]
 gb|EOJ73224.1| dihydroorotase [Enterococcus faecalis EnGen0337]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010819415.1| dihydroorotase [Enterococcus faecalis]
 gb|EOJ64410.1| dihydroorotase [Enterococcus faecalis EnGen0336]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010717329.1| dihydroorotase [Enterococcus faecalis]
 gb|EOF39626.1| dihydroorotase [Enterococcus faecalis EnGen0101]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002379495.1| dihydroorotase [Enterococcus faecalis]
 gb|EEU91231.1| dihydroorotase [Enterococcus faecalis T11]
 gb|EPI36490.1| dihydroorotase [Enterococcus faecalis SLO2C-1]
 gb|ETU09557.1| dihydroorotase [Enterococcus faecalis B301]
 gb|ETU45198.1| dihydroorotase [Enterococcus faecalis B345]
 gb|ETU47559.1| dihydroorotase [Enterococcus faecalis B347]
 gb|KAJ58662.1| Dihydroorotase [Enterococcus faecalis GA2]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002364044.1| MULTISPECIES: dihydroorotase [Enterococcus]
 ref|YP_007153265.1| dihydroorotase [Enterococcus faecalis str. Symbioflor 1]
 gb|EEN75225.1| amidohydrolase family protein [Enterococcus faecalis TX1322]
 gb|EEU17914.1| dihydroorotase multifunctional complex type [Enterococcus faecalis 
ATCC 4200]
 gb|EEU26770.1| dihydroorotase [Enterococcus faecalis T8]
 gb|EEU66255.1| dihydroorotase multifunctional complex type [Enterococcus faecalis 
DS5]
 gb|EEU72105.1| dihydroorotase [Enterococcus faecalis HIP11704]
 gb|EEU82336.1| dihydroorotase multifunctional complex type [Enterococcus faecalis 
D6]
 gb|EFK77790.1| dihydroorotase [Enterococcus faecalis TUSoD Ef11]
 gb|EFM66656.1| amidohydrolase family protein [Enterococcus faecalis TX0411]
 gb|EFM69326.1| amidohydrolase family protein [Enterococcus faecalis TX0109]
 gb|EFM76644.1| amidohydrolase family protein [Enterococcus faecalis TX2134]
 gb|EFM79081.1| amidohydrolase family protein [Enterococcus faecalis TX0855]
 gb|EFT39806.1| amidohydrolase family protein [Enterococcus faecalis TX2137]
 gb|EFT41481.1| amidohydrolase family protein [Enterococcus faecalis TX4000]
 gb|EFT43954.1| amidohydrolase family protein [Enterococcus faecalis TX0017]
 gb|EFT49062.1| amidohydrolase family protein [Enterococcus faecalis TX0027]
 gb|EFT88973.1| amidohydrolase family protein [Enterococcus faecalis TX2141]
 gb|EFT94778.1| amidohydrolase family protein [Enterococcus faecalis TX0012]
 gb|EFU06382.1| amidohydrolase family protein [Enterococcus faecalis TX0645]
 gb|EFU07887.1| amidohydrolase family protein [Enterococcus faecalis TX1302]
 gb|EJU87714.1| dihydroorotase [Enterococcus faecalis 599]
 emb|CCO72551.1| dihydroorotase [Enterococcus faecalis str. Symbioflor 1]
 gb|EOD92677.1| dihydroorotase [Enterococcus faecalis EnGen0076]
 gb|EOD96272.1| dihydroorotase [Enterococcus faecalis EnGen0059]
 gb|EOE03325.1| dihydroorotase [Enterococcus faecalis EnGen0075]
 gb|EOE14104.1| dihydroorotase [Enterococcus faecalis EnGen0079]
 gb|EOE14437.1| dihydroorotase [Enterococcus faecalis EnGen0080]
 gb|EOE18728.1| dihydroorotase [Enterococcus faecalis EnGen0060]
 gb|EOE24706.1| dihydroorotase [Enterococcus faecalis EnGen0083]
 gb|EOE25932.1| dihydroorotase [Enterococcus faecalis EnGen0081]
 gb|EOE27054.1| dihydroorotase [Enterococcus faecalis EnGen0082]
 gb|EOE29186.1| dihydroorotase [Enterococcus faecalis EnGen0071]
 gb|EOE34207.1| dihydroorotase [Enterococcus faecalis EnGen0072]
 gb|EOF25788.1| dihydroorotase [Enterococcus faecalis EnGen0086]
 gb|EOF27721.1| dihydroorotase [Enterococcus faecalis EnGen0115]
 gb|EOF34014.1| dihydroorotase [Enterococcus faecalis EnGen0103]
 gb|EOF34760.1| dihydroorotase [Enterococcus faecalis EnGen0102]
 gb|EOF40933.1| dihydroorotase [Enterococcus faecalis EnGen0104]
 gb|EOF42883.1| dihydroorotase [Enterococcus faecalis EnGen0105]
 gb|EOF46764.1| dihydroorotase [Enterococcus faecalis EnGen0116]
 gb|EOF50059.1| dihydroorotase [Enterococcus faecalis EnGen0118]
 gb|EOF52295.1| dihydroorotase [Enterococcus faecalis EnGen0117]
 gb|EOI03790.1| dihydroorotase [Enterococcus faecalis EnGen0241]
 gb|EOI39209.1| dihydroorotase [Enterococcus faecalis EnGen0299]
 gb|EOJ46671.1| dihydroorotase [Enterococcus faecalis EnGen0361]
 gb|EOJ51678.1| dihydroorotase [Enterococcus faecalis EnGen0345]
 gb|EOJ77179.1| dihydroorotase [Enterococcus faecalis EnGen0355]
 gb|EOJ85126.1| dihydroorotase [Enterococcus faecalis EnGen0357]
 gb|EOJ88525.1| dihydroorotase [Enterococcus faecalis EnGen0358]
 gb|EOK30590.1| dihydroorotase [Enterococcus faecalis EnGen0333]
 gb|EOK31655.1| dihydroorotase [Enterococcus faecalis EnGen0328]
 gb|EOK36479.1| dihydroorotase [Enterococcus faecalis EnGen0330]
 gb|EOK39759.1| dihydroorotase [Enterococcus faecalis EnGen0335]
 gb|EOK40324.1| dihydroorotase [Enterococcus faecalis EnGen0332]
 gb|EOK55390.1| dihydroorotase [Enterococcus faecalis EnGen0066]
 gb|EOK58364.1| dihydroorotase [Enterococcus faecalis EnGen0063]
 gb|EOL28771.1| dihydroorotase [Enterococcus faecalis EnGen0354]
 gb|EOL35006.1| dihydroorotase [Enterococcus faecalis ATCC 19433]
 gb|EOL39919.1| dihydroorotase [Enterococcus faecalis EnGen0348]
 gb|EOL83022.1| dihydroorotase [Enterococcus faecalis EnGen0295]
 gb|EOL87958.1| dihydroorotase [Enterococcus faecalis EnGen0283]
 gb|EOL90633.1| dihydroorotase [Enterococcus faecalis EnGen0366]
 gb|EOL93636.1| dihydroorotase [Enterococcus faecalis EnGen0344]
 gb|EOL96701.1| dihydroorotase [Enterococcus faecalis EnGen0341]
 gb|EOM01085.1| dihydroorotase [Enterococcus faecalis EnGen0233]
 gb|EOM15340.1| dihydroorotase [Enterococcus faecalis EnGen0234]
 gb|EOM24270.1| dihydroorotase [Enterococcus faecalis EnGen0253]
 gb|EOM29449.1| dihydroorotase [Enterococcus faecalis EnGen0232]
 gb|EPH69679.1| dihydroorotase [Enterococcus faecalis 20-SD-BW-06]
 gb|EPH74166.1| dihydroorotase [Enterococcus faecalis 02-MB-P-10]
 gb|EPH75905.1| dihydroorotase [Enterococcus faecalis D811610-10]
 gb|EPI02266.1| dihydroorotase [Enterococcus faecalis 20-SD-BW-08]
 gb|EPI22512.1| dihydroorotase [Enterococcus faecium SB2C-2]
 gb|EPI26808.1| dihydroorotase [Enterococcus faecalis WKS-26-18-2]
 gb|EPI30293.1| dihydroorotase [Enterococcus faecalis VC1B-1]
 gb|EPI31224.1| dihydroorotase [Enterococcus faecalis UP2S-6]
 gb|EPI39491.1| dihydroorotase [Enterococcus faecalis LA3B-2]
 gb|ERL09368.1| dihydroorotase [Enterococcus faecalis E12]
 gb|ERT23739.1| dihydroorotase [Enterococcus faecalis JH2-2]
 gb|ERT24830.1| dihydroorotase [Enterococcus faecalis BM4539]
 gb|ETT91910.1| dihydroorotase [Enterococcus faecalis B284]
 gb|ETU14564.1| dihydroorotase [Enterococcus faecalis B312]
 gb|ETU22450.1| dihydroorotase [Enterococcus faecalis B318]
 gb|ETU36714.1| dihydroorotase [Enterococcus faecalis B327]
 gb|ETU40191.1| dihydroorotase [Enterococcus faecalis B337]
 gb|ETU54515.1| dihydroorotase [Enterococcus faecalis B350]
 gb|ETU64023.1| dihydroorotase [Enterococcus faecalis B375]
 gb|AHI40837.1| Dihydroorotase [Enterococcus faecalis DENG1]
 gb|KAJ70299.1| Dihydroorotase [Enterococcus faecalis MTmid8]
 gb|KAJ77097.1| Dihydroorotase [Enterococcus faecalis AZ19]
 gb|KAJ80206.1| Dihydroorotase [Enterococcus faecalis NJ44]
 gb|KAJ80886.1| Dihydroorotase [Enterococcus faecalis GAN13]
 gb|KAJ81718.1| Dihydroorotase [Enterococcus faecalis MTUP9]
 gb|KDN89274.1| dihydroorotase [Enterococcus faecalis]
 gb|AIL03802.1| dihydroorotase [Enterococcus faecalis ATCC 29212]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>gb|KHJ56862.1| dihydroorotase [Lactobacillus rhamnosus]
Length=424

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  322



>ref|WP_029607192.1| dihydroorotase [Lactobacillus rhamnosus]
Length=424

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  322



>ref|WP_005710474.1| dihydroorotase [Lactobacillus rhamnosus]
 ref|YP_008203056.1| Dihydroorotase [Lactobacillus rhamnosus LOCK900]
 gb|EHJ24108.1| dihydroorotase [Lactobacillus rhamnosus R0011]
 gb|EHJ34153.1| dihydroorotase [Lactobacillus rhamnosus ATCC 21052]
 gb|EKS48793.1| Dihydroorotase [Lactobacillus rhamnosus LRHMDP3]
 gb|EKS49432.1| Dihydroorotase [Lactobacillus rhamnosus LRHMDP2]
 gb|AGP71239.1| Dihydroorotase [Lactobacillus rhamnosus LOCK900]
Length=424

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  322



>ref|WP_014569648.1| dihydroorotase [Lactobacillus rhamnosus]
 ref|YP_003171204.1| dihydroorotase [Lactobacillus rhamnosus GG]
 ref|YP_005865893.1| dihydroorotase [Lactobacillus rhamnosus GG]
 emb|CAR87353.1| Dihydroorotase [Lactobacillus rhamnosus GG]
 dbj|BAI41928.1| dihydroorotase [Lactobacillus rhamnosus GG]
Length=424

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  322



>ref|WP_005689381.1| dihydroorotase [Lactobacillus rhamnosus]
 ref|YP_003174165.1| dihydroorotase [Lactobacillus rhamnosus Lc 705]
 ref|YP_005873089.1| dihydroorotase [Lactobacillus rhamnosus ATCC 8530]
 ref|YP_008206013.1| Dihydroorotase [Lactobacillus rhamnosus LOCK908]
 gb|EEN80365.1| dihydroorotase [Lactobacillus rhamnosus LMS2-1]
 emb|CAR90314.1| Dihydroorotase [Lactobacillus rhamnosus Lc 705]
 gb|AER64236.1| dihydroorotase [Lactobacillus rhamnosus ATCC 8530]
 gb|AGP74156.1| Dihydroorotase [Lactobacillus rhamnosus LOCK908]
 gb|ETW69509.1| dihydroorotase [Lactobacillus rhamnosus 2166]
 gb|KDS83746.1| dihydroorotase [Lactobacillus rhamnosus 51B]
Length=424

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  322



>ref|WP_002357412.1| MULTISPECIES: dihydroorotase [Enterococcus]
 ref|NP_815424.1| dihydroorotase [Enterococcus faecalis V583]
 ref|YP_005708486.1| dihydroorotase [Enterococcus faecalis OG1RF]
 ref|YP_005706049.1| dihydroorotase [Enterococcus faecalis 62]
 ref|YP_007807597.1| dihydroorotase [Enterococcus sp. 7L76]
 sp|Q834E0.1|PYRC_ENTFA RecName: Full=Dihydroorotase; Short=DHOase [Enterococcus faecalis 
V583]
 gb|AAO81494.1| dihydroorotase [Enterococcus faecalis V583]
 gb|EEI11559.1| amidohydrolase family protein [Enterococcus faecalis TX0104]
 gb|EEI58301.1| amidohydrolase family protein [Enterococcus faecalis EnGen0297]
 gb|EEN71127.1| amidohydrolase family protein [Enterococcus faecalis ATCC 29200]
 gb|EET96140.1| dihydroorotase [Enterococcus faecalis T1]
 gb|EET99192.1| dihydroorotase [Enterococcus faecalis T2]
 gb|EEU23593.1| dihydroorotase multifunctional complex type [Enterococcus faecalis 
T3]
 gb|EEU68907.1| dihydroorotase [Enterococcus faecalis Merz96]
 gb|EEU74491.1| dihydroorotase [Enterococcus faecalis JH1]
 gb|EEU85364.1| dihydroorotase [Enterococcus faecalis CH188]
 gb|EEU94249.1| dihydroorotase [Enterococcus faecalis X98]
 gb|EFE16640.1| amidohydrolase family protein [Enterococcus faecalis R712]
 gb|EFE18748.1| amidohydrolase family protein [Enterococcus faecalis S613]
 gb|EFG21906.1| dihydroorotase [Enterococcus faecalis PC1.1]
 emb|CBL31736.1| dihydroorotase [Enterococcus sp. 7L76]
 gb|EFM74499.1| amidohydrolase family protein [Enterococcus faecalis TX0860]
 gb|EFM82725.1| amidohydrolase family protein [Enterococcus faecalis TX4248]
 gb|EFQ09997.1| amidohydrolase family protein [Enterococcus faecalis DAPTO 512]
 gb|EFQ13648.1| amidohydrolase family protein [Enterococcus faecalis TX0102]
 gb|EFQ68133.1| amidohydrolase family protein [Enterococcus faecalis DAPTO 516]
 gb|EFT96347.1| amidohydrolase family protein [Enterococcus faecalis TX0031]
 gb|EFU00149.1| amidohydrolase family protein [Enterococcus faecalis TX0043]
 gb|EFU02243.1| amidohydrolase family protein [Enterococcus faecalis TX0312]
 gb|EFU12901.1| amidohydrolase family protein [Enterococcus faecalis TX1341]
 gb|EFU13626.1| amidohydrolase family protein [Enterococcus faecalis TX1342]
 gb|EFU16459.1| amidohydrolase family protein [Enterococcus faecalis TX1346]
 gb|EFU88263.1| amidohydrolase family protein [Enterococcus faecalis TX0309B]
 gb|EFU92838.1| amidohydrolase family protein [Enterococcus faecalis TX0309A]
 gb|ADX80316.1| dihydroorotase [Enterococcus faecalis 62]
 gb|AEA94116.1| dihydroorotase [Enterococcus faecalis OG1RF]
 gb|EGG53565.1| dihydroorotase [Enterococcus faecalis TX1467]
 gb|EJU85568.1| dihydroorotase [Enterococcus faecalis ERV116]
 gb|EJU91356.1| dihydroorotase [Enterococcus faecalis ERV103]
 gb|EJU98569.1| dihydroorotase [Enterococcus faecalis ERV129]
 gb|EJU98678.1| dihydroorotase [Enterococcus faecalis ERV31]
 gb|EJV02206.1| dihydroorotase [Enterococcus faecalis ERV25]
 gb|EJV02501.1| dihydroorotase [Enterococcus faecalis ERV37]
 gb|EJV09325.1| dihydroorotase [Enterococcus faecalis ERV62]
 gb|EJV11015.1| dihydroorotase [Enterococcus faecalis ERV41]
 gb|EJV18495.1| dihydroorotase [Enterococcus faecalis ERV65]
 gb|EJV18692.1| dihydroorotase [Enterococcus faecalis ERV63]
 gb|EJV19838.1| dihydroorotase [Enterococcus faecalis ERV68]
 gb|EJV24626.1| dihydroorotase [Enterococcus faecalis ERV81]
 gb|EJV26263.1| dihydroorotase [Enterococcus faecalis ERV72]
 gb|EJV28999.1| dihydroorotase [Enterococcus faecalis ERV73]
 gb|EJV32294.1| dihydroorotase [Enterococcus faecalis ERV85]
 gb|EJV39338.1| dihydroorotase [Enterococcus faecalis ERV93]
 gb|ELA01998.1| dihydroorotase [Enterococcus faecalis OG1X]
 gb|ELA05679.1| dihydroorotase [Enterococcus faecalis M7]
 gb|EOD88086.1| dihydroorotase [Enterococcus faecalis EnGen0065]
 gb|EOD99484.1| dihydroorotase [Enterococcus faecalis EnGen0074]
 gb|EOE04606.1| dihydroorotase [Enterococcus faecalis EnGen0073]
 gb|EOE08272.1| dihydroorotase [Enterococcus faecalis EnGen0058]
 gb|EOE10629.1| dihydroorotase [Enterococcus faecalis EnGen0078]
 gb|EOE38421.1| dihydroorotase [Enterococcus faecalis EnGen0070]
 gb|EOE41413.1| dihydroorotase [Enterococcus faecalis EnGen0106]
 gb|EOE44689.1| dihydroorotase [Enterococcus faecalis EnGen0067]
 gb|EOE47563.1| dihydroorotase [Enterococcus faecalis EnGen0088]
 gb|EOE48493.1| dihydroorotase [Enterococcus faecalis EnGen0089]
 gb|EOE53410.1| dihydroorotase [Enterococcus faecalis EnGen0120]
 gb|EOE56259.1| dihydroorotase [Enterococcus faecalis EnGen0090]
 gb|EOE59921.1| dihydroorotase [Enterococcus faecalis EnGen0109]
 gb|EOE63250.1| dihydroorotase [Enterococcus faecalis EnGen0091]
 gb|EOE64223.1| dihydroorotase [Enterococcus faecalis EnGen0110]
 gb|EOE70070.1| dihydroorotase [Enterococcus faecalis EnGen0092]
 gb|EOE73409.1| dihydroorotase [Enterococcus faecalis EnGen0085]
 gb|EOE74310.1| dihydroorotase [Enterococcus faecalis EnGen0111]
 gb|EOE82514.1| dihydroorotase [Enterococcus faecalis EnGen0119]
 gb|EOE84588.1| dihydroorotase [Enterococcus faecalis EnGen0094]
 gb|EOE89105.1| dihydroorotase [Enterococcus faecalis EnGen0095]
 gb|EOE91485.1| dihydroorotase [Enterococcus faecalis EnGen0096]
 gb|EOE94828.1| dihydroorotase [Enterococcus faecalis EnGen0097]
 gb|EOE98252.1| dihydroorotase [Enterococcus faecalis EnGen0098]
 gb|EOF00857.1| dihydroorotase [Enterococcus faecalis EnGen0112]
 gb|EOF04758.1| dihydroorotase [Enterococcus faecalis EnGen0099]
 gb|EOF08953.1| dihydroorotase [Enterococcus faecalis EnGen0113]
 gb|EOF10006.1| dihydroorotase [Enterococcus faecalis EnGen0114]
 gb|EOF14354.1| dihydroorotase [Enterococcus faecalis EnGen0100]
 gb|EOF18785.1| dihydroorotase [Enterococcus faecalis EnGen0107]
 gb|EOF20656.1| dihydroorotase [Enterococcus faecalis EnGen0087]
 gb|EOF24830.1| dihydroorotase [Enterococcus faecalis EnGen0108]
 gb|EOG33683.1| dihydroorotase [Enterococcus faecalis EnGen0194]
 gb|EOG42693.1| dihydroorotase [Enterococcus faecalis EnGen0196]
 gb|EOG45000.1| dihydroorotase [Enterococcus faecalis EnGen0195]
 gb|EOG47228.1| dihydroorotase [Enterococcus faecalis EnGen0197]
 gb|EOG53849.1| dihydroorotase [Enterococcus faecalis EnGen0199]
 gb|EOG57109.1| dihydroorotase [Enterococcus faecalis EnGen0200]
 gb|EOG61035.1| dihydroorotase [Enterococcus faecalis EnGen0204]
 gb|EOG62578.1| dihydroorotase [Enterococcus faecalis EnGen0207]
 gb|EOG66290.1| dihydroorotase [Enterococcus faecalis EnGen0205]
 gb|EOG70232.1| dihydroorotase [Enterococcus faecalis EnGen0228]
 gb|EOG73976.1| dihydroorotase [Enterococcus faecalis EnGen0206]
 gb|EOG75235.1| dihydroorotase [Enterococcus faecalis EnGen0374]
 gb|EOG78889.1| dihydroorotase [Enterococcus faecalis EnGen0208]
 gb|EOG82976.1| dihydroorotase [Enterococcus faecalis EnGen0209]
 gb|EOG86624.1| dihydroorotase [Enterococcus faecalis EnGen0211]
 gb|EOG87731.1| dihydroorotase [Enterococcus faecalis EnGen0210]
 gb|EOG91925.1| dihydroorotase [Enterococcus faecalis EnGen0212]
 gb|EOG96233.1| dihydroorotase [Enterococcus faecalis EnGen0213]
 gb|EOG97295.1| dihydroorotase [Enterococcus faecalis EnGen0214]
 gb|EOH00695.1| dihydroorotase [Enterococcus faecalis EnGen0215]
 gb|EOH05985.1| dihydroorotase [Enterococcus faecalis EnGen0216]
 gb|EOH07168.1| dihydroorotase [Enterococcus faecalis EnGen0217]
 gb|EOH09981.1| dihydroorotase [Enterococcus faecalis EnGen0218]
 gb|EOH17011.1| dihydroorotase [Enterococcus faecalis EnGen0220]
 gb|EOH18371.1| dihydroorotase [Enterococcus faecalis EnGen0221]
 gb|EOH19478.1| dihydroorotase [Enterococcus faecalis EnGen0219]
 gb|EOH25779.1| dihydroorotase [Enterococcus faecalis EnGen0223]
 gb|EOH28911.1| dihydroorotase [Enterococcus faecalis EnGen0222]
 gb|EOH29973.1| dihydroorotase [Enterococcus faecalis EnGen0224]
 gb|EOH36484.1| dihydroorotase [Enterococcus faecalis EnGen0225]
 gb|EOH37551.1| dihydroorotase [Enterococcus faecalis EnGen0226]
 gb|EOH62911.1| dihydroorotase [Enterococcus faecalis EnGen0235]
 gb|EOI04756.1| dihydroorotase [Enterococcus faecalis EnGen0237]
 gb|EOI11138.1| dihydroorotase [Enterococcus faecalis EnGen0242]
 gb|EOI14259.1| dihydroorotase [Enterococcus faecalis EnGen0244]
 gb|EOI14881.1| dihydroorotase [Enterococcus faecalis EnGen0243]
 gb|EOI19378.1| dihydroorotase [Enterococcus faecalis EnGen0248]
 gb|EOI22599.1| dihydroorotase [Enterococcus faecalis EnGen0252]
 gb|EOI29388.1| dihydroorotase [Enterococcus faecalis EnGen0231]
 gb|EOI32803.1| dihydroorotase [Enterococcus faecalis EnGen0250]
 gb|EOI81356.1| dihydroorotase [Enterococcus faecalis EnGen0310]
 gb|EOI82424.1| dihydroorotase [Enterococcus faecalis EnGen0297]
 gb|EOI88021.1| dihydroorotase [Enterococcus faecalis EnGen0294]
 gb|EOI92018.1| dihydroorotase [Enterococcus faecalis EnGen0298]
 gb|EOI97194.1| dihydroorotase [Enterococcus faecalis EnGen0302]
 gb|EOJ01011.1| dihydroorotase [Enterococcus faecalis EnGen0291]
 gb|EOJ03135.1| dihydroorotase [Enterococcus faecalis EnGen0306]
 gb|EOJ05284.1| dihydroorotase [Enterococcus faecalis EnGen0282]
 gb|EOJ08882.1| dihydroorotase [Enterococcus faecalis ATCC 29200]
 gb|EOJ12358.1| dihydroorotase [Enterococcus faecalis EnGen0304]
 gb|EOJ13629.1| dihydroorotase [Enterococcus faecalis EnGen0279]
 gb|EOJ17512.1| dihydroorotase [Enterococcus faecalis EnGen0281]
 gb|EOJ19809.1| dihydroorotase [Enterococcus faecalis EnGen0287]
 gb|EOJ26111.1| dihydroorotase [Enterococcus faecalis EnGen0286]
 gb|EOJ28871.1| dihydroorotase [Enterococcus faecalis EnGen0300]
 gb|EOJ31991.1| dihydroorotase [Enterococcus faecalis EnGen0293]
 gb|EOJ33633.1| dihydroorotase [Enterococcus faecalis EnGen0290]
 gb|EOJ37316.1| dihydroorotase [Enterococcus faecalis ATCC 27275]
 gb|EOJ40847.1| dihydroorotase [Enterococcus faecalis ATCC 27959]
 gb|EOJ42418.1| dihydroorotase [Enterococcus faecalis EnGen0289]
 gb|EOJ47426.1| dihydroorotase [Enterococcus faecalis EnGen0285]
 gb|EOJ55591.1| dihydroorotase [Enterococcus faecalis EnGen0363]
 gb|EOJ60269.1| dihydroorotase [Enterococcus faecalis EnGen0364]
 gb|EOJ62743.1| dihydroorotase [Enterococcus faecalis EnGen0350]
 gb|EOJ69435.1| dihydroorotase [Enterococcus faecalis EnGen0351]
 gb|EOJ71299.1| dihydroorotase [Enterococcus faecalis EnGen0352]
 gb|EOJ79049.1| dihydroorotase [Enterococcus faecalis EnGen0356]
 gb|EOJ82406.1| dihydroorotase [Enterococcus faecalis EnGen0369]
 gb|EOJ91781.1| dihydroorotase [Enterococcus faecalis EnGen0368]
 gb|EOJ92464.1| dihydroorotase [Enterococcus faecalis EnGen0370]
 gb|EOJ98227.1| dihydroorotase [Enterococcus faecalis EnGen0359]
 gb|EOK08538.1| dihydroorotase [Enterococcus faecalis ATCC 10100]
 gb|EOK21525.1| dihydroorotase [Enterococcus faecalis EnGen0326]
 gb|EOK22947.1| dihydroorotase [Enterococcus faecalis EnGen0329]
 gb|EOK24151.1| dihydroorotase [Enterococcus faecalis EnGen0338]
 gb|EOK32756.1| dihydroorotase [Enterococcus faecalis EnGen0334]
 gb|EOK51066.1| dihydroorotase [Enterococcus faecalis EnGen0064]
 gb|EOK54246.1| dihydroorotase [Enterococcus faecalis EnGen0061]
 gb|EOK62927.1| dihydroorotase [Enterococcus faecalis EnGen0068]
 gb|EOK65757.1| dihydroorotase [Enterococcus faecalis EnGen0069]
 gb|EOL15181.1| dihydroorotase [Enterococcus faecalis EnGen0327]
 gb|EOL24083.1| dihydroorotase [Enterococcus faecalis EnGen0342]
 gb|EOL25657.1| dihydroorotase [Enterococcus faecalis EnGen0365]
 gb|EOL48375.1| dihydroorotase [Enterococcus faecalis EnGen0238]
 gb|EOL53888.1| dihydroorotase [Enterococcus faecalis EnGen0240]
 gb|EOL58236.1| dihydroorotase [Enterococcus faecalis EnGen0245]
 gb|EOL62091.1| dihydroorotase [Enterococcus faecalis EnGen0246]
 gb|EOL76819.1| dihydroorotase [Enterococcus faecalis EnGen0307]
 gb|EOL77795.1| dihydroorotase [Enterococcus faecalis EnGen0280]
 gb|EOL84139.1| dihydroorotase [Enterococcus faecalis EnGen0303]
 gb|EOM49495.1| dihydroorotase [Enterococcus faecalis EnGen0202]
 gb|EOM50602.1| dihydroorotase [Enterococcus faecalis EnGen0201]
 gb|EOM55997.1| dihydroorotase [Enterococcus faecalis EnGen0203]
 gb|EOT50002.1| dihydroorotase [Enterococcus faecalis V583]
 gb|EOT84922.1| dihydroorotase [Enterococcus faecalis V583]
 gb|EPH82848.1| dihydroorotase [Enterococcus faecalis 06-MB-S-10]
 gb|EPH89287.1| dihydroorotase [Enterococcus faecalis 06-MB-S-04]
 gb|EPH94083.1| dihydroorotase [Enterococcus faecalis F01966]
 gb|EPI11079.1| dihydroorotase [Enterococcus faecalis RP2S-4]
 gb|EPR46920.1| dihydroorotase [Enterococcus faecalis 10244]
 gb|ERT27141.1| dihydroorotase [Enterococcus faecalis BM4654]
 gb|ESU75795.1| Dihydroorotase [Enterococcus faecalis CBRD01]
 gb|ETT92485.1| dihydroorotase [Enterococcus faecalis B287]
 gb|ETT96487.1| dihydroorotase [Enterococcus faecalis B289]
 gb|ETT99664.1| dihydroorotase [Enterococcus faecalis B291]
 gb|ETU04304.1| dihydroorotase [Enterococcus faecalis B292]
 gb|ETU05222.1| dihydroorotase [Enterococcus faecalis B293]
 gb|ETU11631.1| dihydroorotase [Enterococcus faecalis B294]
 gb|ETU17484.1| dihydroorotase [Enterococcus faecalis B302]
 gb|ETU20326.1| dihydroorotase [Enterococcus faecalis B316]
 gb|ETU25938.1| dihydroorotase [Enterococcus faecalis B319]
 gb|ETU28796.1| dihydroorotase [Enterococcus faecalis B320]
 gb|ETU34449.1| dihydroorotase [Enterococcus faecalis B324]
 gb|ETU42313.1| dihydroorotase [Enterococcus faecalis B338]
 gb|ETU50218.1| dihydroorotase [Enterococcus faecalis B348]
 gb|ETU57228.1| dihydroorotase [Enterococcus faecalis B363]
 gb|ETU62595.1| dihydroorotase [Enterococcus faecalis B382]
 gb|ETU67902.1| dihydroorotase [Enterococcus faecalis B388]
 gb|KAJ84384.1| Dihydroorotase [Enterococcus faecalis NY9]
 gb|KDE18228.1| dihydroorotase [Enterococcus faecalis 918]
 gb|KGQ74740.1| dihydroorotase [Enterococcus faecalis]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010828229.1| dihydroorotase [Enterococcus faecalis]
 gb|EOK05636.1| dihydroorotase [Enterococcus faecalis EnGen0367]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010827467.1| dihydroorotase [Enterococcus faecalis]
 gb|EOJ99165.1| dihydroorotase [Enterococcus faecalis EnGen0340]
 gb|KGJ34428.1| dihydroorotase [Enterococcus faecalis]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010817937.1| dihydroorotase [Enterococcus faecalis]
 gb|EOJ56796.1| dihydroorotase [Enterococcus faecalis ATCC 35038]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002393366.1| dihydroorotase [Enterococcus faecalis]
 gb|EFU90029.1| amidohydrolase family protein [Enterococcus faecalis TX0630]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002366770.1| dihydroorotase [Enterococcus faecalis]
 gb|EEU77737.1| dihydroorotase multifunctional complex type [Enterococcus faecalis 
E1Sol]
 gb|EEU80369.1| dihydroorotase multifunctional complex type [Enterococcus faecalis 
Fly1]
 gb|EEU88026.1| dihydroorotase multifunctional complex type [Enterococcus faecalis 
ARO1/DG]
 gb|EOI48520.1| dihydroorotase [Enterococcus faecalis EnGen0301]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_016616871.1| dihydroorotase [Enterococcus faecalis]
 gb|EPH82401.1| dihydroorotase [Enterococcus faecalis 02-MB-BW-10]
 gb|ETU58047.1| dihydroorotase [Enterococcus faecalis B373]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_016618342.1| dihydroorotase [Enterococcus faecalis]
 gb|EPH80569.1| dihydroorotase [Enterococcus faecalis B83616-1]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010713358.1| dihydroorotase [Enterococcus faecalis]
 gb|EOE33365.1| dihydroorotase [Enterococcus faecalis EnGen0084]
 gb|EOI30287.1| dihydroorotase [Enterococcus faecalis EnGen0249]
 gb|EOJ22880.1| dihydroorotase [Enterococcus faecalis EnGen0284]
 gb|EOK13454.1| dihydroorotase [Enterococcus faecalis ATCC 6055]
 gb|ETU31577.1| dihydroorotase [Enterococcus faecalis B321]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002420140.1| dihydroorotase [Enterococcus faecalis]
 gb|EJV35150.1| dihydroorotase [Enterococcus faecalis R508]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_016626636.1| dihydroorotase [Enterococcus faecalis]
 gb|EPI02603.1| dihydroorotase [Enterococcus faecalis 20.SD.W.06]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010715248.1| dihydroorotase [Enterococcus faecalis]
 gb|EOE79878.1| dihydroorotase [Enterococcus faecalis EnGen0093]
 gb|EOG51168.1| dihydroorotase [Enterococcus faecalis EnGen0198]
 gb|EPH63796.1| dihydroorotase [Enterococcus faecalis KI-6-1-110608-1]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_014862181.1| dihydroorotase [Enterococcus faecalis]
 ref|YP_006537815.1| dihydroorotase [Enterococcus faecalis D32]
 gb|AFO44338.1| dihydroorotase [Enterococcus faecalis D32]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_010753750.1| dihydroorotase [Enterococcus asini]
 gb|EOH88342.1| dihydroorotase [Enterococcus asini ATCC 700915]
 gb|EOT56139.1| dihydroorotase [Enterococcus asini ATCC 700915]
Length=425

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  288  ALIEGLLDGTIDCIATDHAPHGFEEKNQSFLKAPFGIV  325



>ref|WP_010816556.1| dihydroorotase [Enterococcus faecalis]
 gb|EOL38312.1| dihydroorotase [Enterococcus faecalis EnGen0362]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002394498.1| dihydroorotase [Enterococcus faecalis]
 gb|EFT91429.1| amidohydrolase family protein [Enterococcus faecalis TX4244]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_002480618.1| dihydroorotase [Staphylococcus simulans]
 gb|EKS25894.1| dihydroorotase [Staphylococcus simulans ACS-120-V-Sch1]
 gb|ERS93295.1| dihydroorotase [Staphylococcus simulans UMC-CNS-990]
Length=423

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAA+EKA     A FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHAADEKAQPMTKAPFGIV  324



>ref|WP_029888221.1| dihydroorotase [Enterococcus faecalis]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_033601002.1| dihydroorotase [Enterococcus faecalis]
 gb|KAJ61619.1| Dihydroorotase [Enterococcus faecalis KS19]
Length=427

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKQQSFLNAPFGIV  326



>ref|WP_033571329.1| dihydroorotase [Lactobacillus rhamnosus]
Length=424

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH AEEK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIV  322



>ref|WP_007208294.1| dihydroorotase [Enterococcus italicus]
 gb|EFU73888.1| amidohydrolase family protein [Enterococcus italicus DSM 15952]
Length=426

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK+ SF +A FG++
Sbjct  289  ALIDGLLDGTIDCIATDHAPHGLEEKSQSFLNAPFGIV  326



>gb|KGY36229.1| dihydroorotase [Staphylococcus epidermidis]
Length=425

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  325



>ref|WP_025787524.1| dihydroorotase [Staphylococcus aureus]
Length=425

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA S   A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHARDEKAQSMEKAPFGIV  325



>ref|WP_002510927.1| MULTISPECIES: dihydroorotase [Staphylococcus]
 gb|EJY94602.1| dihydroorotase [Staphylococcus arlettae CVD059]
 gb|ERF49631.1| dihydroorotase [Staphylococcus sp. EGD-HP3]
Length=424

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAA+EKA     A FG++
Sbjct  287  ALLEGLVDGTIDCIATDHAPHAADEKAQPMTKAPFGIV  324



>emb|CEI84367.1| Dihydroorotase [Oceanobacillus oncorhynchi]
Length=427

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH  EEKA  F +A FG++
Sbjct  288  ALIEGLLDGTLDAIATDHAPHGEEEKANGFLEAPFGIV  325



>ref|WP_016185463.1| dihydroorotase [Enterococcus sulfureus]
 gb|EOT47637.1| dihydroorotase [Enterococcus sulfureus ATCC 49903]
 gb|EOT83942.1| dihydroorotase [Enterococcus sulfureus ATCC 49903]
Length=428

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGHEEKCQSFLHAPFGIV  326



>ref|WP_002455449.1| dihydroorotase [Staphylococcus hominis]
 gb|EFS19000.1| dihydroorotase [Staphylococcus hominis subsp. hominis C80]
Length=424

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_002448747.1| dihydroorotase [Staphylococcus hominis]
 gb|EEK12339.1| dihydroorotase [Staphylococcus hominis SK119]
 gb|EHR86566.1| dihydroorotase [Staphylococcus hominis VCU122]
Length=424

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_002879172.1| dihydroorotase [Lactobacillus delbrueckii]
 gb|EOD02656.1| dihydroorotase [Lactobacillus delbrueckii ZN7a-9]
Length=427

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>ref|WP_010772397.1| dihydroorotase [Enterococcus caccae]
 gb|EOL44263.1| dihydroorotase [Enterococcus caccae ATCC BAA-1240]
 gb|EOT68621.1| dihydroorotase [Enterococcus caccae ATCC BAA-1240]
Length=427

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  +F  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKNQTFLKAPFGIV  326



>ref|WP_017174558.1| MULTISPECIES: dihydroorotase [Staphylococcus]
 gb|EUZ70158.1| dihydroorotase [Staphylococcus sp. M0480]
Length=424

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_025869031.1| dihydroorotase [Enterococcus sp. TR]
Length=427

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  +F  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKNQTFLKAPFGIV  326



>ref|WP_028105985.1| dihydroorotase [Exiguobacterium undae]
Length=423

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGV  10
            A++EGL DGT+ CIATD+APHAA+EKA     A FG+
Sbjct  283  ALIEGLLDGTIDCIATDHAPHAADEKALGIERAPFGI  319



>ref|WP_035184401.1| dihydroorotase [Lactobacillus delbrueckii]
 sp|P48795.1|PYRC_LACLE RecName: Full=Dihydroorotase; Short=DHOase [Lactobacillus leichmannii]
 emb|CAA55633.1| dihydroorotase [Lactobacillus leichmannii]
 emb|CDR84552.1| Dihydroorotase [Lactobacillus delbrueckii subsp. lactis]
Length=427

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EG+ DGT+  IATD+APH+ EEKA   R AAFG+I N
Sbjct  287  ALIEGMLDGTIDLIATDHAPHSREEKAGDMRKAAFGIIGN  326



>ref|WP_010761465.1| dihydroorotase [Enterococcus haemoperoxidus]
 gb|EOH98661.1| dihydroorotase [Enterococcus haemoperoxidus ATCC BAA-382]
 gb|EOT62156.1| dihydroorotase [Enterococcus haemoperoxidus ATCC BAA-382]
Length=427

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  +F  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKNQTFLKAPFGIV  326



>ref|WP_026832573.1| dihydroorotase [Exiguobacterium undae]
Length=423

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGV  10
            A++EGL DGT+ CIATD+APHAA+EKA     A FG+
Sbjct  283  ALIEGLLDGTIDCIATDHAPHAADEKALGIERAPFGI  319



>ref|WP_037552351.1| dihydroorotase [Staphylococcus haemolyticus]
 gb|KGF25727.1| dihydroorotase [Staphylococcus haemolyticus DNF00585]
Length=424

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_010765033.1| dihydroorotase [Enterococcus moraviensis]
 gb|EOI00548.1| dihydroorotase [Enterococcus moraviensis ATCC BAA-383]
 gb|EOT73223.1| dihydroorotase [Enterococcus moraviensis ATCC BAA-383]
Length=427

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  +F  A FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGLEEKNQTFLKAPFGIV  326



>ref|WP_037536299.1| dihydroorotase [Staphylococcus haemolyticus]
 gb|KGJ25965.1| dihydroorotase [Staphylococcus haemolyticus]
 gb|KGJ30287.1| dihydroorotase [Staphylococcus haemolyticus]
Length=424

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_037545901.1| dihydroorotase [Staphylococcus lugdunensis]
 gb|KAK55135.1| dihydro-orotase-like protein [Staphylococcus lugdunensis VCU150]
Length=424

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_002459345.1| dihydroorotase [Staphylococcus lugdunensis]
 ref|YP_003471921.1| dihydroorotase [Staphylococcus lugdunensis HKU09-01]
 ref|YP_005760811.1| putative dihydroorotase [Staphylococcus lugdunensis N920143]
 gb|ADC87794.1| Dihydroorotase [Staphylococcus lugdunensis HKU09-01]
 gb|EFU85164.1| dihydroorotase [Staphylococcus lugdunensis M23590]
 emb|CCB54193.1| putative dihydroorotase [Staphylococcus lugdunensis N920143]
 gb|EKS24817.1| dihydroorotase [Staphylococcus lugdunensis ACS-027-V-Sch2]
Length=424

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_011275998.1| MULTISPECIES: dihydroorotase [Staphylococcus]
 ref|YP_253628.1| dihydroorotase [Staphylococcus haemolyticus JCSC1435]
 dbj|BAE05022.1| dihydroorotase [Staphylococcus haemolyticus JCSC1435]
 gb|EZI39876.1| dihydroorotase [Staphylococcus haemolyticus]
 gb|KDP49461.1| dihydro-orotase-like protein [Staphylococcus aureus subsp. aureus 
CO-98]
Length=424

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_023606248.1| dihydroorotase [Vagococcus lutrae]
 gb|EST90020.1| dihydroorotase [Vagococcus lutrae LBD1]
Length=432

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ C+ATD+APH A+EKA S  +A FG++
Sbjct  292  ALIEGLLDGTIDCLATDHAPHHADEKALSMIEAPFGIV  329



>ref|WP_010744829.1| dihydroorotase [Enterococcus raffinosus]
 gb|EOH80373.1| dihydroorotase [Enterococcus raffinosus ATCC 49464]
 gb|EOT71197.1| dihydroorotase [Enterococcus raffinosus ATCC 49464]
Length=426

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGFEEKNQSFLKSPFGIV  326



>ref|WP_002493090.1| dihydroorotase [Staphylococcus lugdunensis]
 gb|EHS02288.1| dihydroorotase [Staphylococcus lugdunensis VCU139]
 gb|EVI50076.1| dihydroorotase [Staphylococcus lugdunensis UCIM6116]
 gb|KAK61839.1| dihydro-orotase-like protein [Staphylococcus lugdunensis VCU148]
Length=424

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  324



>ref|WP_008379867.1| dihydroorotase [Enterococcus sp. C1]
 gb|EJF49397.1| dihydroorotase [Enterococcus sp. C1]
Length=427

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIKGLLDGTIDCIATDHAPHGYEEKMQSFLKAPFGIV  326



>ref|WP_015900067.1| dihydroorotase [Staphylococcus carnosus]
 ref|YP_002633910.1| dihydroorotase [Staphylococcus carnosus subsp. carnosus TM300]
 emb|CAL27725.1| dihydroorotase [Staphylococcus carnosus subsp. carnosus TM300]
Length=423

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEK      A FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHAAEEKDQPMTKAPFGIV  324



>ref|WP_033193764.1| dihydroorotase [Staphylococcus intermedius]
Length=424

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAA+EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAADEKAQPMTRAPFGIV  324



>ref|WP_034877146.1| dihydroorotase [Enterococcus avium]
Length=426

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGFEEKNQSFLKSPFGIV  326



>ref|WP_010739183.1| dihydroorotase [Enterococcus malodoratus]
 gb|EOH81680.1| dihydroorotase [Enterococcus malodoratus ATCC 43197]
 gb|EOT68762.1| dihydroorotase [Enterococcus malodoratus ATCC 43197]
Length=426

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGFEEKNQSFLKSPFGIV  326



>ref|WP_016180208.1| dihydroorotase [Enterococcus avium]
 gb|EOT45415.1| dihydroorotase [Enterococcus avium ATCC 14025]
 gb|EOU16702.1| dihydroorotase [Enterococcus avium ATCC 14025]
Length=435

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  + FG++
Sbjct  298  ALIEGLLDGTIDCIATDHAPHGFEEKNQSFLKSPFGIV  335



>ref|WP_013774048.1| dihydroorotase [Melissococcus plutonius]
 ref|YP_004456419.1| dihydroorotase [Melissococcus plutonius ATCC 35311]
 dbj|BAK21610.1| dihydroorotase [Melissococcus plutonius ATCC 35311]
Length=427

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK  SF  + FG++
Sbjct  289  ALIEGLLDGTIDCIATDHAPHGIEEKNQSFLKSPFGIV  326



>ref|WP_019165550.1| dihydroorotase [Staphylococcus delphini]
Length=425

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAA+EKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHAADEKAQPMTRAPFGIV  325



>ref|WP_015729004.1| dihydroorotase [Staphylococcus pseudintermedius]
 ref|YP_004149068.1| dihydroorotase [Staphylococcus pseudintermedius HKU10-03]
 gb|ADV05432.1| Dihydroorotase [Staphylococcus pseudintermedius HKU10-03]
Length=425

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAA+EKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHAADEKAQPMTRAPFGIV  325



>ref|WP_037544242.1| dihydroorotase [Staphylococcus pseudintermedius]
Length=424

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAA+EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAADEKAQPMTRAPFGIV  324



>ref|WP_014614156.1| dihydroorotase [Staphylococcus pseudintermedius]
 ref|YP_006015698.1| dihydroorotase [Staphylococcus pseudintermedius ED99]
 gb|ADX76859.1| dihydroorotase [Staphylococcus pseudintermedius ED99]
Length=424

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAA+EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAADEKAQPMTRAPFGIV  324



>ref|WP_039838273.1| dihydroorotase [Staphylococcus delphini]
Length=424

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAA+EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAADEKAQPMTRAPFGIV  324



>ref|WP_027963126.1| dihydroorotase [Halalkalibacillus halophilus]
Length=425

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK   F  + FG++
Sbjct  285  ALIEGLMDGTIDCIATDHAPHTLEEKQSGFEQSPFGIV  322



>ref|WP_002456590.1| dihydroorotase [Staphylococcus epidermidis]
 gb|EFE59505.1| dihydroorotase [Staphylococcus epidermidis M23864:W2(grey)]
Length=425

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  325



>ref|WP_002485025.1| dihydroorotase [Staphylococcus epidermidis]
 ref|NP_764432.1| dihydroorotase [Staphylococcus epidermidis ATCC 12228]
 sp|Q8CPJ6.1|PYRC_STAES RecName: Full=Dihydroorotase; Short=DHOase [Staphylococcus epidermidis 
ATCC 12228]
 gb|AAO04474.1|AE016746_264 dihydroorotase [Staphylococcus epidermidis ATCC 12228]
 gb|EHQ77188.1| dihydroorotase [Staphylococcus epidermidis VCU065]
 gb|EHQ79119.1| dihydroorotase [Staphylococcus epidermidis VCU057]
Length=425

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  325



>ref|WP_011303313.1| dihydroorotase [Staphylococcus saprophyticus]
 ref|YP_301661.1| dihydroorotase [Staphylococcus saprophyticus subsp. saprophyticus 
ATCC 15305]
 dbj|BAE18716.1| dihydroorotase [Staphylococcus saprophyticus subsp. saprophyticus 
ATCC 15305]
Length=424

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEK      A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAAEEKNQPMTKAPFGIV  324



>ref|WP_001830129.1| MULTISPECIES: dihydroorotase [Staphylococcus]
 gb|EES58448.1| dihydroorotase [Staphylococcus epidermidis BCM-HMP0060]
 gb|EFA87919.1| dihydroorotase [Staphylococcus epidermidis SK135]
 gb|EGG66414.1| dihydroorotase [Staphylococcus epidermidis VCU144]
 gb|EGG72472.1| dihydroorotase [Staphylococcus epidermidis VCU028]
 gb|EGG72839.1| dihydroorotase [Staphylococcus epidermidis VCU045]
 gb|EGS76319.1| dihydroorotase [Staphylococcus epidermidis VCU037]
 gb|EGS78799.1| dihydroorotase [Staphylococcus epidermidis VCU105]
 gb|EGS79463.1| dihydroorotase [Staphylococcus epidermidis VCU109]
 gb|EHM70137.1| dihydroorotase [Staphylococcus epidermidis VCU071]
 gb|EHQ73530.1| dihydroorotase [Staphylococcus epidermidis VCU041]
 gb|EHQ81043.1| dihydroorotase [Staphylococcus epidermidis VCU081]
 gb|EHR84925.1| dihydroorotase [Staphylococcus epidermidis VCU120]
 gb|EHR91390.1| dihydroorotase [Staphylococcus epidermidis VCU123]
 gb|EHR91606.1| dihydroorotase [Staphylococcus epidermidis VCU125]
 gb|EHR98648.1| dihydroorotase [Staphylococcus epidermidis VCU127]
 gb|EID36650.1| dihydroorotase [Staphylococcus epidermidis IS-K]
 gb|EID36910.1| dihydroorotase [Staphylococcus epidermidis IS-250]
 gb|EJD80722.1| dihydroorotase [Staphylococcus epidermidis NIHLM095]
 gb|EJD81961.1| dihydroorotase [Staphylococcus epidermidis NIHLM088]
 gb|EJD83072.1| dihydroorotase [Staphylococcus epidermidis NIHLM087]
 gb|EJD86889.1| dihydroorotase [Staphylococcus epidermidis NIHLM067]
 gb|EJD88419.1| dihydroorotase [Staphylococcus epidermidis NIHLM070]
 gb|EJD94547.1| dihydroorotase [Staphylococcus epidermidis NIHLM049]
 gb|EJD99449.1| dihydroorotase [Staphylococcus epidermidis NIHLM040]
 gb|EJE00971.1| dihydroorotase [Staphylococcus epidermidis NIHLM039]
 gb|EJE10546.1| dihydroorotase [Staphylococcus epidermidis NIHLM020]
 gb|EJE11384.1| dihydroorotase [Staphylococcus epidermidis NIHLM021]
 gb|EJE14580.1| dihydroorotase [Staphylococcus epidermidis NIHLM018]
 gb|EJE22634.1| dihydroorotase [Staphylococcus epidermidis NIHLM008]
 gb|EJE23278.1| dihydroorotase [Staphylococcus epidermidis NIHLM003]
 gb|EJE24698.1| dihydroorotase [Staphylococcus epidermidis NIHLM001]
 gb|EJE27848.1| dihydroorotase [Staphylococcus epidermidis NIH05005]
 gb|EJE30963.1| dihydroorotase [Staphylococcus epidermidis NIH04008]
 gb|EJE33908.1| dihydroorotase [Staphylococcus epidermidis NIH08001]
 gb|EJE36340.1| dihydroorotase [Staphylococcus epidermidis NIH05001]
 gb|EJE37958.1| dihydroorotase [Staphylococcus epidermidis NIH06004]
 gb|EJE41090.1| dihydroorotase [Staphylococcus epidermidis NIH05003]
 gb|EJE42631.1| dihydroorotase [Staphylococcus epidermidis NIH04003]
 gb|EJE45663.1| dihydroorotase [Staphylococcus epidermidis NIH051668]
 gb|EJE47728.1| dihydroorotase [Staphylococcus epidermidis NIH051475]
 gb|EKC83482.1| dihydroorotase [Staphylococcus epidermidis AU12-03]
 gb|EKS40141.1| dihydroorotase [Staphylococcus epidermidis BVS058A4]
 gb|ENL50159.1| dihydroorotase [Staphylococcus epidermidis M0881]
 gb|EON83709.1| dihydroorotase [Staphylococcus epidermidis 41tr]
 gb|EON84328.1| dihydroorotase [Staphylococcus epidermidis 528m]
 gb|EPZ44918.1| dihydro-orotase-like protein [Staphylococcus epidermidis E13A]
 gb|EST95387.1| dihydroorotase [Staphylococcus epidermidis Scl31]
 gb|EST99922.1| dihydroorotase [Staphylococcus epidermidis Scl25]
 gb|EUR99162.1| dihydroorotase [Staphylococcus epidermidis M0026]
 gb|EZI11014.1| dihydro-orotase-like protein [Staphylococcus epidermidis VCU014]
 gb|EZI11391.1| dihydro-orotase-like protein [Staphylococcus epidermidis VCU050]
 gb|KDP62905.1| dihydro-orotase-like protein [Staphylococcus epidermidis VCU013]
 gb|KDP66686.1| dihydro-orotase-like protein [Staphylococcus epidermidis VCU036]
 gb|KDP69842.1| dihydro-orotase-like protein [Staphylococcus epidermidis VCU111]
 gb|KEA34481.1| dihydroorotase [Staphylococcus epidermidis]
 gb|KEA36164.1| dihydroorotase [Staphylococcus epidermidis]
 gb|KEA38476.1| dihydroorotase [Staphylococcus epidermidis]
 emb|CDM13415.1| Dihydroorotase [Staphylococcus epidermidis PM221]
 gb|AIR82903.1| dihydroorotase [Staphylococcus epidermidis]
 gb|KGJ26862.1| dihydroorotase [Staphylococcus epidermidis]
Length=425

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHAKEEKAQPMTKAPFGIV  325



>ref|WP_021984962.1| dihydroorotase [Clostridium sp. CAG:127]
 emb|CCZ07765.1| dihydroorotase [Clostridium sp. CAG:127]
Length=439

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+VEGL DGT+  I+TD+APH+AEEKA  F  A FG++
Sbjct  296  ALVEGLVDGTMPAISTDHAPHSAEEKAQFFDKAPFGIV  333



>ref|WP_002483527.1| dihydroorotase [Staphylococcus saprophyticus]
 gb|EHY92614.1| dihydroorotase [Staphylococcus saprophyticus subsp. saprophyticus 
KACC 16562]
Length=424

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEK      A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAAEEKNQPMTKAPFGIV  324



>ref|WP_016371260.1| dihydroorotase, partial [Lactobacillus paracasei]
 gb|EPC65854.1| dihydroorotase, partial [Lactobacillus paracasei subsp. paracasei 
Lpp14]
Length=311

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  175  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  212



>ref|WP_039066836.1| dihydroorotase [Staphylococcus xylosus]
Length=424

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEK      A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAAEEKDQPMTKAPFGIV  324



>ref|WP_017724230.1| dihydroorotase [Staphylococcus xylosus]
Length=424

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEK      A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAAEEKDQPMTKAPFGIV  324



>ref|WP_034530953.1| dihydroorotase [Lactobacillus kunkeei]
 gb|KFJ15537.1| dihydroorotase [Lactobacillus kunkeei]
Length=422

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++ GL DGT+  +ATD+APH+ +EK+ S RDAAFG++
Sbjct  283  ALIAGLLDGTIDMVATDHAPHSEKEKSGSMRDAAFGIV  320



>gb|AID43043.1| Dihydroorotase [Staphylococcus xylosus]
 emb|CEF19072.1| Dihydroorotase [Staphylococcus xylosus]
Length=424

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHAAEEK      A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHAAEEKDQPMTKAPFGIV  324



>ref|WP_003594504.1| MULTISPECIES: dihydroorotase [Lactobacillus casei group]
 ref|YP_806674.1| dihydroorotase [Lactobacillus casei ATCC 334]
 gb|ABJ70232.1| dihydroorotase [Lactobacillus casei ATCC 334]
 gb|EEI67342.1| amidohydrolase family protein [Lactobacillus paracasei subsp. 
paracasei ATCC 25302]
 gb|EKQ19136.1| dihydroorotase [Lactobacillus casei UCD174]
 gb|EPC36353.1| Dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp120]
 dbj|BAN71673.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei JCM 
8130]
Length=421

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_011065890.1| dihydroorotase [Oceanobacillus iheyensis]
 ref|NP_692410.1| dihydroorotase [Oceanobacillus iheyensis HTE831]
 dbj|BAC13445.1| dihydroorotase [Oceanobacillus iheyensis HTE831]
Length=430

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+ +GL DGT+  IATD+APHA EEKA  F++A FG++
Sbjct  288  ALFDGLMDGTIDLIATDHAPHATEEKAVGFKEAPFGIV  325



>ref|WP_034534052.1| dihydroorotase [Lactobacillus kunkeei]
 gb|KDB01202.1| dihydroorotase PyrC [Lactobacillus kunkeei EFB6]
Length=422

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++ GL DGT+  +ATD+APH+ +EK+ S RDAAFG++
Sbjct  283  ALIAGLLDGTIDMVATDHAPHSEKEKSGSMRDAAFGIV  320



>ref|WP_003602305.1| MULTISPECIES: dihydroorotase [Lactobacillus casei group]
 gb|EKQ22029.1| dihydroorotase [Lactobacillus casei UW4]
 gb|EPC30813.1| Dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp22]
Length=421

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_013489160.1| dihydroorotase [Bacillus cellulosilyticus]
 ref|YP_004095557.1| dihydroorotase [Bacillus cellulosilyticus DSM 2522]
 gb|ADU30826.1| dihydroorotase, multifunctional complex type [Bacillus cellulosilyticus 
DSM 2522]
Length=432

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+  IATD+APH AEEKA +  +A FG++
Sbjct  292  ALIEGLLDGTIDFIATDHAPHTAEEKALAIEEAPFGIV  329



>ref|WP_015904630.1| dihydroorotase [Desulfobacterium autotrophicum]
 ref|YP_002604031.1| protein PyrC [Desulfobacterium autotrophicum HRM2]
 sp|C0QJ54.1|PYRC_DESAH RecName: Full=Dihydroorotase; Short=DHOase [Desulfobacterium 
autotrophicum HRM2]
 gb|ACN15867.1| PyrC [Desulfobacterium autotrophicum HRM2]
Length=426

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH+  EKA  F  AAFG+I
Sbjct  291  AVIKGLQDGTIDCIATDHAPHSPLEKAVEFDQAAFGII  328



>ref|WP_016625171.1| dihydroorotase [Enterococcus faecalis]
 gb|EPH95465.1| dihydroorotase [Enterococcus faecalis 13-SD-W-01]
Length=428

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APH  EEK+ SF  A FG++
Sbjct  289  ALIKGLLDGTIDCIATDHAPHGLEEKSQSFLKAPFGIV  326



>ref|WP_009765571.1| dihydroorotase [Sporosarcina newyorkensis]
 gb|EGQ27256.1| dihydroorotase [Sporosarcina newyorkensis 2681]
Length=425

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGV  10
            A+ +GL DGTL CIATD+APH AEEK+  F  A FG+
Sbjct  288  ALRQGLLDGTLDCIATDHAPHTAEEKSVGFAKAPFGI  324



>ref|WP_016182717.1| dihydroorotase [Enterococcus columbae]
 gb|EOT44498.1| dihydroorotase [Enterococcus columbae DSM 7374 = ATCC 51263]
 gb|EOW84656.1| dihydroorotase [Enterococcus columbae DSM 7374 = ATCC 51263]
Length=427

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CI+TD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGTIDCISTDHAPHGHEEKCQSFLKAPFGIV  326



>gb|EPC50664.1| dihydroorotase, partial [Lactobacillus paracasei subsp. paracasei 
Lpp123]
Length=367

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_016363374.1| dihydroorotase [Lactobacillus paracasei]
 gb|EPC45503.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp219]
Length=421

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_016369441.1| dihydroorotase [Lactobacillus paracasei]
 gb|EPC15983.1| Dihydroorotase [Lactobacillus paracasei subsp. tolerans Lpl7]
 gb|EPC53895.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei CNCM 
I-4270]
 gb|EPC64890.1| dihydroorotase [Lactobacillus paracasei subsp. tolerans Lpl14]
Length=421

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_003579187.1| MULTISPECIES: dihydroorotase [Lactobacillus casei group]
 gb|EKQ07082.1| dihydroorotase [Lactobacillus casei CRF28]
 gb|EKQ10248.1| dihydroorotase [Lactobacillus casei M36]
 gb|EKQ12021.1| dihydroorotase [Lactobacillus casei A2-362]
 gb|EKQ25845.1| dihydroorotase [Lactobacillus casei Lpc-37]
 gb|EPC41073.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp74]
 gb|EPC85083.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp43]
 gb|EPC98353.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp227]
Length=421

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_010767674.1| dihydroorotase [Enterococcus phoeniculicola]
 gb|EOL46196.1| dihydroorotase [Enterococcus phoeniculicola ATCC BAA-412]
 gb|EOT76959.1| dihydroorotase [Enterococcus phoeniculicola ATCC BAA-412]
Length=427

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DG++ CIATD+APH  EEK  SF  A FG++
Sbjct  289  ALIEGLLDGSIDCIATDHAPHGLEEKNQSFLQAPFGIV  326



>ref|WP_003575120.1| MULTISPECIES: dihydroorotase [Lactobacillus casei group]
 gb|EKP99459.1| dihydroorotase [Lactobacillus casei 32G]
 gb|EPC39170.1| Dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp225]
 gb|EPD04517.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei CNCM 
I-2877]
Length=421

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_016379713.1| dihydroorotase, partial [Lactobacillus paracasei]
 gb|EPC77345.1| dihydroorotase, partial [Lactobacillus paracasei subsp. paracasei 
Lpp221]
Length=382

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_013245745.1| MULTISPECIES: dihydroorotase [Lactobacillus casei group]
 ref|YP_003788526.1| dihydroorotase [Lactobacillus casei str. Zhang]
 ref|YP_008200143.1| Dihydroorotase [Lactobacillus casei LOCK919]
 gb|ADK18676.1| Dihydroorotase [Lactobacillus casei str. Zhang]
 gb|EPC27240.1| Dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp46]
 gb|AGP68326.1| Dihydroorotase [Lactobacillus casei LOCK919]
Length=421

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_015454939.1| Dihydroorotase [Listeria monocytogenes]
 ref|YP_007604270.1| Dihydroorotase [Listeria monocytogenes]
 ref|YP_007607402.1| Dihydroorotase [Listeria monocytogenes N53-1]
 emb|CCQ21356.1| Dihydroorotase [Listeria monocytogenes]
 emb|CCQ24488.1| Dihydroorotase [Listeria monocytogenes N53-1]
Length=263

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+  IATD+APHAAEEK      AAFG++
Sbjct  124  ALLEGLLDGTIDFIATDHAPHAAEEKNVPMEQAAFGIV  161



>gb|EPC70586.1| dihydroorotase, partial [Lactobacillus paracasei subsp. paracasei 
Lpp126]
Length=355

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_039232019.1| dihydroorotase [Bacillus thermotolerans]
 gb|KIA70118.1| Dihydroorotase [Bacillus thermotolerans]
Length=428

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+VEGL DGT+  IATD+APH AEEKA   + A FG++
Sbjct  288  ALVEGLLDGTIDFIATDHAPHTAEEKAVGMKTAPFGIV  325



>ref|WP_016363934.1| dihydroorotase, partial [Lactobacillus paracasei]
 gb|EPC48257.1| dihydroorotase, partial [Lactobacillus paracasei subsp. paracasei 
Lpp229]
Length=317

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  181  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  218



>ref|WP_016837483.1| dihydroorotase [Ureibacillus thermosphaericus]
Length=424

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK C    A FG++
Sbjct  287  ALIEGLLDGTIDCIATDHAPHTTEEKCCGMVGAPFGIV  324



>ref|WP_000767026.1| dihydroorotase [Staphylococcus aureus]
Length=424

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA +   A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHARDEKAQAMEKAPFGIV  324



>ref|WP_019887399.1| dihydroorotase [Lactobacillus paracasei]
 gb|EPD00340.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp125]
Length=421

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_039041874.1| dihydroorotase [Sporosarcina sp. ZBG7A]
Length=424

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGV  10
            A+ EGL DGTL  IATD+APH+AEEKA  F+ A FG+
Sbjct  287  ALREGLLDGTLDFIATDHAPHSAEEKAAGFKIAPFGI  323



>ref|WP_001824134.1| dihydroorotase [Staphylococcus aureus]
 gb|EHS77516.1| dihydroorotase [Staphylococcus aureus subsp. aureus IS-160]
 gb|EVX47858.1| dihydroorotase [Staphylococcus aureus F70893]
 gb|EVX68341.1| dihydroorotase [Staphylococcus aureus F77047]
 gb|EVZ14545.1| dihydroorotase [Staphylococcus aureus H48052]
 gb|EVZ18402.1| dihydroorotase [Staphylococcus aureus H48054]
 gb|EWB32131.1| dihydroorotase [Staphylococcus aureus W21932]
 gb|EWL66836.1| dihydroorotase [Staphylococcus aureus F77917]
 gb|EWX03193.1| dihydroorotase [Staphylococcus aureus H81433]
 gb|EWY23941.1| dihydroorotase [Staphylococcus aureus W73738]
 gb|EYF21734.1| dihydroorotase [Staphylococcus aureus F19490]
 gb|EYK06627.1| dihydroorotase [Staphylococcus aureus M17033]
 gb|EYL91020.1| dihydroorotase [Staphylococcus aureus M64056]
 gb|EYM17702.1| dihydroorotase [Staphylococcus aureus T63897]
 gb|EYM23739.1| dihydroorotase [Staphylococcus aureus T63898]
 gb|KAG93594.1| dihydroorotase [Staphylococcus aureus VET1518S]
 gb|KDP61461.1| dihydroorotase [Staphylococcus aureus subsp. aureus 21321]
Length=425

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA +   A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHARDEKAQAMEKAPFGIV  325



>ref|WP_017186654.1| hypothetical protein [Alkalibacillus haloalkaliphilus]
Length=423

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APH  EEK   F  + FG++
Sbjct  283  ALIEGLLDGTIDCIATDHAPHTREEKESGFMQSPFGIV  320



>ref|WP_020587576.1| dihydroorotase [Desulfobacter curvatus]
Length=429

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+  IATD+APHA +EK   F  AAFG++
Sbjct  295  AIIEGLIDGTIDMIATDHAPHAEDEKQVEFDQAAFGIV  332



>ref|WP_031907270.1| dihydroorotase [Staphylococcus aureus]
Length=424

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEQAPFGIV  324



>gb|KIG07304.1| Dihydroorotase [Bacillaceae bacterium MTCC 8252]
Length=428

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+VEGL DGT+  IATD+APH AEEKA   + A FG++
Sbjct  288  ALVEGLLDGTIDFIATDHAPHTAEEKAAGMKTAPFGIV  325



>gb|EVC50041.1| dihydroorotase [Staphylococcus aureus SMMC0005]
Length=425

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEQAPFGIV  325



>ref|WP_003598753.1| MULTISPECIES: dihydroorotase [Lactobacillus casei group]
 ref|YP_001987616.1| dihydroorotase [Lactobacillus casei BL23]
 ref|YP_005856542.1| Dihydroorotase [Lactobacillus casei LC2W]
 ref|YP_005859695.1| Dihydroorotase [Lactobacillus casei BD-II]
 ref|YP_006751713.1| dihydroorotase [Lactobacillus casei W56]
 emb|CAQ66758.1| Dihydroorotase (DHOase) [Lactobacillus casei BL23]
 gb|AEA53958.1| Dihydroorotase [Lactobacillus casei LC2W]
 gb|AEA57154.1| Dihydroorotase [Lactobacillus casei BD-II]
 emb|CCK22594.1| Dihydroorotase [Lactobacillus casei W56]
 gb|EKQ21655.1| dihydroorotase [Lactobacillus casei UW1]
 gb|EPC21450.1| Dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp122]
 gb|EPC22005.1| Dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp226]
 gb|EPC31320.1| Dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp223]
 gb|EPC54503.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp7]
 gb|EPC72236.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp71]
 gb|EPC81220.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp37]
 gb|EPC90137.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp49]
 gb|AHJ32866.1| dihydroorotase [Lactobacillus paracasei N1115]
Length=421

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_016372633.1| dihydroorotase [Lactobacillus paracasei]
 gb|EPC61172.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp228]
Length=421

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_003605160.1| dihydroorotase [Lactobacillus casei]
 gb|EKQ27483.1| dihydroorotase [Lactobacillus casei Lc-10]
 gb|ERN49962.1| dihydroorotase [Lactobacillus casei 5b]
Length=421

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_006366653.1| dihydroorotase [Chlorobium ferrooxidans]
 gb|EAT58701.1| dihydroorotase, multifunctional complex type [Chlorobium ferrooxidans 
DSM 13031]
Length=444

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+  IATD+APHA+ EK C    AAFG+I
Sbjct  305  AILQGLADGTIDAIATDHAPHASHEKECPLDQAAFGII  342



>ref|WP_022156361.1| dihydroorotase [Firmicutes bacterium CAG:145]
 emb|CDB03654.1| dihydroorotase [Firmicutes bacterium CAG:145]
Length=402

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EG+ DGT+  IATD+APH+ EEKA   +D+AFG++
Sbjct  276  ALIEGIKDGTIDIIATDHAPHSKEEKAKGLKDSAFGIV  313



>gb|KIG08732.1| Dihydroorotase [Bacillaceae bacterium MTCC 10057]
Length=428

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+VEGL DGT+  IATD+APH AEEKA   + A FG++
Sbjct  288  ALVEGLLDGTIDFIATDHAPHTAEEKAAGMKTAPFGIV  325



>gb|EFM06160.1| putative dihydroorotase [Staphylococcus aureus subsp. aureus 
ATCC BAA-39]
Length=292

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  155  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  192



>ref|WP_032090439.1| dihydroorotase [bacterium LF-3]
Length=420

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVITN  1
            A++EGL DGT+TCI+TD+APH+ EEK      A FG+I N
Sbjct  287  ALIEGLKDGTVTCISTDHAPHSDEEKLKPIDQAPFGIIGN  326



>ref|WP_025598899.1| dihydroorotase [Lactobacillus casei]
Length=421

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_003565520.1| MULTISPECIES: dihydroorotase [Lactobacillus casei group]
 ref|YP_008446674.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei 8700:2]
 gb|EEQ64926.1| dihydroorotase [Lactobacillus paracasei subsp. paracasei 8700:2]
 gb|EKP99973.1| dihydroorotase [Lactobacillus casei 12A]
 gb|EKQ01593.1| dihydroorotase [Lactobacillus casei 21/1]
 gb|EPC25698.1| Dihydroorotase [Lactobacillus paracasei subsp. paracasei Lpp17]
Length=421

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK  SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKTGSFKTAAFGIV  322



>ref|WP_025012375.1| MULTISPECIES: dihydroorotase [Lactobacillus]
 dbj|BAN74462.1| dihydroorotase [Lactobacillus casei subsp. casei ATCC 393]
Length=424

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGTL  IATD+APH A EK+ SF+ AAFG++
Sbjct  285  ALLEGLQDGTLDMIATDHAPHTAAEKSGSFKTAAFGIV  322



>ref|WP_002464927.1| dihydroorotase [Staphylococcus simiae]
 gb|EHJ07048.1| dihydroorotase [Staphylococcus simiae CCM 7213]
Length=424

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A+++GL DGT+ CIATD+APHA EEKA     A FG++
Sbjct  287  ALLDGLLDGTIDCIATDHAPHAREEKAQPMEKAPFGIV  324



>ref|WP_000767032.1| dihydroorotase [Staphylococcus aureus]
 gb|EWG58010.1| dihydroorotase [Staphylococcus aureus MUF168]
Length=424

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  324



>ref|WP_031899697.1| dihydroorotase [Staphylococcus aureus]
Length=424

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  324



>emb|CDR58352.1| dihydroorotase [Staphylococcus aureus]
Length=424

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  324



>ref|WP_000767024.1| dihydroorotase [Staphylococcus aureus]
Length=424

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  324



>emb|CDR53739.1| dihydroorotase [Staphylococcus aureus]
 emb|CDR26775.1| dihydroorotase [Staphylococcus aureus]
Length=425

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  325



>gb|EVZ25734.1| dihydroorotase [Staphylococcus aureus T12805]
 gb|EVZ30530.1| dihydroorotase [Staphylococcus aureus T12818]
 gb|EXO80133.1| dihydroorotase [Staphylococcus aureus T86792]
 gb|EXO98086.1| dihydroorotase [Staphylococcus aureus M79684]
 gb|EXP86155.1| dihydroorotase [Staphylococcus aureus M79686]
Length=425

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  325



>gb|EIK06530.1| dihydroorotase [Staphylococcus aureus subsp. aureus VRS3a]
 gb|EUJ57221.1| dihydroorotase [Staphylococcus aureus DAR1199]
 gb|EVE12623.1| dihydroorotase [Staphylococcus aureus SJOS6004]
 gb|EVW43068.1| dihydroorotase [Staphylococcus aureus F52748]
 gb|EVY07997.1| dihydroorotase [Staphylococcus aureus H45755]
 gb|EWB49386.1| dihydroorotase [Staphylococcus aureus W55442]
 gb|EYP04212.1| dihydroorotase [Staphylococcus aureus DAR1065]
 gb|EYP49633.1| dihydroorotase [Staphylococcus aureus DAR1278]
 gb|EYP68407.1| dihydroorotase [Staphylococcus aureus DAR1369]
 gb|EYP81223.1| dihydroorotase [Staphylococcus aureus DAR1698]
 gb|EYQ11091.1| dihydroorotase [Staphylococcus aureus DAR1885]
 gb|EYQ54829.1| dihydroorotase [Staphylococcus aureus DAR2000]
 gb|EYQ71635.1| dihydroorotase [Staphylococcus aureus DAR2068]
Length=425

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  288  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  325



>ref|WP_031845117.1| dihydroorotase [Staphylococcus aureus]
Length=424

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  120  AMVEGLCDGTLTCIATDNAPHAAEEKACSFRDAAFGVI  7
            A++EGL DGT+ CIATD+APHA +EKA     A FG++
Sbjct  287  ALLEGLLDGTIDCIATDHAPHARDEKAQPMEKAPFGIV  324



Lambda      K        H        a         alpha
   0.316    0.138    0.417    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518182412384