BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c66074_g1_i1 len=213 path=[1:0-212]

Length=213
                                                                      Score     E

ref|XP_010318021.1|  PREDICTED: uncharacterized protein LOC101253262    134   6e-34   
ref|XP_006350630.1|  PREDICTED: uncharacterized protein LOC102601834    131   4e-33   
ref|XP_009788883.1|  PREDICTED: uncharacterized protein LOC104236622    126   5e-33   
ref|XP_010662862.1|  PREDICTED: uncharacterized protein LOC100252...    130   8e-33   
ref|XP_010662860.1|  PREDICTED: uncharacterized protein LOC100252...    130   8e-33   
ref|XP_010662861.1|  PREDICTED: uncharacterized protein LOC100252...    130   8e-33   
emb|CAN64522.1|  hypothetical protein VITISV_043621                     129   2e-32   Vitis vinifera
ref|XP_011024838.1|  PREDICTED: uncharacterized protein LOC105125...    129   2e-32   
ref|XP_011024837.1|  PREDICTED: uncharacterized protein LOC105125...    129   2e-32   
ref|XP_011024840.1|  PREDICTED: uncharacterized protein LOC105125...    128   4e-32   
ref|XP_010109257.1|  hypothetical protein L484_011879                   127   1e-31   
ref|XP_009607734.1|  PREDICTED: uncharacterized protein LOC104101...    126   2e-31   
ref|XP_009607733.1|  PREDICTED: uncharacterized protein LOC104101...    126   2e-31   
ref|XP_009607732.1|  PREDICTED: uncharacterized protein LOC104101...    126   2e-31   
ref|XP_009607731.1|  PREDICTED: uncharacterized protein LOC104101...    126   2e-31   
ref|XP_009607730.1|  PREDICTED: uncharacterized protein LOC104101...    126   2e-31   
ref|XP_009607726.1|  PREDICTED: uncharacterized protein LOC104101...    126   2e-31   
ref|XP_006493323.1|  PREDICTED: uncharacterized protein LOC102628...    125   4e-31   
ref|XP_006493320.1|  PREDICTED: uncharacterized protein LOC102628...    125   4e-31   
ref|XP_004498513.1|  PREDICTED: uncharacterized protein LOC101490815    125   7e-31   
ref|XP_010267594.1|  PREDICTED: uncharacterized protein LOC104604...    124   9e-31   
ref|XP_010267593.1|  PREDICTED: uncharacterized protein LOC104604...    124   9e-31   
ref|XP_010267595.1|  PREDICTED: uncharacterized protein LOC104604...    124   1e-30   
gb|KDO54231.1|  hypothetical protein CISIN_1g0003663mg                  123   2e-30   
gb|KDO54229.1|  hypothetical protein CISIN_1g0003663mg                  123   2e-30   
gb|KDO54228.1|  hypothetical protein CISIN_1g0003663mg                  123   2e-30   
gb|AES58759.2|  gamma-irradiation and mitomycin C induced protein...    120   2e-30   
ref|XP_003588508.1|  hypothetical protein MTR_1g007950                  120   2e-30   
ref|XP_010671900.1|  PREDICTED: uncharacterized protein LOC104888575    123   3e-30   
ref|XP_006441093.1|  hypothetical protein CICLE_v10018477mg             123   3e-30   
ref|XP_010671901.1|  PREDICTED: uncharacterized protein LOC104888577    122   4e-30   
gb|KHN14095.1|  hypothetical protein glysoja_033322                     122   4e-30   
ref|XP_006600803.1|  PREDICTED: uncharacterized protein LOC100815144    122   4e-30   
emb|CDX80422.1|  BnaC07g30220D                                          122   7e-30   
gb|AES58766.2|  gamma-irradiation and mitomycin C induced protein...    122   7e-30   
ref|XP_010519439.1|  PREDICTED: uncharacterized protein LOC104798...    121   1e-29   
ref|XP_010519440.1|  PREDICTED: uncharacterized protein LOC104798...    121   1e-29   
ref|XP_010519438.1|  PREDICTED: uncharacterized protein LOC104798...    121   1e-29   
ref|XP_010519437.1|  PREDICTED: uncharacterized protein LOC104798...    121   1e-29   
ref|XP_010519436.1|  PREDICTED: uncharacterized protein LOC104798...    121   1e-29   
ref|XP_010519435.1|  PREDICTED: uncharacterized protein LOC104798...    121   1e-29   
ref|XP_010519434.1|  PREDICTED: uncharacterized protein LOC104798...    121   1e-29   
ref|XP_006286349.1|  hypothetical protein CARUB_v10000030mg             119   5e-29   
ref|XP_006394681.1|  hypothetical protein EUTSA_v10003513mg             119   6e-29   
ref|XP_007039066.1|  Gamma-irradiation and mitomycin c induced 1,...    117   3e-28   
ref|XP_007039064.1|  Gamma-irradiation and mitomycin c induced 1,...    117   4e-28   
ref|XP_007039067.1|  Gamma-irradiation and mitomycin c induced 1,...    117   4e-28   
ref|XP_007039063.1|  Gamma-irradiation and mitomycin c induced 1,...    117   4e-28   
ref|XP_007039065.1|  Gamma-irradiation and mitomycin c induced 1,...    117   4e-28   
emb|CDX88084.1|  BnaA06g26750D                                          115   2e-27   
ref|XP_002874183.1|  predicted protein                                  115   2e-27   
ref|XP_006286885.1|  hypothetical protein CARUB_v10000029mg             115   2e-27   
ref|XP_004309137.1|  PREDICTED: uncharacterized protein LOC101291584    115   2e-27   
ref|XP_009380586.1|  PREDICTED: uncharacterized protein LOC103968942    114   3e-27   
ref|XP_008377035.1|  PREDICTED: uncharacterized protein LOC103440148    112   3e-27   
ref|XP_008783195.1|  PREDICTED: uncharacterized protein LOC103702510    114   3e-27   
ref|XP_010495413.1|  PREDICTED: uncharacterized protein LOC104772508    114   4e-27   
ref|XP_010915961.1|  PREDICTED: uncharacterized protein LOC105040910    114   4e-27   
gb|EYU25236.1|  hypothetical protein MIMGU_mgv1a019692mg                114   5e-27   
ref|XP_009357370.1|  PREDICTED: uncharacterized protein LOC103948098    114   5e-27   
ref|XP_009368768.1|  PREDICTED: uncharacterized protein LOC103958243    114   5e-27   
ref|XP_008234883.1|  PREDICTED: uncharacterized protein LOC103333768    114   6e-27   
ref|XP_003588515.1|  hypothetical protein MTR_1g008050                  113   1e-26   
ref|XP_006394682.1|  hypothetical protein EUTSA_v10003512mg             112   1e-26   
ref|XP_011069355.1|  PREDICTED: uncharacterized protein LOC105155189    112   1e-26   
emb|CDX80426.1|  BnaC07g30180D                                          111   4e-26   
dbj|BAB10394.1|  unnamed protein product                                111   5e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88088.1|  BnaA06g26790D                                          111   5e-26   
ref|NP_197816.3|  gamma-irradiation and mitomycin c induced 1           110   6e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007218895.1|  hypothetical protein PRUPE_ppa000400mg             110   6e-26   
ref|XP_009150949.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   4e-25   
gb|KDO54232.1|  hypothetical protein CISIN_1g0003663mg                  106   2e-24   
ref|XP_006852616.1|  hypothetical protein AMTR_s00021p00227450          105   6e-24   
ref|XP_010236672.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   7e-23   
ref|XP_010067961.1|  PREDICTED: uncharacterized protein LOC104454756  90.1    5e-20   
ref|XP_010027395.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  93.6    5e-20   
ref|XP_010038463.1|  PREDICTED: uncharacterized protein LOC104427005  93.2    8e-20   
ref|XP_010067954.1|  PREDICTED: uncharacterized protein LOC104454747  93.2    8e-20   
ref|XP_010027391.1|  PREDICTED: uncharacterized protein LOC104417888  89.7    9e-20   
ref|XP_010067964.1|  PREDICTED: uncharacterized protein LOC104454760  92.8    1e-19   
gb|KCW62378.1|  hypothetical protein EUGRSUZ_H05016                   89.4    5e-19   
gb|KCW62625.1|  hypothetical protein EUGRSUZ_G00143                   89.4    6e-19   
gb|KCW62610.1|  hypothetical protein EUGRSUZ_G00111                   89.4    6e-19   
ref|XP_002318430.1|  hypothetical protein POPTR_0012s02320g           89.7    7e-19   Populus trichocarpa [western balsam poplar]
emb|CBI23013.3|  unnamed protein product                              87.0    1e-17   
ref|XP_002874182.1|  hypothetical protein ARALYDRAFT_351449           85.1    3e-17   
ref|XP_002994428.1|  hypothetical protein SELMODRAFT_432347           85.1    4e-17   
ref|XP_010067951.1|  PREDICTED: uncharacterized protein LOC104454742  85.1    6e-17   
gb|KCW62601.1|  hypothetical protein EUGRSUZ_G00092                   83.2    8e-17   
ref|XP_011069370.1|  PREDICTED: uncharacterized protein LOC105155...  82.4    2e-16   
ref|XP_011069369.1|  PREDICTED: uncharacterized protein LOC105155...  82.8    2e-16   
ref|XP_011069367.1|  PREDICTED: uncharacterized protein LOC105155...  82.8    2e-16   
ref|XP_011069368.1|  PREDICTED: uncharacterized protein LOC105155...  74.7    1e-13   
emb|CDP05057.1|  unnamed protein product                              74.7    2e-13   
ref|XP_010692829.1|  PREDICTED: uncharacterized protein LOC104905...  70.5    4e-13   
ref|XP_010456668.1|  PREDICTED: uncharacterized protein LOC104738142  68.6    3e-11   
ref|XP_011069423.1|  PREDICTED: uncharacterized protein LOC105155250  62.0    6e-10   



>ref|XP_010318021.1| PREDICTED: uncharacterized protein LOC101253262 [Solanum lycopersicum]
Length=1967

 Score =   134 bits (336),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L K +ITIFD+GLGMDGSAENSI KWGKMGAS+HRS++ + IG KPPYL PYFGMFGYGG
Sbjct  191  LTKSRITIFDTGLGMDGSAENSIVKWGKMGASIHRSARDRGIGGKPPYLTPYFGMFGYGG  250

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  251  PIASMHLGRR  260



>ref|XP_006350630.1| PREDICTED: uncharacterized protein LOC102601834 [Solanum tuberosum]
Length=1790

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L K +ITIFD+GLGMDGSAENSI KWGKMGAS+HR S+ + IG KPPYL PYFGMFGYGG
Sbjct  191  LTKSRITIFDTGLGMDGSAENSIVKWGKMGASLHRLSRDRGIGGKPPYLTPYFGMFGYGG  250

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  251  PIASMHLGRR  260



>ref|XP_009788883.1| PREDICTED: uncharacterized protein LOC104236622 [Nicotiana sylvestris]
Length=356

 Score =   126 bits (317),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L + +ITIFD+G GMDGSAENSI KWGKMGAS+HRSS+ + IG KPPYL P+FGMFGYGG
Sbjct  197  LTEKRITIFDTGPGMDGSAENSIVKWGKMGASLHRSSRYRGIGGKPPYLMPFFGMFGYGG  256

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  257  PIASMHLGRR  266



>ref|XP_010662862.1| PREDICTED: uncharacterized protein LOC100252197 isoform X3 [Vitis 
vinifera]
Length=1470

 Score =   130 bits (327),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + +D+I+IFDSG GMDGS ENSI KWGKMGAS+HRSSK +AIG KPPYLKP+FGMFGYGG
Sbjct  36   IVEDRISIFDSGPGMDGSDENSIVKWGKMGASLHRSSKAQAIGGKPPYLKPFFGMFGYGG  95

Query  183  PIASMHLGR  209
            PIASMHLGR
Sbjct  96   PIASMHLGR  104



>ref|XP_010662860.1| PREDICTED: uncharacterized protein LOC100252197 isoform X1 [Vitis 
vinifera]
Length=1616

 Score =   130 bits (327),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + +D+I+IFDSG GMDGS ENSI KWGKMGAS+HRSSK +AIG KPPYLKP+FGMFGYGG
Sbjct  182  IVEDRISIFDSGPGMDGSDENSIVKWGKMGASLHRSSKAQAIGGKPPYLKPFFGMFGYGG  241

Query  183  PIASMHLGR  209
            PIASMHLGR
Sbjct  242  PIASMHLGR  250



>ref|XP_010662861.1| PREDICTED: uncharacterized protein LOC100252197 isoform X2 [Vitis 
vinifera]
Length=1610

 Score =   130 bits (327),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + +D+I+IFDSG GMDGS ENSI KWGKMGAS+HRSSK +AIG KPPYLKP+FGMFGYGG
Sbjct  182  IVEDRISIFDSGPGMDGSDENSIVKWGKMGASLHRSSKAQAIGGKPPYLKPFFGMFGYGG  241

Query  183  PIASMHLGR  209
            PIASMHLGR
Sbjct  242  PIASMHLGR  250



>emb|CAN64522.1| hypothetical protein VITISV_043621 [Vitis vinifera]
Length=1459

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + +D+I+IFDSG GMDGS ENSI KWGKMGAS+HRSSK +AIG KPPYLKP+FGMFGYGG
Sbjct  280  IVEDRISIFDSGPGMDGSDENSIVKWGKMGASLHRSSKAQAIGGKPPYLKPFFGMFGYGG  339

Query  183  PIASMHLGR  209
            PIASMHLGR
Sbjct  340  PIASMHLGR  348



>ref|XP_011024838.1| PREDICTED: uncharacterized protein LOC105125881 isoform X2 [Populus 
euphratica]
 ref|XP_011024839.1| PREDICTED: uncharacterized protein LOC105125881 isoform X2 [Populus 
euphratica]
Length=1582

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/70 (80%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + KDKI+IFD+G GMD S ENSI KWGKMGAS+HRS K KAIG KPPYL PYFGMFGYGG
Sbjct  200  IMKDKISIFDTGPGMDASDENSIVKWGKMGASLHRSFKAKAIGVKPPYLIPYFGMFGYGG  259

Query  183  PIASMHLGRR  212
            PIA+MHLGRR
Sbjct  260  PIATMHLGRR  269



>ref|XP_011024837.1| PREDICTED: uncharacterized protein LOC105125881 isoform X1 [Populus 
euphratica]
Length=1602

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/70 (80%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + KDKI+IFD+G GMD S ENSI KWGKMGAS+HRS K KAIG KPPYL PYFGMFGYGG
Sbjct  220  IMKDKISIFDTGPGMDASDENSIVKWGKMGASLHRSFKAKAIGVKPPYLIPYFGMFGYGG  279

Query  183  PIASMHLGRR  212
            PIA+MHLGRR
Sbjct  280  PIATMHLGRR  289



>ref|XP_011024840.1| PREDICTED: uncharacterized protein LOC105125881 isoform X3 [Populus 
euphratica]
Length=1314

 Score =   128 bits (322),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/70 (80%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + KDKI+IFD+G GMD S ENSI KWGKMGAS+HRS K KAIG KPPYL PYFGMFGYGG
Sbjct  220  IMKDKISIFDTGPGMDASDENSIVKWGKMGASLHRSFKAKAIGVKPPYLIPYFGMFGYGG  279

Query  183  PIASMHLGRR  212
            PIA+MHLGRR
Sbjct  280  PIATMHLGRR  289



>ref|XP_010109257.1| hypothetical protein L484_011879 [Morus notabilis]
 gb|EXC21437.1| hypothetical protein L484_011879 [Morus notabilis]
Length=1568

 Score =   127 bits (318),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D+I+IFD+G GMDGS ENSI KWGKMGAS+HR+SK +AIG KPPYLKP+FGMFGYGGPI
Sbjct  179  EDRISIFDTGPGMDGSDENSIVKWGKMGASLHRASKAQAIGGKPPYLKPFFGMFGYGGPI  238

Query  189  ASMHLGR  209
            ASMHLGR
Sbjct  239  ASMHLGR  245



>ref|XP_009607734.1| PREDICTED: uncharacterized protein LOC104101890 isoform X6 [Nicotiana 
tomentosiformis]
Length=1469

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L + +ITIFD+G GMDGSAENS+ KWGKMGAS+HRSS+ + IG KPPYL P+FGMFGYGG
Sbjct  273  LTEKRITIFDTGPGMDGSAENSVVKWGKMGASLHRSSRYRGIGGKPPYLMPFFGMFGYGG  332

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  333  PIASMHLGRR  342



>ref|XP_009607733.1| PREDICTED: uncharacterized protein LOC104101890 isoform X5 [Nicotiana 
tomentosiformis]
Length=1512

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L + +ITIFD+G GMDGSAENS+ KWGKMGAS+HRSS+ + IG KPPYL P+FGMFGYGG
Sbjct  273  LTEKRITIFDTGPGMDGSAENSVVKWGKMGASLHRSSRYRGIGGKPPYLMPFFGMFGYGG  332

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  333  PIASMHLGRR  342



>ref|XP_009607732.1| PREDICTED: uncharacterized protein LOC104101890 isoform X4 [Nicotiana 
tomentosiformis]
Length=1628

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L + +ITIFD+G GMDGSAENS+ KWGKMGAS+HRSS+ + IG KPPYL P+FGMFGYGG
Sbjct  197  LTEKRITIFDTGPGMDGSAENSVVKWGKMGASLHRSSRYRGIGGKPPYLMPFFGMFGYGG  256

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  257  PIASMHLGRR  266



>ref|XP_009607731.1| PREDICTED: uncharacterized protein LOC104101890 isoform X3 [Nicotiana 
tomentosiformis]
Length=1681

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L + +ITIFD+G GMDGSAENS+ KWGKMGAS+HRSS+ + IG KPPYL P+FGMFGYGG
Sbjct  273  LTEKRITIFDTGPGMDGSAENSVVKWGKMGASLHRSSRYRGIGGKPPYLMPFFGMFGYGG  332

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  333  PIASMHLGRR  342



>ref|XP_009607730.1| PREDICTED: uncharacterized protein LOC104101890 isoform X2 [Nicotiana 
tomentosiformis]
Length=1703

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L + +ITIFD+G GMDGSAENS+ KWGKMGAS+HRSS+ + IG KPPYL P+FGMFGYGG
Sbjct  273  LTEKRITIFDTGPGMDGSAENSVVKWGKMGASLHRSSRYRGIGGKPPYLMPFFGMFGYGG  332

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  333  PIASMHLGRR  342



>ref|XP_009607726.1| PREDICTED: uncharacterized protein LOC104101890 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607727.1| PREDICTED: uncharacterized protein LOC104101890 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607728.1| PREDICTED: uncharacterized protein LOC104101890 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607729.1| PREDICTED: uncharacterized protein LOC104101890 isoform X1 [Nicotiana 
tomentosiformis]
Length=1704

 Score =   126 bits (317),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L + +ITIFD+G GMDGSAENS+ KWGKMGAS+HRSS+ + IG KPPYL P+FGMFGYGG
Sbjct  273  LTEKRITIFDTGPGMDGSAENSVVKWGKMGASLHRSSRYRGIGGKPPYLMPFFGMFGYGG  332

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  333  PIASMHLGRR  342



>ref|XP_006493323.1| PREDICTED: uncharacterized protein LOC102628315 isoform X4 [Citrus 
sinensis]
Length=1554

 Score =   125 bits (315),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +DKI++FD+G GMDG+ ENSI KWGKMGAS+HR+SK + IG KPPYL P+FGMFGYGGPI
Sbjct  192  EDKISVFDTGPGMDGTDENSIVKWGKMGASLHRASKAQGIGGKPPYLTPFFGMFGYGGPI  251

Query  189  ASMHLGRR  212
            ASMHLGRR
Sbjct  252  ASMHLGRR  259



>ref|XP_006493320.1| PREDICTED: uncharacterized protein LOC102628315 isoform X1 [Citrus 
sinensis]
 ref|XP_006493321.1| PREDICTED: uncharacterized protein LOC102628315 isoform X2 [Citrus 
sinensis]
 ref|XP_006493322.1| PREDICTED: uncharacterized protein LOC102628315 isoform X3 [Citrus 
sinensis]
Length=1576

 Score =   125 bits (315),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +DKI++FD+G GMDG+ ENSI KWGKMGAS+HR+SK + IG KPPYL P+FGMFGYGGPI
Sbjct  192  EDKISVFDTGPGMDGTDENSIVKWGKMGASLHRASKAQGIGGKPPYLTPFFGMFGYGGPI  251

Query  189  ASMHLGRR  212
            ASMHLGRR
Sbjct  252  ASMHLGRR  259



>ref|XP_004498513.1| PREDICTED: uncharacterized protein LOC101490815 [Cicer arietinum]
Length=1483

 Score =   125 bits (313),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            KDKI+IFD+G GMD S ENS+ KWGKMGAS+HR SK +AIG KPPYL PYFGM+GYGGPI
Sbjct  187  KDKISIFDNGSGMDDSNENSLVKWGKMGASLHRLSKSQAIGGKPPYLMPYFGMYGYGGPI  246

Query  189  ASMHLGRR  212
            ASMHLGRR
Sbjct  247  ASMHLGRR  254



>ref|XP_010267594.1| PREDICTED: uncharacterized protein LOC104604778 isoform X2 [Nelumbo 
nucifera]
Length=1570

 Score =   124 bits (312),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            K  I IFD+G GMDGS ENSI KWGKMGAS+HRSS+G+AIG KPPYL P+FGMFGYGGPI
Sbjct  176  KRGIAIFDTGPGMDGSDENSIVKWGKMGASLHRSSRGQAIGGKPPYLTPFFGMFGYGGPI  235

Query  189  ASMHLGR  209
            ASMHLGR
Sbjct  236  ASMHLGR  242



>ref|XP_010267593.1| PREDICTED: uncharacterized protein LOC104604778 isoform X1 [Nelumbo 
nucifera]
Length=1586

 Score =   124 bits (312),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            K  I IFD+G GMDGS ENSI KWGKMGAS+HRSS+G+AIG KPPYL P+FGMFGYGGPI
Sbjct  176  KRGIAIFDTGPGMDGSDENSIVKWGKMGASLHRSSRGQAIGGKPPYLTPFFGMFGYGGPI  235

Query  189  ASMHLGR  209
            ASMHLGR
Sbjct  236  ASMHLGR  242



>ref|XP_010267595.1| PREDICTED: uncharacterized protein LOC104604778 isoform X3 [Nelumbo 
nucifera]
Length=1557

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            K  I IFD+G GMDGS ENSI KWGKMGAS+HRSS+G+AIG KPPYL P+FGMFGYGGPI
Sbjct  176  KRGIAIFDTGPGMDGSDENSIVKWGKMGASLHRSSRGQAIGGKPPYLTPFFGMFGYGGPI  235

Query  189  ASMHLGR  209
            ASMHLGR
Sbjct  236  ASMHLGR  242



>gb|KDO54231.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=1258

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +DKI++FD+G GMD + ENSI KWGKMGAS+HR+SK + IG KPPYL P+FGMFGYGGPI
Sbjct  192  EDKISVFDTGPGMDSTDENSIVKWGKMGASLHRASKAQGIGGKPPYLTPFFGMFGYGGPI  251

Query  189  ASMHLGRR  212
            ASMHLGRR
Sbjct  252  ASMHLGRR  259



>gb|KDO54229.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
 gb|KDO54230.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=1268

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +DKI++FD+G GMD + ENSI KWGKMGAS+HR+SK + IG KPPYL P+FGMFGYGGPI
Sbjct  192  EDKISVFDTGPGMDSTDENSIVKWGKMGASLHRASKAQGIGGKPPYLTPFFGMFGYGGPI  251

Query  189  ASMHLGRR  212
            ASMHLGRR
Sbjct  252  ASMHLGRR  259



>gb|KDO54228.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=1304

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +DKI++FD+G GMD + ENSI KWGKMGAS+HR+SK + IG KPPYL P+FGMFGYGGPI
Sbjct  192  EDKISVFDTGPGMDSTDENSIVKWGKMGASLHRASKAQGIGGKPPYLTPFFGMFGYGGPI  251

Query  189  ASMHLGRR  212
            ASMHLGRR
Sbjct  252  ASMHLGRR  259



>gb|AES58759.2| gamma-irradiation and mitomycin C induced protein, putative [Medicago 
truncatula]
Length=517

 Score =   120 bits (301),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  15   KITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIAS  194
            KITIFDSG GMD S ENSI KWGKMGAS+HR SK +AIG KPPYL P FGMFGYGGPIAS
Sbjct  191  KITIFDSGSGMDDSDENSIVKWGKMGASLHRQSKSQAIGGKPPYLMPCFGMFGYGGPIAS  250

Query  195  MHLGR  209
            MHLGR
Sbjct  251  MHLGR  255



>ref|XP_003588508.1| hypothetical protein MTR_1g007950 [Medicago truncatula]
Length=521

 Score =   120 bits (301),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  15   KITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIAS  194
            KITIFDSG GMD S ENSI KWGKMGAS+HR SK +AIG KPPYL P FGMFGYGGPIAS
Sbjct  195  KITIFDSGSGMDDSDENSIVKWGKMGASLHRQSKSQAIGGKPPYLMPCFGMFGYGGPIAS  254

Query  195  MHLGR  209
            MHLGR
Sbjct  255  MHLGR  259



>ref|XP_010671900.1| PREDICTED: uncharacterized protein LOC104888575 [Beta vulgaris 
subsp. vulgaris]
Length=1681

 Score =   123 bits (309),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            +++DKI++FD+G GMDGS ENSI KWGKMGASVHR+SK  AIG KPPYL P+FGMFGYGG
Sbjct  169  VYEDKISVFDTGPGMDGSDENSIVKWGKMGASVHRTSKKLAIGGKPPYLTPFFGMFGYGG  228

Query  183  PIASMHLGR  209
             IASMHLGR
Sbjct  229  TIASMHLGR  237



>ref|XP_006441093.1| hypothetical protein CICLE_v10018477mg [Citrus clementina]
 gb|ESR54333.1| hypothetical protein CICLE_v10018477mg [Citrus clementina]
Length=1576

 Score =   123 bits (308),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +DKI++FD+G GMD + ENSI KWGKMGAS+HR+SK + IG KPPYL P+FGMFGYGGPI
Sbjct  192  EDKISVFDTGPGMDSTDENSIVKWGKMGASLHRASKAQGIGGKPPYLTPFFGMFGYGGPI  251

Query  189  ASMHLGRR  212
            ASMHLGRR
Sbjct  252  ASMHLGRR  259



>ref|XP_010671901.1| PREDICTED: uncharacterized protein LOC104888577 [Beta vulgaris 
subsp. vulgaris]
Length=1556

 Score =   122 bits (307),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            +++DK+++FD+G GMDGS ENSI KWGKMGASVHR+SK  AIG KPPYL P+FGMFGYGG
Sbjct  99   VYEDKVSVFDTGPGMDGSDENSIVKWGKMGASVHRTSKKLAIGGKPPYLTPFFGMFGYGG  158

Query  183  PIASMHLGR  209
             IASMHLGR
Sbjct  159  TIASMHLGR  167



>gb|KHN14095.1| hypothetical protein glysoja_033322 [Glycine soja]
Length=1131

 Score =   122 bits (306),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L K KI+IFD+G G+D + ENS+ KWGKM AS+HRSSK KAIG KPPYL PYFGMFGYGG
Sbjct  174  LGKSKISIFDNGPGLDDTDENSLVKWGKMDASLHRSSKSKAIGGKPPYLMPYFGMFGYGG  233

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  234  PIASMHLGRR  243



>ref|XP_006600803.1| PREDICTED: uncharacterized protein LOC100815144 [Glycine max]
Length=1036

 Score =   122 bits (306),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L K KI+IFD+G G+D + ENS+ KWGKM AS+HRSSK KAIG KPPYL PYFGMFGYGG
Sbjct  50   LGKSKISIFDNGPGLDDTDENSLVKWGKMDASLHRSSKSKAIGGKPPYLMPYFGMFGYGG  109

Query  183  PIASMHLGRR  212
            PIASMHLGRR
Sbjct  110  PIASMHLGRR  119



>emb|CDX80422.1| BnaC07g30220D [Brassica napus]
Length=1569

 Score =   122 bits (305),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + +D+I++FDSG GMD S ENSIAKWGK+GAS+HRSSK KAIG KPPYL P+FGMFGYGG
Sbjct  176  VLEDRISVFDSGPGMDSSKENSIAKWGKIGASIHRSSKSKAIGGKPPYLMPFFGMFGYGG  235

Query  183  PIASMHLGRR  212
              A MHLGRR
Sbjct  236  AYACMHLGRR  245



>gb|AES58766.2| gamma-irradiation and mitomycin C induced protein, putative [Medicago 
truncatula]
Length=1462

 Score =   122 bits (305),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  15   KITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIAS  194
            KITIFD+G GMD S ENS+ KWGKMGAS+HR SK +AIG KPPYL PYFGM+GYGGPIAS
Sbjct  185  KITIFDNGSGMDDSNENSLVKWGKMGASLHRLSKSQAIGGKPPYLMPYFGMYGYGGPIAS  244

Query  195  MHLGRR  212
            MHLGRR
Sbjct  245  MHLGRR  250



>ref|XP_010519439.1| PREDICTED: uncharacterized protein LOC104798901 isoform X6 [Tarenaya 
hassleriana]
Length=1624

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D+I++FD+G GMDGS  NSIAKWG+MGAS+HRSSK  A+G KPPYLKP FGMFGYGGPI
Sbjct  181  EDRISVFDTGSGMDGSETNSIAKWGRMGASLHRSSKPLAVGGKPPYLKPLFGMFGYGGPI  240

Query  189  ASMHLGRR  212
            ASMHLG R
Sbjct  241  ASMHLGGR  248



>ref|XP_010519440.1| PREDICTED: uncharacterized protein LOC104798901 isoform X7 [Tarenaya 
hassleriana]
Length=1628

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D+I++FD+G GMDGS  NSIAKWG+MGAS+HRSSK  A+G KPPYLKP FGMFGYGGPI
Sbjct  181  EDRISVFDTGSGMDGSETNSIAKWGRMGASLHRSSKPLAVGGKPPYLKPLFGMFGYGGPI  240

Query  189  ASMHLGRR  212
            ASMHLG R
Sbjct  241  ASMHLGGR  248



>ref|XP_010519438.1| PREDICTED: uncharacterized protein LOC104798901 isoform X5 [Tarenaya 
hassleriana]
Length=1630

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D+I++FD+G GMDGS  NSIAKWG+MGAS+HRSSK  A+G KPPYLKP FGMFGYGGPI
Sbjct  181  EDRISVFDTGSGMDGSETNSIAKWGRMGASLHRSSKPLAVGGKPPYLKPLFGMFGYGGPI  240

Query  189  ASMHLGRR  212
            ASMHLG R
Sbjct  241  ASMHLGGR  248



>ref|XP_010519437.1| PREDICTED: uncharacterized protein LOC104798901 isoform X4 [Tarenaya 
hassleriana]
Length=1632

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D+I++FD+G GMDGS  NSIAKWG+MGAS+HRSSK  A+G KPPYLKP FGMFGYGGPI
Sbjct  181  EDRISVFDTGSGMDGSETNSIAKWGRMGASLHRSSKPLAVGGKPPYLKPLFGMFGYGGPI  240

Query  189  ASMHLGRR  212
            ASMHLG R
Sbjct  241  ASMHLGGR  248



>ref|XP_010519436.1| PREDICTED: uncharacterized protein LOC104798901 isoform X3 [Tarenaya 
hassleriana]
Length=1639

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D+I++FD+G GMDGS  NSIAKWG+MGAS+HRSSK  A+G KPPYLKP FGMFGYGGPI
Sbjct  181  EDRISVFDTGSGMDGSETNSIAKWGRMGASLHRSSKPLAVGGKPPYLKPLFGMFGYGGPI  240

Query  189  ASMHLGRR  212
            ASMHLG R
Sbjct  241  ASMHLGGR  248



>ref|XP_010519435.1| PREDICTED: uncharacterized protein LOC104798901 isoform X2 [Tarenaya 
hassleriana]
Length=1639

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D+I++FD+G GMDGS  NSIAKWG+MGAS+HRSSK  A+G KPPYLKP FGMFGYGGPI
Sbjct  181  EDRISVFDTGSGMDGSETNSIAKWGRMGASLHRSSKPLAVGGKPPYLKPLFGMFGYGGPI  240

Query  189  ASMHLGRR  212
            ASMHLG R
Sbjct  241  ASMHLGGR  248



>ref|XP_010519434.1| PREDICTED: uncharacterized protein LOC104798901 isoform X1 [Tarenaya 
hassleriana]
Length=1641

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D+I++FD+G GMDGS  NSIAKWG+MGAS+HRSSK  A+G KPPYLKP FGMFGYGGPI
Sbjct  181  EDRISVFDTGSGMDGSETNSIAKWGRMGASLHRSSKPLAVGGKPPYLKPLFGMFGYGGPI  240

Query  189  ASMHLGRR  212
            ASMHLG R
Sbjct  241  ASMHLGGR  248



>ref|XP_006286349.1| hypothetical protein CARUB_v10000030mg [Capsella rubella]
 gb|EOA19247.1| hypothetical protein CARUB_v10000030mg [Capsella rubella]
Length=1570

 Score =   119 bits (299),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+IT+FD+G GMD S ENSI KWGK+GAS+HRS K  AIG KPPYLKPYFGMFGYGGP A
Sbjct  177  DRITVFDTGRGMDSSEENSIDKWGKIGASLHRSQKTGAIGGKPPYLKPYFGMFGYGGPYA  236

Query  192  SMHLGRR  212
            SM LGRR
Sbjct  237  SMFLGRR  243



>ref|XP_006394681.1| hypothetical protein EUTSA_v10003513mg [Eutrema salsugineum]
 gb|ESQ31967.1| hypothetical protein EUTSA_v10003513mg [Eutrema salsugineum]
Length=1583

 Score =   119 bits (298),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            +  D+I++FDSG GMD S ENSIAKWGK+GAS+HRS K KAIG KPPYL P+FGMFGYGG
Sbjct  178  VLADRISVFDSGPGMDSSEENSIAKWGKIGASIHRSHKSKAIGGKPPYLMPFFGMFGYGG  237

Query  183  PIASMHLGRR  212
              A MHLGRR
Sbjct  238  AYACMHLGRR  247



>ref|XP_007039066.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
4 [Theobroma cacao]
 gb|EOY23567.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
4 [Theobroma cacao]
Length=1200

 Score =   117 bits (292),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + ++ I+IFD+G GMD S ENSI KWGKMGAS++R SK +AIGCKPPYL P+FGMFGYGG
Sbjct  188  VLENTISIFDTGPGMDSSDENSIVKWGKMGASLNRLSKVQAIGCKPPYLMPFFGMFGYGG  247

Query  183  PIASMHLG  206
            PIASMHLG
Sbjct  248  PIASMHLG  255



>ref|XP_007039064.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
2 [Theobroma cacao]
 gb|EOY23565.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
2 [Theobroma cacao]
Length=1375

 Score =   117 bits (292),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + ++ I+IFD+G GMD S ENSI KWGKMGAS++R SK +AIGCKPPYL P+FGMFGYGG
Sbjct  188  VLENTISIFDTGPGMDSSDENSIVKWGKMGASLNRLSKVQAIGCKPPYLMPFFGMFGYGG  247

Query  183  PIASMHLG  206
            PIASMHLG
Sbjct  248  PIASMHLG  255



>ref|XP_007039067.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
5 [Theobroma cacao]
 gb|EOY23568.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
5 [Theobroma cacao]
Length=1532

 Score =   117 bits (292),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + ++ I+IFD+G GMD S ENSI KWGKMGAS++R SK +AIGCKPPYL P+FGMFGYGG
Sbjct  188  VLENTISIFDTGPGMDSSDENSIVKWGKMGASLNRLSKVQAIGCKPPYLMPFFGMFGYGG  247

Query  183  PIASMHLG  206
            PIASMHLG
Sbjct  248  PIASMHLG  255



>ref|XP_007039063.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
1 [Theobroma cacao]
 gb|EOY23564.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
1 [Theobroma cacao]
Length=1595

 Score =   117 bits (292),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + ++ I+IFD+G GMD S ENSI KWGKMGAS++R SK +AIGCKPPYL P+FGMFGYGG
Sbjct  188  VLENTISIFDTGPGMDSSDENSIVKWGKMGASLNRLSKVQAIGCKPPYLMPFFGMFGYGG  247

Query  183  PIASMHLG  206
            PIASMHLG
Sbjct  248  PIASMHLG  255



>ref|XP_007039065.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
3 [Theobroma cacao]
 gb|EOY23566.1| Gamma-irradiation and mitomycin c induced 1, putative isoform 
3 [Theobroma cacao]
Length=1596

 Score =   117 bits (292),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + ++ I+IFD+G GMD S ENSI KWGKMGAS++R SK +AIGCKPPYL P+FGMFGYGG
Sbjct  188  VLENTISIFDTGPGMDSSDENSIVKWGKMGASLNRLSKVQAIGCKPPYLMPFFGMFGYGG  247

Query  183  PIASMHLG  206
            PIASMHLG
Sbjct  248  PIASMHLG  255



>emb|CDX88084.1| BnaA06g26750D [Brassica napus]
Length=1574

 Score =   115 bits (288),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            + +D+I++FDSG GMD S ENSIAKWGK+GAS+HR+ K KAIG KPPYL P+FGMFGYGG
Sbjct  176  VLEDRISVFDSGPGMDSSKENSIAKWGKIGASIHRAHKSKAIGGKPPYLMPFFGMFGYGG  235

Query  183  PIASMHLGRR  212
              A MHLG R
Sbjct  236  AYACMHLGIR  245



>ref|XP_002874183.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50442.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1607

 Score =   115 bits (288),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+IT+FD+G GMD S ENSI KWGK+GAS+HRS K  AIG KPPYLKPYFGMFGYGGP A
Sbjct  190  DRITVFDTGRGMDSSEENSIDKWGKIGASIHRSQKTGAIGGKPPYLKPYFGMFGYGGPYA  249

Query  192  SMHLG  206
            SM LG
Sbjct  250  SMFLG  254



>ref|XP_006286885.1| hypothetical protein CARUB_v10000029mg [Capsella rubella]
 gb|EOA19783.1| hypothetical protein CARUB_v10000029mg [Capsella rubella]
Length=1588

 Score =   115 bits (288),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+I+IFDSG GMD S  NSI KWGK+GAS+HRS K KA+G +PPYL P+FGMFGYGGP A
Sbjct  180  DRISIFDSGPGMDSSEANSIDKWGKIGASLHRSRKSKAVGGEPPYLMPFFGMFGYGGPYA  239

Query  192  SMHLGRR  212
             MHLGRR
Sbjct  240  CMHLGRR  246



>ref|XP_004309137.1| PREDICTED: uncharacterized protein LOC101291584 [Fragaria vesca 
subsp. vesca]
Length=1595

 Score =   115 bits (287),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D I+IFD+G GMD S EN I KWGKMGAS+HRS K +AIG  PPYLKP+FGMFGYGGPI
Sbjct  158  EDMISIFDNGSGMDASDENCIVKWGKMGASLHRSYKEQAIGGNPPYLKPFFGMFGYGGPI  217

Query  189  ASMHLGR  209
            ASM LGR
Sbjct  218  ASMQLGR  224



>ref|XP_009380586.1| PREDICTED: uncharacterized protein LOC103968942 [Musa acuminata 
subsp. malaccensis]
Length=1584

 Score =   114 bits (286),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            + KI IFDSG GMDGS EN I KWGKMG+S HR+ + KAIG K PYL P+FGMFGYGGPI
Sbjct  176  EQKIEIFDSGQGMDGSEENCITKWGKMGSSKHRACRSKAIGTKAPYLMPFFGMFGYGGPI  235

Query  189  ASMHLGR  209
            A+MHLGR
Sbjct  236  ATMHLGR  242



>ref|XP_008377035.1| PREDICTED: uncharacterized protein LOC103440148 [Malus domestica]
Length=492

 Score =   112 bits (279),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   ITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASM  197
            I+IFD+G GMDGS +NSI KWGKMGAS+HRS K +AIG  PPYL P+FGMFGYGGPIASM
Sbjct  179  ISIFDTGPGMDGSDKNSIVKWGKMGASLHRSFKDQAIGGTPPYLTPFFGMFGYGGPIASM  238

Query  198  HLGR  209
             LGR
Sbjct  239  QLGR  242



>ref|XP_008783195.1| PREDICTED: uncharacterized protein LOC103702510 [Phoenix dactylifera]
Length=1597

 Score =   114 bits (286),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            + KI IFDSG GMDGS ENSI+KWG+MG+S HR S+  AIG K PYL P+FGMFGYGGPI
Sbjct  177  EQKIVIFDSGPGMDGSEENSISKWGRMGSSNHRPSRQMAIGGKAPYLMPFFGMFGYGGPI  236

Query  189  ASMHLGR  209
            ASMHLGR
Sbjct  237  ASMHLGR  243



>ref|XP_010495413.1| PREDICTED: uncharacterized protein LOC104772508 [Camelina sativa]
Length=1449

 Score =   114 bits (284),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+IT+FD+G GMD S +NSI KWGK+GAS+HRS K  AIG  PPYLKPY+GMFGYGGP A
Sbjct  132  DRITVFDTGKGMDSSEQNSIDKWGKIGASLHRSQKTDAIGGDPPYLKPYYGMFGYGGPYA  191

Query  192  SMHLGRR  212
            SM LGRR
Sbjct  192  SMFLGRR  198



>ref|XP_010915961.1| PREDICTED: uncharacterized protein LOC105040910 [Elaeis guineensis]
Length=1594

 Score =   114 bits (285),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            + KI IFDSG GMDGS ENSI+KWG+MG+S HR S+  AIG K PYL P+FGMFGYGGPI
Sbjct  177  EQKIVIFDSGPGMDGSDENSISKWGRMGSSNHRPSRQMAIGGKAPYLMPFFGMFGYGGPI  236

Query  189  ASMHLGR  209
            ASMHLGR
Sbjct  237  ASMHLGR  243



>gb|EYU25236.1| hypothetical protein MIMGU_mgv1a019692mg [Erythranthe guttata]
Length=1524

 Score =   114 bits (284),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGG  182
            L +D+I+IFDSG GMDG+  N + KWGKMGAS+HRS +G+AIG KPPYL P+FGMFGYGG
Sbjct  195  LHRDRISIFDSGPGMDGAGGN-LVKWGKMGASLHRSVRGQAIGGKPPYLMPFFGMFGYGG  253

Query  183  PIASMHLGRR  212
            P+A+M LGRR
Sbjct  254  PVATMCLGRR  263



>ref|XP_009357370.1| PREDICTED: uncharacterized protein LOC103948098 [Pyrus x bretschneideri]
Length=1355

 Score =   114 bits (284),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   ITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASM  197
            ++IFD+G GMDGS ENSI KWGKMGAS+HRS K +AIG  PPYL P+FGMFGYGGPIASM
Sbjct  179  MSIFDTGPGMDGSDENSIVKWGKMGASLHRSFKDQAIGGTPPYLTPFFGMFGYGGPIASM  238

Query  198  HLGR  209
             LGR
Sbjct  239  QLGR  242



>ref|XP_009368768.1| PREDICTED: uncharacterized protein LOC103958243 [Pyrus x bretschneideri]
Length=1387

 Score =   114 bits (284),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   ITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASM  197
            ++IFD+G GMDGS ENSI KWGKMGAS+HRS K +AIG  PPYL P+FGMFGYGGPIASM
Sbjct  184  MSIFDTGPGMDGSDENSIVKWGKMGASLHRSFKDQAIGGTPPYLTPFFGMFGYGGPIASM  243

Query  198  HLGR  209
             LGR
Sbjct  244  QLGR  247



>ref|XP_008234883.1| PREDICTED: uncharacterized protein LOC103333768 [Prunus mume]
Length=1781

 Score =   114 bits (284),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D I+IFD+G GMDGS ENSI KWGKMGAS+HRS + +AIG +PPYL P+FG+FGYGGP+A
Sbjct  175  DVISIFDTGPGMDGSDENSIVKWGKMGASLHRSLREQAIGGRPPYLTPFFGLFGYGGPLA  234

Query  192  SMHLGR  209
            SM LGR
Sbjct  235  SMQLGR  240



>ref|XP_003588515.1| hypothetical protein MTR_1g008050 [Medicago truncatula]
Length=1675

 Score =   113 bits (282),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 59/82 (72%), Gaps = 16/82 (20%)
 Frame = +3

Query  15   KITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYL---------------  149
            KITIFD+G GMD S ENS+ KWGKMGAS+HR SK +AIG KPPYL               
Sbjct  185  KITIFDNGSGMDDSNENSLVKWGKMGASLHRLSKSQAIGGKPPYLMVFFIFVLSDPSFFV  244

Query  150  -KPYFGMFGYGGPIASMHLGRR  212
             +PYFGM+GYGGPIASMHLGRR
Sbjct  245  ERPYFGMYGYGGPIASMHLGRR  266



>ref|XP_006394682.1| hypothetical protein EUTSA_v10003512mg [Eutrema salsugineum]
 gb|ESQ31968.1| hypothetical protein EUTSA_v10003512mg [Eutrema salsugineum]
Length=1599

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+I++FD+G GMD S EN+I KWGK+G S+HRS K  AIG KPPYLKP+FGMFGYGGP A
Sbjct  180  DRISVFDTGRGMDSSEENAIDKWGKIGGSLHRSQKTSAIGGKPPYLKPFFGMFGYGGPYA  239

Query  192  SMHLGRR  212
             M LGRR
Sbjct  240  CMFLGRR  246



>ref|XP_011069355.1| PREDICTED: uncharacterized protein LOC105155189 [Sesamum indicum]
Length=1640

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+I+IFD+G GMDG+  N + KWGKMGAS+HRS++GKAIG KPPYL P+FGMFGYGGP+A
Sbjct  196  DRISIFDTGPGMDGTDGN-LVKWGKMGASLHRSARGKAIGGKPPYLMPFFGMFGYGGPVA  254

Query  192  SMHLGRR  212
            +M LGRR
Sbjct  255  TMCLGRR  261



>emb|CDX80426.1| BnaC07g30180D [Brassica napus]
Length=1586

 Score =   111 bits (277),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+I++FD+G GMD S EN+I KWGK+G S+HRS K  AIG KPPYLKP+FGMFGYGGP A
Sbjct  177  DRISVFDTGRGMDSSEENAIVKWGKIGGSLHRSEKTFAIGGKPPYLKPFFGMFGYGGPYA  236

Query  192  SMHLGRR  212
             M LGRR
Sbjct  237  CMFLGRR  243



>dbj|BAB10394.1| unnamed protein product [Arabidopsis thaliana]
Length=1634

 Score =   111 bits (277),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D IT+FD+G GMD S  NSI KWGK+GAS+HRS K  AIG  PPYLKPYFGMFGYGGP A
Sbjct  186  DHITVFDTGRGMDSSEGNSIDKWGKIGASLHRSQKTGAIGGNPPYLKPYFGMFGYGGPYA  245

Query  192  SMHLGR  209
            SM LGR
Sbjct  246  SMFLGR  251



>emb|CDX88088.1| BnaA06g26790D [Brassica napus]
Length=1607

 Score =   111 bits (277),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+I++FD+G GMD S EN+I KWGK+G S+HRS K  AIG KPPYLKP+FGMFGYGGP A
Sbjct  177  DRISVFDTGRGMDSSEENAIVKWGKIGGSLHRSEKTFAIGGKPPYLKPFFGMFGYGGPYA  236

Query  192  SMHLGRR  212
             M LGRR
Sbjct  237  CMFLGRR  243



>ref|NP_197816.3| gamma-irradiation and mitomycin c induced 1 [Arabidopsis thaliana]
 gb|AED93279.1| gamma-irradiation and mitomycin c induced 1 [Arabidopsis thaliana]
Length=1598

 Score =   110 bits (276),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D IT+FD+G GMD S  NSI KWGK+GAS+HRS K  AIG  PPYLKPYFGMFGYGGP A
Sbjct  177  DHITVFDTGRGMDSSEGNSIDKWGKIGASLHRSQKTGAIGGNPPYLKPYFGMFGYGGPYA  236

Query  192  SMHLGR  209
            SM LGR
Sbjct  237  SMFLGR  242



>ref|XP_007218895.1| hypothetical protein PRUPE_ppa000400mg [Prunus persica]
 gb|EMJ20094.1| hypothetical protein PRUPE_ppa000400mg [Prunus persica]
Length=1207

 Score =   110 bits (275),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D I+IFD+G GMDGS E+ I KWGKMGAS+HRS + +AIG +PPYL P+FGMFGYGGP+A
Sbjct  175  DVISIFDTGPGMDGSDEHCIVKWGKMGASLHRSLREQAIGGRPPYLTPFFGMFGYGGPLA  234

Query  192  SMHLGR  209
            SM LGR
Sbjct  235  SMQLGR  240



>ref|XP_009150949.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103874295 
[Brassica rapa]
Length=1625

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+I++FD+G GMD S EN+I KWGK+G S+HRS K  AIG KPPYLKP+FGMFGYGGP A
Sbjct  177  DRISLFDTGRGMDSSEENAIVKWGKIGGSLHRSEKTFAIGGKPPYLKPFFGMFGYGGPYA  236

Query  192  SMHLGR  209
             M LGR
Sbjct  237  CMFLGR  242



>gb|KDO54232.1| hypothetical protein CISIN_1g0003663mg, partial [Citrus sinensis]
Length=1065

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  45   MDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASMHLGRR  212
            MD + ENSI KWGKMGAS+HR+SK + IG KPPYL P+FGMFGYGGPIASMHLGRR
Sbjct  1    MDSTDENSIVKWGKMGASLHRASKAQGIGGKPPYLTPFFGMFGYGGPIASMHLGRR  56



>ref|XP_006852616.1| hypothetical protein AMTR_s00021p00227450 [Amborella trichopoda]
 gb|ERN14083.1| hypothetical protein AMTR_s00021p00227450 [Amborella trichopoda]
Length=1485

 Score =   105 bits (261),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  15   KITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIAS  194
            KITIFDSG GMDGS E+SI KWGKMG+S HR  +  AIG  PPYL P FGM+GYGG +AS
Sbjct  174  KITIFDSGQGMDGSEESSIVKWGKMGSSNHRYYRVSAIGGDPPYLLPCFGMYGYGGAVAS  233

Query  195  MHLGR  209
            MHLGR
Sbjct  234  MHLGR  238



>ref|XP_010236672.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100829204 
[Brachypodium distachyon]
Length=1572

 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            K+K+ I D+G GMDGS ENSI+KWG +G+S HR  + K IG + PYL P+FGMFGYGG I
Sbjct  172  KEKMVIMDTGRGMDGSDENSISKWGTIGSSNHRVFRNKGIGGEAPYLVPFFGMFGYGGTI  231

Query  189  ASMHLGR  209
            ASMHLGR
Sbjct  232  ASMHLGR  238



>ref|XP_010067961.1| PREDICTED: uncharacterized protein LOC104454756 [Eucalyptus grandis]
Length=256

 Score = 90.1 bits (222),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  132  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  191

Query  192  SMHLGR  209
            SMHLGR
Sbjct  192  SMHLGR  197



>ref|XP_010027395.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417891 
[Eucalyptus grandis]
Length=1516

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  132  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  191

Query  192  SMHLGR  209
            SMHLGR
Sbjct  192  SMHLGR  197



>ref|XP_010038463.1| PREDICTED: uncharacterized protein LOC104427005 [Eucalyptus grandis]
Length=1558

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  182  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  241

Query  192  SMHLGR  209
            SMHLGR
Sbjct  242  SMHLGR  247



>ref|XP_010067954.1| PREDICTED: uncharacterized protein LOC104454747 [Eucalyptus grandis]
Length=1547

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  182  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  241

Query  192  SMHLGR  209
            SMHLGR
Sbjct  242  SMHLGR  247



>ref|XP_010027391.1| PREDICTED: uncharacterized protein LOC104417888 [Eucalyptus grandis]
Length=336

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  182  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  241

Query  192  SMHLGR  209
            SMHLGR
Sbjct  242  SMHLGR  247



>ref|XP_010067964.1| PREDICTED: uncharacterized protein LOC104454760 [Eucalyptus grandis]
Length=1588

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  182  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  241

Query  192  SMHLGR  209
            SMHLGR
Sbjct  242  SMHLGR  247



>gb|KCW62378.1| hypothetical protein EUGRSUZ_H05016 [Eucalyptus grandis]
Length=489

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  171  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  230

Query  192  SMHLGR  209
            SMHLGR
Sbjct  231  SMHLGR  236



>gb|KCW62625.1| hypothetical protein EUGRSUZ_G00143 [Eucalyptus grandis]
Length=500

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  182  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  241

Query  192  SMHLGR  209
            SMHLGR
Sbjct  242  SMHLGR  247



>gb|KCW62610.1| hypothetical protein EUGRSUZ_G00111 [Eucalyptus grandis]
Length=489

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKWGKMGAS+HR  K KA+G KPPYL P+FG+FG+GGPIA
Sbjct  171  EKISIFDTGPGMDDSDENSIAKWGKMGASLHRKYKVKAVGGKPPYLMPFFGLFGFGGPIA  230

Query  192  SMHLGR  209
            SMHLGR
Sbjct  231  SMHLGR  236



>ref|XP_002318430.1| hypothetical protein POPTR_0012s02320g [Populus trichocarpa]
 gb|EEE96650.1| hypothetical protein POPTR_0012s02320g [Populus trichocarpa]
Length=622

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  69   IAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASMHLGRR  212
            +A  GKMGAS+HRS K KAIG KPPYL PYFGMFGYGGPIA+MHLGRR
Sbjct  279  MATRGKMGASLHRSFKAKAIGVKPPYLIPYFGMFGYGGPIATMHLGRR  326



>emb|CBI23013.3| unnamed protein product [Vitis vinifera]
Length=1718

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLK  152
            + +D+I+IFDSG GMDGS ENSI KWGKMGAS+HRSSK +AIG KPPYLK
Sbjct  182  IVEDRISIFDSGPGMDGSDENSIVKWGKMGASLHRSSKAQAIGGKPPYLK  231


 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  147  LKPYFGMFGYGGPIASMHLGR  209
             KP+FGMFGYGGPIASMHLGR
Sbjct  335  FKPFFGMFGYGGPIASMHLGR  355



>ref|XP_002874182.1| hypothetical protein ARALYDRAFT_351449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50441.1| hypothetical protein ARALYDRAFT_351449 [Arabidopsis lyrata subsp. 
lyrata]
Length=698

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  78   WGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASMHLGRR  212
            WGK+GAS+HRS K KAIG  PPYL P+FGMFGYGGP A MHLGRR
Sbjct  31   WGKIGASLHRSHKSKAIGGIPPYLMPFFGMFGYGGPYACMHLGRR  75



>ref|XP_002994428.1| hypothetical protein SELMODRAFT_432347, partial [Selaginella 
moellendorffii]
 gb|EFJ04507.1| hypothetical protein SELMODRAFT_432347, partial [Selaginella 
moellendorffii]
Length=1233

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPI  188
            +D ITIFD+G+GMD +A++SI KWG +GAS HR+   + IG  PP+LKPY G +G GG  
Sbjct  188  QDTITIFDTGMGMDATAQDSIEKWGTVGASNHRNVHRQGIGGDPPFLKPYLGKYGAGGVA  247

Query  189  ASMHLG  206
            A++ LG
Sbjct  248  AALFLG  253



>ref|XP_010067951.1| PREDICTED: uncharacterized protein LOC104454742 [Eucalyptus grandis]
Length=1561

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKW KMGAS+HR  K KA+G KP YL P+FG+FG+GGPIA
Sbjct  182  EKISIFDTGPGMDDSDENSIAKWVKMGASLHRKYKVKAVGRKPLYLMPFFGLFGFGGPIA  241

Query  192  SMHLGR  209
            SMHLGR
Sbjct  242  SMHLGR  247



>gb|KCW62601.1| hypothetical protein EUGRSUZ_G00092 [Eucalyptus grandis]
Length=489

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            +KI+IFD+G GMD S ENSIAKW KMGAS+HR  K KA+G KP YL P+FG+FG+GGPIA
Sbjct  171  EKISIFDTGPGMDDSDENSIAKWVKMGASLHRKYKVKAVGRKPLYLMPFFGLFGFGGPIA  230

Query  192  SMHLGR  209
            SMHLGR
Sbjct  231  SMHLGR  236



>ref|XP_011069370.1| PREDICTED: uncharacterized protein LOC105155197 isoform X4 [Sesamum 
indicum]
Length=481

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  63   NSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASMHLGRR  212
            N    WGKMGAS+HRS++GKAIG KPPYL P+FGMFGYGGP+A+M LGRR
Sbjct  6    NYAIDWGKMGASLHRSARGKAIGGKPPYLMPFFGMFGYGGPVATMCLGRR  55



>ref|XP_011069369.1| PREDICTED: uncharacterized protein LOC105155197 isoform X3 [Sesamum 
indicum]
Length=547

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  63   NSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASMHLGRR  212
            N    WGKMGAS+HRS++GKAIG KPPYL P+FGMFGYGGP+A+M LGRR
Sbjct  6    NYAIDWGKMGASLHRSARGKAIGGKPPYLMPFFGMFGYGGPVATMCLGRR  55



>ref|XP_011069367.1| PREDICTED: uncharacterized protein LOC105155197 isoform X1 [Sesamum 
indicum]
Length=571

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  63   NSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASMHLGRR  212
            N    WGKMGAS+HRS++GKAIG KPPYL P+FGMFGYGGP+A+M LGRR
Sbjct  6    NYAIDWGKMGASLHRSARGKAIGGKPPYLMPFFGMFGYGGPVATMCLGRR  55



>ref|XP_011069368.1| PREDICTED: uncharacterized protein LOC105155197 isoform X2 [Sesamum 
indicum]
Length=558

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +3

Query  87   MGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIASMHLGRR  212
            MGAS+HRS++GKAIG KPPYL P+FGMFGYGGP+A+M LGRR
Sbjct  1    MGASLHRSARGKAIGGKPPYLMPFFGMFGYGGPVATMCLGRR  42



>emb|CDP05057.1| unnamed protein product [Coffea canephora]
Length=1468

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  3    LFKDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYL  149
            L +DKI IFD+G GMDGS ENSIAKWGK+GAS+HR ++ + I  KPPYL
Sbjct  194  LAQDKIEIFDTGPGMDGSDENSIAKWGKIGASLHRLAREQGIESKPPYL  242



>ref|XP_010692829.1| PREDICTED: uncharacterized protein LOC104905880 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692839.1| PREDICTED: uncharacterized protein LOC104905880 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=187

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  9    KDKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYL  149
            +DK+++FD+G  MD S ENSI KWG+MGAS HR+SK  AIG KPPYL
Sbjct  85   EDKVSVFDTGSRMDESDENSIVKWGEMGASAHRTSKRLAIGGKPPYL  131



>ref|XP_010456668.1| PREDICTED: uncharacterized protein LOC104738142 [Camelina sativa]
Length=1711

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 37/67 (55%), Gaps = 24/67 (36%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIGCKPPYLKPYFGMFGYGGPIA  191
            D+IT+FD+G GMD S ENSI KW                        PYFGMFGYGGP A
Sbjct  177  DRITVFDTGKGMDSSEENSIDKW------------------------PYFGMFGYGGPYA  212

Query  192  SMHLGRR  212
            SM LGRR
Sbjct  213  SMFLGRR  219



>ref|XP_011069423.1| PREDICTED: uncharacterized protein LOC105155250 [Sesamum indicum]
Length=247

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +3

Query  12   DKITIFDSGLGMDGSAENSIAKWGKMGASVHRSSKGKAIG  131
            D+I+IFD+G GMDG+  N + KWGKMGAS+HRS++GKAIG
Sbjct  196  DRISIFDTGPGMDGTDGN-LVKWGKMGASLHRSARGKAIG  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511067545352