BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c65847_g1_i1 len=222 path=[200:0-221]

Length=222
                                                                      Score     E

ref|XP_006438002.1|  hypothetical protein CICLE_v10033318mg           95.1    2e-23   
ref|XP_004236928.1|  PREDICTED: uncharacterized protein LOC101264206  92.0    2e-22   
gb|KDP26825.1|  hypothetical protein JCGZ_17983                       90.5    1e-21   
gb|KEH20614.1|  transmembrane protein, putative                       90.1    1e-21   
ref|XP_010530564.1|  PREDICTED: uncharacterized protein LOC104807141  90.1    2e-21   
emb|CDP13356.1|  unnamed protein product                              89.7    2e-21   
ref|XP_004504402.1|  PREDICTED: uncharacterized protein LOC101504831  90.1    1e-20   
ref|XP_009372258.1|  PREDICTED: uncharacterized protein LOC103961441  87.8    1e-20   
ref|XP_007158672.1|  hypothetical protein PHAVU_002G172700g           86.3    5e-20   
ref|XP_004502277.1|  PREDICTED: uncharacterized protein LOC101502767  86.3    6e-20   
ref|XP_003601754.1|  Katanin p80 subunit-like protein                 85.9    8e-20   
ref|XP_002304676.1|  hypothetical protein POPTR_0003s16900g           85.9    8e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006580125.1|  PREDICTED: uncharacterized protein LOC102662714  85.5    9e-20   
ref|XP_009125729.1|  PREDICTED: uncharacterized protein LOC103850696  85.5    9e-20   
ref|XP_004151235.1|  PREDICTED: uncharacterized protein LOC101208994  85.5    1e-19   
ref|XP_010423099.1|  PREDICTED: uncharacterized protein LOC104708251  86.3    1e-19   
ref|XP_010491472.1|  PREDICTED: uncharacterized protein LOC104769048  86.3    1e-19   
ref|XP_002871323.1|  hypothetical protein ARALYDRAFT_487673           85.1    1e-19   
ref|XP_010456447.1|  PREDICTED: uncharacterized protein LOC104737892  85.1    2e-19   
ref|XP_010249051.1|  PREDICTED: uncharacterized protein LOC104591752  84.3    3e-19   
ref|XP_008459846.1|  PREDICTED: uncharacterized protein LOC103498846  84.3    3e-19   
ref|XP_004515066.1|  PREDICTED: uncharacterized protein LOC101492296  84.3    3e-19   
gb|KEH22004.1|  transmembrane protein, putative                       84.3    3e-19   
ref|XP_008441325.1|  PREDICTED: uncharacterized protein LOC103485474  84.3    3e-19   
ref|NP_001119192.1|  uncharacterized protein                          84.0    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006848292.1|  hypothetical protein AMTR_s00013p00100030        84.0    4e-19   
ref|XP_011020769.1|  PREDICTED: uncharacterized protein LOC105123025  86.3    4e-19   
ref|XP_004239230.1|  PREDICTED: uncharacterized protein LOC101249266  84.0    4e-19   
ref|XP_009131063.1|  PREDICTED: uncharacterized protein LOC103855781  83.6    5e-19   
ref|XP_009415891.1|  PREDICTED: uncharacterized protein LOC103996657  83.6    6e-19   
ref|XP_002298634.2|  hypothetical protein POPTR_0001s33660g           83.6    7e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010322518.1|  PREDICTED: uncharacterized protein LOC101251388  82.8    1e-18   
ref|XP_009404758.1|  PREDICTED: uncharacterized protein LOC103987996  82.8    1e-18   
ref|XP_004138621.1|  PREDICTED: uncharacterized protein LOC101211888  84.3    1e-18   
ref|NP_001067936.1|  Os11g0496500                                     82.4    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008810234.1|  PREDICTED: uncharacterized protein LOC103721704  82.4    1e-18   
ref|XP_002297848.1|  hypothetical protein POPTR_0001s13690g           82.4    2e-18   Populus trichocarpa [western balsam poplar]
gb|AFK46474.1|  unknown                                               82.4    2e-18   
ref|XP_010545946.1|  PREDICTED: uncharacterized protein LOC104818180  82.4    2e-18   
gb|ABA93771.1|  expressed protein                                     82.4    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KDP46268.1|  hypothetical protein JCGZ_10108                       82.0    2e-18   
ref|XP_003553935.1|  PREDICTED: uncharacterized protein LOC100793543  82.0    2e-18   
gb|EMS57713.1|  hypothetical protein TRIUR3_30382                     82.0    2e-18   
ref|XP_010556293.1|  PREDICTED: uncharacterized protein LOC104825630  82.0    2e-18   
ref|XP_011071240.1|  PREDICTED: uncharacterized protein LOC105156717  81.6    3e-18   
gb|ACG35954.1|  hypothetical protein                                  81.6    3e-18   Zea mays [maize]
ref|XP_004502278.1|  PREDICTED: uncharacterized protein LOC101503082  81.6    3e-18   
gb|KFK25206.1|  hypothetical protein AALP_AA8G080900                  81.6    3e-18   
gb|KEH18682.1|  transmembrane protein, putative                       82.4    3e-18   
ref|XP_003601753.1|  hypothetical protein MTR_3g085020                81.3    4e-18   
ref|XP_002449524.1|  hypothetical protein SORBIDRAFT_05g017500        81.3    4e-18   Sorghum bicolor [broomcorn]
ref|XP_003577555.1|  PREDICTED: uncharacterized protein LOC100843401  81.3    5e-18   
ref|XP_008807446.1|  PREDICTED: uncharacterized protein LOC103719...  83.2    5e-18   
ref|XP_003528798.1|  PREDICTED: uncharacterized protein LOC100305821  81.3    5e-18   
ref|XP_009359419.1|  PREDICTED: uncharacterized protein LOC103949996  81.3    5e-18   
ref|XP_003549178.1|  PREDICTED: uncharacterized protein LOC100527861  80.9    5e-18   
ref|XP_009629695.1|  PREDICTED: uncharacterized protein LOC104119810  80.9    5e-18   
ref|XP_006347392.1|  PREDICTED: uncharacterized protein LOC102602710  80.9    6e-18   
ref|XP_010656087.1|  PREDICTED: uncharacterized protein LOC100262494  80.5    8e-18   
ref|XP_009416571.1|  PREDICTED: uncharacterized protein LOC103997149  80.5    8e-18   
ref|XP_002514896.1|  conserved hypothetical protein                   80.5    9e-18   Ricinus communis
ref|XP_006352171.1|  PREDICTED: uncharacterized protein LOC102585729  80.5    9e-18   
ref|XP_011000976.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  82.0    1e-17   
ref|XP_004503745.1|  PREDICTED: uncharacterized protein LOC101508777  80.1    1e-17   
ref|XP_009780342.1|  PREDICTED: uncharacterized protein LOC104229393  80.1    1e-17   
ref|XP_008341292.1|  PREDICTED: uncharacterized protein LOC103404182  80.1    1e-17   
ref|XP_004516406.1|  PREDICTED: uncharacterized protein LOC101504054  80.1    1e-17   
ref|XP_010112378.1|  hypothetical protein L484_010783                 80.1    1e-17   
ref|XP_009802034.1|  PREDICTED: uncharacterized protein LOC104247662  79.7    2e-17   
ref|XP_009390391.1|  PREDICTED: uncharacterized protein LOC103976791  79.7    2e-17   
ref|XP_009421065.1|  PREDICTED: uncharacterized protein LOC104000686  79.7    2e-17   
ref|XP_008347999.1|  PREDICTED: uncharacterized protein LOC103411121  81.6    2e-17   
ref|XP_010044830.1|  PREDICTED: uncharacterized protein LOC104433689  79.7    2e-17   
gb|EMS52236.1|  hypothetical protein TRIUR3_01824                     79.7    2e-17   
ref|XP_011009186.1|  PREDICTED: uncharacterized protein LOC105114364  79.7    2e-17   
gb|KEH21021.1|  transmembrane protein, putative                       79.7    2e-17   
gb|AFK47378.1|  unknown                                               79.7    2e-17   
ref|XP_011044119.1|  PREDICTED: uncharacterized protein LOC105139404  79.3    2e-17   
ref|XP_002455352.1|  hypothetical protein SORBIDRAFT_03g009080        79.3    2e-17   Sorghum bicolor [broomcorn]
ref|XP_008222187.1|  PREDICTED: uncharacterized protein LOC103322089  79.3    3e-17   
ref|XP_008231104.1|  PREDICTED: uncharacterized protein LOC103330325  79.3    3e-17   
gb|KCW55823.1|  hypothetical protein EUGRSUZ_I01640                   79.3    3e-17   
ref|XP_006438001.1|  hypothetical protein CICLE_v10033268mg           79.0    3e-17   
ref|XP_008798931.1|  PREDICTED: uncharacterized protein LOC103713699  79.0    3e-17   
gb|EYU42082.1|  hypothetical protein MIMGU_mgv1a017524mg              79.0    3e-17   
ref|XP_007224868.1|  hypothetical protein PRUPE_ppa022743mg           79.0    3e-17   
ref|XP_004979312.1|  PREDICTED: uncharacterized protein LOC101758057  79.0    3e-17   
ref|XP_010682738.1|  PREDICTED: uncharacterized protein LOC104897543  79.0    3e-17   
ref|XP_008346681.1|  PREDICTED: uncharacterized protein LOC103409651  79.0    4e-17   
ref|XP_009594856.1|  PREDICTED: uncharacterized protein LOC104091270  79.0    4e-17   
gb|KDP22604.1|  hypothetical protein JCGZ_26435                       79.0    4e-17   
ref|XP_004138041.1|  PREDICTED: uncharacterized protein LOC101212373  79.0    4e-17   
ref|XP_004967908.1|  PREDICTED: uncharacterized protein LOC101762723  79.0    4e-17   
ref|XP_006373209.1|  hypothetical protein POPTR_0017s09670g           79.0    4e-17   
gb|ACG32653.1|  hypothetical protein                                  79.0    4e-17   Zea mays [maize]
ref|XP_011071239.1|  PREDICTED: uncharacterized protein LOC105156716  78.6    4e-17   
ref|XP_008361851.1|  PREDICTED: uncharacterized protein LOC103425537  78.6    4e-17   
ref|XP_003553183.1|  PREDICTED: uncharacterized protein LOC100527578  78.6    4e-17   
ref|XP_007161717.1|  hypothetical protein PHAVU_001G092500g           78.6    4e-17   
ref|XP_008360750.1|  PREDICTED: uncharacterized protein LOC103424445  78.6    4e-17   
ref|XP_010250673.1|  PREDICTED: uncharacterized protein LOC104592859  78.6    5e-17   
emb|CBI21336.3|  unnamed protein product                              78.6    5e-17   
ref|XP_007163777.1|  hypothetical protein PHAVU_001G263200g           78.6    5e-17   
ref|XP_007216168.1|  hypothetical protein PRUPE_ppa015651mg           78.6    5e-17   
ref|XP_004306304.1|  PREDICTED: uncharacterized protein LOC101306369  78.6    5e-17   
ref|XP_007217459.1|  hypothetical protein PRUPE_ppa026813mg           80.1    5e-17   
ref|XP_010026396.1|  PREDICTED: uncharacterized protein LOC104416742  78.6    5e-17   
ref|XP_004297598.1|  PREDICTED: uncharacterized protein LOC101294753  78.2    6e-17   
gb|EMT00249.1|  hypothetical protein F775_21667                       78.2    6e-17   
emb|CDP13357.1|  unnamed protein product                              78.2    6e-17   
ref|XP_008678124.1|  PREDICTED: uncharacterized protein LOC100277266  80.1    7e-17   
ref|XP_010680010.1|  PREDICTED: uncharacterized protein LOC104895250  78.2    7e-17   
ref|XP_010090640.1|  hypothetical protein L484_017442                 78.2    7e-17   
ref|XP_010037403.1|  PREDICTED: uncharacterized protein LOC104426149  78.2    8e-17   
ref|XP_007043959.1|  Uncharacterized protein TCM_008722               79.7    8e-17   
ref|XP_008341296.1|  PREDICTED: uncharacterized protein LOC103404186  78.2    8e-17   
ref|XP_007031906.1|  Uncharacterized protein TCM_017235               78.2    8e-17   
ref|XP_008379108.1|  PREDICTED: uncharacterized protein LOC103442131  77.8    9e-17   
ref|XP_007160023.1|  hypothetical protein PHAVU_002G286200g           77.8    1e-16   
ref|XP_006493216.1|  PREDICTED: uncharacterized protein LOC102619374  77.8    1e-16   
ref|XP_009344919.1|  PREDICTED: uncharacterized protein LOC103936777  79.3    1e-16   
ref|XP_009597111.1|  PREDICTED: uncharacterized protein LOC104093102  77.8    1e-16   
ref|XP_010503500.1|  PREDICTED: uncharacterized protein LOC104780677  77.4    1e-16   
ref|XP_010026362.1|  PREDICTED: uncharacterized protein LOC104416706  78.2    1e-16   
gb|KCW44914.1|  hypothetical protein EUGRSUZ_L01505                   78.6    1e-16   
ref|XP_010028990.1|  PREDICTED: uncharacterized protein LOC104419133  79.3    1e-16   
ref|XP_002511164.1|  conserved hypothetical protein                   77.4    1e-16   Ricinus communis
ref|XP_006447045.1|  hypothetical protein CICLE_v10017396mg           77.4    1e-16   
ref|XP_010695381.1|  PREDICTED: uncharacterized protein LOC104908027  77.4    2e-16   
ref|XP_009612663.1|  PREDICTED: uncharacterized protein LOC104105934  77.0    2e-16   
ref|XP_004231769.1|  PREDICTED: uncharacterized protein LOC101265494  77.0    2e-16   
ref|XP_009129453.1|  PREDICTED: uncharacterized protein LOC103854271  77.0    2e-16   
ref|XP_008360131.1|  PREDICTED: uncharacterized protein LOC103423825  77.0    2e-16   
ref|XP_006404231.1|  hypothetical protein EUTSA_v10010885mg           77.0    2e-16   
ref|XP_010660745.1|  PREDICTED: uncharacterized protein LOC100246292  77.0    2e-16   
gb|EMS52235.1|  hypothetical protein TRIUR3_01823                     77.0    2e-16   
ref|XP_002297849.2|  hypothetical protein POPTR_0001s13680g           77.8    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002304675.2|  hypothetical protein POPTR_0003s16890g           77.8    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002300115.2|  hypothetical protein POPTR_0001s33620g           77.0    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002270842.1|  PREDICTED: uncharacterized protein LOC100261...  78.6    2e-16   Vitis vinifera
ref|XP_004306303.1|  PREDICTED: uncharacterized protein LOC101306079  79.0    2e-16   
gb|EMT10577.1|  hypothetical protein F775_16458                       76.6    2e-16   
ref|XP_009372260.1|  PREDICTED: uncharacterized protein LOC103961442  76.6    2e-16   
ref|XP_007038005.1|  Uncharacterized protein TCM_014660               79.0    3e-16   
ref|XP_003525413.1|  PREDICTED: uncharacterized protein LOC100805083  77.4    3e-16   
ref|XP_002270989.1|  PREDICTED: uncharacterized protein LOC100251434  76.6    3e-16   Vitis vinifera
ref|XP_010044829.1|  PREDICTED: uncharacterized protein LOC104433688  76.6    3e-16   
ref|XP_009375198.1|  PREDICTED: uncharacterized protein LOC103964039  76.3    3e-16   
gb|KCW61925.1|  hypothetical protein EUGRSUZ_H04621                   76.3    3e-16   
ref|XP_003631356.1|  PREDICTED: uncharacterized protein LOC100852958  76.3    3e-16   
ref|XP_006591443.1|  PREDICTED: uncharacterized protein LOC100787382  76.3    4e-16   
ref|XP_006470082.1|  PREDICTED: uncharacterized protein LOC102613711  77.8    4e-16   
ref|XP_009771783.1|  PREDICTED: uncharacterized protein LOC104222267  76.3    4e-16   
ref|XP_010682737.1|  PREDICTED: uncharacterized protein LOC104897542  75.9    4e-16   
ref|XP_006436859.1|  hypothetical protein CICLE_v10033156mg           76.6    5e-16   
ref|XP_006351515.1|  PREDICTED: uncharacterized protein LOC102599395  75.9    5e-16   
ref|XP_009606515.1|  PREDICTED: uncharacterized protein LOC104100868  75.9    5e-16   
gb|AFK45116.1|  unknown                                               75.9    5e-16   
ref|XP_008222189.1|  PREDICTED: uncharacterized protein LOC103322090  75.5    6e-16   
ref|XP_004515980.1|  PREDICTED: uncharacterized protein LOC101493085  75.5    6e-16   
ref|XP_008379099.1|  PREDICTED: uncharacterized protein LOC103442121  75.5    7e-16   
ref|XP_007225875.1|  hypothetical protein PRUPE_ppa014446mg           75.5    7e-16   
ref|XP_009149804.1|  PREDICTED: uncharacterized protein LOC103873125  75.5    7e-16   
ref|XP_006395490.1|  hypothetical protein EUTSA_v10005242mg           75.5    7e-16   
ref|XP_006338707.1|  PREDICTED: uncharacterized protein LOC102580109  75.5    8e-16   
emb|CBI21334.3|  unnamed protein product                              75.5    8e-16   
ref|XP_004234309.1|  PREDICTED: uncharacterized protein LOC101248948  75.5    8e-16   
ref|XP_011097271.1|  PREDICTED: uncharacterized protein LOC105176237  75.5    9e-16   
ref|XP_009151995.1|  PREDICTED: uncharacterized protein LOC103875253  75.1    9e-16   
ref|XP_006292149.1|  hypothetical protein CARUB_v10018353mg           75.1    1e-15   
ref|XP_004960935.1|  PREDICTED: uncharacterized protein LOC101767288  75.1    1e-15   
emb|CDX83043.1|  BnaA01g20430D                                        75.1    1e-15   
ref|XP_006591444.1|  PREDICTED: uncharacterized protein LOC102660664  75.1    1e-15   
ref|XP_010550223.1|  PREDICTED: uncharacterized protein LOC104821134  75.1    1e-15   
ref|XP_004304527.1|  PREDICTED: uncharacterized protein LOC101292234  75.1    1e-15   
ref|XP_010425441.1|  PREDICTED: uncharacterized protein LOC104710521  75.1    1e-15   
ref|XP_010528162.1|  PREDICTED: uncharacterized protein LOC104805325  76.6    1e-15   
ref|XP_002875914.1|  hypothetical protein ARALYDRAFT_323459           75.1    1e-15   
gb|KFK33626.1|  hypothetical protein AALP_AA5G038000                  74.7    1e-15   
ref|NP_001118713.1|  uncharacterized protein                          74.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010663762.1|  PREDICTED: uncharacterized protein LOC100247554  74.7    1e-15   
ref|NP_190435.1|  uncharacterized protein                             75.1    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150183.1|  PREDICTED: uncharacterized protein LOC103873522  74.7    1e-15   
ref|XP_009344922.1|  PREDICTED: uncharacterized protein LOC103936782  74.7    1e-15   
ref|XP_007043960.1|  Uncharacterized protein TCM_008724               74.7    2e-15   
ref|XP_008341295.1|  PREDICTED: uncharacterized protein LOC103404185  74.7    2e-15   
ref|XP_006447041.1|  hypothetical protein CICLE_v10017392mg           74.7    2e-15   
ref|XP_007163776.1|  hypothetical protein PHAVU_001G263100g           74.7    2e-15   
ref|XP_006292147.1|  hypothetical protein CARUB_v10018351mg           74.7    2e-15   
ref|XP_006580126.1|  PREDICTED: uncharacterized protein LOC102662841  74.3    2e-15   
ref|XP_006594529.1|  PREDICTED: uncharacterized protein LOC102664775  74.3    2e-15   
ref|XP_006582287.1|  PREDICTED: uncharacterized protein LOC102670423  74.3    2e-15   
ref|NP_201155.1|  uncharacterized protein                             74.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551939.1|  PREDICTED: uncharacterized protein LOC104822418  74.3    2e-15   
ref|XP_002439094.1|  hypothetical protein SORBIDRAFT_09g000370        74.3    2e-15   Sorghum bicolor [broomcorn]
ref|XP_010024171.1|  PREDICTED: uncharacterized protein LOC104414707  73.9    3e-15   
emb|CDY13678.1|  BnaA06g32450D                                        73.9    3e-15   
ref|XP_006285635.1|  hypothetical protein CARUB_v10007088mg           73.9    3e-15   
dbj|BAD42942.1|  hypothetical protein                                 73.9    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009343145.1|  PREDICTED: uncharacterized protein LOC103935116  73.6    4e-15   
gb|ACG48702.1|  hypothetical protein                                  73.6    4e-15   Zea mays [maize]
ref|XP_006292430.1|  hypothetical protein CARUB_v10018645mg           73.6    4e-15   
ref|XP_008798929.1|  PREDICTED: uncharacterized protein LOC103713697  73.6    4e-15   
gb|KCW60621.1|  hypothetical protein EUGRSUZ_H03346                   74.3    5e-15   
ref|XP_009402174.1|  PREDICTED: uncharacterized protein LOC103986032  73.6    5e-15   
ref|XP_010680015.1|  PREDICTED: uncharacterized protein LOC104895255  73.2    5e-15   
gb|KCW61926.1|  hypothetical protein EUGRSUZ_H04622                   73.2    5e-15   
ref|XP_002453888.1|  hypothetical protein SORBIDRAFT_04g020640        73.2    5e-15   Sorghum bicolor [broomcorn]
ref|XP_009150403.1|  PREDICTED: uncharacterized protein LOC103873762  73.2    5e-15   
ref|XP_010250671.1|  PREDICTED: uncharacterized protein LOC104592857  73.2    6e-15   
dbj|BAD23191.1|  unknown protein                                      73.2    6e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406320.1|  PREDICTED: uncharacterized protein LOC103989242  73.2    6e-15   
ref|NP_001046925.2|  Os02g0508100                                     73.2    6e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002321710.2|  hypothetical protein POPTR_0015s11020g           73.2    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008806424.1|  PREDICTED: uncharacterized protein LOC103719121  73.2    6e-15   
ref|NP_001045237.1|  Os01g0923200                                     73.2    6e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010112381.1|  hypothetical protein L484_010786                 73.2    6e-15   
ref|XP_003575012.1|  PREDICTED: uncharacterized protein LOC100826781  72.8    7e-15   
ref|XP_010258717.1|  PREDICTED: uncharacterized protein LOC104598380  72.8    7e-15   
ref|XP_010027269.1|  PREDICTED: uncharacterized protein LOC104417744  75.5    7e-15   
ref|XP_008790764.1|  PREDICTED: uncharacterized protein LOC103707858  72.8    7e-15   
ref|XP_008810232.1|  PREDICTED: uncharacterized protein LOC103721701  72.8    8e-15   
gb|AFK41536.1|  unknown                                               72.8    8e-15   
ref|XP_009129455.1|  PREDICTED: uncharacterized protein LOC103854274  72.8    8e-15   
ref|XP_007038004.1|  Uncharacterized protein TCM_014659               72.4    1e-14   
emb|CBI15682.3|  unnamed protein product                              73.9    1e-14   
ref|XP_009419370.1|  PREDICTED: uncharacterized protein LOC103999354  72.4    1e-14   
ref|XP_011098906.1|  PREDICTED: uncharacterized protein LOC105177439  72.4    1e-14   
ref|NP_189339.1|  uncharacterized protein                             73.9    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151994.1|  PREDICTED: uncharacterized protein LOC103875252  73.9    1e-14   
ref|XP_002877012.1|  hypothetical protein ARALYDRAFT_322830           73.9    1e-14   
ref|XP_010244261.1|  PREDICTED: uncharacterized protein LOC104588139  72.4    1e-14   
emb|CDP16705.1|  unnamed protein product                              72.4    1e-14   
ref|XP_011097269.1|  PREDICTED: uncharacterized protein LOC105176235  72.8    1e-14   
ref|XP_004971095.1|  PREDICTED: uncharacterized protein LOC101772582  72.4    1e-14   
ref|XP_006395489.1|  hypothetical protein EUTSA_v10005506mg           74.3    1e-14   
gb|ACG41546.1|  hypothetical protein                                  72.0    1e-14   Zea mays [maize]
ref|XP_008790760.1|  PREDICTED: uncharacterized protein LOC103707855  72.0    2e-14   
ref|XP_011098903.1|  PREDICTED: uncharacterized protein LOC105177436  72.0    2e-14   
ref|XP_008239492.1|  PREDICTED: uncharacterized protein LOC103338084  72.0    2e-14   
ref|XP_003531203.1|  PREDICTED: uncharacterized protein LOC100777861  72.0    2e-14   
ref|XP_010250670.1|  PREDICTED: uncharacterized protein LOC104592856  73.6    2e-14   
gb|EPS58439.1|  hypothetical protein M569_16374                       73.6    2e-14   
emb|CDY58411.1|  BnaC09g54570D                                        71.6    2e-14   
emb|CDX84422.1|  BnaC03g50780D                                        71.6    2e-14   
ref|XP_009379975.1|  PREDICTED: uncharacterized protein LOC103968468  71.6    2e-14   
ref|XP_009771784.1|  PREDICTED: uncharacterized protein LOC104222268  71.6    2e-14   
dbj|BAJ92955.1|  predicted protein                                    71.6    2e-14   
gb|EMT04963.1|  hypothetical protein F775_27729                       71.6    2e-14   
ref|NP_001054393.1|  Os05g0103300                                     71.6    3e-14   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97857.1|  predicted protein                                    71.2    3e-14   
ref|NP_001052628.1|  Os04g0387600                                     71.2    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456863.1|  hypothetical protein SORBIDRAFT_03g044200        72.0    3e-14   Sorghum bicolor [broomcorn]
ref|NP_001054394.1|  Os05g0103400                                     71.2    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645248.1|  PREDICTED: uncharacterized protein LOC102707917  71.2    3e-14   
gb|ABK25714.1|  unknown                                               71.2    3e-14   Picea sitchensis
gb|EPS61900.1|  hypothetical protein M569_12894                       71.2    4e-14   
ref|XP_010028987.1|  PREDICTED: uncharacterized protein LOC104419131  71.2    4e-14   
emb|CDX78560.1|  BnaA03g04720D                                        70.9    4e-14   
gb|ACF80966.1|  unknown                                               70.9    4e-14   Zea mays [maize]
ref|XP_006399920.1|  hypothetical protein EUTSA_v10015204mg           70.9    4e-14   
ref|XP_008360130.1|  PREDICTED: uncharacterized protein LOC103423824  70.9    4e-14   
gb|ACG27375.1|  hypothetical protein                                  70.9    4e-14   Zea mays [maize]
ref|XP_009131386.1|  PREDICTED: uncharacterized protein LOC103856060  70.9    4e-14   
gb|KFK28060.1|  hypothetical protein AALP_AA8G466600                  70.9    4e-14   
ref|XP_007210695.1|  hypothetical protein PRUPE_ppa026126mg           70.9    5e-14   
gb|ABR25956.1|  unknown                                               71.6    5e-14   Oryza sativa Indica Group [Indian rice]
emb|CDY52400.1|  BnaC07g48990D                                        70.9    5e-14   
emb|CDP16708.1|  unnamed protein product                              70.9    5e-14   
emb|CDY67025.1|  BnaCnng53210D                                        70.9    5e-14   
ref|XP_007158670.1|  hypothetical protein PHAVU_002G172500g           70.9    5e-14   
gb|KFK34166.1|  hypothetical protein AALP_AA5G109200                  70.5    5e-14   
dbj|BAK06202.1|  predicted protein                                    70.5    6e-14   
gb|EMT23663.1|  hypothetical protein F775_26540                       70.5    6e-14   
ref|XP_003579615.1|  PREDICTED: uncharacterized protein LOC100836824  70.5    6e-14   
gb|EYU45420.1|  hypothetical protein MIMGU_mgv1a017520mg              70.5    6e-14   
gb|EMS45275.1|  hypothetical protein TRIUR3_20548                     70.5    6e-14   
ref|XP_010086969.1|  hypothetical protein L484_010115                 70.5    7e-14   
emb|CDX70542.1|  BnaC03g06260D                                        70.5    7e-14   
ref|XP_003549164.1|  PREDICTED: uncharacterized protein LOC100306597  70.5    7e-14   
emb|CDX77093.1|  BnaC04g38880D                                        70.5    7e-14   
ref|XP_003553940.1|  PREDICTED: uncharacterized protein LOC100796180  70.5    7e-14   
ref|XP_004231771.1|  PREDICTED: uncharacterized protein LOC101266083  70.1    8e-14   
ref|XP_010680011.1|  PREDICTED: uncharacterized protein LOC104895252  70.1    8e-14   
gb|KFK25642.1|  hypothetical protein AALP_AA8G141200                  70.1    9e-14   
ref|XP_002884251.1|  hypothetical protein ARALYDRAFT_477317           70.1    9e-14   
ref|XP_010249052.1|  PREDICTED: uncharacterized protein LOC104591753  70.1    1e-13   
ref|XP_003549157.1|  PREDICTED: uncharacterized protein LOC100809615  70.1    1e-13   
ref|XP_009606509.1|  PREDICTED: uncharacterized protein LOC104100863  70.1    1e-13   
gb|KCW60623.1|  hypothetical protein EUGRSUZ_H03348                   69.7    1e-13   
ref|XP_007161714.1|  hypothetical protein PHAVU_001G092200g           69.7    1e-13   
gb|ABK28273.1|  unknown                                               69.7    1e-13   
ref|NP_196915.1|  uncharacterized protein                             69.7    1e-13   
gb|EMS48358.1|  hypothetical protein TRIUR3_06279                     69.7    1e-13   
ref|XP_007031908.1|  Uncharacterized protein TCM_017237               70.9    1e-13   
gb|ADE76945.1|  unknown                                               69.7    1e-13   
ref|XP_002459730.1|  hypothetical protein SORBIDRAFT_02g009520        69.7    1e-13   
ref|XP_010249499.1|  PREDICTED: uncharacterized protein LOC104592052  69.7    1e-13   
emb|CDY68347.1|  BnaAnng27000D                                        69.7    1e-13   
gb|EPS58440.1|  hypothetical protein M569_16375                       69.3    1e-13   
ref|XP_007216210.1|  hypothetical protein PRUPE_ppa016180mg           69.3    2e-13   
ref|XP_006299323.1|  hypothetical protein CARUB_v10015480mg           69.3    2e-13   
ref|XP_008652274.1|  PREDICTED: uncharacterized protein LOC103632238  69.7    2e-13   
dbj|BAK02583.1|  predicted protein                                    69.3    2e-13   
ref|XP_009597110.1|  PREDICTED: uncharacterized protein LOC104093101  69.3    2e-13   
emb|CDY13677.1|  BnaA06g32460D                                        69.3    2e-13   
ref|NP_001175149.1|  Os07g0298400                                     69.3    2e-13   
ref|NP_186844.1|  uncharacterized protein                             69.3    2e-13   
gb|AAB07877.1|  localized according to blastn similarity to EST s...  69.3    2e-13   
gb|AFW75090.1|  hypothetical protein ZEAMMB73_968611                  70.1    2e-13   
dbj|BAD23654.1|  hypothetical protein                                 68.9    2e-13   
ref|XP_008347996.1|  PREDICTED: uncharacterized protein LOC103411119  68.9    2e-13   
ref|XP_003553939.1|  PREDICTED: uncharacterized protein LOC100526927  68.9    3e-13   
ref|XP_006657625.1|  PREDICTED: uncharacterized protein LOC102711082  68.9    3e-13   
ref|XP_004515979.1|  PREDICTED: uncharacterized protein LOC101492304  68.6    3e-13   
ref|XP_006365032.1|  PREDICTED: uncharacterized protein LOC102587038  68.9    3e-13   
ref|XP_008351734.1|  PREDICTED: uncharacterized protein LOC103415161  68.6    3e-13   
ref|XP_010249054.1|  PREDICTED: uncharacterized protein LOC104591755  68.6    3e-13   
ref|XP_009125167.1|  PREDICTED: uncharacterized protein LOC103850202  68.6    3e-13   
ref|XP_010090641.1|  hypothetical protein L484_017443                 70.1    4e-13   
ref|XP_004173967.1|  PREDICTED: uncharacterized protein LOC101232695  68.6    4e-13   
gb|EMS49217.1|  hypothetical protein TRIUR3_07383                     68.9    4e-13   
gb|KEH21990.1|  AT.I.24-6 protein, putative                           68.2    4e-13   
ref|XP_011098905.1|  PREDICTED: uncharacterized protein LOC105177438  68.2    4e-13   
emb|CDY28499.1|  BnaC02g36610D                                        68.2    4e-13   
ref|XP_004138623.1|  PREDICTED: uncharacterized protein LOC101212375  68.2    4e-13   
ref|NP_198914.1|  uncharacterized protein                             68.2    5e-13   
ref|XP_004231770.1|  PREDICTED: uncharacterized protein LOC101265785  69.7    5e-13   
gb|EYU34817.1|  hypothetical protein MIMGU_mgv1a018707mg              68.2    5e-13   
ref|XP_006373211.1|  hypothetical protein POPTR_0017s09690g           68.2    5e-13   
ref|XP_009125964.1|  PREDICTED: uncharacterized protein LOC103850916  68.2    5e-13   
ref|XP_010420033.1|  PREDICTED: uncharacterized protein LOC104705680  68.2    5e-13   
ref|XP_008441320.1|  PREDICTED: uncharacterized protein LOC103485470  68.2    5e-13   
ref|XP_006289013.1|  hypothetical protein CARUB_v10002394mg           68.2    5e-13   
ref|XP_006338705.1|  PREDICTED: uncharacterized protein LOC102579469  69.7    6e-13   
ref|XP_009121695.1|  PREDICTED: uncharacterized protein LOC103846509  68.2    6e-13   
emb|CDY34185.1|  BnaA02g28550D                                        67.8    6e-13   
ref|XP_006436858.1|  hypothetical protein CICLE_v10033493mg           67.8    6e-13   
ref|XP_004975405.1|  PREDICTED: uncharacterized protein LOC101768729  67.8    7e-13   
ref|XP_009410640.1|  PREDICTED: uncharacterized protein LOC103992590  67.8    7e-13   
ref|XP_010250672.1|  PREDICTED: uncharacterized protein LOC104592858  67.8    7e-13   
gb|KDP46267.1|  hypothetical protein JCGZ_10107                       67.4    8e-13   
ref|XP_003575014.1|  PREDICTED: uncharacterized protein LOC100827399  67.4    9e-13   
gb|EYU45418.1|  hypothetical protein MIMGU_mgv1a025760mg              68.9    9e-13   
ref|XP_009771780.1|  PREDICTED: uncharacterized protein LOC104222265  67.0    1e-12   
gb|ACG43521.1|  hypothetical protein                                  67.4    1e-12   
ref|XP_002873649.1|  hypothetical protein ARALYDRAFT_909368           67.0    1e-12   
ref|XP_004233289.1|  PREDICTED: uncharacterized protein LOC101246593  67.0    1e-12   
ref|XP_008239629.1|  PREDICTED: uncharacterized protein LOC103338223  66.6    1e-12   
ref|XP_004955990.1|  PREDICTED: uncharacterized protein LOC101770220  67.4    2e-12   
ref|XP_009387682.1|  PREDICTED: uncharacterized protein LOC103974558  66.6    2e-12   
gb|KFK37650.1|  hypothetical protein AALP_AA3G010700                  66.6    2e-12   
ref|XP_002509498.1|  conserved hypothetical protein                   66.6    2e-12   
gb|AAB07878.1|  localized according to blastn similarity to EST s...  66.6    2e-12   
ref|XP_009597108.1|  PREDICTED: uncharacterized protein LOC104093099  66.6    2e-12   
ref|XP_002882156.1|  hypothetical protein ARALYDRAFT_477318           66.6    2e-12   
gb|EYU34816.1|  hypothetical protein MIMGU_mgv1a023280mg              66.2    2e-12   
gb|EMT02180.1|  hypothetical protein F775_13187                       66.6    2e-12   
emb|CDM85796.1|  unnamed protein product                              66.6    2e-12   
gb|EMS45582.1|  hypothetical protein TRIUR3_17661                     66.6    2e-12   
ref|NP_566158.1|  uncharacterized protein                             66.2    3e-12   
ref|XP_003631357.1|  PREDICTED: uncharacterized protein LOC100852987  66.2    3e-12   
ref|XP_006447040.1|  hypothetical protein CICLE_v10017398mg           66.2    3e-12   
gb|KDO63902.1|  hypothetical protein CISIN_1g035267mg                 65.9    3e-12   
ref|XP_007161713.1|  hypothetical protein PHAVU_001G092100g           65.9    4e-12   
dbj|BAK05783.1|  predicted protein                                    65.9    4e-12   
ref|XP_010232759.1|  PREDICTED: uncharacterized protein LOC100824068  67.4    4e-12   
ref|XP_009606513.1|  PREDICTED: uncharacterized protein LOC104100866  65.5    5e-12   
ref|XP_006848286.1|  hypothetical protein AMTR_s00013p00095520        65.5    5e-12   
gb|EMT07012.1|  hypothetical protein F775_42741                       66.2    5e-12   
ref|XP_009151486.1|  PREDICTED: uncharacterized protein LOC103874798  65.5    6e-12   
gb|KDO39368.1|  hypothetical protein CISIN_1g039872mg                 65.5    6e-12   
ref|XP_008441322.1|  PREDICTED: uncharacterized protein LOC103485472  65.5    6e-12   
ref|XP_008231102.1|  PREDICTED: uncharacterized protein LOC103330323  65.5    6e-12   
ref|XP_009129454.1|  PREDICTED: uncharacterized protein LOC103854272  65.5    6e-12   
ref|XP_006604976.1|  PREDICTED: uncharacterized protein LOC100799722  67.4    6e-12   
ref|XP_010024172.1|  PREDICTED: uncharacterized protein LOC104414708  65.1    8e-12   
ref|XP_004960934.1|  PREDICTED: uncharacterized protein LOC101766876  65.1    8e-12   
ref|XP_003549169.1|  PREDICTED: uncharacterized protein LOC100816029  64.7    9e-12   
ref|XP_006447043.1|  hypothetical protein CICLE_v10017400mg           64.7    9e-12   
ref|XP_008346680.1|  PREDICTED: uncharacterized protein LOC103409650  64.7    9e-12   
ref|XP_006447042.1|  hypothetical protein CICLE_v10017402mg           64.7    1e-11   
ref|XP_007161715.1|  hypothetical protein PHAVU_001G092300g           64.7    1e-11   
ref|XP_003553938.1|  PREDICTED: uncharacterized protein LOC100795123  64.7    1e-11   
emb|CAN77119.1|  hypothetical protein VITISV_037262                   64.7    1e-11   
ref|XP_006405409.1|  hypothetical protein EUTSA_v10028016mg           64.7    1e-11   
gb|EMS62568.1|  hypothetical protein TRIUR3_03662                     64.3    1e-11   
ref|XP_010556291.1|  PREDICTED: uncharacterized protein LOC104825629  64.3    1e-11   
gb|KHN48794.1|  hypothetical protein glysoja_030564                   64.7    1e-11   
emb|CDX85612.1|  BnaA02g02010D                                        68.2    2e-11   
ref|XP_010112380.1|  hypothetical protein L484_010785                 63.9    2e-11   
ref|XP_003575013.1|  PREDICTED: uncharacterized protein LOC100827089  63.9    2e-11   
ref|XP_006373212.1|  hypothetical protein POPTR_0017s09700g           63.9    2e-11   
emb|CDP16707.1|  unnamed protein product                              63.5    2e-11   
gb|KDP46266.1|  hypothetical protein JCGZ_10106                       64.3    3e-11   
ref|XP_006402079.1|  hypothetical protein EUTSA_v10015879mg           63.5    3e-11   
ref|XP_002509499.1|  conserved hypothetical protein                   63.2    4e-11   
ref|XP_002318139.1|  hypothetical protein POPTR_0012s10180g           63.2    4e-11   
ref|XP_002298636.2|  hypothetical protein POPTR_0001s33630g           62.8    5e-11   
gb|KEH21985.1|  transmembrane protein, putative                       63.2    8e-11   
ref|XP_009383324.1|  PREDICTED: uncharacterized protein LOC103971097  62.4    8e-11   
ref|XP_009107435.1|  PREDICTED: uncharacterized protein LOC103833087  62.0    9e-11   
emb|CDX71672.1|  BnaC09g27130D                                        62.0    1e-10   
emb|CDY05817.1|  BnaA10g06030D                                        62.0    1e-10   
ref|XP_009597109.1|  PREDICTED: uncharacterized protein LOC104093100  62.0    1e-10   
gb|ABK23540.1|  unknown                                               61.6    1e-10   
ref|XP_006279722.1|  hypothetical protein CARUB_v10027492mg           61.6    2e-10   
ref|XP_004145151.1|  PREDICTED: uncharacterized protein LOC101223049  61.6    2e-10   
ref|XP_009771781.1|  PREDICTED: uncharacterized protein LOC104222266  61.2    2e-10   
ref|XP_011098907.1|  PREDICTED: uncharacterized protein LOC105177440  61.2    2e-10   
gb|KEH20615.1|  transmembrane protein, putative                       61.2    2e-10   
emb|CDY11729.1|  BnaC06g13370D                                        61.2    2e-10   
ref|XP_006284883.1|  hypothetical protein CARUB_v10006174mg           60.8    3e-10   
emb|CDY68346.1|  BnaAnng26990D                                        60.8    3e-10   
ref|NP_198913.1|  uncharacterized protein                             60.5    4e-10   
ref|XP_007031909.1|  Uncharacterized protein TCM_017240               63.5    4e-10   
gb|EMS67281.1|  hypothetical protein TRIUR3_17967                     60.1    5e-10   
ref|XP_010086968.1|  hypothetical protein L484_010114                 60.1    6e-10   
ref|XP_009381336.1|  PREDICTED: uncharacterized protein LOC103969512  59.7    8e-10   
ref|NP_568739.1|  uncharacterized protein                             59.3    1e-09   
ref|XP_004515981.1|  PREDICTED: uncharacterized protein LOC101493411  59.3    1e-09   
ref|XP_009125166.1|  PREDICTED: uncharacterized protein LOC103850201  58.9    2e-09   
dbj|BAK05016.1|  predicted protein                                    58.9    2e-09   
ref|XP_006373213.1|  hypothetical protein POPTR_0017s09710g           58.5    2e-09   
ref|XP_008239488.1|  PREDICTED: uncharacterized protein LOC103338082  58.5    2e-09   
ref|XP_006292151.1|  hypothetical protein CARUB_v10018355mg           58.5    2e-09   
ref|XP_008807445.1|  PREDICTED: uncharacterized protein LOC103719...  58.5    2e-09   
ref|XP_002509501.1|  conserved hypothetical protein                   58.5    2e-09   
ref|XP_002321709.2|  hypothetical protein POPTR_0015s11010g           58.9    3e-09   
ref|XP_002864068.1|  hypothetical protein ARALYDRAFT_495120           58.2    3e-09   
ref|XP_007210213.1|  hypothetical protein PRUPE_ppa015984mg           58.2    3e-09   
gb|AFK41617.1|  unknown                                               58.2    3e-09   
ref|XP_009384297.1|  PREDICTED: uncharacterized protein LOC103971877  58.2    3e-09   
ref|XP_009375199.1|  PREDICTED: uncharacterized protein LOC103964040  57.8    4e-09   
ref|XP_011097274.1|  PREDICTED: uncharacterized protein LOC105176239  57.4    6e-09   
gb|KCW55821.1|  hypothetical protein EUGRSUZ_I01638                   57.0    7e-09   
gb|AEW08927.1|  hypothetical protein CL2309Contig1_03                 57.0    8e-09   
ref|XP_002455353.1|  hypothetical protein SORBIDRAFT_03g009090        57.0    8e-09   
ref|XP_010680018.1|  PREDICTED: uncharacterized protein LOC104895258  56.6    1e-08   
ref|XP_004152116.1|  PREDICTED: uncharacterized protein LOC101215245  56.6    1e-08   
gb|ACG27155.1|  hypothetical protein                                  56.2    1e-08   
emb|CAN79771.1|  hypothetical protein VITISV_019407                   58.5    2e-08   
ref|XP_004297600.1|  PREDICTED: uncharacterized protein LOC101296283  55.8    2e-08   
ref|XP_006605561.1|  PREDICTED: uncharacterized protein LOC102669109  55.8    3e-08   
gb|ABK21760.1|  unknown                                               55.5    3e-08   
ref|XP_008341294.1|  PREDICTED: uncharacterized protein LOC103404184  55.5    3e-08   
ref|XP_009140053.1|  PREDICTED: uncharacterized protein LOC103864042  55.5    4e-08   
gb|EMT11234.1|  hypothetical protein F775_26159                       55.1    5e-08   
ref|XP_003544184.1|  PREDICTED: uncharacterized protein LOC100776055  54.7    5e-08   
gb|KHN41505.1|  hypothetical protein glysoja_039206                   54.7    7e-08   
gb|EPS69781.1|  hypothetical protein M569_04985                       53.9    1e-07   
ref|XP_002453889.1|  hypothetical protein SORBIDRAFT_04g020650        53.5    2e-07   
ref|XP_004152115.1|  PREDICTED: uncharacterized protein LOC101215007  53.1    2e-07   
ref|XP_010231875.1|  PREDICTED: uncharacterized protein LOC104582784  53.1    2e-07   
ref|XP_007031905.1|  Uncharacterized protein TCM_017234               53.9    2e-07   
ref|XP_003564612.2|  PREDICTED: uncharacterized protein LOC100824890  53.1    2e-07   
ref|XP_004967907.1|  PREDICTED: uncharacterized protein LOC101762316  53.1    3e-07   
ref|XP_002870662.1|  hypothetical protein ARALYDRAFT_493879           52.8    3e-07   
ref|NP_001046927.1|  Os02g0509500                                     52.8    3e-07   
gb|ACG24923.1|  hypothetical protein                                  52.8    4e-07   
gb|EMS47260.1|  hypothetical protein TRIUR3_27395                     52.8    4e-07   
ref|XP_008454011.1|  PREDICTED: uncharacterized protein LOC103494560  52.8    4e-07   
gb|EPS62813.1|  hypothetical protein M569_11976                       52.8    4e-07   
ref|XP_008798930.1|  PREDICTED: uncharacterized protein LOC103713698  52.0    5e-07   
ref|XP_010660748.1|  PREDICTED: uncharacterized protein LOC100261...  52.0    7e-07   
ref|XP_009402172.1|  PREDICTED: uncharacterized protein LOC103986031  51.6    8e-07   
gb|EMT15753.1|  hypothetical protein F775_43850                       52.4    8e-07   
dbj|BAD45503.1|  hypothetical protein                                 51.6    9e-07   
ref|XP_009601177.1|  PREDICTED: uncharacterized protein LOC104096500  51.6    9e-07   
ref|XP_004233290.1|  PREDICTED: uncharacterized protein LOC101246891  51.6    1e-06   
ref|XP_010112382.1|  hypothetical protein L484_010787                 51.2    1e-06   
ref|XP_006365033.1|  PREDICTED: uncharacterized protein LOC102587365  51.2    1e-06   
ref|XP_003568948.1|  PREDICTED: uncharacterized protein LOC100830110  50.8    2e-06   
ref|XP_001751826.1|  predicted protein                                50.8    2e-06   
ref|XP_011097273.1|  PREDICTED: uncharacterized protein LOC105176238  50.4    2e-06   
ref|XP_001760825.1|  predicted protein                                50.4    2e-06   
ref|XP_001763506.1|  predicted protein                                50.4    2e-06   
ref|XP_010233405.1|  PREDICTED: uncharacterized protein LOC104583268  53.1    3e-06   
ref|XP_010441260.1|  PREDICTED: uncharacterized protein LOC104724469  50.4    3e-06   
ref|XP_002455354.1|  hypothetical protein SORBIDRAFT_03g009100        50.1    3e-06   
ref|XP_010249053.1|  PREDICTED: uncharacterized protein LOC104591754  49.7    5e-06   
ref|XP_002456636.1|  hypothetical protein SORBIDRAFT_03g039900        49.7    5e-06   
ref|XP_004967906.1|  PREDICTED: uncharacterized protein LOC101761897  49.7    5e-06   
gb|ACG34311.1|  hypothetical protein                                  49.7    5e-06   
ref|XP_008347997.1|  PREDICTED: uncharacterized protein LOC103411120  49.3    5e-06   
emb|CDY52401.1|  BnaC07g49000D                                        51.6    7e-06   
ref|XP_007216639.1|  hypothetical protein PRUPE_ppb025443mg           48.9    7e-06   
dbj|BAB62632.1|  P0402A09.15                                          52.4    8e-06   
ref|XP_008231103.1|  PREDICTED: uncharacterized protein LOC103330324  48.9    8e-06   
ref|XP_010660746.1|  PREDICTED: uncharacterized protein LOC100256574  48.5    1e-05   
ref|XP_002509500.1|  conserved hypothetical protein                   48.5    1e-05   
ref|XP_006373210.1|  hypothetical protein POPTR_0017s09680g           48.5    1e-05   
gb|AFK45356.1|  unknown                                               48.5    1e-05   
ref|XP_002300114.1|  hypothetical protein POPTR_0001s33640g           47.8    2e-05   
ref|XP_004515982.1|  PREDICTED: uncharacterized protein LOC101493732  47.8    2e-05   
ref|XP_003549176.1|  PREDICTED: uncharacterized protein LOC100820286  47.8    3e-05   
ref|XP_006470081.1|  PREDICTED: uncharacterized protein LOC102613424  47.4    3e-05   
ref|NP_001044809.1|  Os01g0849500                                     47.4    3e-05   
ref|XP_006447044.1|  hypothetical protein CICLE_v10018377mg           47.4    3e-05   
gb|EMT24283.1|  hypothetical protein F775_11711                       47.4    3e-05   



>ref|XP_006438002.1| hypothetical protein CICLE_v10033318mg [Citrus clementina]
 ref|XP_006484136.1| PREDICTED: uncharacterized protein LOC102617214 [Citrus sinensis]
 gb|ESR51242.1| hypothetical protein CICLE_v10033318mg [Citrus clementina]
 gb|KDO81858.1| hypothetical protein CISIN_1g040541mg [Citrus sinensis]
Length=69

 Score = 95.1 bits (235),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR RCVEFGNFQTSG A++VH+LLYFALV VFFLAVKV
Sbjct  10   AVILFVLLSPGLLFQVPGRHRCVEFGNFQTSGAAIMVHSLLYFALVCVFFLAVKV  64



>ref|XP_004236928.1| PREDICTED: uncharacterized protein LOC101264206 [Solanum lycopersicum]
 ref|XP_006355057.1| PREDICTED: uncharacterized protein LOC102605996 [Solanum tuberosum]
Length=69

 Score = 92.0 bits (227),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LLSPGLLFQLPG R CVEFGNF TSG ++++H LLYFALV VFFLAVKV
Sbjct  10   SVILFILLSPGLLFQLPGHRHCVEFGNFHTSGASIMIHTLLYFALVCVFFLAVKV  64



>gb|KDP26825.1| hypothetical protein JCGZ_17983 [Jatropha curcas]
Length=69

 Score = 90.5 bits (223),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PG RRCVEFGNFQTSG +++VH+LLYFALV VFFLA++V
Sbjct  10   AVILFVLLTPGLLFQVPGNRRCVEFGNFQTSGASIMVHSLLYFALVCVFFLALRV  64



>gb|KEH20614.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 90.1 bits (222),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            S++LFVLL+PGLLFQ+PGR RCVEFGNFQTSG ++L+H+LLYF  V +FFLA+K+
Sbjct  10   SIVLFVLLTPGLLFQIPGRSRCVEFGNFQTSGASILIHSLLYFGFVCIFFLAIKI  64



>ref|XP_010530564.1| PREDICTED: uncharacterized protein LOC104807141 [Tarenaya hassleriana]
 ref|XP_010552445.1| PREDICTED: uncharacterized protein LOC104822794 [Tarenaya hassleriana]
Length=69

 Score = 90.1 bits (222),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPGR RCVEFGNFQTS  AV+VH+LLYFALV VF LAVK+
Sbjct  10   AVILFVLLTPGLLFQLPGRNRCVEFGNFQTSAPAVIVHSLLYFALVCVFTLAVKI  64



>emb|CDP13356.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 89.7 bits (221),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PG  RCVEFGN QTSG A++VH+LLYFAL+SVF LA+K+
Sbjct  10   AVVLFVLLSPGLLFQIPGHHRCVEFGNLQTSGAAIMVHSLLYFALISVFLLAIKL  64



>ref|XP_004504402.1| PREDICTED: uncharacterized protein LOC101504831 [Cicer arietinum]
Length=143

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            S++LFVLL+PGLLFQLPGR RCVEFGNFQTSG ++L+H+LLYFA + +F +AVK+
Sbjct  10   SIVLFVLLTPGLLFQLPGRSRCVEFGNFQTSGASILIHSLLYFAFICIFLIAVKI  64


 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LFVLLSPGLLFQLP + R V FG+ QTSG+++LVH +++F L+++F LA+ +
Sbjct  84   SVVLFVLLSPGLLFQLPAKGRVVAFGSMQTSGISILVHTIIFFGLITIFLLAIGI  138



>ref|XP_009372258.1| PREDICTED: uncharacterized protein LOC103961441 [Pyrus x bretschneideri]
Length=69

 Score = 87.8 bits (216),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR RCVEFG+F TSG A++VH+LLYF L+ VF LA+KV
Sbjct  10   AVVLFVLLSPGLLFQLPGRHRCVEFGSFHTSGAAIMVHSLLYFGLICVFLLAIKV  64



>ref|XP_007158672.1| hypothetical protein PHAVU_002G172700g [Phaseolus vulgaris]
 gb|ESW30666.1| hypothetical protein PHAVU_002G172700g [Phaseolus vulgaris]
Length=69

 Score = 86.3 bits (212),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            S++LFVLL+PGLLFQ+PGR RCVEFGNFQTSG +VL+H+LLYF  + VF LA+K+
Sbjct  10   SLVLFVLLTPGLLFQVPGRGRCVEFGNFQTSGASVLIHSLLYFGFICVFLLAIKI  64



>ref|XP_004502277.1| PREDICTED: uncharacterized protein LOC101502767 [Cicer arietinum]
Length=69

 Score = 86.3 bits (212),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +VMLFVLL+PGLLFQ+PGR RC+EFGNFQTS  A+++H+LLYFALV +F +A+K+
Sbjct  10   TVMLFVLLTPGLLFQVPGRSRCIEFGNFQTSAAAIVLHSLLYFALVCLFLIAIKL  64



>ref|XP_003601754.1| Katanin p80 subunit-like protein [Medicago truncatula]
 gb|AES72005.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 85.9 bits (211),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +VMLFVLL+PGLLFQ+PGR RC+EFGNFQTS  A++VH+LLYF LV +F +A++V
Sbjct  10   TVMLFVLLTPGLLFQVPGRSRCIEFGNFQTSAAAIVVHSLLYFGLVCLFLIAIRV  64



>ref|XP_002304676.1| hypothetical protein POPTR_0003s16900g [Populus trichocarpa]
 gb|EEE79655.1| hypothetical protein POPTR_0003s16900g [Populus trichocarpa]
Length=69

 Score = 85.9 bits (211),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLLFQ+PGR R +EFGNFQTSG +++VH LLYFAL+ VF LAVKV
Sbjct  10   AVVLFILLTPGLLFQVPGRHRSIEFGNFQTSGASIMVHTLLYFALICVFLLAVKV  64



>ref|XP_006580125.1| PREDICTED: uncharacterized protein LOC102662714 [Glycine max]
 gb|KHN34828.1| hypothetical protein glysoja_036821 [Glycine soja]
Length=69

 Score = 85.5 bits (210),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            S++LFVLL+PGLLFQ+PGR R VEFGNFQTSG A+L+H+LLYFAL+ VF LAV++
Sbjct  10   SLVLFVLLTPGLLFQVPGRSRVVEFGNFQTSGAAILIHSLLYFALICVFLLAVRI  64



>ref|XP_009125729.1| PREDICTED: uncharacterized protein LOC103850696 [Brassica rapa]
 emb|CDY44773.1| BnaC02g01140D [Brassica napus]
 emb|CDY40749.1| BnaAnng06120D [Brassica napus]
Length=69

 Score = 85.5 bits (210),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQLPGR+R VEFGNFQTS V+V+VH+LLYF+LV VF LA+K+
Sbjct  10   TVILFVMLTPGLLFQLPGRQRYVEFGNFQTSAVSVMVHSLLYFSLVCVFLLALKI  64



>ref|XP_004151235.1| PREDICTED: uncharacterized protein LOC101208994 [Cucumis sativus]
 ref|XP_004172710.1| PREDICTED: uncharacterized protein LOC101231572 [Cucumis sativus]
 gb|KGN46463.1| hypothetical protein Csa_6G095300 [Cucumis sativus]
Length=70

 Score = 85.5 bits (210),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPG RRC+EFGNF TS  A++VH++LYF L+ VF LA+KV
Sbjct  10   AVILFVLLTPGLLFQLPGNRRCLEFGNFHTSAAAIIVHSILYFGLICVFLLAIKV  64



>ref|XP_010423099.1| PREDICTED: uncharacterized protein LOC104708251 [Camelina sativa]
Length=102

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQLPGR+R VEFGNFQTS V+V+VH+LLYF+LV VF LA+K+
Sbjct  43   TVILFVMLTPGLLFQLPGRQRYVEFGNFQTSAVSVIVHSLLYFSLVCVFLLALKI  97



>ref|XP_010491472.1| PREDICTED: uncharacterized protein LOC104769048 [Camelina sativa]
Length=101

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQLPGR+R VEFGNFQTS V+V+VH+LLYF+LV VF LA+K+
Sbjct  42   TVILFVMLTPGLLFQLPGRQRYVEFGNFQTSAVSVIVHSLLYFSLVCVFLLALKI  96



>ref|XP_002871323.1| hypothetical protein ARALYDRAFT_487673 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006289011.1| hypothetical protein CARUB_v10002392mg [Capsella rubella]
 ref|XP_006399330.1| hypothetical protein EUTSA_v10015314mg [Eutrema salsugineum]
 gb|EFH47582.1| hypothetical protein ARALYDRAFT_487673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA21909.1| hypothetical protein CARUB_v10002392mg [Capsella rubella]
 gb|ESQ40783.1| hypothetical protein EUTSA_v10015314mg [Eutrema salsugineum]
Length=69

 Score = 85.1 bits (209),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQLPGR+R VEFGNFQTS V+V+VH+LLYF+LV VF LA+K+
Sbjct  10   TVILFVMLTPGLLFQLPGRQRYVEFGNFQTSAVSVIVHSLLYFSLVCVFLLALKI  64



>ref|XP_010456447.1| PREDICTED: uncharacterized protein LOC104737892 [Camelina sativa]
Length=86

 Score = 85.1 bits (209),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQLPGR+R VEFGNFQTS V+V+VH+LLYF+LV VF LA+K+
Sbjct  27   TVILFVMLTPGLLFQLPGRQRYVEFGNFQTSAVSVIVHSLLYFSLVCVFLLALKI  81



>ref|XP_010249051.1| PREDICTED: uncharacterized protein LOC104591752 [Nelumbo nucifera]
Length=69

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGL+FQLPGR R VEFGN QTSGV++LVHA++YFAL+++F +A+ V
Sbjct  10   AVVLFVLLTPGLVFQLPGRNRIVEFGNMQTSGVSILVHAVIYFALITIFLIAIGV  64



>ref|XP_008459846.1| PREDICTED: uncharacterized protein LOC103498846 [Cucumis melo]
Length=70

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPG RRC+EFGNF TS  +++VH++LYF L+ VF LA+KV
Sbjct  10   AVILFVLLTPGLLFQLPGNRRCLEFGNFHTSAASIIVHSILYFGLICVFLLAIKV  64



>ref|XP_004515066.1| PREDICTED: uncharacterized protein LOC101492296 [Cicer arietinum]
Length=69

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLLFQ+PGR + VEFGNFQTSG+++L+HALLYF LV +F LA+ +
Sbjct  10   SVVLFILLTPGLLFQIPGRNKIVEFGNFQTSGLSILIHALLYFGLVCIFMLAIGI  64



>gb|KEH22004.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLLFQ+PGR R VEFGNFQTSG+++L+HA+LYFALV +F LA+ +
Sbjct  10   SVVLFILLTPGLLFQIPGRGRFVEFGNFQTSGLSILIHAMLYFALVCIFMLAIGI  64



>ref|XP_008441325.1| PREDICTED: uncharacterized protein LOC103485474 [Cucumis melo]
Length=70

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +VMLFVLL+PGLL Q+PG+ R VEFGNFQTSGV++LVH++LYFAL+ +F LAV+V
Sbjct  10   AVMLFVLLTPGLLVQMPGKSRFVEFGNFQTSGVSILVHSILYFALICIFLLAVRV  64



>ref|NP_001119192.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM64499.1| unknown [Arabidopsis thaliana]
 gb|AED91293.1| uncharacterized protein AT5G08391 [Arabidopsis thaliana]
Length=69

 Score = 84.0 bits (206),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQLPGR++ VEFGNFQTS V+V+VH+LLYF+LV VF LA+K+
Sbjct  10   TVILFVMLTPGLLFQLPGRQKYVEFGNFQTSAVSVIVHSLLYFSLVCVFLLALKI  64



>ref|XP_006848292.1| hypothetical protein AMTR_s00013p00100030 [Amborella trichopoda]
 gb|ERN09873.1| hypothetical protein AMTR_s00013p00100030 [Amborella trichopoda]
Length=69

 Score = 84.0 bits (206),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG+ R VEFGNFQTSG+++LVH ++YF L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGKSRVVEFGNFQTSGISILVHTIIYFGLITIFLIAIGV  64



>ref|XP_011020769.1| PREDICTED: uncharacterized protein LOC105123025 [Populus euphratica]
Length=155

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLLFQ+PGR R +EFGNFQTSG +++VH LLYFAL+ VF LAVKV
Sbjct  10   AVVLFILLTPGLLFQVPGRHRSIEFGNFQTSGASIMVHTLLYFALICVFLLAVKV  64


 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLL QLPGR R VEFGN QTSG+++LVH +++F L+++F +A+ V
Sbjct  96   AVVLFVLLSPGLLCQLPGRSRVVEFGNLQTSGLSILVHTIIFFGLITIFLIAIGV  150



>ref|XP_004239230.1| PREDICTED: uncharacterized protein LOC101249266 [Solanum lycopersicum]
Length=69

 Score = 84.0 bits (206),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR + VEFGN QTSG++VLVH +LYFAL++VF +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRHKIVEFGNMQTSGLSVLVHTVLYFALITVFLIAIGV  64



>ref|XP_009131063.1| PREDICTED: uncharacterized protein LOC103855781 [Brassica rapa]
 emb|CDX81100.1| BnaC03g03540D [Brassica napus]
Length=70

 Score = 83.6 bits (205),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQLPGR+R VEFGNFQTS V+V+VH+LLYF+L  VF LA+K+
Sbjct  11   TVILFVMLTPGLLFQLPGRQRYVEFGNFQTSAVSVIVHSLLYFSLACVFLLALKI  65



>ref|XP_009415891.1| PREDICTED: uncharacterized protein LOC103996657 [Musa acuminata 
subsp. malaccensis]
Length=69

 Score = 83.6 bits (205),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +VMLFVLLSPGLL QLP R R VEFGN QTSG+++LVHA+LYFALV++F +A+ V
Sbjct  10   AVMLFVLLSPGLLIQLPARGRVVEFGNMQTSGLSILVHAILYFALVTIFLIAIGV  64



>ref|XP_002298634.2| hypothetical protein POPTR_0001s33660g [Populus trichocarpa]
 gb|EEE83439.2| hypothetical protein POPTR_0001s33660g [Populus trichocarpa]
Length=76

 Score = 83.6 bits (205),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PGR+R VEFGNFQTSGV++LVH++LYFAL+ +F LAV V
Sbjct  10   AVVLFILLTPGLLIQIPGRQRLVEFGNFQTSGVSILVHSILYFALICIFLLAVGV  64



>ref|XP_010322518.1| PREDICTED: uncharacterized protein LOC101251388 [Solanum lycopersicum]
Length=69

 Score = 82.8 bits (203),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPGR + VEFGN QTSGV++LVHA++YF L+++F LA+ V
Sbjct  10   AVVLFVLLTPGLLFQLPGRGKTVEFGNMQTSGVSILVHAVIYFGLITIFLLAIGV  64



>ref|XP_009404758.1| PREDICTED: uncharacterized protein LOC103987996 [Musa acuminata 
subsp. malaccensis]
Length=70

 Score = 82.8 bits (203),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQ+PGR R +EFGNFQTSG+++LVH+++YF L+++F LAV V
Sbjct  10   AVILFILLSPGLLFQVPGRSRFIEFGNFQTSGISILVHSIIYFGLLAIFLLAVHV  64



>ref|XP_004138621.1| PREDICTED: uncharacterized protein LOC101211888 [Cucumis sativus]
 ref|XP_004172664.1| PREDICTED: uncharacterized LOC101211888 [Cucumis sativus]
Length=142

 Score = 84.3 bits (207),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +VMLFVLL+PGLL Q+PG+ R VEFGNFQTSGV++LVH++LYFAL+ +F LAV+V
Sbjct  10   AVMLFVLLTPGLLVQMPGKSRFVEFGNFQTSGVSILVHSILYFALICIFLLAVRV  64


 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LFVLLSPGLLFQ PG  R  EFG+ +T+G AV +H L++F L +VF LA+ +
Sbjct  83   GVVLFVLLSPGLLFQFPGNNRQFEFGSMKTNGKAVAIHTLIFFVLYAVFILALHI  137



>ref|NP_001067936.1| Os11g0496500 [Oryza sativa Japonica Group]
 dbj|BAF28299.1| Os11g0496500 [Oryza sativa Japonica Group]
 gb|EAY81001.1| hypothetical protein OsI_36184 [Oryza sativa Indica Group]
 dbj|BAG88505.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68208.1| hypothetical protein OsI_36188 [Oryza sativa Indica Group]
 gb|EEE52133.1| hypothetical protein OsJ_33960 [Oryza sativa Japonica Group]
Length=69

 Score = 82.4 bits (202),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             ++LF+LLSPGLLFQ+PG+ R VEFGNFQTSG+++LVH+++YFAL+++F LAV V
Sbjct  10   GLVLFILLSPGLLFQIPGKGRIVEFGNFQTSGLSILVHSIIYFALIAIFLLAVNV  64



>ref|XP_008810234.1| PREDICTED: uncharacterized protein LOC103721704 [Phoenix dactylifera]
Length=69

 Score = 82.4 bits (202),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLLSPGLLFQLPGR R VEFGNFQTSG+++L+H ++YF L+++F +A+ V
Sbjct  10   ATVLFVLLSPGLLFQLPGRGRVVEFGNFQTSGISILIHTVIYFGLITIFLIAIGV  64



>ref|XP_002297848.1| hypothetical protein POPTR_0001s13690g [Populus trichocarpa]
 ref|XP_011036095.1| PREDICTED: uncharacterized protein LOC105133709 [Populus euphratica]
 gb|EEE82653.1| hypothetical protein POPTR_0001s13690g [Populus trichocarpa]
Length=69

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLLFQ+PGR R VEFGNFQTSG +++VH LLYFAL+ V  LAVKV
Sbjct  10   AVVLFILLTPGLLFQVPGRHRYVEFGNFQTSGASIMVHTLLYFALICVSLLAVKV  64



>gb|AFK46474.1| unknown [Medicago truncatula]
Length=69

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLL Q+PG+ + VEFGNFQTSG+++L+H++LYFALV +FFLA+++
Sbjct  10   SVVLFILLTPGLLVQIPGKGKMVEFGNFQTSGLSILIHSILYFALVCIFFLAIRI  64



>ref|XP_010545946.1| PREDICTED: uncharacterized protein LOC104818180 [Tarenaya hassleriana]
Length=69

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR R VEFGN QTSG ++LVHA++YF L+++F +A++V
Sbjct  10   AVVLFVLLSPGLLFQIPGRGRVVEFGNMQTSGASILVHAIIYFGLITIFTVAIQV  64



>gb|ABA93771.1| expressed protein [Oryza sativa Japonica Group]
Length=76

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             ++LF+LLSPGLLFQ+PG+ R VEFGNFQTSG+++LVH+++YFAL+++F LAV V
Sbjct  10   GLVLFILLSPGLLFQIPGKGRIVEFGNFQTSGLSILVHSIIYFALIAIFLLAVNV  64



>gb|KDP46268.1| hypothetical protein JCGZ_10108 [Jatropha curcas]
Length=69

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PGR R +EFGNFQTSGV++LVH++LYFAL+ +F LAV V
Sbjct  10   AVVLFILLTPGLLIQIPGRHRFIEFGNFQTSGVSILVHSILYFALICIFLLAVGV  64



>ref|XP_003553935.1| PREDICTED: uncharacterized protein LOC100793543 [Glycine max]
 gb|KHN10360.1| hypothetical protein glysoja_048323 [Glycine soja]
Length=69

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LLSPGLL Q+PGR R +EFGNFQTSG+++L+HA+LYFALV +F LA+ +
Sbjct  10   SVVLFILLSPGLLVQIPGRGRFIEFGNFQTSGLSILIHAILYFALVCIFMLAIGI  64



>gb|EMS57713.1| hypothetical protein TRIUR3_30382 [Triticum urartu]
 gb|EMT08747.1| hypothetical protein F775_32325 [Aegilops tauschii]
Length=69

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             ++LF+LLSPGLLFQ+PG+ R VEFGNFQTSG+++LVHA++YFAL+++  LAV V
Sbjct  10   GLVLFILLSPGLLFQIPGKGRMVEFGNFQTSGISILVHAVIYFALIAILILAVNV  64



>ref|XP_010556293.1| PREDICTED: uncharacterized protein LOC104825630 [Tarenaya hassleriana]
Length=69

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLL Q+PGR R VEFG FQTSGV+VLVH+L+YF LV +FFLAV V
Sbjct  10   AVALFVLLTPGLLIQIPGRSRVVEFGTFQTSGVSVLVHSLIYFTLVCIFFLAVHV  64



>ref|XP_011071240.1| PREDICTED: uncharacterized protein LOC105156717 [Sesamum indicum]
Length=70

 Score = 81.6 bits (200),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFGN QTSG+++LVH ++YF L+++F +A+ V
Sbjct  11   AVVLFVLLSPGLLFQLPGRGRVVEFGNMQTSGLSILVHTIIYFGLITIFLIAIGV  65



>gb|ACG35954.1| hypothetical protein [Zea mays]
 gb|ACG40527.1| hypothetical protein [Zea mays]
Length=69

 Score = 81.6 bits (200),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             ++LF+LLSPGLLFQ+PG+ R +EFGNFQTSG+++LVHA++YFAL+++F LAV V
Sbjct  10   GLVLFILLSPGLLFQIPGKGRIIEFGNFQTSGLSILVHAVIYFALLAIFLLAVGV  64



>ref|XP_004502278.1| PREDICTED: uncharacterized protein LOC101503082 [Cicer arietinum]
Length=69

 Score = 81.6 bits (200),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFGN QTSGV++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRSRVVEFGNMQTSGVSILVHTIIFFGLITIFLIAIGV  64



>gb|KFK25206.1| hypothetical protein AALP_AA8G080900 [Arabis alpina]
Length=69

 Score = 81.6 bits (200),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQLPG++R VEFGNF TS  +V+VH+LLYF+LV VF LA+K+
Sbjct  10   TVILFVMLTPGLLFQLPGKQRYVEFGNFHTSAASVIVHSLLYFSLVCVFLLAIKI  64



>gb|KEH18682.1| transmembrane protein, putative [Medicago truncatula]
Length=110

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLL Q+PG+ + VEFGNFQTSG+++L+H++LYFALV +FFLA+++
Sbjct  10   SVVLFILLTPGLLVQIPGKGKMVEFGNFQTSGLSILIHSILYFALVCIFFLAIRI  64



>ref|XP_003601753.1| hypothetical protein MTR_3g085020 [Medicago truncatula]
 gb|AES72004.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 81.3 bits (199),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR + VEFGN QTSGV++LVH +L+F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQMPGRNKVVEFGNMQTSGVSILVHTILFFGLITIFLIAIGV  64



>ref|XP_002449524.1| hypothetical protein SORBIDRAFT_05g017500 [Sorghum bicolor]
 gb|ACG39831.1| hypothetical protein [Zea mays]
 gb|ACG48790.1| hypothetical protein [Zea mays]
 gb|EES08512.1| hypothetical protein SORBIDRAFT_05g017500 [Sorghum bicolor]
 gb|AFW60737.1| hypothetical protein ZEAMMB73_570920 [Zea mays]
Length=69

 Score = 81.3 bits (199),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             ++LF+LLSPGLLFQ+PG+ R +EFGNFQTSG+++L+HA++YFAL+++F LAV V
Sbjct  10   GLVLFILLSPGLLFQIPGKGRIIEFGNFQTSGLSILIHAVIYFALLAIFLLAVGV  64



>ref|XP_003577555.1| PREDICTED: uncharacterized protein LOC100843401 [Brachypodium 
distachyon]
Length=69

 Score = 81.3 bits (199),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             ++LF+LLSPGLLFQ+PG+ R VEFGNFQTSG+++LVHA++YFAL+++F LA+ V
Sbjct  10   GLVLFILLSPGLLFQIPGKGRMVEFGNFQTSGLSILVHAVIYFALIAIFILALGV  64



>ref|XP_008807446.1| PREDICTED: uncharacterized protein LOC103719813 isoform X2 [Phoenix 
dactylifera]
Length=142

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LF+LLSPGLLFQ+PG+ R VEFGNFQTSG+++LVHA+++FALV++F LA+ +
Sbjct  10   AAVLFILLSPGLLFQIPGKNRIVEFGNFQTSGISILVHAIIFFALVAIFLLAIGI  64


 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SPGLLF+LPG  R V+FG F+T+G AV +H L++FAL ++  LA+ +
Sbjct  91   SPGLLFELPGTHRAVDFGGFRTNGKAVAIHTLIFFALFTILILALHL  137



>ref|XP_003528798.1| PREDICTED: uncharacterized protein LOC100305821 [Glycine max]
 ref|XP_003548470.1| PREDICTED: uncharacterized protein LOC100781253 [Glycine max]
 gb|KHN06296.1| hypothetical protein glysoja_021134 [Glycine soja]
 gb|KHN15948.1| hypothetical protein glysoja_013164 [Glycine soja]
Length=70

 Score = 81.3 bits (199),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLL Q+PG+ + VEFGNFQTSGV++LVH++LYFALV +F +A+ V
Sbjct  10   SVVLFILLTPGLLIQIPGKGKMVEFGNFQTSGVSILVHSILYFALVCIFLMAIGV  64



>ref|XP_009359419.1| PREDICTED: uncharacterized protein LOC103949996 [Pyrus x bretschneideri]
Length=71

 Score = 81.3 bits (199),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PG RR VEFGN +TSG ++LVHA++YF L+++F +A+ V
Sbjct  10   AVLLFVLLTPGLLFQIPGHRRLVEFGNMETSGASILVHAVIYFGLITIFLIAIGV  64



>ref|XP_003549178.1| PREDICTED: uncharacterized protein LOC100527861 [Glycine max]
 gb|ACU17054.1| unknown [Glycine max]
 gb|KHN28291.1| hypothetical protein glysoja_040171 [Glycine soja]
Length=69

 Score = 80.9 bits (198),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLL Q+PGR R +EFGNFQTSG+++L+HA+LYFALV +F LA+ +
Sbjct  10   SVVLFILLTPGLLVQIPGRGRFIEFGNFQTSGLSILIHAILYFALVCIFMLAIGI  64



>ref|XP_009629695.1| PREDICTED: uncharacterized protein LOC104119810 [Nicotiana tomentosiformis]
Length=69

 Score = 80.9 bits (198),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFGN  TSG+++LVH +LYF L++VF +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRHRVVEFGNMHTSGLSILVHTILYFGLITVFLIAMGV  64



>ref|XP_006347392.1| PREDICTED: uncharacterized protein LOC102602710 [Solanum tuberosum]
Length=69

 Score = 80.9 bits (198),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPGR + VEFGN QTSGV++LVHA++YF L+++  LA+ V
Sbjct  10   AVVLFVLLTPGLLFQLPGRGKTVEFGNMQTSGVSILVHAVIYFGLITILLLAIGV  64



>ref|XP_010656087.1| PREDICTED: uncharacterized protein LOC100262494 [Vitis vinifera]
Length=71

 Score = 80.5 bits (197),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LFVLLSPGLLFQLPG  RCVEFGN +TSG ++++HALL+FAL+ +F L  K+
Sbjct  11   SVVLFVLLSPGLLFQLPGSNRCVEFGNLRTSGASIMLHALLFFALICLFLLGFKI  65



>ref|XP_009416571.1| PREDICTED: uncharacterized protein LOC103997149 [Musa acuminata 
subsp. malaccensis]
Length=69

 Score = 80.5 bits (197),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PG+LFQLPG  R VEFG+F+T+GVA++VHA+LYFAL+++F +AV V
Sbjct  10   AVLLFVLLTPGVLFQLPGNERAVEFGSFKTNGVAIIVHAVLYFALITIFVVAVGV  64



>ref|XP_002514896.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47450.1| conserved hypothetical protein [Ricinus communis]
Length=69

 Score = 80.5 bits (197),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG+ R VEFGN QTSG+++LVH +++FALV++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGKGRVVEFGNMQTSGLSILVHTIIFFALVTIFLIAIGV  64



>ref|XP_006352171.1| PREDICTED: uncharacterized protein LOC102585729 [Solanum tuberosum]
Length=69

 Score = 80.5 bits (197),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR + VEFGN QTSG+++LVH +LYF ++++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRHKIVEFGNMQTSGLSILVHTVLYFGVITIFLIAIGV  64



>ref|XP_011000976.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105108380 
[Populus euphratica]
Length=142

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PGR+R VEFGNFQTSGV++LVH++LY AL+ +F LAV V
Sbjct  10   AVVLFILLTPGLLIQIPGRQRLVEFGNFQTSGVSILVHSILYLALICIFLLAVGV  64


 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LFVLL PGLLFQLPG  + V+FG+ +T+G A+ VH L++F   ++  LAV V
Sbjct  83   GVVLFVLLQPGLLFQLPGNNKHVDFGSLKTNGKAIAVHTLIFFTAYAILILAVHV  137



>ref|XP_004503745.1| PREDICTED: uncharacterized protein LOC101508777 [Cicer arietinum]
Length=69

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR R +EFGN QTSG ++LVHA++YF L+++  +A+ V
Sbjct  10   AVVLFVLLSPGLLFQIPGRGRVIEFGNMQTSGASILVHAIIYFGLITILLIAIGV  64



>ref|XP_009780342.1| PREDICTED: uncharacterized protein LOC104229393 [Nicotiana sylvestris]
Length=69

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPGR + VEFGN QTSG ++LVH ++YF L+++F LA+ V
Sbjct  10   AVVLFVLLTPGLLFQLPGRGKVVEFGNMQTSGASILVHTIIYFGLITIFLLAIGV  64



>ref|XP_008341292.1| PREDICTED: uncharacterized protein LOC103404182 [Malus domestica]
Length=70

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PG+ R VEFGNFQTSGV++LVH+++YFAL+ +F LA+ V
Sbjct  10   AVVLFILLTPGLLIQMPGKSRFVEFGNFQTSGVSILVHSIIYFALICIFLLAIGV  64



>ref|XP_004516406.1| PREDICTED: uncharacterized protein LOC101504054 [Cicer arietinum]
Length=69

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLL Q+PG+ + VEFGNFQTSG+++L+H++LYFALV +F LA+++
Sbjct  10   SVVLFILLTPGLLVQIPGKAKMVEFGNFQTSGLSILIHSVLYFALVCIFLLAIRI  64



>ref|XP_010112378.1| hypothetical protein L484_010783 [Morus notabilis]
 gb|EXC33373.1| hypothetical protein L484_010783 [Morus notabilis]
Length=70

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PG+ R +E+GNFQTSGV++LVH++LYFAL+ +F LA+ V
Sbjct  10   AVVLFILLTPGLLIQIPGKSRMIEYGNFQTSGVSILVHSVLYFALICIFLLAIGV  64



>ref|XP_009802034.1| PREDICTED: uncharacterized protein LOC104247662 [Nicotiana sylvestris]
Length=69

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFGN  TSG+++LVH +LYF L++V  +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRHRVVEFGNMHTSGLSILVHTILYFGLITVLLIAIGV  64



>ref|XP_009390391.1| PREDICTED: uncharacterized protein LOC103976791 [Musa acuminata 
subsp. malaccensis]
Length=70

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRR-RCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PG+  R VEFGNF TSG+++LVHA++YFAL+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQIPGKSGRVVEFGNFHTSGISILVHAIIYFALITIFLIAIGV  65



>ref|XP_009421065.1| PREDICTED: uncharacterized protein LOC104000686 [Musa acuminata 
subsp. malaccensis]
Length=70

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGL+FQ PG+ R +EFGN QTSG++++VH+++YFALV+VF LAV V
Sbjct  10   AVILFVLLTPGLVFQAPGKSRLIEFGNLQTSGISIVVHSIIYFALVAVFLLAVHV  64



>ref|XP_008347999.1| PREDICTED: uncharacterized protein LOC103411121 [Malus domestica]
Length=139

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLL Q+PG+ R VEFGNFQTSGV++LVH+++YFAL+ +F LA+ V
Sbjct  10   AVLLFVLLTPGLLIQMPGKSRFVEFGNFQTSGVSILVHSIIYFALICIFLLAIGV  64


 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LF+LL PGLLF LPG  + +EFG+ +T+G A+ VH L++FAL ++  LAV V
Sbjct  80   GVVLFILLQPGLLFALPGNSKQMEFGHMKTNGKAIAVHTLIFFALYAILILAVHV  134



>ref|XP_010044830.1| PREDICTED: uncharacterized protein LOC104433689 [Eucalyptus grandis]
 gb|KCW86939.1| hypothetical protein EUGRSUZ_B03510 [Eucalyptus grandis]
Length=69

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR+R +EFGN QTSG+++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRQRFIEFGNMQTSGLSILVHTIIFFGLITIFLIAIGV  64



>gb|EMS52236.1| hypothetical protein TRIUR3_01824 [Triticum urartu]
Length=69

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +++LFVLLSPGLLFQ+PG+ R +EFGN QTSGV+VL HA++YFAL+S+F LAV+V
Sbjct  10   ALVLFVLLSPGLLFQVPGKNRFLEFGNKQTSGVSVLFHAVIYFALISIFTLAVRV  64



>ref|XP_011009186.1| PREDICTED: uncharacterized protein LOC105114364 [Populus euphratica]
Length=70

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLL Q+PG  R +EFGNF+TSGV++LVH++LYFAL+ +F LAV V
Sbjct  10   AVVLFILLSPGLLIQMPGHNRFIEFGNFKTSGVSILVHSILYFALICIFLLAVGV  64



>gb|KEH21021.1| transmembrane protein, putative [Medicago truncatula]
Length=69

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR + +EFGN QTSG ++LVHA++YF L+++  +AV V
Sbjct  10   AVVLFVLLSPGLLFQIPGRGKVIEFGNMQTSGASILVHAIIYFGLITILLIAVGV  64



>gb|AFK47378.1| unknown [Lotus japonicus]
Length=69

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLL Q+PG+ R VEFGNFQTSG ++LVH++LYF LV +F LA+ V
Sbjct  10   SVVLFILLTPGLLIQIPGKSRMVEFGNFQTSGASILVHSILYFVLVCIFLLAIGV  64



>ref|XP_011044119.1| PREDICTED: uncharacterized protein LOC105139404 [Populus euphratica]
Length=69

 Score = 79.3 bits (194),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL PGLLFQ+PGR R VEFGN QTSG +++VHA++YF L+++F +A+ V
Sbjct  10   AVVLFVLLVPGLLFQIPGRNRVVEFGNMQTSGASIVVHAIIYFGLITIFLIAIGV  64



>ref|XP_002455352.1| hypothetical protein SORBIDRAFT_03g009080 [Sorghum bicolor]
 gb|EES00472.1| hypothetical protein SORBIDRAFT_03g009080 [Sorghum bicolor]
Length=70

 Score = 79.3 bits (194),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            S++LF+LLSPGLLFQ+PG+ R +EFGNFQTS +++LVHA+L+FAL ++F +AV V
Sbjct  10   SLVLFILLSPGLLFQMPGKCRIIEFGNFQTSAISILVHAILFFALAAIFLIAVGV  64



>ref|XP_008222187.1| PREDICTED: uncharacterized protein LOC103322089 [Prunus mume]
Length=69

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SPGLLFQLPGR  CVEFG+FQTSG A++VH+LLYFAL+ VF LA+KV
Sbjct  18   SPGLLFQLPGRHGCVEFGSFQTSGAAIMVHSLLYFALICVFLLAIKV  64



>ref|XP_008231104.1| PREDICTED: uncharacterized protein LOC103330325 [Prunus mume]
Length=70

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PG+ R VEFGNFQTSG+++LVH+++YFAL+ +F LA+ V
Sbjct  10   AVVLFILLTPGLLIQMPGKGRFVEFGNFQTSGISILVHSIIYFALICIFLLAIGV  64



>gb|KCW55823.1| hypothetical protein EUGRSUZ_I01640 [Eucalyptus grandis]
Length=70

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +++LFVLL+PGLL Q+PG+ R +EFGNFQTSG +VLVH++LYFALV +F LAV V
Sbjct  10   AMVLFVLLTPGLLIQIPGKHRFIEFGNFQTSGASVLVHSILYFALVCIFLLAVGV  64



>ref|XP_006438001.1| hypothetical protein CICLE_v10033268mg [Citrus clementina]
 ref|XP_006484137.1| PREDICTED: uncharacterized protein LOC102617509 [Citrus sinensis]
 gb|ESR51241.1| hypothetical protein CICLE_v10033268mg [Citrus clementina]
 gb|KDO36879.1| hypothetical protein CISIN_1g035259mg [Citrus sinensis]
Length=69

 Score = 79.0 bits (193),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFGN  TSG+++LVH +++F LV++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRNRVVEFGNMHTSGLSILVHTIIFFGLVTIFLIAIGV  64



>ref|XP_008798931.1| PREDICTED: uncharacterized protein LOC103713699 [Phoenix dactylifera]
Length=70

 Score = 79.0 bits (193),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  215  MLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +LF+LLSPGLLFQ+PG+ R VEFGNFQTSGV++++HA+++F L+++F LA+ V
Sbjct  12   VLFILLSPGLLFQIPGKHRIVEFGNFQTSGVSIVIHAIIFFGLIAIFLLALGV  64



>gb|EYU42082.1| hypothetical protein MIMGU_mgv1a017524mg [Erythranthe guttata]
Length=69

 Score = 79.0 bits (193),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFGN QTSG+++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRGRVVEFGNMQTSGLSILVHTVIFFGLITIFLIAIGV  64



>ref|XP_007224868.1| hypothetical protein PRUPE_ppa022743mg [Prunus persica]
 gb|EMJ26067.1| hypothetical protein PRUPE_ppa022743mg [Prunus persica]
Length=69

 Score = 79.0 bits (193),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SPGLLFQLPGR  CVEFG FQTSG A++VH+LLYFAL+ VF LA+KV
Sbjct  18   SPGLLFQLPGRHGCVEFGGFQTSGAAIMVHSLLYFALICVFLLAIKV  64



>ref|XP_004979312.1| PREDICTED: uncharacterized protein LOC101758057 [Setaria italica]
Length=69

 Score = 79.0 bits (193),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             ++LF+LLSPGLLFQ+PG+ R +EFGNFQTSG+++L+HA++YF L+++  LAV V
Sbjct  10   GLVLFILLSPGLLFQIPGKGRIIEFGNFQTSGLSILIHAIIYFTLIAILLLAVGV  64



>ref|XP_010682738.1| PREDICTED: uncharacterized protein LOC104897543 [Beta vulgaris 
subsp. vulgaris]
Length=74

 Score = 79.0 bits (193),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLLSPGLLFQ+PG +RC+EFGNF+T G ++L+HALLYF  + +F +A+ +
Sbjct  15   ATILFVLLSPGLLFQVPGHQRCIEFGNFRTGGASILIHALLYFGFICIFLIALGI  69



>ref|XP_008346681.1| PREDICTED: uncharacterized protein LOC103409651 [Malus domestica]
Length=69

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PGR R VEFGN QTSG +++VHA++YF L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQIPGRGRLVEFGNMQTSGASIVVHAIIYFGLLTIFLIAIGV  64



>ref|XP_009594856.1| PREDICTED: uncharacterized protein LOC104091270 [Nicotiana tomentosiformis]
Length=69

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPGR + VEFGN QTSG ++LVH ++YF ++++F LA+ V
Sbjct  10   AVVLFVLLTPGLLFQLPGRGKVVEFGNMQTSGASILVHTIIYFGVITIFLLAIGV  64



>gb|KDP22604.1| hypothetical protein JCGZ_26435 [Jatropha curcas]
Length=69

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PG+ R VEFGN QTSG +++VHA++YF L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQIPGKGRVVEFGNMQTSGASIIVHAIIYFGLLTIFLIAIGV  64



>ref|XP_004138041.1| PREDICTED: uncharacterized protein LOC101212373 [Cucumis sativus]
 ref|XP_004167276.1| PREDICTED: uncharacterized LOC101212373 [Cucumis sativus]
 ref|XP_008464420.1| PREDICTED: uncharacterized protein LOC103502312 [Cucumis melo]
 gb|KGN63475.1| hypothetical protein Csa_1G001470 [Cucumis sativus]
Length=69

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+P + R VEFGN QTSG ++LVHA++YF L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQIPAKGRVVEFGNMQTSGASILVHAIIYFGLITIFLIAIGV  64



>ref|XP_004967908.1| PREDICTED: uncharacterized protein LOC101762723 [Setaria italica]
Length=70

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            S++LF+LLSPGLLFQ+PG+ R +EFGNF TS +++LVHA+LYFAL+++F +A+ V
Sbjct  10   SLVLFILLSPGLLFQIPGKCRIIEFGNFHTSALSILVHAILYFALIAIFLIAIGV  64



>ref|XP_006373209.1| hypothetical protein POPTR_0017s09670g [Populus trichocarpa]
 gb|ERP51006.1| hypothetical protein POPTR_0017s09670g [Populus trichocarpa]
Length=70

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PG  R +EFGNF+TSGV++LVH++LYFAL+ +F LAV V
Sbjct  10   AVVLFILLTPGLLIQMPGHHRFIEFGNFKTSGVSILVHSILYFALICIFLLAVGV  64



>gb|ACG32653.1| hypothetical protein [Zea mays]
 tpg|DAA53890.1| TPA: hypothetical protein ZEAMMB73_765265 [Zea mays]
Length=70

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            S++LF+LLSPGLLFQ+PG+ R +EFGNFQTS +++LVHA+L+FAL ++F +AV V
Sbjct  10   SLVLFILLSPGLLFQMPGKCRIIEFGNFQTSAISILVHAILFFALAAIFLVAVGV  64



>ref|XP_011071239.1| PREDICTED: uncharacterized protein LOC105156716 [Sesamum indicum]
Length=69

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LFVLL   LLFQLPG RR VEFGNF TSG AV+VHAL +FAL+ VF +A++V
Sbjct  10   SVLLFVLLRTALLFQLPGHRRWVEFGNFHTSGAAVMVHALFFFALICVFMIAIRV  64



>ref|XP_008361851.1| PREDICTED: uncharacterized protein LOC103425537 [Malus domestica]
Length=69

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG+ R VEFGN QTSG+++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGKGRVVEFGNMQTSGISILVHTIIFFGLLTIFLIAIGV  64



>ref|XP_003553183.1| PREDICTED: uncharacterized protein LOC100527578 [Glycine max]
 gb|KHN24053.1| hypothetical protein glysoja_025226 [Glycine soja]
Length=69

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFGN QTS +++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRSRVVEFGNMQTSAISILVHTIIFFGLITIFLIAIGV  64



>ref|XP_007161717.1| hypothetical protein PHAVU_001G092500g [Phaseolus vulgaris]
 gb|ESW33711.1| hypothetical protein PHAVU_001G092500g [Phaseolus vulgaris]
Length=69

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PGLL Q+PGR   +EFGNFQTSG+++L+HA+LYFALV +F LA+ +
Sbjct  10   SVVLFILLTPGLLVQIPGRGSFIEFGNFQTSGLSILIHAILYFALVCIFMLAIGI  64



>ref|XP_008360750.1| PREDICTED: uncharacterized protein LOC103424445 [Malus domestica]
Length=71

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +VMLFVLL+PGLLFQ+PG  R VEFGN +TSG ++LVH+++YF L+++F +A+ V
Sbjct  10   AVMLFVLLTPGLLFQIPGHGRLVEFGNMETSGASILVHSVIYFGLITIFLIAIGV  64



>ref|XP_010250673.1| PREDICTED: uncharacterized protein LOC104592859 [Nelumbo nucifera]
Length=69

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLP R R +EFGN QTSG ++ VH+L+YF L+++F LAV+V
Sbjct  10   AVLLFVLLSPGLLFQLPARGRFIEFGNLQTSGASIFVHSLIYFVLIAIFLLAVRV  64



>emb|CBI21336.3| unnamed protein product [Vitis vinifera]
Length=69

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SVMLF+LL PGLL Q+PGR R +EF NFQTSGV++LVH+L+YF L+ +F LA+ V
Sbjct  10   SVMLFILLMPGLLIQIPGRGRFIEFTNFQTSGVSILVHSLIYFTLICIFLLAIGV  64



>ref|XP_007163777.1| hypothetical protein PHAVU_001G263200g [Phaseolus vulgaris]
 gb|ESW35771.1| hypothetical protein PHAVU_001G263200g [Phaseolus vulgaris]
Length=69

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG+ R VEFG  QTSGV++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGKNRVVEFGKMQTSGVSILVHTIIFFGLITIFLIAIGV  64



>ref|XP_007216168.1| hypothetical protein PRUPE_ppa015651mg [Prunus persica]
 ref|XP_008231100.1| PREDICTED: uncharacterized protein LOC103330321 [Prunus mume]
 gb|EMJ17367.1| hypothetical protein PRUPE_ppa015651mg [Prunus persica]
Length=69

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPG  R VEF N QTSGV++LVH ++YF LV++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQLPGNSRVVEFNNMQTSGVSILVHTIIYFGLVTIFLIAIGV  64



>ref|XP_004306304.1| PREDICTED: uncharacterized protein LOC101306369 [Fragaria vesca 
subsp. vesca]
Length=72

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLLFQLPG+ R VEF N QTSGV++LVH ++YF L+++F +A+ V
Sbjct  10   AVALFVLLTPGLLFQLPGKSRVVEFNNMQTSGVSILVHTIIYFGLITIFLIAIGV  64



>ref|XP_007217459.1| hypothetical protein PRUPE_ppa026813mg [Prunus persica]
 gb|EMJ18658.1| hypothetical protein PRUPE_ppa026813mg [Prunus persica]
Length=139

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PG+ R VEFGNFQTSG+++LVH+++YFAL+ +F LA+ V
Sbjct  10   AVVLFILLTPGLLIQMPGKSRFVEFGNFQTSGISILVHSIIYFALICIFLLAIGV  64


 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LF+LL PGLLF LPG  R VEFG+ +T+G A+ VH L++FAL ++  LAV V
Sbjct  80   GVVLFILLQPGLLFSLPGNSRQVEFGSMKTNGKAIAVHTLIFFALYAILILAVHV  134



>ref|XP_010026396.1| PREDICTED: uncharacterized protein LOC104416742 [Eucalyptus grandis]
 ref|XP_010040800.1| PREDICTED: uncharacterized protein LOC104429649 [Eucalyptus grandis]
 gb|KCW83143.1| hypothetical protein EUGRSUZ_B00099 [Eucalyptus grandis]
Length=69

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR R VEFGN +TSG ++LVH ++YF L+++  +A+ V
Sbjct  10   AVVLFVLLSPGLLFQIPGRHRVVEFGNMETSGASILVHTIIYFGLITILLIAIGV  64



>ref|XP_004297598.1| PREDICTED: uncharacterized protein LOC101294753 [Fragaria vesca 
subsp. vesca]
Length=69

 Score = 78.2 bits (191),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PG+ R VEFGN QTSG +++VHA++YF L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQIPGKGRVVEFGNMQTSGASIVVHAIIYFGLLTIFLIAIGV  64



>gb|EMT00249.1| hypothetical protein F775_21667 [Aegilops tauschii]
Length=69

 Score = 78.2 bits (191),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +++LFVLLSPGLLFQ+PG+ R +EFGN QTSGV+VL HA++YFAL+++F LAV+V
Sbjct  10   ALVLFVLLSPGLLFQVPGKNRFLEFGNKQTSGVSVLFHAVIYFALIAIFTLAVRV  64



>emb|CDP13357.1| unnamed protein product [Coffea canephora]
Length=69

 Score = 78.2 bits (191),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLL QLPGR R VEFGN QTSG+++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLIQLPGRSRVVEFGNMQTSGLSILVHTIIFFGLITIFLIAIGV  64



>ref|XP_008678124.1| PREDICTED: uncharacterized protein LOC100277266 [Zea mays]
Length=156

 Score = 80.1 bits (196),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  218  VMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            ++LF+LLSPGLLFQ+PG+ R +EFGNFQTSG+++L+HA++YFAL+++F LAV V
Sbjct  98   LVLFILLSPGLLFQIPGKGRIIEFGNFQTSGLSILIHAVIYFALLAIFLLAVGV  151



>ref|XP_010680010.1| PREDICTED: uncharacterized protein LOC104895250 [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 78.2 bits (191),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +++LF+LL+PGLLFQLPG+ R VEFGN QTSG+++LVH ++YF L+++F +AV V
Sbjct  10   ALVLFILLTPGLLFQLPGKNRVVEFGNLQTSGMSILVHTVIYFCLITIFLIAVGV  64



>ref|XP_010090640.1| hypothetical protein L484_017442 [Morus notabilis]
 gb|EXB40304.1| hypothetical protein L484_017442 [Morus notabilis]
Length=69

 Score = 78.2 bits (191),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +PGLLFQLPGR  CVEFGNFQTSG ++++H+LLYF L+ +F LA+KV
Sbjct  18   TPGLLFQLPGRHGCVEFGNFQTSGASIMIHSLLYFGLICIFLLAIKV  64



>ref|XP_010037403.1| PREDICTED: uncharacterized protein LOC104426149 [Eucalyptus grandis]
Length=69

 Score = 78.2 bits (191),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR R VEFGN QTSG +V+VHA+++F LV++F + + V
Sbjct  10   AVVLFVLLSPGLLFQIPGRHRVVEFGNMQTSGASVIVHAVIFFGLVAIFLVVIGV  64



>ref|XP_007043959.1| Uncharacterized protein TCM_008722 [Theobroma cacao]
 gb|EOX99790.1| Uncharacterized protein TCM_008722 [Theobroma cacao]
Length=135

 Score = 79.7 bits (195),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR + VEFGN QTSG+++LVH +++F L+++F +A+ V
Sbjct  76   AVVLFVLLSPGLLFQLPGRSKVVEFGNMQTSGISILVHTIIFFGLITIFLIAIGV  130



>ref|XP_008341296.1| PREDICTED: uncharacterized protein LOC103404186 [Malus domestica]
 ref|XP_009344923.1| PREDICTED: uncharacterized protein LOC103936783 [Pyrus x bretschneideri]
Length=69

 Score = 78.2 bits (191),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPG  R VEF N QTSGV++LVH ++YF L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQLPGNSRVVEFNNMQTSGVSILVHTIIYFGLITIFLIAIGV  64



>ref|XP_007031906.1| Uncharacterized protein TCM_017235 [Theobroma cacao]
 gb|EOY02832.1| Uncharacterized protein TCM_017235 [Theobroma cacao]
Length=70

 Score = 78.2 bits (191),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PG+ R +EFGNFQTSG+++LVH+++YFAL+ +F LAV V
Sbjct  10   AVVLFILLTPGLLIQVPGKSRFIEFGNFQTSGLSILVHSIIYFALICIFLLAVGV  64



>ref|XP_008379108.1| PREDICTED: uncharacterized protein LOC103442131 [Malus domestica]
Length=70

 Score = 77.8 bits (190),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLL Q+PG+ R V FGNFQTSGV++LVH+++YFAL+ +F LA+ V
Sbjct  10   AVLLFVLLTPGLLIQMPGKSRFVXFGNFQTSGVSILVHSIIYFALICIFLLAIGV  64



>ref|XP_007160023.1| hypothetical protein PHAVU_002G286200g [Phaseolus vulgaris]
 gb|AAQ09000.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW32017.1| hypothetical protein PHAVU_002G286200g [Phaseolus vulgaris]
Length=69

 Score = 77.8 bits (190),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+P R R  EFGN QTSG ++LVHA++YF L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQIPSRGRIAEFGNMQTSGASILVHAVIYFGLITIFLIAIGV  64



>ref|XP_006493216.1| PREDICTED: uncharacterized protein LOC102619374 [Citrus sinensis]
 gb|KDO64399.1| hypothetical protein CISIN_1g040390mg [Citrus sinensis]
Length=69

 Score = 77.8 bits (190),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLLFQ+PGR R VEFGN QTSG ++LVH++++F L+++F +A+ V
Sbjct  10   ATVLFVLLTPGLLFQIPGRNRVVEFGNMQTSGASILVHSVIFFGLITIFLIAITV  64



>ref|XP_009344919.1| PREDICTED: uncharacterized protein LOC103936777 [Pyrus x bretschneideri]
Length=143

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PG+ R VEFGNFQTSGV++LVH+++YFAL+ +F LA+ +
Sbjct  10   AVVLFILLTPGLLIQMPGKSRFVEFGNFQTSGVSILVHSIIYFALICIFLLAIDL  64


 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LF+LL PGLLF  PG  + +EFG  +T+G A+ VH L +F L ++  L V V
Sbjct  84   GVVLFILLQPGLLFSFPGNSKQLEFGRMKTNGKAIAVHTLFFFVLYAILILVVHV  138



>ref|XP_009597111.1| PREDICTED: uncharacterized protein LOC104093102 [Nicotiana tomentosiformis]
Length=69

 Score = 77.8 bits (190),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +VMLFVLL+PGLLFQLPG  R +EF NFQTS +++ +H LLYFAL+++F +A+ V
Sbjct  10   AVMLFVLLTPGLLFQLPGSSRSIEFVNFQTSAISIFIHTLLYFALITMFLIAIGV  64



>ref|XP_010503500.1| PREDICTED: uncharacterized protein LOC104780677 [Camelina sativa]
Length=69

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            +V+LFVLL+PGLLFQ+PGR R VEFGN QTSG ++LVH +++F L+++F +A++
Sbjct  10   AVILFVLLTPGLLFQIPGRGRVVEFGNMQTSGASILVHTIIFFGLITIFTIAIR  63



>ref|XP_010026362.1| PREDICTED: uncharacterized protein LOC104416706 [Eucalyptus grandis]
Length=96

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR R VEFGN +TSG ++ VH ++YF L+++F +A+ V
Sbjct  37   AVLLFVLLSPGLLFQIPGRHRFVEFGNMETSGASIFVHTIIYFGLITIFLIAIGV  91



>gb|KCW44914.1| hypothetical protein EUGRSUZ_L01505 [Eucalyptus grandis]
Length=121

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+PGR R VEFGN +TSG ++LVH ++YF L+++  +A+ V
Sbjct  62   AVVLFVLLSPGLLFQIPGRHRVVEFGNMETSGASILVHTIIYFGLITILLIAIGV  116



>ref|XP_010028990.1| PREDICTED: uncharacterized protein LOC104419133 [Eucalyptus grandis]
Length=142

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +++LFVLL+PGLL Q+PG+ R +EFGNFQTSG +VLVH++LYFALV +F LAV V
Sbjct  10   AMVLFVLLTPGLLIQIPGKHRFIEFGNFQTSGASVLVHSILYFALVCIFLLAVGV  64


 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LFVLL PGLLF +PG  + +EFG  +T+G A+  H L++FA  S+  LA+ +
Sbjct  83   GVVLFVLLQPGLLFAIPGEGKQLEFGKMKTNGKAIAFHTLIFFACYSILLLALHI  137



>ref|XP_002511164.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51766.1| conserved hypothetical protein [Ricinus communis]
Length=69

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PGR R VEFGN  TSG +++VHA++YF L+++  +A+ +
Sbjct  10   AVILFVLLTPGLLFQIPGRNRVVEFGNMHTSGASIVVHAIIYFGLITILLIAIGI  64



>ref|XP_006447045.1| hypothetical protein CICLE_v10017396mg [Citrus clementina]
 gb|ESR60285.1| hypothetical protein CICLE_v10017396mg [Citrus clementina]
 gb|KDO63906.1| hypothetical protein CISIN_1g035243mg [Citrus sinensis]
Length=69

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LF+LLSPGLL Q+PGR R  EFGNFQTSG ++LVH++LYFAL+ +F LA+ V
Sbjct  10   GVVLFILLSPGLLIQVPGRNRFFEFGNFQTSGASILVHSILYFALMCIFLLAIGV  64



>ref|XP_010695381.1| PREDICTED: uncharacterized protein LOC104908027 [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 77.4 bits (189),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PGR R +EFG+ QTSG ++LVH ++YF L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQIPGRGRIIEFGSMQTSGASILVHTIIYFGLITIFLIAIGV  64



>ref|XP_009612663.1| PREDICTED: uncharacterized protein LOC104105934 [Nicotiana tomentosiformis]
 ref|XP_009793453.1| PREDICTED: uncharacterized protein LOC104240321 [Nicotiana sylvestris]
Length=69

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR + VEFG  QTSG A+LVH ++YF L+++  +AV V
Sbjct  10   AVVLFVLLSPGLLFQLPGRGKVVEFGGMQTSGAAILVHTVIYFGLITILLIAVGV  64



>ref|XP_004231769.1| PREDICTED: uncharacterized protein LOC101265494 [Solanum lycopersicum]
Length=69

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG  R VEF NFQTSG+++ +H +L+F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGNNRAVEFANFQTSGLSIFIHTILFFGLITIFLIAIGV  64



>ref|XP_009129453.1| PREDICTED: uncharacterized protein LOC103854271 [Brassica rapa]
 emb|CDY34184.1| BnaA02g28560D [Brassica napus]
 emb|CDY28498.1| BnaC02g36620D [Brassica napus]
Length=69

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLL Q+PGR R VEFG FQTSGV+V+VH L+YF LV +  +A++V
Sbjct  10   AVTLFVLLTPGLLIQIPGRNRVVEFGTFQTSGVSVIVHTLVYFTLVCILLIAIQV  64



>ref|XP_008360131.1| PREDICTED: uncharacterized protein LOC103423825 [Malus domestica]
 ref|XP_009343144.1| PREDICTED: uncharacterized protein LOC103935115 [Pyrus x bretschneideri]
Length=69

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR + VEFGN  TSG+++LVH +++F L+++F +AV V
Sbjct  10   AVVLFVLLSPGLLFQLPGRGKVVEFGNMHTSGISILVHTIIFFGLLTIFLIAVGV  64



>ref|XP_006404231.1| hypothetical protein EUTSA_v10010885mg [Eutrema salsugineum]
 gb|ESQ45684.1| hypothetical protein EUTSA_v10010885mg [Eutrema salsugineum]
Length=69

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            +V+LFVLL+PGLLFQ+P R R VEFGN QTSG ++LVH ++YF L+++F +A++
Sbjct  10   AVILFVLLTPGLLFQIPARGRIVEFGNMQTSGASILVHTIIYFGLITIFTIAIR  63



>ref|XP_010660745.1| PREDICTED: uncharacterized protein LOC100246292 [Vitis vinifera]
 emb|CBI21333.3| unnamed protein product [Vitis vinifera]
Length=69

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPG  R VEFGN QTS +++LVH ++YF L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQLPGNNRVVEFGNMQTSRISILVHTIIYFGLITIFLIAIGV  64



>gb|EMS52235.1| hypothetical protein TRIUR3_01823 [Triticum urartu]
Length=69

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  212  LFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            LF+LLSPGLLFQ+PG+ R V+FG+FQTSG ++L+HA++YFAL+++  LAV+V
Sbjct  13   LFILLSPGLLFQIPGKGRIVDFGSFQTSGASMLIHAVIYFALITILLLAVRV  64



>ref|XP_002297849.2| hypothetical protein POPTR_0001s13680g, partial [Populus trichocarpa]
 gb|EEE82654.2| hypothetical protein POPTR_0001s13680g, partial [Populus trichocarpa]
Length=101

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPG LFQ PGRRR VEFGN QTSG+A+LVH +++F L+++F + + V
Sbjct  42   AVVLFVLLSPGSLFQFPGRRRVVEFGNMQTSGIAILVHTIIFFGLITIFLVVIGV  96



>ref|XP_002304675.2| hypothetical protein POPTR_0003s16890g, partial [Populus trichocarpa]
 gb|EEE79654.2| hypothetical protein POPTR_0003s16890g, partial [Populus trichocarpa]
Length=105

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFGN QTS +++LVH +++F L+++F +A+ V
Sbjct  46   AVVLFVLLSPGLLFQLPGRNRVVEFGNMQTSALSILVHTIIFFGLITIFLIAIGV  100



>ref|XP_002300115.2| hypothetical protein POPTR_0001s33620g [Populus trichocarpa]
 gb|EEE84920.2| hypothetical protein POPTR_0001s33620g [Populus trichocarpa]
Length=70

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R VEFGN  TSG+A+LVHA++YF ++++  +AV V
Sbjct  11   AVVLFILLSPGLLFQLPARTRVVEFGNMYTSGIAILVHAVIYFCIITILIIAVGV  65



>ref|XP_002270842.1| PREDICTED: uncharacterized protein LOC100261671 isoform X2 [Vitis 
vinifera]
Length=140

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SVMLF+LL PGLL Q+PGR R +EF NFQTSGV++LVH+L+YF L+ +F LA+ V
Sbjct  10   SVMLFILLMPGLLIQIPGRGRFIEFTNFQTSGVSILVHSLIYFTLICIFLLAIGV  64


 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SPGLLFQLPG  R V+FG  +T+G ++ VH L++ A+ +V  +A+ +
Sbjct  89   SPGLLFQLPGHYRHVDFGGMKTNGKSIAVHTLIFVAIFAVLIMALHL  135



>ref|XP_004306303.1| PREDICTED: uncharacterized protein LOC101306079 [Fragaria vesca 
subsp. vesca]
Length=161

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LL+PGLL Q+PG+ R VEFGNFQTSGV++LVH+++YF L+ +F LA+ V
Sbjct  10   AVVLFILLTPGLLIQIPGKSRFVEFGNFQTSGVSILVHSIIYFTLICIFLLAIGV  64


 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LF+LL PGLLF LPG  + VEFG+ +T+G A+ VH L++FAL ++  LAV V
Sbjct  102  GVVLFILLQPGLLFSLPGNGKQVEFGSMKTNGKAIAVHTLIFFALYAILILAVHV  156



>gb|EMT10577.1| hypothetical protein F775_16458 [Aegilops tauschii]
Length=69

 Score = 76.6 bits (187),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  212  LFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            LF+LLSPGLLFQ+PG+ R ++FG FQTSG+++L+HA++YFAL+++  LAV+V
Sbjct  13   LFILLSPGLLFQIPGKGRIMDFGGFQTSGISMLIHAVIYFALITILLLAVRV  64



>ref|XP_009372260.1| PREDICTED: uncharacterized protein LOC103961442 [Pyrus x bretschneideri]
Length=69

 Score = 76.6 bits (187),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG+ R VEFGN  TSG+++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGKGRVVEFGNMHTSGISILVHTIIFFGLLTIFLIAIGV  64



>ref|XP_007038005.1| Uncharacterized protein TCM_014660 [Theobroma cacao]
 gb|EOY22506.1| Uncharacterized protein TCM_014660 [Theobroma cacao]
Length=173

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLLSPGLLFQ+PGR + VEFGN QTSG ++LVHA++YF L+++F +A+ V
Sbjct  113  ATVLFVLLSPGLLFQIPGRNKVVEFGNMQTSGASILVHAIIYFGLITIFCIAIGV  167



>ref|XP_003525413.1| PREDICTED: uncharacterized protein LOC100805083 [Glycine max]
 gb|KHN23673.1| hypothetical protein glysoja_039124 [Glycine soja]
Length=103

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQ+P R R  EFGN QTSG ++LVHA++YF L+++F +A+ V
Sbjct  44   AVVLFVLLSPGLLFQMPARGRVAEFGNMQTSGASILVHAIIYFGLITIFLIAIGV  98



>ref|XP_002270989.1| PREDICTED: uncharacterized protein LOC100251434 [Vitis vinifera]
Length=70

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LLSPGLLFQLP R R VEFGN  TSG+A+LVHA++YF ++++  +AV +
Sbjct  11   SVVLFILLSPGLLFQLPARTRVVEFGNMCTSGIAILVHAIIYFCILTILLIAVGI  65



>ref|XP_010044829.1| PREDICTED: uncharacterized protein LOC104433688 [Eucalyptus grandis]
 gb|KCW86938.1| hypothetical protein EUGRSUZ_B03509 [Eucalyptus grandis]
Length=69

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +PGLLFQ+PG+ RCVEFGNF+TSG ++++H+LLYF+L+ VF LAVKV
Sbjct  18   TPGLLFQVPGQHRCVEFGNFRTSGASIMIHSLLYFSLICVFLLAVKV  64



>ref|XP_009375198.1| PREDICTED: uncharacterized protein LOC103964039 [Pyrus x bretschneideri]
 ref|XP_009344273.1| PREDICTED: uncharacterized protein LOC103936158 [Pyrus x bretschneideri]
Length=69

 Score = 76.3 bits (186),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PGR R VEFGN QTS  +++VHA++YF L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQIPGRGRLVEFGNMQTSAASIVVHAIIYFGLLTIFLIAIGV  64



>gb|KCW61925.1| hypothetical protein EUGRSUZ_H04621 [Eucalyptus grandis]
Length=69

 Score = 76.3 bits (186),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLPG+ + VEFGN QT+G ++LVH +++F L+++F +AV V
Sbjct  10   AVVLFILLSPGLLFQLPGKMKAVEFGNMQTTGASILVHTIIFFCLITIFLIAVGV  64



>ref|XP_003631356.1| PREDICTED: uncharacterized protein LOC100852958 [Vitis vinifera]
Length=71

 Score = 76.3 bits (186),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLL Q+PGR R VEFGN  TSG+++LVHA++YFALV++F +AV V
Sbjct  10   ATVLFVLLTPGLLCQIPGRGRVVEFGNMSTSGLSILVHAVIYFALVTIFVIAVSV  64



>ref|XP_006591443.1| PREDICTED: uncharacterized protein LOC100787382 [Glycine max]
 gb|KHN44452.1| hypothetical protein glysoja_014493 [Glycine soja]
Length=69

 Score = 76.3 bits (186),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGL+FQLPG+ R VEFGN QTS V++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLVFQLPGKSRVVEFGNMQTSAVSILVHTIIFFGLITIFLVAIGV  64



>ref|XP_006470082.1| PREDICTED: uncharacterized protein LOC102613711 [Citrus sinensis]
Length=140

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LF+LLSPGLL Q+PGR R  EFGNFQTSG ++LVH++LYFAL+ +F LA+ V
Sbjct  10   GVVLFILLSPGLLIQVPGRNRFFEFGNFQTSGASILVHSILYFALMCIFLLAIGV  64


 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LFVLL PGLLFQLPG  R +EFG+ +T+G A+ VH L++F L ++  LAV V
Sbjct  81   GVVLFVLLQPGLLFQLPGHSRLLEFGSMKTNGKAISVHTLIFFVLYAILILAVHV  135



>ref|XP_009771783.1| PREDICTED: uncharacterized protein LOC104222267 [Nicotiana sylvestris]
Length=69

 Score = 76.3 bits (186),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPG  R +EF NFQTS +++ +H +LYFALVS+F +AV V
Sbjct  10   AVVLFVLLTPGLLFQLPGNSRSIEFANFQTSVISIFIHTVLYFALVSMFLIAVGV  64



>ref|XP_010682737.1| PREDICTED: uncharacterized protein LOC104897542 [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 75.9 bits (185),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +++LF+LLSPGLL Q+PGR R VEF N QTSGV++LVHA++YF L+++F +A+ V
Sbjct  10   ALVLFILLSPGLLCQIPGRGRVVEFANMQTSGVSILVHAIIYFGLITIFLIAIGV  64



>ref|XP_006436859.1| hypothetical protein CICLE_v10033156mg [Citrus clementina]
 gb|ESR50099.1| hypothetical protein CICLE_v10033156mg [Citrus clementina]
Length=101

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLLFQ+PGR R VEFGN QTSG ++LVH++++F L+++F +A+ V
Sbjct  10   ATVLFVLLTPGLLFQIPGRNRVVEFGNMQTSGASILVHSVIFFGLITIFLIAITV  64



>ref|XP_006351515.1| PREDICTED: uncharacterized protein LOC102599395 [Solanum tuberosum]
Length=69

 Score = 75.9 bits (185),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLP R + VEFG  QTSG A+LVHA++YF L+++  +AV V
Sbjct  10   AVVLFVLLSPGLLFQLPSRGKVVEFGGMQTSGAAILVHAVIYFGLITILLIAVGV  64



>ref|XP_009606515.1| PREDICTED: uncharacterized protein LOC104100868 [Nicotiana tomentosiformis]
 ref|XP_009788056.1| PREDICTED: uncharacterized protein LOC104235922 [Nicotiana sylvestris]
Length=69

 Score = 75.9 bits (185),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG  R VEF NFQTSG+++ +H LL+F  +++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGNSRAVEFANFQTSGLSIFIHTLLFFGFITIFLIAIGV  64



>gb|AFK45116.1| unknown [Lotus japonicus]
Length=70

 Score = 75.9 bits (185),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LFVLLSPGLLFQLPGR + V FG+ QTSG+++LVH +++F L+++F LAV V
Sbjct  11   SVVLFVLLSPGLLFQLPGRGKVVAFGSMQTSGLSILVHTIIFFGLITIFLLAVGV  65



>ref|XP_008222189.1| PREDICTED: uncharacterized protein LOC103322090 [Prunus mume]
Length=69

 Score = 75.5 bits (184),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFG   TSG+++LVH +++F L+++F +AV V
Sbjct  10   AVVLFVLLSPGLLFQLPGRGRVVEFGGMHTSGISILVHTIIFFGLLTIFLIAVGV  64



>ref|XP_004515980.1| PREDICTED: uncharacterized protein LOC101493085 [Cicer arietinum]
Length=70

 Score = 75.5 bits (184),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQ P R RCVEFGN  TSG+++LVHA++YF L+++  +AV +
Sbjct  11   AVALFILLSPGLLFQFPSRFRCVEFGNMSTSGISILVHAIIYFCLLTILIIAVGI  65



>ref|XP_008379099.1| PREDICTED: uncharacterized protein LOC103442121 [Malus domestica]
Length=69

 Score = 75.5 bits (184),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQLPG  R  EF N QTSGV++LVH ++YF L ++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQLPGNSRVAEFNNMQTSGVSILVHTIIYFGLXTIFLIAIGV  64



>ref|XP_007225875.1| hypothetical protein PRUPE_ppa014446mg [Prunus persica]
 gb|EMJ27074.1| hypothetical protein PRUPE_ppa014446mg [Prunus persica]
Length=69

 Score = 75.5 bits (184),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR R VEFG+  TSG+++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGRGRVVEFGSMHTSGISILVHTIIFFGLLTIFLIAIGV  64



>ref|XP_009149804.1| PREDICTED: uncharacterized protein LOC103873125 [Brassica rapa]
 emb|CDY44657.1| BnaA08g06830D [Brassica napus]
 emb|CDY08087.1| BnaA06g16390D [Brassica napus]
 emb|CDY05860.1| BnaC08g20370D [Brassica napus]
Length=69

 Score = 75.5 bits (184),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            +V+LFVLL+PGLLFQ+P R R VEFGN QTSG ++LVH++++F L+++F +A++
Sbjct  10   AVILFVLLTPGLLFQIPARGRIVEFGNMQTSGASILVHSIIFFGLITIFTIAIR  63



>ref|XP_006395490.1| hypothetical protein EUTSA_v10005242mg [Eutrema salsugineum]
 gb|ESQ32776.1| hypothetical protein EUTSA_v10005242mg [Eutrema salsugineum]
Length=69

 Score = 75.5 bits (184),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQLP R R VEFGN  TSG+A+LVHA++YF ++++  +A+++
Sbjct  11   AVSLFILLSPGLLFQLPARTRVVEFGNMTTSGIAILVHAVIYFCILTILVIAIQI  65



>ref|XP_006338707.1| PREDICTED: uncharacterized protein LOC102580109 [Solanum tuberosum]
Length=69

 Score = 75.5 bits (184),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG  R V+F NFQTSG+++ +H +L+F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGNNRVVQFANFQTSGLSIFIHTILFFGLITIFLIAIGV  64



>emb|CBI21334.3| unnamed protein product [Vitis vinifera]
Length=80

 Score = 75.5 bits (184),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LLSPGLLFQLP R R VEFGN  TSG+A+LVHA++YF ++++  +AV +
Sbjct  21   SVVLFILLSPGLLFQLPARTRVVEFGNMCTSGIAILVHAIIYFCILTILLIAVGI  75



>ref|XP_004234309.1| PREDICTED: uncharacterized protein LOC101248948 [Solanum lycopersicum]
Length=69

 Score = 75.5 bits (184),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLP R + VEFG  QTSG A+LVHA++YF L+++  +AV V
Sbjct  10   AVVLFVLLSPGLLFQLPSRGKVVEFGGMQTSGAAILVHAVIYFGLITILLVAVGV  64



>ref|XP_011097271.1| PREDICTED: uncharacterized protein LOC105176237 [Sesamum indicum]
Length=70

 Score = 75.5 bits (184),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +PGLL Q+PGR R VEFGNFQTSGV++LVHA+LYFAL+ +F LA+ V
Sbjct  18   TPGLLIQIPGRNRIVEFGNFQTSGVSILVHAILYFALICIFLLAIGV  64



>ref|XP_009151995.1| PREDICTED: uncharacterized protein LOC103875253 [Brassica rapa]
Length=69

 Score = 75.1 bits (183),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQ+P R R VEFGN  TSG+A+LVHA++YF ++++  +A++V
Sbjct  11   AVSLFILLSPGLLFQIPARTRVVEFGNMSTSGIAILVHAVIYFCILTILVIAIQV  65



>ref|XP_006292149.1| hypothetical protein CARUB_v10018353mg [Capsella rubella]
 ref|XP_010515183.1| PREDICTED: uncharacterized protein LOC104791080 [Camelina sativa]
 ref|XP_010426359.1| PREDICTED: uncharacterized protein LOC104711357 [Camelina sativa]
 gb|EOA25047.1| hypothetical protein CARUB_v10018353mg [Capsella rubella]
Length=69

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            +V+LFVLL+PGLLFQ+P R R VEFGN QTSG ++LVH +++F L+++F +A++
Sbjct  10   AVILFVLLTPGLLFQIPARGRVVEFGNMQTSGASILVHTIIFFGLITIFTIAIR  63



>ref|XP_004960935.1| PREDICTED: uncharacterized protein LOC101767288 [Setaria italica]
Length=70

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPGR   V+FGN QTS V++LVH+++YFAL+++F + + V
Sbjct  10   AVVLFVLLSPGLLFQLPGRCHFVDFGNLQTSAVSILVHSIIYFALIAIFVIVIGV  64



>emb|CDX83043.1| BnaA01g20430D [Brassica napus]
Length=69

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            +V+LFVLL+PGLLFQ+P R R VEFGN  TSG ++LVH ++YF L+++F +A++
Sbjct  10   AVILFVLLTPGLLFQIPARGRVVEFGNMHTSGASILVHTIIYFGLITIFTIAIR  63



>ref|XP_006591444.1| PREDICTED: uncharacterized protein LOC102660664 [Glycine max]
 gb|KHN44451.1| hypothetical protein glysoja_014492 [Glycine soja]
Length=69

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  194  PGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            PGLLFQ+PGR RC+EFGNFQTSG ++LVH+LLYF L+ +F  A+KV
Sbjct  19   PGLLFQVPGRSRCLEFGNFQTSGASILVHSLLYFGLICLFLFAIKV  64



>ref|XP_010550223.1| PREDICTED: uncharacterized protein LOC104821134 [Tarenaya hassleriana]
Length=70

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            SV+LF++L+PG+LFQLPG+ R VEFG FQTSG A+ +H L++FAL+++F +A+ 
Sbjct  11   SVVLFIVLTPGVLFQLPGKTRVVEFGGFQTSGAAIFIHTLIFFALITIFLIALH  64



>ref|XP_004304527.1| PREDICTED: uncharacterized protein LOC101292234 [Fragaria vesca 
subsp. vesca]
Length=70

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R +EFGN  TSG+A+LVHA++YF ++++  +A+ +
Sbjct  11   AVVLFILLSPGLLFQLPARTRVMEFGNMMTSGIAILVHAIIYFCILTILIIAIGI  65



>ref|XP_010425441.1| PREDICTED: uncharacterized protein LOC104710521 [Camelina sativa]
Length=69

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLL Q+PGR R VEFG FQTSGV+V+VH L+YF +V +  LA+++
Sbjct  10   AVTLFVLLTPGLLIQIPGRGRVVEFGTFQTSGVSVIVHTLIYFTIVCILLLALQI  64



>ref|XP_010528162.1| PREDICTED: uncharacterized protein LOC104805325 [Tarenaya hassleriana]
Length=142

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LL+PGLL Q+PGR + VEFG FQTSGV+VLVH+L+YF L+ +  LAV V
Sbjct  10   AVALFILLTPGLLVQIPGRNKAVEFGTFQTSGVSVLVHSLIYFTLICILLLAVHV  64


 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
             V+LFV+LSPGLLF LPG  R +EFGN +T+G A+ VH L++FA+ S+  +AV 
Sbjct  83   GVILFVILSPGLLFSLPGNHRTLEFGNLKTNGKAIAVHTLIFFAIYSILIIAVN  136



>ref|XP_002875914.1| hypothetical protein ARALYDRAFT_323459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52173.1| hypothetical protein ARALYDRAFT_323459 [Arabidopsis lyrata subsp. 
lyrata]
Length=84

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            +V+LFVLL+PGLLFQ+P R R VEFGN QTSG ++LVH +++F L+++F +A++
Sbjct  10   AVILFVLLTPGLLFQIPARGRVVEFGNMQTSGASILVHTIIFFGLITIFTIAIR  63



>gb|KFK33626.1| hypothetical protein AALP_AA5G038000 [Arabis alpina]
Length=69

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLL Q+PGR R +EFG FQTSGV+V++H L+YF LV +  LA+++
Sbjct  10   AVSLFVLLTPGLLIQVPGRNRVIEFGTFQTSGVSVIIHTLIYFTLVCILLLALQI  64



>ref|NP_001118713.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_002875354.1| hypothetical protein ARALYDRAFT_904911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51613.1| hypothetical protein ARALYDRAFT_904911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE77257.1| uncharacterized protein AT3G27027 [Arabidopsis thaliana]
Length=69

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQLP R R VEFGN  TSG+A+LVHA +YF ++++  +A+++
Sbjct  11   AVSLFILLSPGLLFQLPARTRVVEFGNMTTSGIAILVHAFIYFCILTILVIAIQI  65



>ref|XP_010663762.1| PREDICTED: uncharacterized protein LOC100247554 [Vitis vinifera]
Length=69

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PG+ R VEFG+  TSG ++LVH ++YF L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQVPGKNRVVEFGSMHTSGASILVHTIIYFGLITIFLIAIGV  64



>ref|NP_190435.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB62355.1| putative protein [Arabidopsis thaliana]
 gb|AEE78441.1| uncharacterized protein AT3G48660 [Arabidopsis thaliana]
Length=89

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            +V+LFVLL+PGLLFQ+P R R VEFGN QTSG ++LVH +++F L+++F +A++
Sbjct  10   AVILFVLLTPGLLFQIPARGRVVEFGNMQTSGASILVHTIIFFGLITIFTIAIR  63



>ref|XP_009150183.1| PREDICTED: uncharacterized protein LOC103873522 [Brassica rapa]
 emb|CDY37918.1| BnaA06g18990D [Brassica napus]
 emb|CDX77917.1| BnaC03g53020D [Brassica napus]
Length=69

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            +V+LFVLL+PGLLFQ+P R R VEFGN  TSG ++LVH +++FAL+++F +A++
Sbjct  10   AVILFVLLTPGLLFQIPARGRIVEFGNMHTSGASILVHTIIFFALITIFTIAIR  63



>ref|XP_009344922.1| PREDICTED: uncharacterized protein LOC103936782 [Pyrus x bretschneideri]
Length=70

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V++F+LLSPGLLFQLP R R +EFGN  TSG+A+LVHA++YF ++++  +A+ +
Sbjct  11   AVVMFILLSPGLLFQLPARTRVMEFGNMSTSGIAILVHAVIYFCIITILVIAIGI  65



>ref|XP_007043960.1| Uncharacterized protein TCM_008724 [Theobroma cacao]
 gb|EOX99791.1| Uncharacterized protein TCM_008724 [Theobroma cacao]
Length=69

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +PGLLFQ+PG  RCV+FGNF+TSG ++LVH+LLYF L+ VF LA+KV
Sbjct  18   TPGLLFQVPGHLRCVDFGNFKTSGASILVHSLLYFGLICVFLLAIKV  64



>ref|XP_008341295.1| PREDICTED: uncharacterized protein LOC103404185 [Malus domestica]
Length=70

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V++F+LLSPGLLFQLP R R +EFGN  TSG+A+LVHA++YF ++++  +A+ +
Sbjct  11   AVVMFILLSPGLLFQLPARTRVMEFGNMSTSGIAILVHAVIYFCIITILVIAIGI  65



>ref|XP_006447041.1| hypothetical protein CICLE_v10017392mg [Citrus clementina]
 ref|XP_006470084.1| PREDICTED: uncharacterized protein LOC102614315 [Citrus sinensis]
 gb|ESR60281.1| hypothetical protein CICLE_v10017392mg [Citrus clementina]
 gb|KDO63901.1| hypothetical protein CISIN_1g035192mg [Citrus sinensis]
Length=70

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQLP R R VEFGN  TSG+A+LVHA++YF +V++  +A+ +
Sbjct  11   AVGLFILLSPGLLFQLPARTRVVEFGNMCTSGIAILVHAIIYFCIVTILIVAIGI  65



>ref|XP_007163776.1| hypothetical protein PHAVU_001G263100g [Phaseolus vulgaris]
 gb|ESW35770.1| hypothetical protein PHAVU_001G263100g [Phaseolus vulgaris]
Length=69

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  194  PGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            PGLLFQLPGR RCVEFGNFQTS  ++LVH+LLYF L+ +F  AVKV
Sbjct  19   PGLLFQLPGRSRCVEFGNFQTSASSILVHSLLYFGLMCLFLFAVKV  64



>ref|XP_006292147.1| hypothetical protein CARUB_v10018351mg [Capsella rubella]
 gb|EOA25045.1| hypothetical protein CARUB_v10018351mg [Capsella rubella]
Length=69

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQLP R R VEFGN  TSG+A+L+HA +YF ++++  +A+++
Sbjct  11   AVSLFILLSPGLLFQLPARTRVVEFGNMTTSGIAILIHAFIYFCILTILVIAIQI  65



>ref|XP_006580126.1| PREDICTED: uncharacterized protein LOC102662841 [Glycine max]
Length=70

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LFVLLSPGLLFQLP + + V FGN QTSG+++LVH +++F L+++F LA+ V
Sbjct  11   SVVLFVLLSPGLLFQLPAKGKVVAFGNMQTSGLSILVHTIIFFGLITIFLLAIGV  65



>ref|XP_006594529.1| PREDICTED: uncharacterized protein LOC102664775 [Glycine max]
Length=69

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG+ + VEFGN QT  V++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGKSKVVEFGNMQTRAVSILVHTIIFFGLITIFLVAIGV  64



>ref|XP_006582287.1| PREDICTED: uncharacterized protein LOC102670423 [Glycine max]
Length=69

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLLSPGLLFQLPG+ + VEFGN QT  V++LVH +++F L+++F +A+ V
Sbjct  10   AVVLFVLLSPGLLFQLPGKSKVVEFGNMQTRAVSILVHTIIFFGLITIFLVAIGV  64



>ref|NP_201155.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_002864849.1| hypothetical protein ARALYDRAFT_919638 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006279720.1| hypothetical protein CARUB_v10027490mg [Capsella rubella]
 ref|XP_006394270.1| hypothetical protein EUTSA_v10005243mg [Eutrema salsugineum]
 dbj|BAB08815.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42648.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|AAO42898.1| At5g63500 [Arabidopsis thaliana]
 gb|EFH41108.1| hypothetical protein ARALYDRAFT_919638 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED97759.1| uncharacterized protein AT5G63500 [Arabidopsis thaliana]
 gb|EOA12618.1| hypothetical protein CARUB_v10027490mg [Capsella rubella]
 gb|ESQ31556.1| hypothetical protein EUTSA_v10005243mg [Eutrema salsugineum]
Length=69

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+LSPGLLFQ+P   R VEFGN QTSG ++LVHA+++F L+++F +A+ V
Sbjct  10   AVILFVVLSPGLLFQIPAGGRVVEFGNMQTSGASILVHAIIFFGLITIFTIAINV  64



>ref|XP_010551939.1| PREDICTED: uncharacterized protein LOC104822418 [Tarenaya hassleriana]
Length=70

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LL+PG+LFQLPG+ R VEFG FQTSG A+++H +L+FAL+++  +A+ V
Sbjct  11   SVVLFILLTPGVLFQLPGKTRVVEFGGFQTSGAAIVIHTVLFFALITISLIALHV  65



>ref|XP_002439094.1| hypothetical protein SORBIDRAFT_09g000370 [Sorghum bicolor]
 gb|EES17524.1| hypothetical protein SORBIDRAFT_09g000370 [Sorghum bicolor]
Length=70

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  215  MLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +LFVLLSPGLL QLPGR   VEFGN QTS V++LVH+++YFAL+++F + + V
Sbjct  12   VLFVLLSPGLLIQLPGRHHFVEFGNLQTSAVSILVHSIIYFALITIFVIVIGV  64



>ref|XP_010024171.1| PREDICTED: uncharacterized protein LOC104414707 [Eucalyptus grandis]
Length=70

 Score = 73.9 bits (180),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  212  LFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            LF+LL+PG+LFQ+PG+ R VEFGNF TSGV++LVH++LY A + +F +A+ V
Sbjct  13   LFILLTPGMLFQIPGQHRYVEFGNFHTSGVSILVHSILYLAFMCIFLIAIGV  64



>emb|CDY13678.1| BnaA06g32450D [Brassica napus]
Length=69

 Score = 73.9 bits (180),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PG+L Q+PG+ R VEFG FQTSG++V+VH L+YF LV +  LA+++
Sbjct  10   AVALFVLLTPGVLIQIPGKNRVVEFGTFQTSGLSVIVHTLIYFTLVCILLLAIQI  64



>ref|XP_006285635.1| hypothetical protein CARUB_v10007088mg [Capsella rubella]
 ref|XP_009140054.1| PREDICTED: uncharacterized protein LOC103864043 [Brassica rapa]
 gb|EOA18533.1| hypothetical protein CARUB_v10007088mg [Capsella rubella]
 emb|CDY65951.1| BnaC04g56120D [Brassica napus]
 emb|CDY48966.1| BnaA04g10740D [Brassica napus]
Length=69

 Score = 73.9 bits (180),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQLP R R +EFGN  TSG+++LVHA++YF ++++  +A+++
Sbjct  11   AVALFILLSPGLLFQLPARTRVMEFGNMSTSGISILVHAIIYFCILTILVIAIQI  65



>dbj|BAD42942.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD42993.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44663.1| hypothetical protein [Arabidopsis thaliana]
Length=69

 Score = 73.9 bits (180),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLL Q+PGR R VEFG FQTSG++V+VH L+YF LV +  LA+++
Sbjct  10   AVTLFVLLTPGLLIQVPGRGRVVEFGTFQTSGLSVIVHTLIYFTLVCILLLALQI  64



>ref|XP_009343145.1| PREDICTED: uncharacterized protein LOC103935116 [Pyrus x bretschneideri]
Length=69

 Score = 73.6 bits (179),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SPGLLFQLPG   CVEFG+F TSG A+++H+LLYF L+ VF LA+KV
Sbjct  18   SPGLLFQLPGSHGCVEFGSFHTSGAAIMIHSLLYFGLICVFLLAIKV  64



>gb|ACG48702.1| hypothetical protein [Zea mays]
 gb|AFW71536.1| hypothetical protein ZEAMMB73_526140 [Zea mays]
Length=69

 Score = 73.6 bits (179),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLLFQLP   R V FG   TSGVA+LVHA+LYFAL+++F +A+ V
Sbjct  10   ATVLFVLLTPGLLFQLPAHGRIVGFGTMHTSGVAILVHAVLYFALITIFLIAIGV  64



>ref|XP_006292430.1| hypothetical protein CARUB_v10018645mg [Capsella rubella]
 ref|XP_010502664.1| PREDICTED: uncharacterized protein LOC104779929 [Camelina sativa]
 ref|XP_010514387.1| PREDICTED: uncharacterized protein LOC104790353 [Camelina sativa]
 gb|EOA25328.1| hypothetical protein CARUB_v10018645mg [Capsella rubella]
Length=69

 Score = 73.6 bits (179),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLL Q+PGR R VEFG FQTSG++V+VH L+YF +V +  LA+++
Sbjct  10   AVTLFVLLTPGLLIQIPGRGRVVEFGTFQTSGLSVIVHTLIYFTIVCILLLALQI  64



>ref|XP_008798929.1| PREDICTED: uncharacterized protein LOC103713697 [Phoenix dactylifera]
Length=70

 Score = 73.6 bits (179),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R +EFGN  TSG++VLVH++++FA++++  +AV +
Sbjct  11   AVILFILLSPGLLFQLPARTRVIEFGNMYTSGISVLVHSIIFFAILTILVIAVGI  65



>gb|KCW60621.1| hypothetical protein EUGRSUZ_H03346, partial [Eucalyptus grandis]
Length=102

 Score = 74.3 bits (181),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  212  LFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            LF+LL+PG+LFQ+PG+ R VEFGNF TSGV++LVH++LY A + +F +A+ V
Sbjct  45   LFILLTPGMLFQIPGQHRYVEFGNFHTSGVSILVHSILYLAFMCIFLIAIGV  96



>ref|XP_009402174.1| PREDICTED: uncharacterized protein LOC103986032 [Musa acuminata 
subsp. malaccensis]
Length=70

 Score = 73.6 bits (179),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R VEFGN  TSG+++LVH++L+F L+++  +A+ +
Sbjct  11   AVILFILLSPGLLFQLPARSRVVEFGNMSTSGISILVHSILFFCLLTILVIAIGI  65



>ref|XP_010680015.1| PREDICTED: uncharacterized protein LOC104895255 [Beta vulgaris 
subsp. vulgaris]
Length=69

 Score = 73.2 bits (178),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V++F++L+PGLL Q+PGR + VEF +F TSG A+LVHAL+YFAL+ +F LA+ V
Sbjct  10   AVVMFIILTPGLLVQIPGRDKAVEFSSFHTSGPAILVHALIYFALICIFLLAIGV  64



>gb|KCW61926.1| hypothetical protein EUGRSUZ_H04622 [Eucalyptus grandis]
Length=69

 Score = 73.2 bits (178),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +PGLLFQLPGR + VEFGNFQTSG +++VH+LLYF LV VF LA+KV
Sbjct  18   TPGLLFQLPGRHQFVEFGNFQTSGASIMVHSLLYFCLVCVFVLALKV  64



>ref|XP_002453888.1| hypothetical protein SORBIDRAFT_04g020640 [Sorghum bicolor]
 ref|XP_004952553.1| PREDICTED: uncharacterized protein LOC101775843 [Setaria italica]
 gb|ACG31155.1| hypothetical protein [Zea mays]
 gb|EES06864.1| hypothetical protein SORBIDRAFT_04g020640 [Sorghum bicolor]
Length=69

 Score = 73.2 bits (178),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLLFQLP   R V FG   TSG+A+LVHA+LYFAL+++F +A+ V
Sbjct  10   ATVLFVLLTPGLLFQLPAHGRIVGFGTMHTSGIAILVHAVLYFALITIFLIAIGV  64



>ref|XP_009150403.1| PREDICTED: uncharacterized protein LOC103873762 [Brassica rapa]
 emb|CDY68989.1| BnaA06g39150D [Brassica napus]
Length=69

 Score = 73.2 bits (178),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQ+P   R VEFGN QTSG ++LVHA+++F L+++F +A+ V
Sbjct  10   AVILFVVLTPGLLFQIPAGGRVVEFGNMQTSGASILVHAIIFFGLITIFTIAINV  64



>ref|XP_010250671.1| PREDICTED: uncharacterized protein LOC104592857 [Nelumbo nucifera]
Length=70

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF+LLSPGLLFQ P R R VEFGN  TSG+++LVHA++YF ++++  +A+ V
Sbjct  11   SVILFILLSPGLLFQFPARTRIVEFGNMCTSGISILVHAIIYFCILTILIVAIGV  65



>dbj|BAD23191.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD23650.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY85998.1| hypothetical protein OsI_07359 [Oryza sativa Indica Group]
 gb|EAZ23178.1| hypothetical protein OsJ_06862 [Oryza sativa Japonica Group]
 dbj|BAG88916.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00650.1| unnamed protein product [Oryza sativa Japonica Group]
Length=69

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLLFQLP   R V FG   TSGVAVLVHA++YFAL+++F +A+ V
Sbjct  10   ATVLFVLLTPGLLFQLPAHGRIVGFGTMHTSGVAVLVHAVIYFALITIFLIAIGV  64



>ref|XP_009406320.1| PREDICTED: uncharacterized protein LOC103989242 [Musa acuminata 
subsp. malaccensis]
Length=70

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R +EFGN  TSG+++LVH +L+FA++++  +A+ V
Sbjct  11   AVVLFILLSPGLLFQLPARTRVIEFGNMYTSGISILVHGILFFAILTILVIAIGV  65



>ref|NP_001046925.2| Os02g0508100 [Oryza sativa Japonica Group]
 dbj|BAF08839.2| Os02g0508100, partial [Oryza sativa Japonica Group]
Length=72

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLLFQLP   R V FG   TSGVAVLVHA++YFAL+++F +A+ V
Sbjct  13   ATVLFVLLTPGLLFQLPAHGRIVGFGTMHTSGVAVLVHAVIYFALITIFLIAIGV  67



>ref|XP_002321710.2| hypothetical protein POPTR_0015s11020g [Populus trichocarpa]
 gb|EEF05837.2| hypothetical protein POPTR_0015s11020g [Populus trichocarpa]
Length=70

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PG+ R VEFGN QTSG ++ VHA+++  L+++F +A+ V
Sbjct  10   AVVLFVLLTPGLLFQIPGKSRVVEFGNMQTSGASIAVHAIVFSGLITIFLVAIGV  64



>ref|XP_008806424.1| PREDICTED: uncharacterized protein LOC103719121 [Phoenix dactylifera]
Length=70

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R VEFGN  TSG+++LVH++L+F L+++  +A+ +
Sbjct  11   AVILFILLSPGLLFQLPARARVVEFGNMSTSGISILVHSILFFCLLTILVIAIGI  65



>ref|NP_001045237.1| Os01g0923200 [Oryza sativa Japonica Group]
 dbj|BAB90821.1| GPI-anchored protein-like [Oryza sativa Japonica Group]
 dbj|BAD88322.1| GPI-anchored protein-like [Oryza sativa Japonica Group]
 dbj|BAF07151.1| Os01g0923200 [Oryza sativa Japonica Group]
 gb|EAY77027.1| hypothetical protein OsI_04982 [Oryza sativa Indica Group]
 gb|EAZ14667.1| hypothetical protein OsJ_04589 [Oryza sativa Japonica Group]
 dbj|BAG87391.1| unnamed protein product [Oryza sativa Japonica Group]
Length=75

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+LSPGLLFQLP R R VEFGN  TS +A+LVHA+++F L+++F +A+ V
Sbjct  16   AVILFVVLSPGLLFQLPARARVVEFGNMATSAIAILVHAVIFFCLLTIFVVAIGV  70



>ref|XP_010112381.1| hypothetical protein L484_010786 [Morus notabilis]
 gb|EXC33376.1| hypothetical protein L484_010786 [Morus notabilis]
Length=70

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQ+P R R +EFGN  TSG+A+LVHA++YF ++++  +A+ +
Sbjct  11   AVVLFILLSPGLLFQVPARTRVMEFGNMNTSGIAILVHAIIYFCILTILVVAIGI  65



>ref|XP_003575012.1| PREDICTED: uncharacterized protein LOC100826781 [Brachypodium 
distachyon]
Length=69

 Score = 72.8 bits (177),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLLFQLP + R V FG+  TSG+A+LVHA+LYFAL+++F +A+ V
Sbjct  10   ATVLFVLLTPGLLFQLPAQGRIVAFGSMHTSGLAILVHAILYFALITIFLVAIGV  64



>ref|XP_010258717.1| PREDICTED: uncharacterized protein LOC104598380 [Nelumbo nucifera]
Length=65

 Score = 72.8 bits (177),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  218  VMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            V+LFVLL+PGLLFQLP R + VEF N QTSGV++ VHA++YF L+++F +A+ V
Sbjct  7    VVLFVLLTPGLLFQLPRRNKIVEFRNMQTSGVSIRVHAIIYFGLITIFLIAIGV  60



>ref|XP_010027269.1| PREDICTED: uncharacterized protein LOC104417744 [Eucalyptus grandis]
Length=216

 Score = 75.5 bits (184),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLPG+ + VEFGN QT+G ++LVH +++F L+++F +AV V
Sbjct  157  AVVLFILLSPGLLFQLPGKMKAVEFGNMQTTGASILVHTIIFFCLITIFLIAVGV  211


 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +PGLLFQLPGR + VEFGNFQTSG +++VH+LLYF LV VF LA+KV
Sbjct  18   TPGLLFQLPGRHQFVEFGNFQTSGASIMVHSLLYFCLVCVFVLALKV  64



>ref|XP_008790764.1| PREDICTED: uncharacterized protein LOC103707858 [Phoenix dactylifera]
Length=70

 Score = 72.8 bits (177),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R VEFGN  TSG+++LVH++L+F L+++  +AV +
Sbjct  11   AVILFILLSPGLLFQLPARTRVVEFGNMGTSGISILVHSILFFCLLTILVIAVGI  65



>ref|XP_008810232.1| PREDICTED: uncharacterized protein LOC103721701 [Phoenix dactylifera]
Length=70

 Score = 72.8 bits (177),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R +EFGN  TSG+++LVH++++FA++++  +AV +
Sbjct  11   AVILFILLSPGLLFQLPARARIIEFGNMYTSGISILVHSIIFFAILTILVIAVGI  65



>gb|AFK41536.1| unknown [Medicago truncatula]
Length=70

 Score = 72.8 bits (177),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF++LSPGLLFQ P R RCVEFGN  TSG+++L+HA++YF ++++  +A+ +
Sbjct  11   AVALFIVLSPGLLFQFPARFRCVEFGNMSTSGISILIHAIIYFCILTILIVAIGI  65



>ref|XP_009129455.1| PREDICTED: uncharacterized protein LOC103854274 [Brassica rapa]
 emb|CDY34186.1| BnaA02g28540D [Brassica napus]
 emb|CDY28500.1| BnaC02g36600D [Brassica napus]
Length=69

 Score = 72.8 bits (177),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQ+P R R +EFGN  TSG+A+LVHA++YF + ++  +A++V
Sbjct  11   AVSLFILLSPGLLFQIPARTRVMEFGNMSTSGIAILVHAVIYFCIFTILVVAIQV  65



>ref|XP_007038004.1| Uncharacterized protein TCM_014659 [Theobroma cacao]
 gb|EOY22505.1| Uncharacterized protein TCM_014659 [Theobroma cacao]
Length=69

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             ++LF+LLSPGLLFQLPG  R VEFGNF+T+G A+++H +L+F L ++  LAV +
Sbjct  10   GLLLFILLSPGLLFQLPGNTRTVEFGNFKTNGKAIVIHTILFFGLFTILILAVGI  64



>emb|CBI15682.3| unnamed protein product [Vitis vinifera]
Length=138

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVLL+PGLLFQ+PG+ R VEFG+  TSG ++LVH ++YF L+++F +A+ V
Sbjct  31   AVVLFVLLTPGLLFQVPGKNRVVEFGSMHTSGASILVHTIIYFGLITIFLIAIGV  85



>ref|XP_009419370.1| PREDICTED: uncharacterized protein LOC103999354 [Musa acuminata 
subsp. malaccensis]
Length=70

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LF+LLSPGLLFQLP R R +EFGN  TSG+A+LVH++++F ++++  +A+ V
Sbjct  11   AVILFILLSPGLLFQLPARTRVIEFGNMYTSGIAILVHSIIFFVILTILVIAIGV  65



>ref|XP_011098906.1| PREDICTED: uncharacterized protein LOC105177439 [Sesamum indicum]
Length=70

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V++F+LLSPGLLFQLP R R +EFGN  TSG+++L+HA+LYF + ++  +A+ +
Sbjct  11   AVVMFILLSPGLLFQLPARTRVIEFGNMYTSGISILIHAILYFCIYTILIVAIGI  65



>ref|NP_189339.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE77258.1| uncharacterized protein AT3G27030 [Arabidopsis thaliana]
Length=142

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLL Q+PGR R VEFG FQTSG++V+VH L+YF LV +  LA+++
Sbjct  10   AVTLFVLLTPGLLIQVPGRGRVVEFGTFQTSGLSVIVHTLIYFTLVCILLLALQI  64


 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
             V+LFV+LSPGLLF LPG  R V+FG  +T+G A+ VH L++FA+ ++  LA+ 
Sbjct  83   GVVLFVILSPGLLFSLPGNNRTVDFGGLKTNGKAIAVHTLIFFAIYTILILALN  136



>ref|XP_009151994.1| PREDICTED: uncharacterized protein LOC103875252 [Brassica rapa]
Length=145

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PG+L Q+PG+ R VEFG FQTSG++V+VH L+YF LV +  LA+++
Sbjct  10   AVALFVLLTPGVLIQIPGKNRVVEFGTFQTSGLSVIVHTLIYFTLVCILLLAIQI  64


 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
             V+LFV+LSPGLLF LPG  R V+FGN +T+G A+ VH L++FA+ S+  +AV 
Sbjct  86   GVILFVILSPGLLFSLPGNNRAVDFGNLKTNGKAIAVHTLIFFAIYSILIIAVN  139



>ref|XP_002877012.1| hypothetical protein ARALYDRAFT_322830 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53271.1| hypothetical protein ARALYDRAFT_322830 [Arabidopsis lyrata subsp. 
lyrata]
Length=142

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PGLL Q+PGR R VEFG FQTSG++V+VH L+YF LV +  LA+++
Sbjct  10   AVTLFVLLTPGLLIQVPGRGRVVEFGTFQTSGLSVIVHTLIYFTLVCILLLALQI  64


 Score = 63.9 bits (154),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
             V+LFV+LSPGLLF LPG  R V+FG  +T+G A+ VH L++FA+ S+  LA+ 
Sbjct  83   GVVLFVILSPGLLFSLPGNNRTVDFGGLKTNGKAIAVHTLIFFAIYSILILALN  136



>ref|XP_010244261.1| PREDICTED: uncharacterized protein LOC104588139 [Nelumbo nucifera]
Length=69

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFVL +  LLFQL GR R VEFGN QTSGV++LVHA++YF L+++F +A+ V
Sbjct  10   AVVLFVLSTSRLLFQLLGRNRIVEFGNMQTSGVSILVHAIIYFGLITIFLIAIGV  64



>emb|CDP16705.1| unnamed protein product [Coffea canephora]
Length=70

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAV  63
            +V+LF+LL+PGLL Q+PG  R VEF NFQTSG ++LVH+LLYFAL+ +  LA+
Sbjct  10   AVVLFILLTPGLLIQIPGHGRFVEFSNFQTSGASILVHSLLYFALICILLLAI  62



>ref|XP_011097269.1| PREDICTED: uncharacterized protein LOC105176235 [Sesamum indicum]
Length=86

 Score = 72.8 bits (177),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LF+LLSPGLLFQLP R R VEFGN  TSG+++LVHA+LYF + ++  +A+ V
Sbjct  26   AVALFILLSPGLLFQLPARARVVEFGNMYTSGISILVHAVLYFCIYTILIVAIGV  80



>ref|XP_004971095.1| PREDICTED: uncharacterized protein LOC101772582 [Setaria italica]
Length=78

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+LSPGLLFQLP R R VEFGN  TS +A+LVHA+++F L+++F +A+ V
Sbjct  19   AVILFVVLSPGLLFQLPARTRVVEFGNMGTSAIAILVHAVIFFCLLTIFVVAIGV  73



>ref|XP_006395489.1| hypothetical protein EUTSA_v10005506mg [Eutrema salsugineum]
 gb|ESQ32775.1| hypothetical protein EUTSA_v10005506mg [Eutrema salsugineum]
Length=175

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V LFVLL+PG+L Q+PG+ R VEFG FQTSGV+V+VH L+YF LV +  LA+++
Sbjct  10   AVTLFVLLTPGVLIQIPGKNRVVEFGTFQTSGVSVIVHTLIYFTLVCILLLALQI  64


 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  218  VMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVK  60
            V+LFV+LSPGLLF LPG  R V+FG  +T+G A+ VH L++FA+ S+  LAV 
Sbjct  117  VILFVILSPGLLFSLPGNNRAVDFGTLKTNGKAIAVHTLIFFAIYSILILAVN  169



>gb|ACG41546.1| hypothetical protein [Zea mays]
Length=70

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  215  MLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +LFVLLSPGLL QLPGR   VEFGN +TS V++LVH+++YFAL+++F + + V
Sbjct  12   VLFVLLSPGLLVQLPGRHHLVEFGNLKTSAVSILVHSIIYFALITLFVIVIGV  64



>ref|XP_008790760.1| PREDICTED: uncharacterized protein LOC103707855 [Phoenix dactylifera]
Length=70

 Score = 72.0 bits (175),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SPGL+FQ+PG+ R VEFGN QTSG A+LVH+++YF L+++F LAV V
Sbjct  18   SPGLIFQIPGKSRVVEFGNLQTSGAAILVHSIIYFGLIAIFVLAVGV  64



>ref|XP_011098903.1| PREDICTED: uncharacterized protein LOC105177436 [Sesamum indicum]
Length=69

 Score = 72.0 bits (175),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +PGLL Q+PGR R +EFGNFQTSGV+VLVHA+LYFAL  +F LA+ V
Sbjct  18   TPGLLIQVPGRNRFIEFGNFQTSGVSVLVHAILYFALSCIFLLAIGV  64



>ref|XP_008239492.1| PREDICTED: uncharacterized protein LOC103338084 [Prunus mume]
Length=69

 Score = 72.0 bits (175),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  200  LSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            L+PGLLFQ+PG+ R VEFGN QTSG +++VHA++YF L+++F +A+ V
Sbjct  17   LTPGLLFQIPGKGRVVEFGNMQTSGASIMVHAIIYFGLITIFLIAIGV  64



>ref|XP_003531203.1| PREDICTED: uncharacterized protein LOC100777861 [Glycine max]
 gb|KHN12379.1| hypothetical protein glysoja_018509 [Glycine soja]
 gb|KHN34829.1| hypothetical protein glysoja_036822 [Glycine soja]
Length=70

 Score = 72.0 bits (175),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LFVLLSPGLLFQLP + + V FG+ QTSG+++LVH +++F L+++F LA+ V
Sbjct  11   SVVLFVLLSPGLLFQLPAKGKVVAFGSMQTSGLSILVHTIIFFGLITIFLLAIGV  65



>ref|XP_010250670.1| PREDICTED: uncharacterized protein LOC104592856 [Nelumbo nucifera]
Length=139

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  197  SPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +PG+LFQLPGR R VEFGN QTSGV++LVHA++YF L+++F +A+ V
Sbjct  88   TPGMLFQLPGRNRIVEFGNMQTSGVSILVHAIIYFGLITIFLIAIGV  134



>gb|EPS58439.1| hypothetical protein M569_16374 [Genlisea aurea]
Length=141

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALV  84
            +V+LFV+L+PGLL Q+PGR R VEFGNFQTSGV++LVHA+ YFAL+
Sbjct  10   AVVLFVMLTPGLLIQVPGRSRYVEFGNFQTSGVSILVHAVFYFALI  55


 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
             V+LF+LL PGLLFQ+PG  R VEFG+ +T+G A+ +H L +FAL ++  LAV++
Sbjct  82   GVVLFILLQPGLLFQIPGNNRPVEFGSMKTNGKAIALHTLFFFALYAILVLAVRL  136



>emb|CDY58411.1| BnaC09g54570D [Brassica napus]
Length=70

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SV+LF++L+PG+LFQLPG+ + VEFG FQTSG A+++H L++FA ++V  +A+ +
Sbjct  11   SVILFIILTPGVLFQLPGKTKAVEFGGFQTSGAAIVIHTLIFFACITVSLIALHI  65



>emb|CDX84422.1| BnaC03g50780D [Brassica napus]
 emb|CDX84423.1| BnaC03g50770D [Brassica napus]
Length=69

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V+LFV+L+PGLLFQ+P   R VEFGN +TSG ++LVHA+++F L+++F +A+ V
Sbjct  10   AVILFVVLTPGLLFQIPAGGRVVEFGNMKTSGASILVHAIIFFGLITIFTIAINV  64



>ref|XP_009379975.1| PREDICTED: uncharacterized protein LOC103968468 [Musa acuminata 
subsp. malaccensis]
Length=70

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = -2

Query  197  SPGLLFQLPGRR-RCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            SPGLLFQ+PG+  R VEFGNFQTSGV++LVHA++YFAL+++F +AV V
Sbjct  18   SPGLLFQIPGKGGRLVEFGNFQTSGVSILVHAVIYFALITIFLIAVGV  65



>ref|XP_009771784.1| PREDICTED: uncharacterized protein LOC104222268 [Nicotiana sylvestris]
Length=70

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            +V++F+LLSPGLL QLP R R +EFGN  TSG+A+LVHA+LYF + ++  +AV V
Sbjct  11   AVVMFILLSPGLLCQLPARTRVIEFGNMYTSGIAILVHAILYFCIYTILIVAVGV  65



>dbj|BAJ92955.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=69

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLL  LPGR R  EFG+  TSG+++L+HA+LYFALV++F +AV V
Sbjct  10   ATVLFVLLTPGLLCTLPGRGRVAEFGSMHTSGLSILIHAVLYFALVTIFIIAVGV  64



>gb|EMT04963.1| hypothetical protein F775_27729 [Aegilops tauschii]
Length=69

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            + +LFVLL+PGLL  LPGR R  EFG+  TSG+++L+HA+LYFALV++F +AV V
Sbjct  10   ATVLFVLLTPGLLCTLPGRGRVAEFGSMHTSGLSILIHAVLYFALVTIFLIAVGV  64



>ref|NP_001054393.1| Os05g0103300 [Oryza sativa Japonica Group]
 gb|AAS88826.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16307.1| Os05g0103300 [Oryza sativa Japonica Group]
 gb|EAY96207.1| hypothetical protein OsI_18094 [Oryza sativa Indica Group]
 dbj|BAG88512.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92546.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62008.1| hypothetical protein OsJ_16790 [Oryza sativa Japonica Group]
Length=72

 Score = 71.6 bits (174),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  221  SVMLFVLLSPGLLFQLPGRRRCVEFGNFQTSGVAVLVHALLYFALVSVFFLAVKV  57
            S +LF+LLSPGLLFQ+PG+ R +EFG FQTS V++LVH +L+FAL ++F +A+ V
Sbjct  10   SWVLFILLSPGLLFQIPGKCRLIEFGKFQTSVVSILVHTILFFALDAIFLVAIGV  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506208057152