BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c65726_g1_i1 len=137 path=[115:0-136]

Length=137
                                                                      Score     E

gb|EHY91648.1|  putative ABC-type cobalamin Fe3+-siderophores tra...  57.8    2e-08   
ref|WP_037538964.1|  iron ABC transporter permease                    57.8    2e-08   
ref|WP_011303647.1|  iron ABC transporter permease                    57.8    2e-08   
ref|WP_019469516.1|  iron ABC transporter permease                    57.8    2e-08   
gb|EJX16888.1|  cobalamin Fe3+-siderophores ABC transporter permease  57.0    2e-08   
ref|WP_002512098.1|  MULTISPECIES: iron ABC transporter permease      57.0    3e-08   
ref|WP_017722523.1|  iron ABC transporter permease                    57.0    4e-08   
ref|WP_029377693.1|  iron ABC transporter permease                    57.0    4e-08   
ref|WP_039068758.1|  iron ABC transporter permease                    57.0    4e-08   
ref|WP_021339443.1|  iron ABC transporter permease                    56.6    6e-08   
gb|ETJ03683.1|  Iron chelate uptake ABC transporter, FeCT family,...  54.3    7e-08   
emb|CEF19496.1|  Iron compound ABC transporter, permease protein ...  55.8    1e-07   
ref|WP_002471829.1|  iron ABC transporter permease                    55.8    1e-07   
ref|WP_002450938.1|  iron ABC transporter permease                    54.7    3e-07   
ref|WP_002467010.1|  iron ABC transporter permease                    54.7    3e-07   
ref|WP_002509864.1|  MULTISPECIES: iron ABC transporter permease      54.7    3e-07   
ref|WP_017637112.1|  iron ABC transporter permease                    54.7    3e-07   
ref|WP_029056475.1|  iron ABC transporter permease                    54.3    3e-07   
ref|WP_037548531.1|  iron ABC transporter permease                    53.1    9e-07   
ref|WP_011276422.1|  MULTISPECIES: iron ABC transporter permease      53.1    9e-07   
ref|WP_002441487.1|  iron ABC transporter permease                    53.1    1e-06   
ref|WP_031837044.1|  iron ABC transporter permease                    49.3    4e-06   
ref|WP_031857611.1|  iron ABC transporter permease                    49.3    4e-06   
ref|WP_002490780.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002459740.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002501120.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_038812497.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002457601.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002445925.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002476218.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002498607.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002476424.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002491228.1|  iron ABC transporter permease                    51.2    5e-06   
ref|WP_002486667.1|  iron ABC transporter permease                    50.8    5e-06   
ref|WP_002487913.1|  iron ABC transporter permease                    50.8    5e-06   
ref|WP_002473962.1|  iron ABC transporter permease                    50.8    5e-06   
ref|WP_001829651.1|  iron ABC transporter permease                    50.8    5e-06   
ref|WP_002438902.1|  MULTISPECIES: iron ABC transporter permease      50.8    5e-06   
ref|WP_021299002.1|  iron chelate uptake ABC transporter, FeCT fa...  50.8    5e-06   
ref|WP_018113782.1|  iron ABC transporter permease                    50.8    5e-06   
ref|WP_017464606.1|  iron ABC transporter permease                    50.8    6e-06   
ref|WP_002468667.1|  iron ABC transporter permease                    50.8    6e-06   
ref|WP_031825428.1|  iron ABC transporter permease                    48.9    9e-06   
ref|WP_031893034.1|  iron ABC transporter permease                    50.1    1e-05   
ref|WP_016426110.1|  hypothetical protein                             50.1    1e-05   
ref|WP_031863325.1|  iron ABC transporter permease                    48.9    1e-05   
gb|EZH92152.1|  iron chelate uptake ABC transporter, FeCT family,...  49.7    1e-05   
ref|WP_031826093.1|  iron ABC transporter permease                    49.7    1e-05   
gb|EVQ97318.1|  iron compound ABC transporter, permease               49.7    1e-05   
gb|EHT85799.1|  enterochelin uptake permease                          49.7    1e-05   
gb|EGA96651.1|  FecCD family ferrichrome transporter permease         49.7    1e-05   
gb|EOR36758.1|  iron compound ABC transporter, permease               49.7    1e-05   
ref|WP_031893029.1|  iron ABC transporter permease                    49.7    1e-05   
ref|WP_031833969.1|  iron ABC transporter permease                    49.7    1e-05   
ref|WP_037575933.1|  iron ABC transporter permease                    49.7    1e-05   
gb|KEK35188.1|  fecCD transport family protein                        49.3    1e-05   
gb|EJE56513.1|  FecCD family ferrichrome transporter permease         49.7    1e-05   
ref|WP_031904856.1|  iron ABC transporter permease                    49.7    2e-05   
gb|KEK33043.1|  fecCD transport family protein                        49.7    2e-05   
gb|EHT90266.1|  enterochelin uptake permease                          49.7    2e-05   
gb|EGA99504.1|  FecCD family ferrichrome transporter permease         49.7    2e-05   
ref|WP_001821572.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000876320.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_039644025.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031898955.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031807459.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_014532744.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031879994.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000876316.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000876317.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031871507.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031775063.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031862695.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000876319.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_025786878.1|  iron ABC transporter permease                    49.7    2e-05   
gb|KAH22244.1|  hypothetical protein W691_00860                       49.7    2e-05   
ref|WP_031929878.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031793685.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031789717.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031773805.1|  iron ABC transporter permease                    49.7    2e-05   
emb|CAA06497.1|  membrane protein                                     49.7    2e-05   Staphylococcus aureus
ref|WP_000876318.1|  iron ABC transporter permease                    49.7    2e-05   
gb|EUJ52119.1|  iron compound ABC transporter, permease               49.7    2e-05   
ref|WP_031879751.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_011382221.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031897293.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031860544.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031927547.1|  iron ABC transporter permease                    49.7    2e-05   
gb|EGS87750.1|  iron chelate uptake ABC transporter, FeCT family,...  49.7    2e-05   
ref|WP_031766309.1|  iron ABC transporter permease                    49.7    2e-05   
gb|EZT89469.1|  hypothetical protein U927_00139                       49.7    2e-05   
gb|EWA78237.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EVF90053.1|  iron compound ABC transporter, permease               49.7    2e-05   
ref|WP_031887814.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031772503.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031914374.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000876321.1|  iron ABC transporter permease                    49.7    2e-05   
gb|EYQ96590.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EYN07577.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|ENN63625.1|  iron compound ABC transporter, permease               49.7    2e-05   
ref|WP_031906153.1|  iron ABC transporter permease                    49.7    2e-05   
gb|KAG95325.1|  hypothetical protein W793_00442                       49.7    2e-05   
gb|ENI50717.1|  iron compound ABC transporter, permease               49.7    2e-05   
emb|CDR54751.1|  FatD                                                 49.7    2e-05   
emb|CDR57971.1|  FatD                                                 49.7    2e-05   
ref|WP_033856946.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000876309.1|  iron ABC transporter permease                    49.7    2e-05   
gb|EWA48631.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EVY58900.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EVG60684.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EVQ19696.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EYP08653.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EUI35323.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|ENI87296.1|  iron compound ABC transporter, permease               49.7    2e-05   
ref|WP_000605325.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000605324.1|  iron ABC transporter permease                    49.7    2e-05   
emb|CDR26280.1|  FatD                                                 49.7    2e-05   
ref|WP_031904894.1|  iron ABC transporter permease                    49.7    2e-05   
gb|EXM59975.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EFB50370.1|  iron complex transport system permease                49.7    2e-05   Staphylococcus aureus subsp. aureus D139
ref|WP_031914767.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031894963.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000876311.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_000876315.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_037567298.1|  iron ABC transporter permease                    49.7    2e-05   
gb|AIU85494.1|  iron complex transport system permease protein        49.7    2e-05   
emb|CDR60454.1|  FatD                                                 49.7    2e-05   
gb|EYP03787.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EYN65468.1|  iron compound ABC transporter, permease               49.7    2e-05   
gb|EVE96581.1|  iron compound ABC transporter, permease               49.7    2e-05   
dbj|GAK14558.1|  iron compound ABC uptake transporter, permease p...  49.3    2e-05   
gb|EVA15264.1|  iron compound ABC transporter, permease               49.7    2e-05   
ref|WP_031887088.1|  iron ABC transporter permease                    49.3    2e-05   
ref|WP_031926071.1|  iron ABC transporter permease                    49.3    2e-05   
gb|EYO27027.1|  iron compound ABC transporter, permease               49.7    2e-05   
ref|WP_001825705.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031864590.1|  iron ABC transporter permease                    49.3    2e-05   
ref|WP_025173897.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_001793672.1|  iron ABC transporter permease                    49.7    2e-05   
ref|WP_031920098.1|  iron ABC transporter permease                    49.3    2e-05   
ref|WP_000876310.1|  iron ABC transporter permease                    49.3    2e-05   
ref|WP_024928047.1|  iron ABC transporter permease                    49.3    2e-05   
ref|WP_016911805.1|  hypothetical protein                             49.3    2e-05   
gb|EVO14917.1|  iron compound ABC transporter, permease               48.9    2e-05   
ref|WP_025905417.1|  MULTISPECIES: iron ABC transporter permease      49.3    2e-05   
ref|WP_017175943.1|  MULTISPECIES: iron ABC transporter permease      49.3    2e-05   
ref|WP_002449086.1|  MULTISPECIES: iron ABC transporter permease      49.3    2e-05   
ref|WP_031877019.1|  iron ABC transporter permease                    49.3    3e-05   
gb|EJU81847.1|  iron chelate uptake ABC transporter, FeCT family,...  48.9    3e-05   
ref|WP_009383096.1|  cobalamin Fe3+-siderophores ABC transporter ...  48.9    3e-05   
ref|WP_026859895.1|  iron ABC transporter permease                    48.9    3e-05   
ref|WP_000876313.1|  iron ABC transporter permease                    48.9    3e-05   
ref|WP_031835336.1|  iron ABC transporter permease                    48.9    3e-05   
gb|KIH71660.1|  iron ABC transporter permease                         48.9    3e-05   
ref|WP_031547298.1|  iron ABC transporter permease                    48.9    3e-05   
gb|ENI57910.1|  iron compound ABC transporter, permease               48.9    3e-05   
ref|WP_035807487.1|  iron ABC transporter permease                    48.5    4e-05   
ref|WP_017000362.1|  hypothetical protein                             48.1    5e-05   
ref|WP_017176639.1|  iron ABC transporter permease                    47.8    7e-05   
ref|WP_002463844.1|  iron ABC transporter permease                    47.8    9e-05   
ref|WP_005544126.1|  iron ABC transporter permease                    47.4    9e-05   
ref|WP_002492143.1|  iron ABC transporter permease                    47.4    9e-05   
dbj|GAK03227.1|  LOW QUALITY PROTEIN: iron compound ABC uptake tr...  47.4    9e-05   
ref|WP_002459736.1|  iron ABC transporter permease                    47.4    9e-05   
ref|WP_020007043.1|  hypothetical protein                             47.4    1e-04   
ref|WP_011247737.1|  iron ABC transporter permease                    47.4    1e-04   
ref|WP_012703844.1|  iron ABC transporter permease                    47.4    1e-04   
ref|WP_014520257.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_024932718.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_030034161.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_015957555.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_011948718.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_003489433.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_012343576.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_025773893.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_003361009.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_021136621.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_012720573.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_003356131.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_015899640.1|  iron ABC transporter permease                    47.0    1e-04   
ref|WP_003392809.1|  transport system permease                        47.0    1e-04   
gb|EKN41334.1|  iron ABC transporter permease                         44.7    2e-04   
ref|WP_029267392.1|  iron ABC transporter permease                    47.0    2e-04   
ref|WP_025174771.1|  iron ABC transporter permease                    47.0    2e-04   
gb|EHM82732.1|  iron chelate uptake ABC transporter, FeCT family,...  46.6    2e-04   
ref|WP_006287304.1|  permease component                               46.6    2e-04   
ref|WP_017547863.1|  hypothetical protein                             46.6    2e-04   
ref|WP_019423448.1|  iron ABC transporter permease                    46.6    2e-04   
ref|WP_006679306.1|  iron ABC transporter permease                    46.6    2e-04   
ref|WP_027955641.1|  iron ABC transporter permease                    46.2    2e-04   
ref|WP_024094004.1|  iron-siderophore ABC transporter-like protein    46.2    2e-04   
ref|WP_019395381.1|  iron ABC transporter permease                    45.8    3e-04   
ref|WP_003491502.1|  iron ABC transporter permease                    45.8    3e-04   
ref|WP_036577082.1|  iron ABC transporter permease                    45.8    4e-04   
ref|WP_027632822.1|  iron ABC transporter permease                    45.8    4e-04   
ref|WP_026683096.1|  iron ABC transporter permease                    45.8    4e-04   
ref|WP_007441116.1|  transporter                                      44.7    4e-04   
ref|WP_019379135.1|  iron ABC transporter permease                    45.4    5e-04   
gb|AIF42309.1|  iron ABC transporter permease                         45.4    5e-04   
ref|WP_019538238.1|  hypothetical protein                             45.4    5e-04   
ref|WP_029142520.1|  iron ABC transporter permease                    45.4    5e-04   
ref|WP_031262609.1|  iron ABC transporter permease                    45.4    5e-04   
ref|WP_026901737.1|  iron ABC transporter permease                    45.4    5e-04   
gb|EKS24207.1|  hypothetical protein HMPREF9310_02034                 45.4    5e-04   
ref|WP_007444438.1|  MULTISPECIES: Putative iron compound ABC tra...  45.4    5e-04   
ref|WP_014095860.1|  iron ABC transporter permease                    45.4    5e-04   
ref|WP_026684165.1|  iron ABC transporter permease                    45.4    6e-04   
ref|WP_017553918.1|  iron ABC transporter permease                    45.1    6e-04   
dbj|BAQ09003.1|  ABC transporter permease                             45.1    6e-04   
ref|WP_038482138.1|  iron ABC transporter permease                    45.1    6e-04   
ref|WP_009498922.1|  iron ABC transporter permease                    45.1    6e-04   
gb|AIC95375.1|  ABC transporter permease                              45.1    6e-04   
ref|WP_005805565.1|  MULTISPECIES: iron ABC transporter permease      45.1    6e-04   
ref|WP_014018021.1|  iron ABC transporter permease                    45.1    6e-04   
gb|AHM67980.1|  ceuB                                                  43.5    6e-04   
ref|WP_019637373.1|  iron ABC transporter permease                    45.1    6e-04   
dbj|GAK09307.1|  LOW QUALITY PROTEIN: iron compound ABC uptake tr...  45.1    6e-04   
dbj|GAJ99254.1|  iron compound ABC uptake transporter, permease p...  45.1    6e-04   
ref|WP_032122357.1|  iron ABC transporter permease                    45.1    7e-04   
ref|WP_007439824.1|  iron ABC transporter permease                    45.1    7e-04   
ref|WP_013487013.1|  iron ABC transporter permease                    45.1    7e-04   
ref|WP_014095008.1|  iron ABC transporter permease                    45.1    7e-04   
ref|WP_003468532.1|  transport system permease                        43.1    7e-04   
ref|WP_035182202.1|  iron ABC transporter permease                    45.1    7e-04   
ref|WP_021881316.1|  Uncharacterized ABC transporter permease pro...  45.1    8e-04   
ref|WP_022212974.1|  transport system permease protein                44.7    8e-04   
ref|WP_011195730.1|  iron ABC transporter permease                    44.7    9e-04   
ref|WP_025850941.1|  iron ABC transporter permease                    44.7    9e-04   
ref|WP_031573075.1|  iron ABC transporter permease                    44.7    0.001   
ref|WP_021428711.1|  fecCD transport family protein [                 44.7    0.001   
ref|WP_035510293.1|  MULTISPECIES: iron ABC transporter permease      44.7    0.001   
ref|WP_025162825.1|  iron ABC transporter permease [                  44.7    0.001   



>gb|EHY91648.1| putative ABC-type cobalamin Fe3+-siderophores transport system 
permease component [Staphylococcus saprophyticus subsp. saprophyticus 
KACC 16562]
Length=281

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/45 (100%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYEKIINIGLFITATITALVVVTVGTLPF
Sbjct  162  FTIAGMGKDFSNNLGVNYEKIINIGLFITATITALVVVTVGTLPF  206



>ref|WP_037538964.1| iron ABC transporter permease [Staphylococcus saprophyticus]
Length=322

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/45 (100%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYEKIINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYEKIINIGLFITATITALVVVTVGTLPF  247



>ref|WP_011303647.1| iron ABC transporter permease [Staphylococcus saprophyticus]
 ref|YP_302074.1| cobalamin Fe3+-siderophores ABC transporter permease [Staphylococcus 
saprophyticus subsp. saprophyticus ATCC 15305]
 dbj|BAE19129.1| putative ABC-type cobalamin Fe3+-siderophores transport system 
permease component [Staphylococcus saprophyticus subsp. saprophyticus 
ATCC 15305]
Length=322

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/45 (100%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYEKIINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYEKIINIGLFITATITALVVVTVGTLPF  247



>ref|WP_019469516.1| iron ABC transporter permease [Staphylococcus sp. AL1]
Length=322

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/45 (100%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYEKIINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYEKIINIGLFITATITALVVVTVGTLPF  247



>gb|EJX16888.1| cobalamin Fe3+-siderophores ABC transporter permease [Staphylococcus 
sp. OJ82]
Length=260

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYEKIIN+GLFITA ITALVVVTVGTLPF
Sbjct  141  FTIAGMGKDFSNNLGVNYEKIINVGLFITAAITALVVVTVGTLPF  185



>ref|WP_002512098.1| MULTISPECIES: iron ABC transporter permease [Staphylococcus]
 emb|CCI60011.1| iron-siderophore ABC transporter, inner membrane subunit [Staphylococcus 
equorum subsp. equorum Mu2]
Length=322

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYEKIIN+GLFITA ITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYEKIINVGLFITAAITALVVVTVGTLPF  247



>ref|WP_017722523.1| iron ABC transporter permease [Staphylococcus xylosus]
Length=322

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYE+IINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYERIINIGLFITATITALVVVTVGTLPF  247



>ref|WP_029377693.1| iron ABC transporter permease [Staphylococcus xylosus]
 gb|AID00802.1| iron ABC transporter permease [Staphylococcus xylosus]
 gb|AID43396.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
xylosus]
Length=322

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYE+IINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYERIINIGLFITATITALVVVTVGTLPF  247



>ref|WP_039068758.1| iron ABC transporter permease [Staphylococcus xylosus]
Length=322

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYE+IINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYERIINIGLFITATITALVVVTVGTLPF  247



>ref|WP_021339443.1| iron ABC transporter permease [Staphylococcus equorum]
 gb|ERH34960.1| iron ABC transporter permease [Staphylococcus equorum UMC-CNS-924]
Length=322

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYE+IIN+GLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYERIINVGLFITATITALVVVTVGTLPF  247



>gb|ETJ03683.1| Iron chelate uptake ABC transporter, FeCT family, permease protein, 
partial [Streptococcus parasanguinis DORA_23_24]
Length=121

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGVNYEKIINI LFITATITALVVVTVGTLPF
Sbjct  2    FTIAGMGKDFSHNLGVNYEKIINIALFITATITALVVVTVGTLPF  46



>emb|CEF19496.1| Iron compound ABC transporter, permease protein SstA [Staphylococcus 
xylosus]
Length=322

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNY++IINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYQRIINIGLFITATITALVVVTVGTLPF  247



>ref|WP_002471829.1| iron ABC transporter permease [Staphylococcus pettenkoferi]
 gb|EHM70801.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus pettenkoferi VCU012]
Length=323

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNYE+II+IGLFITATITALVVVTVGTLPF
Sbjct  204  FTIAGMGKDFSNNLGVNYERIIHIGLFITATITALVVVTVGTLPF  248



>ref|WP_002450938.1| iron ABC transporter permease [Staphylococcus warneri]
 gb|EEQ80503.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus warneri L37603]
Length=322

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGVNYEKIINI LFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVNYEKIINIALFITATITALVVVTVGTLPF  247



>ref|WP_002467010.1| iron ABC transporter permease [Staphylococcus warneri]
 ref|YP_007385688.1| FecCD transport family protein [Staphylococcus warneri SG1]
 gb|EGG96231.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU121]
 gb|AGC91244.1| FecCD transport family protein [Staphylococcus warneri SG1]
 gb|KEK47239.1| fecCD transport family protein [Staphylococcus warneri Lyso 1 
2011]
 gb|KEK53110.1| fecCD transport family protein [Staphylococcus warneri Lyso 2 
2011]
Length=322

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGVNYEKIINI LFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVNYEKIINIALFITATITALVVVTVGTLPF  247



>ref|WP_002509864.1| MULTISPECIES: iron ABC transporter permease [Staphylococcus]
 gb|EJY95885.1| cobalamin Fe3+-siderophores ABC transporter permease [Staphylococcus 
arlettae CVD059]
 gb|ERF49022.1| iron ABC transporter permease [Staphylococcus sp. EGD-HP3]
Length=322

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFSNNLGVNY++IIN+GLFI+ATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSNNLGVNYDRIINLGLFISATITALVVVTVGTLPF  247



>ref|WP_017637112.1| iron ABC transporter permease [Staphylococcus sp. E463]
Length=322

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGVNYEKIINI LFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVNYEKIINIALFITATITALVVVTVGTLPF  247



>ref|WP_029056475.1| iron ABC transporter permease [Staphylococcus sp. URHA0057]
Length=322

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGVNYEKIINI LFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVNYEKIINIALFITATITALVVVTVGTLPF  247



>ref|WP_037548531.1| iron ABC transporter permease [Staphylococcus haemolyticus]
 gb|KGF28635.1| iron ABC transporter permease [Staphylococcus haemolyticus DNF00585]
Length=322

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKIINI LFITA +TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIINIALFITAALTALVVVTVGTLPF  247



>ref|WP_011276422.1| MULTISPECIES: iron ABC transporter permease [Staphylococcus]
 ref|YP_254075.1| hypothetical protein SH2160 [Staphylococcus haemolyticus JCSC1435]
 dbj|BAE05469.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
 gb|EZI38254.1| iron ABC transporter permease [Staphylococcus haemolyticus]
 gb|KDP47398.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-98]
 gb|KGJ24997.1| iron ABC transporter permease [Staphylococcus haemolyticus]
 gb|KGJ29892.1| iron ABC transporter permease [Staphylococcus haemolyticus]
Length=322

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKIINI LFITA +TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIINIALFITAALTALVVVTVGTLPF  247



>ref|WP_002441487.1| iron ABC transporter permease [Staphylococcus caprae]
 gb|EES40894.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus caprae M23864:W1]
Length=324

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKIINI LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIINIALFITATLTALVVVTVGTLPF  247



>ref|WP_031837044.1| iron ABC transporter permease, partial [Staphylococcus aureus]
 gb|EUL22342.1| hypothetical protein O566_02422, partial [Staphylococcus aureus 
M0502]
Length=148

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  28   FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  72



>ref|WP_031857611.1| iron ABC transporter permease, partial [Staphylococcus aureus]
 gb|EVN19328.1| hypothetical protein O961_02458, partial [Staphylococcus aureus 
M0967]
Length=132

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  12   FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  56



>ref|WP_002490780.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EHR95992.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU128]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002459740.1| iron ABC transporter permease [Staphylococcus lugdunensis]
 ref|YP_003472314.1| iron ABC transporter permease [Staphylococcus lugdunensis HKU09-01]
 ref|YP_005761186.1| FecCD transport family protein [Staphylococcus lugdunensis N920143]
 gb|ADC88186.1| Uncharacterized iron compound ABC uptake transporter, permease 
protein [Staphylococcus lugdunensis HKU09-01]
 gb|EFU84370.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus lugdunensis M23590]
 emb|CCB54593.1| FecCD transport family protein [Staphylococcus lugdunensis N920143]
 gb|EHS05054.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus lugdunensis VCU139]
 gb|EKS21587.1| hypothetical protein HMPREF9308_02163 [Staphylococcus lugdunensis 
ACS-027-V-Sch2]
 gb|EVI47851.1| iron compound ABC transporter, permease [Staphylococcus lugdunensis 
UCIM6116]
 gb|KAK57028.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus lugdunensis VCU150]
 gb|KAK57549.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus lugdunensis VCU148]
Length=325

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGVNYE+I+ I LFITA+ITALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVNYEQIVRIALFITASITALVVVTVGTLPF  247



>ref|WP_002501120.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EJE16004.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM031]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITA +TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITAMLTALVVVTVGTLPF  247



>ref|WP_038812497.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|KEI47863.1| iron ABC transporter permease [Staphylococcus epidermidis UC7032]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002457601.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EFV89403.1| FecCD transport family protein [Staphylococcus epidermidis FRI909]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002445925.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EES36728.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis W23144]
 gb|EJD88740.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM061]
 gb|EJE05036.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM023]
 gb|EPP69391.1| iron ABC transporter permease [Staphylococcus epidermidis Scl22]
 gb|ESR04410.1| iron ABC transporter permease [Staphylococcus epidermidis CIM28]
 gb|ESR24339.1| iron ABC transporter permease [Staphylococcus epidermidis APO35]
 gb|ESU04179.1| iron ABC transporter permease [Staphylococcus epidermidis CIM37]
 gb|ESV09986.1| iron ABC transporter permease [Staphylococcus epidermidis MC28]
 gb|ESV15609.1| iron ABC transporter permease [Staphylococcus epidermidis WI05]
 gb|ESV19032.1| iron ABC transporter permease [Staphylococcus epidermidis WI09]
 gb|ESV24998.1| iron ABC transporter permease [Staphylococcus epidermidis CIM40]
 gb|ESV29656.1| iron ABC transporter permease [Staphylococcus epidermidis APO27]
 gb|ESV38280.1| iron ABC transporter permease [Staphylococcus epidermidis MC16]
 gb|ESV42357.1| iron ABC transporter permease [Staphylococcus epidermidis MC19]
 gb|ESV48235.1| iron ABC transporter permease [Staphylococcus epidermidis Scl19]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002476218.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EHM70981.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis 14.1.R1.SE]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002498607.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EJD98080.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM040]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002476424.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EJD81452.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM095]
 gb|EJD84433.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM087]
 gb|EKS40593.1| hypothetical protein HMPREF9281_00130 [Staphylococcus epidermidis 
BVS058A4]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002491228.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EHS02212.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU129]
 gb|EJD95953.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM053]
 gb|EJD97310.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM057]
 gb|EJE06703.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM037]
 gb|EJE18740.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM015]
 gb|EJE48048.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis NIH051475]
Length=324

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002486667.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EHR85742.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU118]
Length=324

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002487913.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EHR80303.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU120]
 gb|EJD83567.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM070]
 gb|EJE09994.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM020]
 gb|EJE17610.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM018]
 gb|EJE21272.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM008]
 gb|EJE24151.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM001]
 gb|EJE26329.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM003]
 gb|EJE41835.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis NIH05003]
 gb|ETJ12869.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus sp. DORA_6_22]
 gb|KDP66070.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU036]
 gb|KDP69339.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU013]
 gb|KEA36320.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|AIR82140.1| fecCD transport family protein [Staphylococcus epidermidis]
Length=324

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002473962.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EHM68137.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU071]
Length=324

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_001829651.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EHR96899.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU127]
 gb|EID37835.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis IS-250]
 gb|EID39486.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis IS-K]
 gb|EJE08000.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM021]
 gb|KDP68104.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU111]
Length=324

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002438902.1| MULTISPECIES: iron ABC transporter permease [Staphylococcus]
 ref|NP_764070.1| ferrichrome ABC transporter permease [Staphylococcus epidermidis 
ATCC 12228]
 ref|YP_187993.1| iron ABC transporter permease [Staphylococcus epidermidis RP62A]
 gb|AAO04112.1|AE016745_211 ferrichrome ABC transporter permease [Staphylococcus epidermidis 
ATCC 12228]
 gb|AAW53789.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis RP62A]
 gb|EES58876.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis BCM-HMP0060]
 gb|EFA88236.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis SK135]
 gb|EFE58035.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis M23864:W2(grey)]
 gb|EGG73110.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU028]
 gb|EGG74199.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU045]
 gb|EGS74905.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU037]
 gb|EGS76016.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU105]
 gb|EGS77085.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU109]
 gb|EHQ72439.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU057]
 gb|EHQ75763.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU041]
 gb|EHQ78817.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU081]
 gb|EHQ80650.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU065]
 gb|EHR88064.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU117]
 gb|EHR90274.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU123]
 gb|EHR91126.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU125]
 gb|EHR98822.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU126]
 gb|EJD78740.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM088]
 gb|EJD88896.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM067]
 gb|EJD95204.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM049]
 gb|EJE00539.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIHLM039]
 gb|EJE29274.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIH05005]
 gb|EJE30649.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIH05001]
 gb|EJE32747.1| iron compound ABC transporter, permease protein [Staphylococcus 
epidermidis NIH04008]
 gb|EJE33294.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis NIH08001]
 gb|EJE37541.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis NIH06004]
 gb|EJE43180.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis NIH04003]
 gb|EJE46319.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis NIH051668]
 gb|EKC83119.1| iron ABC transporter permease [Staphylococcus epidermidis AU12-03]
 gb|ENL53421.1| iron compound ABC transporter, permease [Staphylococcus epidermidis 
M0881]
 gb|EON81911.1| iron ABC transporter permease [Staphylococcus epidermidis 41tr]
 gb|EON83388.1| iron ABC transporter permease [Staphylococcus epidermidis 528m]
 gb|EON86329.1| iron ABC transporter permease [Staphylococcus epidermidis 36-1]
 gb|EST94266.1| iron ABC transporter permease [Staphylococcus epidermidis Scl31]
 gb|EST98215.1| iron ABC transporter permease [Staphylococcus epidermidis Scl25]
 gb|EUR97794.1| iron compound ABC transporter, permease [Staphylococcus epidermidis 
M0026]
 gb|EZI13685.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU014]
 gb|EZI14910.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU050]
 gb|KEA32707.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|KEA37097.1| iron ABC transporter permease [Staphylococcus epidermidis]
 emb|CDM12995.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
epidermidis PM221]
 gb|KGJ26481.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|KGY35847.1| iron ABC transporter permease [Staphylococcus epidermidis]
Length=324

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_021299002.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis]
 gb|EPZ39963.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis E13A]
Length=324

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_018113782.1| iron ABC transporter permease [Staphylococcus sp. JGI 0001002-I23]
Length=324

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_017464606.1| iron ABC transporter permease [Staphylococcus epidermidis]
Length=324

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_002468667.1| iron ABC transporter permease [Staphylococcus epidermidis]
 gb|EGG59776.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus epidermidis VCU144]
Length=324

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV+YEKII I LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVSYEKIIKIALFITATLTALVVVTVGTLPF  247



>ref|WP_031825428.1| iron ABC transporter permease, partial [Staphylococcus aureus]
 gb|EUZ70809.1| iron compound ABC transporter, permease, partial [Staphylococcus 
aureus M0481]
Length=198

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  78   FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  122



>ref|WP_031893034.1| iron ABC transporter permease, partial [Staphylococcus aureus]
Length=274

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  187  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  231



>ref|WP_016426110.1| hypothetical protein [Staphylococcus sp. HGB0015]
 gb|EPD49119.1| hypothetical protein HMPREF1208_01896 [Staphylococcus sp. HGB0015]
Length=322

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NYE I+NIGLFITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGRDFSKNLGLNYEWIMNIGLFITATMTALVVVTVGTLPF  247



>ref|WP_031863325.1| iron ABC transporter permease, partial [Staphylococcus aureus]
Length=218

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLF  57
            FTI GMGKDF+NNLG++YEK+INI LF
Sbjct  187  FTIVGMGKDFTNNLGLSYEKLINIALF  213



>gb|EZH92152.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21275]
Length=282

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031826093.1| iron ABC transporter permease, partial [Staphylococcus aureus]
 gb|EVM98939.1| iron compound ABC transporter, permease, partial [Staphylococcus 
aureus M0955]
Length=272

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  152  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  196



>gb|EVQ97318.1| iron compound ABC transporter, permease, partial [Staphylococcus 
aureus M1428]
Length=304

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EHT85799.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIGC341D]
 gb|EOR42824.1| hypothetical protein S122051_0820 [Staphylococcus aureus subsp. 
aureus 122051]
 gb|EOR49456.1| hypothetical protein M140OLGA_0376 [Staphylococcus aureus subsp. 
aureus 112808A]
 emb|CEH25446.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus]
Length=270

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  150  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  194



>gb|EGA96651.1| FecCD family ferrichrome transporter permease [Staphylococcus 
aureus O11]
Length=307

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  187  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  231



>gb|EOR36758.1| iron compound ABC transporter, permease [Staphylococcus aureus 
subsp. aureus 103564]
Length=307

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  187  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  231



>ref|WP_031893029.1| iron ABC transporter permease, partial [Staphylococcus aureus]
 gb|EVQ97341.1| iron compound ABC transporter, permease, partial [Staphylococcus 
aureus M1428]
Length=273

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  153  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  197



>ref|WP_031833969.1| iron ABC transporter permease, partial [Staphylococcus aureus]
Length=303

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  187  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  231



>ref|WP_037575933.1| iron ABC transporter permease [Staphylococcus chromogenes]
 gb|KDP12345.1| cobalamin Fe3+-siderophores ABC transporter permease [Staphylococcus 
chromogenes MU 970]
Length=322

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLGVNY+ I+NIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGRDFSKNLGVNYDVIMNIGLFITATITALVVVTVGTLPF  247



>gb|KEK35188.1| fecCD transport family protein [Staphylococcus aureus Lyso 1 
2010]
Length=254

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  134  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  178



>gb|EJE56513.1| FecCD family ferrichrome transporter permease [Staphylococcus 
aureus subsp. aureus str. Newbould 305]
Length=307

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  187  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  231



>ref|WP_031904856.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|KEK33043.1| fecCD transport family protein [Staphylococcus aureus LysK 1 
2010]
Length=302

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  182  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  226



>gb|EHT90266.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIGC345D]
Length=307

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  187  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  231



>gb|EGA99504.1| FecCD family ferrichrome transporter permease [Staphylococcus 
aureus O46]
 gb|EOR31717.1| iron compound ABC transporter, permease [Staphylococcus aureus 
subsp. aureus 091751]
 gb|EOR39760.1| iron compound ABC transporter, permease [Staphylococcus aureus 
subsp. aureus MRGR3]
Length=307

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  187  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  231



>ref|WP_001821572.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EHT90944.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIGC348]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876320.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EEV73396.1| Iron ABC transporter membrane protein [Staphylococcus aureus 
A9299]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_039644025.1| iron ABC transporter permease [Staphylococcus hyicus]
 gb|AJC95205.1| iron ABC transporter permease [Staphylococcus hyicus]
Length=321

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY+ IINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGRDFSKNLGLNYDVIINIGLFITATITALVVVTVGTLPF  247



>ref|WP_031898955.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031807459.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_014532744.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_005738846.1| iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus JKD6159]
 gb|ADL22636.1| iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus JKD6159]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031879994.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876316.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876317.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_005297166.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus M013]
 ref|YP_008584786.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus SA957]
 ref|YP_008587318.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus SA40]
 gb|AEV77791.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus M013]
 gb|AGW33187.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus SA957]
 gb|AGW35719.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus SA40]
 gb|AII55252.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus SA268]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031871507.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031775063.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031862695.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EWJ61483.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H12893]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876319.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_005757231.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
11819-97]
 gb|AEW64799.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
11819-97]
 gb|EHO97531.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21333]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_025786878.1| iron ABC transporter permease [Staphylococcus aureus]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|KAH22244.1| hypothetical protein W691_00860 [Staphylococcus aureus VET1831R]
Length=314

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  194  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  238



>ref|WP_031929878.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031793685.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031789717.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031773805.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>emb|CAA06497.1| membrane protein [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876318.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|NP_371257.1| ferrichrome ABC transporter permease [Staphylococcus aureus subsp. 
aureus Mu50]
 ref|NP_373943.1| hypothetical protein SA0688 [Staphylococcus aureus subsp. aureus 
N315]
 ref|NP_645512.1| hypothetical protein MW0695 [Staphylococcus aureus subsp. aureus 
MW2]
 ref|YP_042826.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus MSSA476]
 ref|YP_185670.1| iron compound ABC transporter permease [Staphylococcus aureus 
subsp. aureus COL]
 ref|YP_493421.1| iron compound ABC transporter permease [Staphylococcus aureus 
subsp. aureus USA300_FPR3757]
 ref|YP_499306.1| hypothetical protein SAOUHSC_00746 [Staphylococcus aureus subsp. 
aureus NCTC 8325]
 ref|YP_001246136.1| transport system permease protein [Staphylococcus aureus subsp. 
aureus JH9]
 ref|YP_001315917.1| transport system permease protein [Staphylococcus aureus subsp. 
aureus JH1]
 ref|YP_001331736.1| ferrichrome ABC transporter permease [Staphylococcus aureus subsp. 
aureus str. Newman]
 ref|YP_001441320.1| hypothetical protein SAHV_0730 [Staphylococcus aureus subsp. 
aureus Mu3]
 ref|YP_003281622.1| iron compound ABC transporter, permease protein [Staphylococcus 
aureus subsp. aureus ED98]
 ref|YP_005290257.1| iron (Fe+3) ABC transporter membrane protein [Staphylococcus 
aureus subsp. aureus VC40]
 ref|YP_005736268.1| iron compound ABC transporter permease [Staphylococcus aureus 
subsp. aureus ED133]
 ref|YP_005752033.1| Transport system permease protein [Staphylococcus aureus subsp. 
aureus T0131]
 ref|YP_005730820.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus TW20]
 ref|YP_005741460.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus 04-02981]
 ref|YP_005754666.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus LGA251]
 ref|YP_007867802.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus M1]
 ref|YP_008484739.1| iron compound ABC transporter, permease protein, putative [Staphylococcus 
aureus subsp. aureus 6850]
 ref|YP_008715330.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus Z172]
 dbj|BAB41921.1| SA0688 [Staphylococcus aureus subsp. aureus N315]
 dbj|BAB56895.1| ferrichrome ABC transporter permease [Staphylococcus aureus subsp. 
aureus Mu50]
 dbj|BAB94560.1| MW0695 [Staphylococcus aureus subsp. aureus MW2]
 emb|CAG42474.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus MSSA476]
 gb|AAW37851.1| iron compound ABC transporter, permease protein [Staphylococcus 
aureus subsp. aureus COL]
 gb|ABD21862.1| iron compound ABC transporter, permease [Staphylococcus aureus 
subsp. aureus USA300_FPR3757]
 gb|ABD29879.1| conserved hypothetical protein [Staphylococcus aureus subsp. 
aureus NCTC 8325]
 gb|ABQ48560.1| transport system permease protein [Staphylococcus aureus subsp. 
aureus JH9]
 gb|ABR51630.1| transport system permease protein [Staphylococcus aureus subsp. 
aureus JH1]
 dbj|BAF66974.1| ferrichrome ABC transporter permease [Staphylococcus aureus subsp. 
aureus str. Newman]
 dbj|BAF77613.1| hypothetical protein SAHV_0730 [Staphylococcus aureus subsp. 
aureus Mu3]
 gb|EEV27258.1| ABC iron transporter membrane protein [Staphylococcus aureus 
A9781]
 gb|EEV63534.1| ABC iron transporter membrane protein [Staphylococcus aureus 
A9763]
 gb|EEV66909.1| iron ABC transporter membrane protein [Staphylococcus aureus 
A9719]
 gb|EEV76150.1| Iron ABC transporter membrane protein [Staphylococcus aureus 
A8115]
 gb|EEV78319.1| iron ABC transporter membrane protein [Staphylococcus aureus 
A6300]
 gb|EEV80023.1| iron ABC transporter membrane protein [Staphylococcus aureus 
A6224]
 gb|EEV82306.1| iron compound ABC transporter [Staphylococcus aureus A5948]
 gb|EEV86637.1| iron compound ABC transporter [Staphylococcus aureus A5937]
 gb|EEW44801.1| hypothetical protein SA930_1046 [Staphylococcus aureus 930918-3]
 gb|EEW46925.1| hypothetical protein SAD30_0939 [Staphylococcus aureus D30]
 gb|ACY10616.1| iron compound ABC transporter, permease protein [Staphylococcus 
aureus subsp. aureus ED98]
 emb|CBI48687.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus TW20]
 gb|EFB96564.1| iron complex transport system permease [Staphylococcus aureus 
A10102]
 gb|EFB98680.1| iron complex transport system permease [Staphylococcus aureus 
A9765]
 gb|EFC03346.1| iron complex transport system permease [Staphylococcus aureus 
A8117]
 gb|ADC36922.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus 04-02981]
 gb|ADI97287.1| iron compound ABC transporter, permease protein [Staphylococcus 
aureus subsp. aureus ED133]
 gb|EFT85409.1| iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus CGS03]
 gb|EFU26758.1| iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus CGS01]
 gb|AEB87867.1| Transport system permease protein [Staphylococcus aureus subsp. 
aureus T0131]
 gb|EGG60336.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21189]
 gb|EGG61051.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21172]
 gb|EGG66075.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21193]
 gb|EGL88365.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21305]
 gb|EGL92820.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21318]
 gb|EGS81911.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21235]
 gb|EGS84155.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21259]
 gb|EGS84635.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21266]
 gb|EGS98619.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21201]
 emb|CCC87434.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus LGA251]
 gb|EHM58842.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21178]
 gb|EHM60552.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21209]
 gb|EHM65088.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus VCU006]
 gb|EHM83891.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21232]
 gb|EHM84485.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21340]
 gb|EHO94920.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21262]
 gb|EHO98549.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21272]
 gb|EHP02434.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21283]
 gb|AEZ36823.1| iron (Fe+3) ABC transporter membrane protein [Staphylococcus 
aureus subsp. aureus VC40]
 gb|EHQ64785.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21343]
 gb|EHS10134.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-99]
 gb|EHS11092.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-3]
 gb|EHS13682.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-24]
 gb|EHS18087.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-88]
 gb|EHS19285.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-55]
 gb|EHS20212.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-91]
 gb|EHS29479.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-111]
 gb|EHS32686.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-122]
 gb|EHS73595.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-125]
 gb|EHS79895.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-189]
 gb|EHS81195.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-157]
 gb|EHS81291.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-160]
 gb|EHT20643.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1165]
 gb|EHT21015.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1114]
 gb|EHT22885.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1057]
 gb|EHT40215.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1769]
 gb|EHT40815.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1750]
 gb|EHT43595.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1835]
 gb|EHT46870.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1096]
 gb|EHT48903.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG547]
 gb|EHT51429.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1150]
 gb|EHT56925.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1213]
 gb|EHT61977.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1612]
 gb|EHT66008.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1770]
 gb|EHT70237.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG2018]
 gb|EHT81313.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIGC340D]
 gb|EHT95203.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIGC128]
 gb|EHT95848.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIGC93]
 gb|EID41328.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-M]
 gb|EID86812.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-23]
 gb|EIK10064.1| hypothetical protein MQA_01755 [Staphylococcus aureus subsp. 
aureus VRS1]
 gb|EIK24636.1| iron compound ABC transporter, permease iron complex transport 
system [Staphylococcus aureus subsp. aureus VRS8]
 gb|EKU09513.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus CN79]
 gb|ELP28595.1| iron (Fe+3) ABC transporter membrane protein [Staphylococcus 
aureus subsp. aureus DSM 20231]
 gb|ELP42471.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21282]
 gb|ELS63972.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21196]
 gb|ELS65978.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21236]
 gb|ENI71040.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0055]
 gb|ENJ69206.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0329]
 gb|ENK18977.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0438]
 gb|ENK33222.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0478]
 gb|ENK44393.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0510]
 gb|ENM91250.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1367]
 gb|ENN38648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1565]
 emb|CCW21067.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus M1]
 gb|EOR90538.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus CBD-635]
 gb|EPR24372.1| iron ABC transporter permease [Staphylococcus aureus SA_ST125_MupR]
 gb|ERE93600.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-08]
 gb|AGU54546.1| iron compound ABC transporter, permease protein, putative [Staphylococcus 
aureus subsp. aureus 6850]
 gb|AGY88845.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus Z172]
 gb|ETO53209.1| iron ABC transporter permease [Staphylococcus aureus MUM475]
 gb|EUE94490.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0698]
 gb|EUF42206.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0727]
 gb|EUF72495.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0635]
 gb|EUK55712.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0248]
 gb|EUL12477.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0488]
 gb|EUO25871.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1051]
 gb|EUO82295.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1404]
 gb|EUO94732.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1357]
 gb|EUP13042.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1527]
 gb|EUP74306.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6117]
 gb|EUP96226.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6084]
 gb|EUQ67264.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6003]
 gb|EUQ74978.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6030]
 gb|EUQ80274.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6047]
 gb|EUR10990.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6015]
 gb|EUR34126.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6061]
 gb|EUU73031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0172]
 gb|EUW13260.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0254]
 gb|EUX63382.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0348]
 gb|EUY02496.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0376]
 gb|EUZ05585.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0439]
 gb|EVC19364.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6050]
 gb|EVC46440.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6072]
 gb|EVC77796.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6057]
 gb|EVC91149.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6013]
 gb|EVD90097.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6002]
 gb|EVE12150.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6004]
 gb|EVE73136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0011]
 gb|EVF04349.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6004]
 gb|EVF16796.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6025]
 gb|EVF56495.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6042]
 gb|EVF75616.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6011]
 gb|EVH71052.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC6084]
 gb|EVI19696.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6104]
 gb|EVI58507.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6102]
 gb|EVJ79806.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6048]
 gb|EVK09580.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0782]
 gb|EVK80236.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0818]
 gb|EVQ31575.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1392]
 gb|EVQ73963.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1414]
 gb|EVQ81670.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1417]
 gb|EVR42608.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1445]
 gb|EVR48580.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1447]
 gb|EVR50738.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1448]
 gb|EVR58544.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1453]
 gb|EVS83712.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1501]
 gb|EVU34608.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M81493]
 gb|EVU47301.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F41882]
 gb|EVU68978.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H83536]
 gb|EVU75119.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F48584]
 gb|EVV09670.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M41648]
 gb|EVV13977.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F54452]
 gb|EVW37129.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W39902]
 gb|EVX08233.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M20916]
 gb|EVX27157.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M24390]
 gb|EVX62428.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T78544]
 gb|EVX75357.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F68118]
 gb|EVX80567.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M36077]
 gb|EVY12150.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H45760]
 gb|EVY49673.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H54403]
 gb|EVY79744.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W20433]
 gb|EVZ06597.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F74023]
 gb|EVZ74315.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H27862]
 gb|EVZ75837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H27872]
 gb|EWA14127.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H67656]
 gb|EWA18559.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H70826]
 gb|EWA99374.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T76018]
 gb|EWB19802.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W12628]
 gb|EWB36655.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W21945]
 gb|EWC12378.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F86379]
 gb|EWC17466.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F27254]
 gb|EWC20895.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M44988]
 gb|AHJ06543.1| iron ABC transporter permease [Staphylococcus aureus USA300-ISMMS1]
 gb|EWH44466.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W39826]
 gb|EWI09957.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M46058]
 gb|EWI50856.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W29651]
 gb|EWJ05236.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M91155]
 gb|EWJ15440.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M77229]
 gb|EWJ47027.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H87628]
 gb|EWJ52435.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H84980]
 gb|EWK04918.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75539]
 gb|EWK09207.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75113]
 gb|EWK44349.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T34011]
 gb|EWK51975.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T17131]
 gb|EWK53043.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T17141]
 gb|EWL12675.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H68244]
 gb|EWL15486.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H64967]
 gb|EWL74859.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F29982]
 gb|EWO50355.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1283]
 gb|EWQ06974.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1195]
 gb|EWR06872.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1129]
 gb|EWR56913.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6115]
 gb|EWS17214.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LPIH6008]
 gb|EWT40457.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F70051]
 gb|EWT46681.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M39260]
 gb|EWT68852.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W70659]
 gb|EWU17938.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T18851]
 gb|EWV98628.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M35933]
 gb|EWW20464.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F73187]
 gb|EWW73725.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M42514]
 gb|EWW75699.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H47171]
 gb|EWW84315.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M42518]
 gb|EWX27251.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F85711]
 gb|EWY10711.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T32070]
 gb|EWY31307.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W83137]
 gb|EXM96386.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5801]
 gb|EXP56336.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W12583]
 gb|EXQ50312.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F64894]
 gb|EXQ51250.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F36099]
 gb|EXQ56282.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F36097]
 gb|EXQ70517.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F23613]
 gb|EXQ71136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F23610]
 gb|EYG04600.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F32629]
 gb|EYG29802.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H19404]
 gb|EYG60196.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W19225]
 gb|EYG81115.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F34824]
 gb|EYH04114.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79654]
 gb|EYH27572.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F64891]
 gb|EYJ31247.1| iron compound ABC transporter, permease [Staphylococcus aureus 
S29036]
 gb|EYJ85022.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H43700]
 gb|EYJ93850.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H88149]
 gb|EYJ99364.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13074]
 gb|EYK29477.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79673]
 gb|EYL04880.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W45747]
 gb|EYL49858.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H20321]
 gb|EYM33889.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W34841]
 gb|EYM69936.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3518]
 gb|EYO16216.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3847]
 gb|EYO16784.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3859]
 gb|EYO68700.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3919]
 gb|EYP00309.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1065]
 gb|AHW67310.1| fecCD transport family protein [Staphylococcus aureus]
 gb|EZH87498.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21267]
 gb|EZH92261.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21239]
 gb|EZH97670.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21304]
 gb|EZI00815.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21311]
 gb|EZI04405.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21338]
 gb|EZI14707.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-30]
 gb|EZI19740.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-41]
 gb|EZI20005.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-85]
 gb|EZI21871.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-49]
 gb|KAK58570.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21205]
 emb|CDP42654.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus]
 emb|CDP47180.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus]
 emb|CDP56373.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus]
 emb|CDP59600.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus]
 gb|KDP48907.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-99]
 gb|KDP55756.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-86]
 gb|KDP59011.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21321]
 gb|AID39241.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus]
 gb|KEK36635.1| fecCD transport family protein [Staphylococcus aureus Lyso 2 
2010]
 gb|KEK41218.1| fecCD transport family protein [Staphylococcus aureus LysK 2 
2010]
 gb|KEK43516.1| fecCD transport family protein [Staphylococcus aureus 1101-2 
2010]
 gb|KEK45034.1| fecCD transport family protein [Staphylococcus aureus 1101-1 
2010]
 gb|KEK50526.1| fecCD transport family protein [Staphylococcus aureus 1801-2 
2010]
 gb|KEK55246.1| fecCD transport family protein [Staphylococcus aureus 1801-1 
2010]
 gb|KEK57675.1| fecCD transport family protein [Staphylococcus aureus LysK 1 
2011]
 gb|KEK62664.1| fecCD transport family protein [Staphylococcus aureus LysK 2 
2011]
 gb|KEK63469.1| fecCD transport family protein [Staphylococcus aureus 1101-1 
2011]
 gb|KEK66631.1| fecCD transport family protein [Staphylococcus aureus 1101-2 
2011]
 gb|KEK70357.1| fecCD transport family protein [Staphylococcus aureus 1801-1 
2011]
 gb|KEK71589.1| fecCD transport family protein [Staphylococcus aureus 1801-2 
2011]
 emb|CDP41876.1| Iron compound ABC uptake transporter permease protein [Staphylococcus 
aureus subsp. aureus]
 gb|KFA44088.1| fecCD transport family protein [Staphylococcus aureus]
 gb|KFB79058.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CO-06]
 gb|KFL08685.1| fecCD transport family protein [Staphylococcus aureus]
 gb|AJC30146.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|AJC32990.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|AJC35833.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|AJC38679.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|AJC41523.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|AJC44367.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|EUJ52119.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR948]
 gb|EYP64326.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1311]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_031879751.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_011382221.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_416179.1| FecCD family ferrichrome transporter permease [Staphylococcus 
aureus RF122]
 emb|CAI80373.1| FecCD family ferrichrome transporter permease [Staphylococcus 
aureus RF122]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031897293.1| iron ABC transporter permease, partial [Staphylococcus aureus]
 gb|EYJ08655.1| iron compound ABC transporter, permease, partial [Staphylococcus 
aureus M32567]
Length=311

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  191  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  235



>ref|WP_031860544.1| iron ABC transporter permease [Staphylococcus aureus]
Length=324

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031927547.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|KDP61133.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21320]
Length=322

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|EGS87750.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21269]
 gb|EZI09788.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21337]
Length=322

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031766309.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|EZT89469.1| hypothetical protein U927_00139 [Staphylococcus aureus 12S00972]
 gb|EZT94158.1| hypothetical protein U922_00561 [Staphylococcus aureus 11S01420]
 gb|EZU13820.1| hypothetical protein U911_00426 [Staphylococcus aureus 07-03451]
 gb|EZU21257.1| hypothetical protein U910_00680 [Staphylococcus aureus 07-03450]
 gb|EZU29424.1| hypothetical protein U908_00389 [Staphylococcus aureus 08-02906]
 gb|EZU66557.1| hypothetical protein U985_00550 [Staphylococcus aureus 1110803248]
 gb|EZU70360.1| hypothetical protein U989_02168 [Staphylococcus aureus 1111000177]
 gb|EZU70854.1| hypothetical protein U988_00461 [Staphylococcus aureus 1111000175]
 gb|EZU72772.1| hypothetical protein U991_01676 [Staphylococcus aureus 1111100370]
 gb|EZV00060.1| hypothetical protein U919_01027 [Staphylococcus aureus 11S00605]
 gb|EZV05729.1| hypothetical protein U921_00811 [Staphylococcus aureus 11S01415]
 gb|EZV07922.1| hypothetical protein U914_01175 [Staphylococcus aureus 12-03481]
 gb|EZV16596.1| hypothetical protein U924_00738 [Staphylococcus aureus 12S00040]
 gb|EZV29058.1| hypothetical protein U930_00911 [Staphylococcus aureus 12-ST01564]
 gb|EZV35250.1| hypothetical protein U932_00869 [Staphylococcus aureus 13-ST00049]
 gb|EZW81722.1| hypothetical protein U887_01013 [Staphylococcus aureus 7-B-1]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EWA78237.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T42722]
 gb|EWK48872.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T20118]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EVF90053.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6020]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_031887814.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031772503.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031914374.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EZR59246.1| hypothetical protein W720_00933 [Staphylococcus aureus VET1869R]
 gb|KAB70655.1| hypothetical protein W475_00783 [Staphylococcus aureus VET0166R]
 gb|KAE47661.1| hypothetical protein W616_01385 [Staphylococcus aureus VET0373R]
 gb|KAE51432.1| hypothetical protein W617_01253 [Staphylococcus aureus VET0376R]
 gb|KAG01523.1| hypothetical protein W686_00983 [Staphylococcus aureus VET0485R]
 gb|KAH87035.1| hypothetical protein W719_00980 [Staphylococcus aureus VET1868R]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876321.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EVE28573.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6016]
 gb|EWK03837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75119]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|EYQ96590.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3156]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EYN07577.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3581]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|ENN63625.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1216]
 gb|EWP74650.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1217]
Length=338

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_031906153.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|KAG95325.1| hypothetical protein W793_00442 [Staphylococcus aureus VET1518S]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|ENI50717.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HIF003_B2N-C]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>emb|CDR54751.1| FatD [Staphylococcus aureus]
 emb|CDR51591.1| FatD [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>emb|CDR57971.1| FatD [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_033856946.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EZY47465.1| hypothetical protein V052_01235 [Staphylococcus aureus MSSA-93]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876309.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_008448663.1| iron ABC superfamily ATP binding cassette transporter [Staphylococcus 
aureus subsp. aureus 55/2053]
 gb|EEV04546.1| iron ABC superfamily ATP binding cassette transporter [Staphylococcus 
aureus subsp. aureus 55/2053]
 gb|EEV07187.1| FecCD transporter [Staphylococcus aureus subsp. aureus 65-1322]
 gb|EEV09950.1| FecCD transporter [Staphylococcus aureus subsp. aureus 68-397]
 gb|EEV12403.1| FecCD transporter [Staphylococcus aureus subsp. aureus E1410]
 gb|EEV15067.1| FecCD transporter [Staphylococcus aureus subsp. aureus M876]
 gb|EFB44750.1| iron complex transport system permease [Staphylococcus aureus 
subsp. aureus C101]
 gb|EFB52927.1| enterochelin ABC transporter, permease protein [Staphylococcus 
aureus subsp. aureus M899]
 gb|EFD98176.1| enterochelin ABC transporter, permease protein [Staphylococcus 
aureus subsp. aureus M1015]
 gb|EFE25884.1| iron complex transport system permease [Staphylococcus aureus 
subsp. aureus 58-424]
 gb|EFF10178.1| FecCD transporter [Staphylococcus aureus subsp. aureus M809]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|EWA48631.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M59498]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EVY58900.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T16281]
 gb|EWB27541.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W16013]
 gb|EWK71783.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M70099]
 gb|EWL07257.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H68256]
 gb|EYL41942.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F56969]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EVG60684.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6067]
 gb|EVG62324.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6066]
 gb|EVI13374.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6095]
 gb|EVX46323.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F70893]
 gb|EVX67176.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77047]
 gb|EVZ16518.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H48052]
 gb|EVZ16642.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H48054]
 gb|EWB31629.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W21932]
 gb|EWL66321.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77917]
 gb|EWX01575.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H81433]
 gb|EWY20166.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W73738]
 gb|EXP40174.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W25797]
 gb|EYF21318.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F19490]
 gb|EYH42089.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W25799]
 gb|EYK02662.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M17033]
 gb|EYL89094.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M64056]
 gb|EYM16777.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T63897]
 gb|EYM20791.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T63898]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EVQ19696.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1382]
 gb|KAJ46715.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus 880]
 gb|KIE14751.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus 917]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EYP08653.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1067]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EUI35323.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1131]
 gb|EVO28773.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1043]
 gb|EVO30348.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1045]
 gb|EWP67026.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1219]
 gb|EWQ28699.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1172]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|ENI87296.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0108]
 gb|EPX93488.1| iron ABC transporter permease [Staphylococcus aureus SA16]
 gb|EYO07769.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3840]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_000605325.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_001574659.1| iron (Fe+3) ABC transporter membrane protein [Staphylococcus 
aureus subsp. aureus USA300_TCH1516]
 ref|YP_005744121.1| iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus str. 
JKD6008]
 ref|YP_007577176.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 ref|YP_007579185.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 ref|YP_007581148.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 ref|YP_007583163.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 ref|YP_007585129.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 ref|YP_007618893.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 ref|YP_007620877.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 ref|YP_007622866.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 ref|YP_008167896.1| iron complex transport system permease protein [Staphylococcus 
aureus Bmb9393]
 ref|YP_008490923.1| Ferric anguibactin transport system permease protein fatD [Staphylococcus 
aureus subsp. aureus CN1]
 gb|ABX28780.1| iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gb|EES93615.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus USA300_TCH959]
 gb|EES97913.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus TCH130]
 gb|EFG39039.1| iron complex transport system permease [Staphylococcus aureus 
A9754]
 gb|EFG44623.1| iron complex transport system permease [Staphylococcus aureus 
A8819]
 gb|EFH25699.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus ATCC 51811]
 gb|EFH37101.1| iron complex transport system permease [Staphylococcus aureus 
A8796]
 gb|EFK82080.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus TCH70]
 gb|ADL64807.1| iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus str. 
JKD6008]
 gb|EFM05696.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gb|EFW31796.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus MRSA131]
 gb|EFW33804.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus MRSA177]
 gb|EHM76295.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21334]
 gb|EIK08127.1| hypothetical protein MQE_02089 [Staphylococcus aureus subsp. 
aureus VRS3a]
 gb|EIK08375.1| hypothetical protein MQC_01105 [Staphylococcus aureus subsp. 
aureus VRS2]
 gb|EIK14403.1| hypothetical protein MQG_01962 [Staphylococcus aureus subsp. 
aureus VRS4]
 gb|EIK16530.1| iron ABC transporter membrane protein [Staphylococcus aureus 
subsp. aureus VRS5]
 gb|EIK18680.1| iron ABC transporter membrane protein [Staphylococcus aureus 
subsp. aureus VRS6]
 gb|EIK25821.1| iron ABC transporter membrane protein [Staphylococcus aureus 
subsp. aureus VRS9]
 gb|EIK26254.1| hypothetical protein MQM_01445 [Staphylococcus aureus subsp. 
aureus VRS7]
 gb|EIK33053.1| iron ABC transporter membrane protein [Staphylococcus aureus 
subsp. aureus VRS10]
 gb|EIK33863.1| iron ABC transporter membrane protein [Staphylococcus aureus 
subsp. aureus VRS11a]
 gb|EIK35352.1| iron ABC transporter membrane protein [Staphylococcus aureus 
subsp. aureus VRS11b]
 emb|CCJ10534.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 emb|CCJ12500.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 emb|CCJ14464.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 emb|CCJ26253.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 emb|CCJ18391.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 emb|CCJ20355.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 emb|CCJ22321.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 emb|CCJ24289.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus ST228]
 gb|ELY15633.1| iron (Fe+3) ABC transporter membrane protein [Staphylococcus 
aureus KT/314250]
 gb|ELY18524.1| iron (Fe+3) ABC transporter membrane protein [Staphylococcus 
aureus KT/Y21]
 gb|EMS37734.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus KLT6]
 gb|EMY92007.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0075]
 gb|EMY94782.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0294]
 gb|EMY95070.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1060]
 gb|EMZ01866.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1193]
 gb|EMZ06515.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1078]
 gb|EMZ08079.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1407]
 gb|EMZ13347.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1466]
 gb|ENI18603.1| iron compound ABC transporter, permease [Staphylococcus aureus 
B40723]
 gb|ENI18889.1| iron compound ABC transporter, permease [Staphylococcus aureus 
B40950]
 gb|ENI21452.1| iron compound ABC transporter, permease [Staphylococcus aureus 
B147830]
 gb|ENI25077.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI010]
 gb|ENI26461.1| iron compound ABC transporter, permease [Staphylococcus aureus 
B53639]
 gb|ENI28816.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI010B]
 gb|ENI32974.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI013]
 gb|ENI34227.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI022]
 gb|ENI36968.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI049B]
 gb|ENI39900.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI049C]
 gb|ENI42136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI111]
 gb|ENI44800.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI049]
 gb|ENI49473.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HI168]
 gb|ENI53611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0001]
 gb|ENI57278.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0006]
 gb|ENI62225.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0035]
 gb|ENI63361.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0045]
 gb|ENI70759.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0060]
 gb|ENI71173.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0066]
 gb|ENI75793.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0102]
 gb|ENI78357.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0077]
 gb|ENI79295.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0103]
 gb|ENI83583.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0104]
 gb|ENI85383.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0144]
 gb|ENI93169.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0154]
 gb|ENI95253.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0150]
 gb|ENI95823.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0171]
 gb|ENI99678.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0173]
 gb|ENJ04472.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0192]
 gb|ENJ05167.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0177]
 gb|ENJ07880.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0210]
 gb|ENJ09917.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0197]
 gb|ENJ13291.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0200]
 gb|ENJ17142.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0212]
 gb|ENJ17807.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0213]
 gb|ENJ21556.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0216]
 gb|ENJ22889.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0221]
 gb|ENJ26889.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0235]
 gb|ENJ28624.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0237]
 gb|ENJ31928.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0250]
 gb|ENJ37226.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0252]
 gb|ENJ38919.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0240]
 gb|ENJ39208.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0239]
 gb|ENJ43577.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0273]
 gb|ENJ45668.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0279]
 gb|ENJ46237.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0270]
 gb|ENJ48404.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0280]
 gb|ENJ52444.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0306]
 gb|ENJ57747.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0288]
 gb|ENJ62191.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0312]
 gb|ENJ63062.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0326]
 gb|ENJ67134.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0330]
 gb|ENJ67874.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0328]
 gb|ENJ74565.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0340]
 gb|ENJ75049.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0347]
 gb|ENJ75469.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0334]
 gb|ENJ80862.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0351]
 gb|ENJ83489.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0350]
 gb|ENJ83850.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0363]
 gb|ENJ88341.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0374]
 gb|ENJ89616.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0364]
 gb|ENJ89816.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0367]
 gb|ENJ97043.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0375]
 gb|ENJ98200.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0391]
 gb|ENK02974.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0396]
 gb|ENK04856.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0404]
 gb|ENK10491.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0424]
 gb|ENK10724.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0415]
 gb|ENK12624.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0427]
 gb|ENK22353.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0455]
 gb|ENK23759.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0450]
 gb|ENK25252.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0467]
 gb|ENK30229.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0460]
 gb|ENK34837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0468]
 gb|ENK36380.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0493]
 gb|ENK43452.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0494]
 gb|ENK44088.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0489]
 gb|ENK49810.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0528]
 gb|ENK50919.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0529]
 gb|ENK56973.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0531]
 gb|ENK59193.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0536]
 gb|ENK59885.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0539]
 gb|ENK62910.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0547]
 gb|ENK66982.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0562]
 gb|ENK69684.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0565]
 gb|ENK71799.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0571]
 gb|ENK71906.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0580]
 gb|ENK76222.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0584]
 gb|ENK79176.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0586]
 gb|ENK84200.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0622]
 gb|ENK84626.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0602]
 gb|ENK88840.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0628]
 gb|ENK89768.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0646]
 gb|ENK92851.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0633]
 gb|ENK95530.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0648]
 gb|ENK98718.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0660]
 gb|ENL01515.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0663]
 gb|ENL04170.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0673]
 gb|ENL07902.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0687]
 gb|ENL09287.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0676]
 gb|ENL12166.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0692]
 gb|ENL15939.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0695]
 gb|ENL17969.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0719]
 gb|ENL19796.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0769]
 gb|ENL22172.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0770]
 gb|ENL27216.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0780]
 gb|ENL29225.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0792]
 gb|ENL32735.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0822]
 gb|ENL33079.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0799]
 gb|ENL38359.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0844]
 gb|ENL39651.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0823]
 gb|ENL42212.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0831]
 gb|ENL48486.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0871]
 gb|ENL51706.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0892]
 gb|ENL55759.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0900]
 gb|ENL58335.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0927]
 gb|ENL60622.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0934]
 gb|ENL63381.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0953]
 gb|ENL64578.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0964]
 gb|ENL72426.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0994]
 gb|ENL72868.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0978]
 gb|ENL75452.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0998]
 gb|ENL77983.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1007]
 gb|ENL78227.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0999]
 gb|ENL85909.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1015]
 gb|ENL86408.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1010]
 gb|ENL87234.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1016]
 gb|ENL93271.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1037]
 gb|ENL94794.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1036]
 gb|ENM00985.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1062]
 gb|ENM01432.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1044]
 gb|ENM02366.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1061]
 gb|ENM08217.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1068]
 gb|ENM09180.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1063]
 gb|ENM09669.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1064]
 gb|ENM15651.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1076]
 gb|ENM19411.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1083]
 gb|ENM19611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1092]
 gb|ENM22647.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1093]
 gb|ENM26297.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1103]
 gb|ENM28022.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1095]
 gb|ENM30042.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1109]
 gb|ENM35945.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1126]
 gb|ENM36477.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1119]
 gb|ENM37960.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1142]
 gb|ENM40820.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1170]
 gb|ENM42701.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1167]
 gb|ENM48103.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1188]
 gb|ENM48560.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1223]
 gb|ENM49688.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1229]
 gb|ENM54231.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1224]
 gb|ENM60541.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1257]
 gb|ENM61119.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1244]
 gb|ENM66241.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1275]
 gb|ENM70140.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1286]
 gb|ENM70831.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1277]
 gb|ENM76608.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1309]
 gb|ENM76811.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1291]
 gb|ENM82912.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1322]
 gb|ENM82665.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1320]
 gb|ENM86696.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1321]
 gb|ENM89920.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1359]
 gb|ENM96443.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1373]
 gb|ENM97248.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1394]
 gb|ENM97569.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1374]
 gb|ENN06988.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1405]
 gb|ENN07222.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1450]
 gb|ENN07508.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1451]
 gb|ENN14411.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1462]
 gb|ENN15541.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1481]
 gb|ENN16360.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1463]
 gb|ENN20225.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1520]
 gb|ENN22241.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1510]
 gb|ENN23829.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1521]
 gb|ENN29137.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1531]
 gb|ENN31209.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1533]
 gb|ENN32808.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1544]
 gb|ENN36491.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1556]
 gb|ENN36862.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1563]
 gb|ENN42781.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1578]
 gb|ENN47728.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0943]
 gb|ENN47998.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0944]
 gb|ENN52119.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1198]
 gb|ENN53376.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1199]
 gb|ENN54141.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1215]
 gb|ENN63931.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1253]
 gb|ENN67115.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1248]
 gb|ENN69650.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1255]
 gb|AGP27732.1| iron complex transport system permease protein [Staphylococcus 
aureus Bmb9393]
 gb|AGU60875.1| Ferric anguibactin transport system permease protein fatD [Staphylococcus 
aureus subsp. aureus CN1]
 gb|ESR30469.1| Iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus PSP1996]
 gb|ETD06492.1| hypothetical protein HMPREF1269_02277 [Staphylococcus aureus 
subsp. aureus KPL1828]
 gb|ETD15288.1| hypothetical protein HMPREF1276_00233 [Staphylococcus aureus 
subsp. aureus KPL1845]
 gb|ETO53576.1| iron ABC transporter permease [Staphylococcus aureus MUF256]
 gb|EUD19338.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0662]
 gb|EUD22832.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0732]
 gb|EUD22915.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0741]
 gb|EUD27796.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0728]
 gb|EUD30389.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0725]
 gb|EUD33859.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0723]
 gb|EUD35662.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0710]
 gb|EUD38632.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0696]
 gb|EUD38983.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0704]
 gb|EUD43539.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0626]
 gb|EUD44020.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0691]
 gb|EUD49373.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0644]
 gb|EUD52209.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0642]
 gb|EUD54779.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0651]
 gb|EUD56843.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0655]
 gb|EUD59576.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0661]
 gb|EUD62592.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0667]
 gb|EUD76031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0627]
 gb|EUD80044.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0631]
 gb|EUD80382.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0630]
 gb|EUD80723.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0632]
 gb|EUD87724.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0634]
 gb|EUD89236.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0636]
 gb|EUD90691.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0637]
 gb|EUD95195.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0638]
 gb|EUD97875.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0640]
 gb|EUE00234.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0643]
 gb|EUE04873.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0647]
 gb|EUE06546.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0649]
 gb|EUE07141.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0645]
 gb|EUE11758.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0652]
 gb|EUE14412.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0654]
 gb|EUE16588.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0653]
 gb|EUE19105.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0656]
 gb|EUE23358.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0657]
 gb|EUE26845.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0659]
 gb|EUE28455.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0658]
 gb|EUE31118.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0664]
 gb|EUE35738.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0666]
 gb|EUE40638.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0669]
 gb|EUE44337.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0668]
 gb|EUE44631.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0670]
 gb|EUE48984.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0672]
 gb|EUE52689.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0671]
 gb|EUE52880.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0674]
 gb|EUE56943.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0677]
 gb|EUE58682.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0678]
 gb|EUE62268.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0679]
 gb|EUE64381.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0680]
 gb|EUE68673.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0681]
 gb|EUE69739.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0682]
 gb|EUE72896.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0683]
 gb|EUE77158.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0685]
 gb|EUE80932.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0686]
 gb|EUE83541.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0689]
 gb|EUE88885.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0693]
 gb|EUE92043.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0697]
 gb|EUE94620.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0699]
 gb|EUE98322.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0700]
 gb|EUF02779.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0701]
 gb|EUF04039.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0703]
 gb|EUF07275.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0706]
 gb|EUF10075.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0708]
 gb|EUF12761.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0707]
 gb|EUF17477.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0709]
 gb|EUF19701.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0711]
 gb|EUF21601.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0713]
 gb|EUF27058.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0716]
 gb|EUF29285.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0718]
 gb|EUF29856.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0720]
 gb|EUF34443.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0721]
 gb|EUF37417.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0722]
 gb|EUF40942.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0724]
 gb|EUF47082.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0729]
 gb|EUF49289.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0731]
 gb|EUF52612.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0730]
 gb|EUF53815.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0733]
 gb|EUF56731.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0734]
 gb|EUF58877.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0736]
 gb|EUF62622.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0739]
 gb|EUF63493.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0737]
 gb|EUF69349.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0625]
 gb|EUF71163.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0742]
 gb|EUF78717.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0675]
 gb|EUF79063.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0650]
 gb|EUF79346.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0688]
 gb|EUF84343.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0714]
 gb|EUF88329.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0702]
 gb|EUF89194.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0726]
 gb|EUF95125.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0735]
 gb|EUF95508.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0498]
 gb|EUF96447.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0511]
 gb|EUG02950.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0538]
 gb|EUG03250.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0524]
 gb|EUG05499.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0551]
 gb|EUG06014.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0561]
 gb|EUG09012.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0570]
 gb|EUG14444.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0608]
 gb|EUG20212.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0620]
 gb|EUG22381.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0371]
 gb|EUG23963.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0379]
 gb|EUG28175.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0395]
 gb|EUG30402.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0407]
 gb|EUG32589.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0418]
 gb|EUG36029.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0432]
 gb|EUG38552.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0456]
 gb|EUG40321.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0443]
 gb|EUG44118.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0473]
 gb|EUG45630.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0492]
 gb|EUG49723.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0243]
 gb|EUG51734.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0253]
 gb|EUG54577.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0268]
 gb|EUG57995.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0299]
 gb|EUG59031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0311]
 gb|EUG61588.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0284]
 gb|EUG64581.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0332]
 gb|EUG65169.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0352]
 gb|EUG66230.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0343]
 gb|EUG72606.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0365]
 gb|EUG74660.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0121]
 gb|EUG78539.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0130]
 gb|EUG81310.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0139]
 gb|EUG84330.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0152]
 gb|EUG88691.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0167]
 gb|EUG89199.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0176]
 gb|EUG89761.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0190]
 gb|EUG94444.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0195]
 gb|EUG98132.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0238]
 gb|EUG98787.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0222]
 gb|EUH03072.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0023]
 gb|EUH03673.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0002]
 gb|EUH07019.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0015]
 gb|EUH10591.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0032]
 gb|EUH14813.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0047]
 gb|EUH16294.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0078]
 gb|EUH17790.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0059]
 gb|EUH22532.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0105]
 gb|EUH22629.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0088]
 gb|EUH31570.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0776]
 gb|EUH33456.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0113]
 gb|EUH35256.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0803]
 gb|EUH35570.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0787]
 gb|EUH39668.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0816]
 gb|EUH40990.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0827]
 gb|EUH46107.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0849]
 gb|EUH49139.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0864]
 gb|EUH49675.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0860]
 gb|EUH54063.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0874]
 gb|EUH56059.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0884]
 gb|EUH60017.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0908]
 gb|EUH65353.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0915]
 gb|EUH69173.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0938]
 gb|EUH70620.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0950]
 gb|EUH72189.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0962]
 gb|EUH75363.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0973]
 gb|EUH79950.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0977]
 gb|EUH81289.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0986]
 gb|EUH83430.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1001]
 gb|EUH87208.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1042]
 gb|EUH87567.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1020]
 gb|EUH89977.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1052]
 gb|EUH94719.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1072]
 gb|EUH98175.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1086]
 gb|EUI02621.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1098]
 gb|EUI04039.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1376]
 gb|EUI04312.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1104]
 gb|EUI07101.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1375]
 gb|EUI09730.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1381]
 gb|EUI14380.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1389]
 gb|EUI14937.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1399]
 gb|EUI20697.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1426]
 gb|EUI22922.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1427]
 gb|EUI25440.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1439]
 gb|EUI26816.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1440]
 gb|EUI28388.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1114]
 gb|EUI28639.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1442]
 gb|EUI40021.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1134]
 gb|EUI40221.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1125]
 gb|EUI41317.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1135]
 gb|EUI45193.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1155]
 gb|EUI47144.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1163]
 gb|EUI48875.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1175]
 gb|EUI53843.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1176]
 gb|EUI56533.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1177]
 gb|EUI62876.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1184]
 gb|EUI63126.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1183]
 gb|EUI64127.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1194]
 gb|EUI67320.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1196]
 gb|EUI69185.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1240]
 gb|EUI72217.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1287]
 gb|EUI76776.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1294]
 gb|EUI78494.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1299]
 gb|EUI78832.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1300]
 gb|EUI80207.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1342]
 gb|EUI86873.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1475]
 gb|EUI88311.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1346]
 gb|EUI92071.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1479]
 gb|EUI94843.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1480]
 gb|EUI96061.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1486]
 gb|EUI96703.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1485]
 gb|EUJ01636.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1499]
 gb|EUJ02822.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1492]
 gb|EUJ07421.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1502]
 gb|EUJ58317.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1280]
 gb|EUJ58761.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1199]
 gb|EUJ62999.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1503]
 gb|EUJ64194.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1366]
 gb|EUJ68429.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3170]
 gb|EUJ69760.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3172]
 gb|EUJ74499.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3165]
 gb|EUK21386.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0018]
 gb|EUK24179.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0050]
 gb|EUK24512.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0039]
 gb|EUK29117.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0056]
 gb|EUK32425.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0062]
 gb|EUK35684.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0068]
 gb|EUK38415.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0067]
 gb|EUK41451.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0126]
 gb|EUK41710.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0073]
 gb|EUK43250.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0114]
 gb|EUK48807.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0133]
 gb|EUK51213.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0158]
 gb|EUK51784.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0180]
 gb|EUK57301.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0267]
 gb|EUK57621.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0259]
 gb|EUK64111.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0277]
 gb|EUK64453.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0269]
 gb|EUK70834.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0291]
 gb|EUK72941.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0304]
 gb|EUK74790.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0298]
 gb|EUK77589.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0316]
 gb|EUK78854.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0324]
 gb|EUK82774.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0358]
 gb|EUK83172.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0354]
 gb|EUK87654.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0370]
 gb|EUK88784.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0366]
 gb|EUK94384.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0389]
 gb|EUK96548.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0397]
 gb|EUK98576.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0394]
 gb|EUL02543.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0410]
 gb|EUL05067.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0429]
 gb|EUL06912.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0434]
 gb|EUL09697.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0459]
 gb|EUL10005.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0444]
 gb|EUL16510.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0495]
 gb|EUL20638.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0499]
 gb|EUL22849.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0535]
 gb|EUL26367.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0502]
 gb|EUL28837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0560]
 gb|EUN41386.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0832]
 gb|EUN45032.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0846]
 gb|EUN47806.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0743]
 gb|EUN47950.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0848]
 gb|EUN50130.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0848]
 gb|EUN52579.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0854]
 gb|EUN53866.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0857]
 gb|EUN57004.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0867]
 gb|EUN61614.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0873]
 gb|EUN63720.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0870]
 gb|EUN64799.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0882]
 gb|EUN70961.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0886]
 gb|EUN72135.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0904]
 gb|EUN72605.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0888]
 gb|EUN76960.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0906]
 gb|EUN78825.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0921]
 gb|EUN82308.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0923]
 gb|EUN85375.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0939]
 gb|EUN87612.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0949]
 gb|EUN90736.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0980]
 gb|EUN93296.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0959]
 gb|EUN96852.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0991]
 gb|EUN98015.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0981]
 gb|EUO00763.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0992]
 gb|EUO03369.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0996]
 gb|EUO06395.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1008]
 gb|EUO09911.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1018]
 gb|EUO11719.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1024]
 gb|EUO14031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1028]
 gb|EUO17514.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1029]
 gb|EUO19893.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1039]
 gb|EUO22730.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1047]
 gb|EUO28131.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1055]
 gb|EUO30822.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1057]
 gb|EUO34327.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1065]
 gb|EUO36385.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1071]
 gb|EUO39032.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1073]
 gb|EUO39732.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1075]
 gb|EUO43759.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1097]
 gb|EUO47293.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1100]
 gb|EUO50618.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1099]
 gb|EUO51690.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1561]
 gb|EUO55526.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1579]
 gb|EUO55706.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0755]
 gb|EUO60136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0765]
 gb|EUO62451.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1379]
 gb|EUO65354.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1368]
 gb|EUO68087.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1385]
 gb|EUO70540.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1384]
 gb|EUO72477.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1388]
 gb|EUO75675.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1418]
 gb|EUO81148.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1468]
 gb|EUO83672.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1473]
 gb|EUO86790.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1343]
 gb|EUO90539.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1339]
 gb|EUO95685.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1358]
 gb|EUO98200.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1362]
 gb|EUP01036.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1494]
 gb|EUP02153.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1488]
 gb|EUP06599.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1509]
 gb|EUP09244.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1522]
 gb|EUP13128.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1503]
 gb|EUP17495.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1536]
 gb|EUP20905.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1543]
 gb|EUP22596.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1547]
 gb|EUP24944.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1539]
 gb|EUP25916.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1548]
 gb|EUP28047.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1554]
 gb|EUP31832.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1549]
 gb|EUP35211.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1555]
 gb|EUP35758.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1558]
 gb|EUP41150.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0805]
 gb|EUP44711.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6046]
 gb|EUP45595.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6057]
 gb|EUP48659.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6100]
 gb|EUP52827.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6058]
 gb|EUP55507.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6081]
 gb|EUP57348.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6062]
 gb|EUP58760.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6146]
 gb|EUP60870.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6061]
 gb|EUP65779.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6123]
 gb|EUP68524.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6138]
 gb|EUP72355.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6100]
 gb|EUP75462.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6125]
 gb|EUP79067.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC6117]
 gb|EUP80464.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6121]
 gb|EUP84970.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6091]
 gb|EUP89062.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6108]
 gb|EUP90926.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6134]
 gb|EUP93012.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6126]
 gb|EUP94377.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6110]
 gb|EUQ00787.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6095]
 gb|EUQ04707.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6180]
 gb|EUQ07789.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC6094]
 gb|EUQ09962.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6076]
 gb|EUQ13684.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6139]
 gb|EUQ15145.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6085]
 gb|EUQ17071.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINB6009]
 gb|EUQ18740.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC6066]
 gb|EUQ21711.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6118]
 gb|EUQ25991.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6065]
 gb|EUQ28217.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6114]
 gb|EUQ29829.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HSOU6002]
 gb|EUQ35512.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6104]
 gb|EUQ35856.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6087]
 gb|EUQ41094.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6057]
 gb|EUQ42080.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6106]
 gb|EUQ42916.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6024]
 gb|EUQ48529.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6022]
 gb|EUQ51508.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6042]
 gb|EUQ53049.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6034]
 gb|EUQ55408.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AGEN6010]
 gb|EUQ58500.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6005]
 gb|EUQ61089.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AGEN6009]
 gb|EUQ64224.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6004]
 gb|EUQ67553.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6001]
 gb|EUQ70592.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0016]
 gb|EUQ73953.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6001]
 gb|EUQ76428.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6073]
 gb|EUQ81956.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6098]
 gb|EUQ86589.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6039]
 gb|EUQ90843.1| iron compound ABC transporter, permease [Staphylococcus aureus 
CHOC6045]
 gb|EUQ93234.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6019]
 gb|EUQ96462.1| iron compound ABC transporter, permease [Staphylococcus aureus 
TUSH6001]
 gb|EUQ99165.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6019]
 gb|EUR00813.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6059]
 gb|EUR03304.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6007]
 gb|EUR08234.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6051]
 gb|EUR10774.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCOA6012]
 gb|EUR15012.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0037]
 gb|EUR16773.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6056]
 gb|EUR18455.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6020]
 gb|EUR21341.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6064]
 gb|EUR26966.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6007]
 gb|EUR28983.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6025]
 gb|EUR31863.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6050]
 gb|EUR36827.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6008]
 gb|EUR39106.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6051]
 gb|EUR48060.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0004]
 gb|EUR49859.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0005]
 gb|EUR54957.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0007]
 gb|EUR56469.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0008]
 gb|EUR58206.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0009]
 gb|EUR61612.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0010]
 gb|EUR65996.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0012]
 gb|EUR69746.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0011]
 gb|EUR75396.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0013]
 gb|EUR77624.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0016]
 gb|EUR79504.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0014]
 gb|EUR84063.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0017]
 gb|EUR89280.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0022]
 gb|EUR89390.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0021]
 gb|EUR93542.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0024]
 gb|EUR94309.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0025]
 gb|EUS00577.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0028]
 gb|EUS02134.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0027]
 gb|EUS05845.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0031]
 gb|EUS07086.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0030]
 gb|EUS14570.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0036]
 gb|EUS18142.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0037]
 gb|EUS18246.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0038]
 gb|EUS22341.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0040]
 gb|EUS24674.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0041]
 gb|EUS27550.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0042]
 gb|EUS29469.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0043]
 gb|EUS32989.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0044]
 gb|EUS36285.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0046]
 gb|EUS39355.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0049]
 gb|EUS40854.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0048]
 gb|EUS43785.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0051]
 gb|EUS46341.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0054]
 gb|EUS47867.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0052]
 gb|EUS51623.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0057]
 gb|EUS55651.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0058]
 gb|EUS57535.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0061]
 gb|EUS60236.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0063]
 gb|EUS64134.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0065]
 gb|EUS69807.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0069]
 gb|EUS71175.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0071]
 gb|EUS71728.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0070]
 gb|EUS76486.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0074]
 gb|EUS77999.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0076]
 gb|EUS80434.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0079]
 gb|EUS84771.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0081]
 gb|EUS88587.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0080]
 gb|EUS90873.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0082]
 gb|EUS93270.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0084]
 gb|EUS95355.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0083]
 gb|EUS98545.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0089]
 gb|EUT00105.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0086]
 gb|EUT03824.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0087]
 gb|EUT06585.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0092]
 gb|EUT08629.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0094]
 gb|EUT11412.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0093]
 gb|EUT12954.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0095]
 gb|EUT18510.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0096]
 gb|EUT20111.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0097]
 gb|EUT22987.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0099]
 gb|EUT23875.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0098]
 gb|EUT35335.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0101]
 gb|EUT38434.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0100]
 gb|EUT39810.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0107]
 gb|EUT43989.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0110]
 gb|EUT47662.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0109]
 gb|EUT49448.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0112]
 gb|EUT51509.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0111]
 gb|EUT54988.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0115]
 gb|EUT55926.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0116]
 gb|EUT58799.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0118]
 gb|EUT60868.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0119]
 gb|EUT60971.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0117]
 gb|EUT68791.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0120]
 gb|EUT71192.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0122]
 gb|EUT72614.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0123]
 gb|EUT74613.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0124]
 gb|EUT78448.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0125]
 gb|EUT82837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0127]
 gb|EUT87498.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0128]
 gb|EUT91253.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0132]
 gb|EUT93248.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0131]
 gb|EUT96541.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0134]
 gb|EUU00450.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0136]
 gb|EUU02424.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0135]
 gb|EUU05959.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0138]
 gb|EUU06109.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0137]
 gb|EUU11677.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0141]
 gb|EUU15143.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0142]
 gb|EUU15702.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0143]
 gb|EUU18820.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0145]
 gb|EUU23548.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0146]
 gb|EUU23687.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0147]
 gb|EUU24450.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0148]
 gb|EUU29228.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0149]
 gb|EUU32334.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0153]
 gb|EUU32743.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0155]
 gb|EUU37672.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0156]
 gb|EUU41176.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0157]
 gb|EUU43549.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0159]
 gb|EUU45770.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0160]
 gb|EUU48864.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0161]
 gb|EUU51548.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0162]
 gb|EUU54867.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0163]
 gb|EUU56815.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0164]
 gb|EUU58921.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0166]
 gb|EUU60986.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0165]
 gb|EUU65053.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0168]
 gb|EUU68237.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0169]
 gb|EUU68902.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0170]
 gb|EUU76266.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0174]
 gb|EUU77987.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0175]
 gb|EUU82197.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0178]
 gb|EUU84260.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0181]
 gb|EUU87464.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0179]
 gb|EUU89474.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0182]
 gb|EUU93113.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0184]
 gb|EUU95354.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0183]
 gb|EUU97933.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0185]
 gb|EUU99266.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0186]
 gb|EUV03088.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0187]
 gb|EUV06127.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0188]
 gb|EUV08826.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0191]
 gb|EUV11352.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0193]
 gb|EUV12079.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0194]
 gb|EUV16745.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0196]
 gb|EUV18231.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0198]
 gb|EUV18302.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0199]
 gb|EUV24843.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0201]
 gb|EUV28321.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0203]
 gb|EUV30151.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0202]
 gb|EUV33256.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0205]
 gb|EUV34272.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0204]
 gb|EUV38308.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0207]
 gb|EUV41195.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0209]
 gb|EUV43391.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0208]
 gb|EUV47312.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0211]
 gb|EUV50532.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0214]
 gb|EUV51616.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0215]
 gb|EUV54701.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0218]
 gb|EUV56967.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0220]
 gb|EUV58474.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0219]
 gb|EUV61760.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0224]
 gb|EUV64970.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0225]
 gb|EUV66291.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0226]
 gb|EUV70490.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0227]
 gb|EUV72994.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0229]
 gb|EUV75009.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0228]
 gb|EUV79233.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0231]
 gb|EUV79921.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0230]
 gb|EUV84239.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0232]
 gb|EUV86885.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0234]
 gb|EUV92943.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0241]
 gb|EUV93254.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0244]
 gb|EUV96829.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0242]
 gb|EUV99520.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0246]
 gb|EUW02228.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0245]
 gb|EUW05522.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0247]
 gb|EUW07772.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0249]
 gb|EUW09337.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0251]
 gb|EUW16015.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0255]
 gb|EUW19837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0262]
 gb|EUW20783.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0256]
 gb|EUW22165.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0258]
 gb|EUW27547.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0264]
 gb|EUW28425.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0263]
 gb|EUW32297.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0265]
 gb|EUW34227.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0271]
 gb|EUW36931.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0272]
 gb|EUW40833.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0275]
 gb|EUW42523.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0276]
 gb|EUW45878.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0278]
 gb|EUW49217.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0281]
 gb|EUW49331.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0283]
 gb|EUW54859.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0286]
 gb|EUW56818.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0285]
 gb|EUW59519.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0287]
 gb|EUW62962.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0289]
 gb|EUW64266.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0292]
 gb|EUW66913.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0290]
 gb|EUW69154.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0295]
 gb|EUW72741.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0293]
 gb|EUW76115.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0297]
 gb|EUW78012.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0296]
 gb|EUW82031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0301]
 gb|EUW82142.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0300]
 gb|EUW85745.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0302]
 gb|EUW89776.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0305]
 gb|EUW90798.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0303]
 gb|EUW95045.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0307]
 gb|EUW97562.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0309]
 gb|EUW98983.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0310]
 gb|EUX01750.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0313]
 gb|EUX04721.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0314]
 gb|EUX08174.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0317]
 gb|EUX12895.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0319]
 gb|EUX15446.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0321]
 gb|EUX16225.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0320]
 gb|EUX20507.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0322]
 gb|EUX24922.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0325]
 gb|EUX26474.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0323]
 gb|EUX29417.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0327]
 gb|EUX31824.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0331]
 gb|EUX34707.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0333]
 gb|EUX36454.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0335]
 gb|EUX39464.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0336]
 gb|EUX44420.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0338]
 gb|EUX45284.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0339]
 gb|EUX48924.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0337]
 gb|EUX50200.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0341]
 gb|EUX53326.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0342]
 gb|EUX53354.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0344]
 gb|EUX59023.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0345]
 gb|EUX62259.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0346]
 gb|EUX66817.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0349]
 gb|EUX71855.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0353]
 gb|EUX73447.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0355]
 gb|EUX74427.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0356]
 gb|EUX78335.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0357]
 gb|EUX82709.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0360]
 gb|EUX86109.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0361]
 gb|EUX89084.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0362]
 gb|EUX90301.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0368]
 gb|EUX94587.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0369]
 gb|EUX97497.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0372]
 gb|EUX99827.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0373]
 gb|EUY05798.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0377]
 gb|EUY07307.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0378]
 gb|EUY10425.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0380]
 gb|EUY13538.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0382]
 gb|EUY14458.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0383]
 gb|EUY18923.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0384]
 gb|EUY22152.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0386]
 gb|EUY23605.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0385]
 gb|EUY27280.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0388]
 gb|EUY30258.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0390]
 gb|EUY31785.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0398]
 gb|EUY34043.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0399]
 gb|EUY34112.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0399]
 gb|EUY36388.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0400]
 gb|EUY40226.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0402]
 gb|EUY43644.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0405]
 gb|EUY44457.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0403]
 gb|EUY49462.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0406]
 gb|EUY52869.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0411]
 gb|EUY53240.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0409]
 gb|EUY56946.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0412]
 gb|EUY60985.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0414]
 gb|EUY62882.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0413]
 gb|EUY66083.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0416]
 gb|EUY66985.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0419]
 gb|EUY69949.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0417]
 gb|EUY73124.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0420]
 gb|EUY76066.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0421]
 gb|EUY77012.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0423]
 gb|EUY81320.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0425]
 gb|EUY83965.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0428]
 gb|EUY87020.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0430]
 gb|EUY92640.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0431]
 gb|EUY95012.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0433]
 gb|EUY97989.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0435]
 gb|EUZ04675.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0440]
 gb|EUZ08513.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0442]
 gb|EUZ10671.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0441]
 gb|EUZ14193.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0445]
 gb|EUZ17221.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0447]
 gb|EUZ18734.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0448]
 gb|EUZ21762.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0449]
 gb|EUZ23333.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0451]
 gb|EUZ28061.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0452]
 gb|EUZ31800.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0453]
 gb|EUZ36555.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0454]
 gb|EUZ37697.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0458]
 gb|EUZ40557.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0457]
 gb|EUZ41208.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0462]
 gb|EUZ42498.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0463]
 gb|EUZ47350.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0464]
 gb|EUZ48690.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0466]
 gb|EUZ56185.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0471]
 gb|EUZ58713.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0469]
 gb|EUZ60833.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0472]
 gb|EUZ64210.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0475]
 gb|EUZ66134.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0476]
 gb|EUZ69341.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0482]
 gb|EUZ77316.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0484]
 gb|EUZ78441.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0483]
 gb|EUZ82866.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0486]
 gb|EUZ84803.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0490]
 gb|EUZ86173.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0487]
 gb|EUZ89107.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0491]
 gb|EUZ90978.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0496]
 gb|EUZ94459.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0501]
 gb|EUZ97836.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0503]
 gb|EVA00110.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0505]
 gb|EVA03247.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0506]
 gb|EVA05934.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0508]
 gb|EVA08611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0509]
 gb|EVA11048.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0512]
 gb|EVA14087.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0514]
 gb|EVA15920.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0515]
 gb|EVA19361.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0516]
 gb|EVA21967.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0518]
 gb|EVA22808.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0519]
 gb|EVA28136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0520]
 gb|EVA30764.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0523]
 gb|EVA35378.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0525]
 gb|EVA40235.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0527]
 gb|EVA41387.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0530]
 gb|EVA43148.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0532]
 gb|EVA46655.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0534]
 gb|EVA47743.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0533]
 gb|EVA52161.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0537]
 gb|EVA54830.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0540]
 gb|EVA62890.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0542]
 gb|EVA63191.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0543]
 gb|EVA64037.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0544]
 gb|EVA68625.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0546]
 gb|EVA69330.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0545]
 gb|EVA74092.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0548]
 gb|EVA76745.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0550]
 gb|EVA79101.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0549]
 gb|EVA85201.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0554]
 gb|EVA87852.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0555]
 gb|EVA89730.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0556]
 gb|EVA92874.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0558]
 gb|EVA93041.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0557]
 gb|EVA98609.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0559]
 gb|EVB03774.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0563]
 gb|EVB05574.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0566]
 gb|EVB06798.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0564]
 gb|EVB08749.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0567]
 gb|EVB09314.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0569]
 gb|EVB13189.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0568]
 gb|EVB16891.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0572]
 gb|EVB20834.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0573]
 gb|EVB23858.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0577]
 gb|EVB25831.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0579]
 gb|EVB27360.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0581]
 gb|EVB30955.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0582]
 gb|EVB33544.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0583]
 gb|EVB35168.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0587]
 gb|EVB38185.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0585]
 gb|EVB41823.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0588]
 gb|EVB45187.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0589]
 gb|EVB49904.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0591]
 gb|EVB52715.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0592]
 gb|EVB55939.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0595]
 gb|EVB58964.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0593]
 gb|EVB60402.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0598]
 gb|EVB64923.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0599]
 gb|EVB65040.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0601]
 gb|EVB68764.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0603]
 gb|EVB72444.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0604]
 gb|EVB75290.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0605]
 gb|EVB78569.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0609]
 gb|EVB79534.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0607]
 gb|EVB82513.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0610]
 gb|EVB86003.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0611]
 gb|EVB88801.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0612]
 gb|EVB91601.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0613]
 gb|EVB95674.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0615]
 gb|EVB95772.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0616]
 gb|EVB98858.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0617]
 gb|EVC01379.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0619]
 gb|EVC04462.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0618]
 gb|EVC07215.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0621]
 gb|EVC10584.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0623]
 gb|EVC11378.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0624]
 gb|EVC17259.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0024]
 gb|EVC19110.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6052]
 gb|EVC24093.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6040]
 gb|EVC27322.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6071]
 gb|EVC30283.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6051]
 gb|EVC31526.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6053]
 gb|EVC36011.1| iron compound ABC transporter, permease [Staphylococcus aureus 
CHAP6049]
 gb|EVC36216.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6010]
 gb|EVC38973.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6012]
 gb|EVC42906.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6054]
 gb|EVC48291.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6011]
 gb|EVC51820.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC0005]
 gb|EVC55101.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6041]
 gb|EVC57188.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6010]
 gb|EVC59316.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6063]
 gb|EVC61857.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HBHO6042]
 gb|EVC64200.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6017]
 gb|EVC68926.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6053]
 gb|EVC71016.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6019]
 gb|EVC73465.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6012]
 gb|EVC76648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6054]
 gb|EVC81124.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6076]
 gb|EVC84966.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6037]
 gb|EVC88372.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCOA6011]
 gb|EVC89532.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6035]
 gb|EVC93269.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6040]
 gb|EVC95611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6016]
 gb|EVC99091.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6068]
 gb|EVD04866.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6018]
 gb|EVD05628.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6014]
 gb|EVD11976.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6068]
 gb|EVD12436.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6017]
 gb|EVD15876.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6086]
 gb|EVD17019.1| iron compound ABC transporter, permease [Staphylococcus aureus 
CHOC6056]
 gb|EVD21413.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6095]
 gb|EVD23848.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6038]
 gb|EVD24151.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6087]
 gb|EVD29190.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6067]
 gb|EVD30302.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6074]
 gb|EVD35399.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6072]
 gb|EVD37587.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6100]
 gb|EVD39614.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6038]
 gb|EVD45814.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LPIH6021]
 gb|EVD46571.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6039]
 gb|EVD49281.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6045]
 gb|EVD51215.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6046]
 gb|EVD51976.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6048]
 gb|EVD57839.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6049]
 gb|EVD58064.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6070]
 gb|EVD58585.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6071]
 gb|EVD65521.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6072]
 gb|EVD66724.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6075]
 gb|EVD69990.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6110]
 gb|EVD73021.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6074]
 gb|EVD77068.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0050]
 gb|EVD77313.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0047]
 gb|EVD80209.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6053]
 gb|EVD80616.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6055]
 gb|EVD88323.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6097]
 gb|EVD92311.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AGEN6033]
 gb|EVD93940.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC6065]
 gb|EVD95252.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6084]
 gb|EVE00286.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6052]
 gb|EVE03317.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6003]
 gb|EVE04570.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6002]
 gb|EVE07724.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6001]
 gb|EVE11038.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6005]
 gb|EVE16667.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6002]
 gb|EVE19712.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6011]
 gb|EVE22974.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6003]
 gb|EVE24461.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6007]
 gb|EVE24568.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6008]
 gb|EVE30985.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0001]
 gb|EVE33781.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6034]
 gb|EVE36727.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6038]
 gb|EVE38192.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6037]
 gb|EVE42404.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6003]
 gb|EVE45163.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6010]
 gb|EVE46644.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6014]
 gb|EVE52153.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6003]
 gb|EVE52640.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6015]
 gb|EVE57860.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6018]
 gb|EVE59886.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6017]
 gb|EVE63550.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6002]
 gb|EVE65051.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0010]
 gb|EVE70172.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC0013]
 gb|EVE71410.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6015]
 gb|EVE74701.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6013]
 gb|EVE75347.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6014]
 gb|EVE79503.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6001]
 gb|EVE83958.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HBHO6002]
 gb|EVE87490.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LPIH6001]
 gb|EVE89613.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6012]
 gb|EVE90501.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6048]
 gb|EVE92946.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6042]
 gb|EVF01249.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6009]
 gb|EVF07026.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6001]
 gb|EVF10248.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCOA6006]
 gb|EVF10785.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6002]
 gb|EVF15643.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCOA6008]
 gb|EVF20977.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6003]
 gb|EVF25186.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6049]
 gb|EVF27821.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6003]
 gb|EVF29478.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6015]
 gb|EVF29680.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6050]
 gb|EVF36870.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6047]
 gb|EVF38258.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6046]
 gb|EVF38360.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6022]
 gb|EVF44652.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6033]
 gb|EVF44882.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6010]
 gb|EVF49392.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COLL6021]
 gb|EVF54224.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6040]
 gb|EVF57791.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6028]
 gb|EVF61111.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LPIH6011]
 gb|EVF62493.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6021]
 gb|EVF65313.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6010]
 gb|EVF69410.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6041]
 gb|EVF69635.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6004]
 gb|EVF71471.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6011]
 gb|EVF76871.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6034]
 gb|EVF82665.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6027]
 gb|EVF84838.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6057]
 gb|EVF88600.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6125]
 gb|EVF92766.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6056]
 gb|EVF94532.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6011]
 gb|EVF96892.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6016]
 gb|EVG01335.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6092]
 gb|EVG02812.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCOA6048]
 gb|EVG06560.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6105]
 gb|EVG08941.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6124]
 gb|EVG11514.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6052]
 gb|EVG12351.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6118]
 gb|EVG15433.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6125]
 gb|EVG21165.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6053]
 gb|EVG21378.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6107]
 gb|EVG22989.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6111]
 gb|EVG27155.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6110]
 gb|EVG30001.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6126]
 gb|EVG30636.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6101]
 gb|EVG32423.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6109]
 gb|EVG38195.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6119]
 gb|EVG39753.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6076]
 gb|EVG42155.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6085]
 gb|EVG43648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6055]
 gb|EVG47861.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6059]
 gb|EVG50984.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6055]
 gb|EVG54004.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6104]
 gb|EVG58205.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6049]
 gb|EVG64590.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6052]
 gb|EVG66704.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6065]
 gb|EVG69774.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6066]
 gb|EVG72561.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6069]
 gb|EVG76134.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6060]
 gb|EVG77005.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6144]
 gb|EVG80069.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6070]
 gb|EVG84797.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6021]
 gb|EVG84921.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6026]
 gb|EVG90546.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6071]
 gb|EVG90745.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6022]
 gb|EVG92578.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6019]
 gb|EVG95850.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6075]
 gb|EVG97535.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6077]
 gb|EVG99704.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6134]
 gb|EVH07990.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6076]
 gb|EVH08084.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6015]
 gb|EVH08175.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6080]
 gb|EVH14098.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6124]
 gb|EVH14852.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6120]
 gb|EVH18608.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6024]
 gb|EVH20882.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6025]
 gb|EVH23089.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6106]
 gb|EVH26183.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6027]
 gb|EVH26834.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6023]
 gb|EVH31256.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINB6023]
 gb|EVH35018.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINB6024]
 gb|EVH36902.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6084]
 gb|EVH39113.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6108]
 gb|EVH40278.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6111]
 gb|EVH45188.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6075]
 gb|EVH47407.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6035]
 gb|EVH50513.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6030]
 gb|EVH53353.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6033]
 gb|EVH55458.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC6078]
 gb|EVH58156.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6081]
 gb|EVH60876.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6119]
 gb|EVH63624.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6052]
 gb|EVH67174.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6085]
 gb|EVH67513.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6090]
 gb|EVH75906.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6057]
 gb|EVH76893.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6121]
 gb|EVH80178.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6029]
 gb|EVH83978.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6079]
 gb|EVH84409.1| iron compound ABC transporter, permease [Staphylococcus aureus 
TUSH6007]
 gb|EVH86223.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6032]
 gb|EVH86325.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6036]
 gb|EVH94961.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6074]
 gb|EVH96323.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6101]
 gb|EVH97572.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6067]
 gb|EVI03096.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6096]
 gb|EVI06048.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6018]
 gb|EVI08635.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6035]
 gb|EVI13143.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6087]
 gb|EVI18962.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6087]
 gb|EVI20378.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AGEN6042]
 gb|EVI22707.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6105]
 gb|EVI24889.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6092]
 gb|EVI26517.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6106]
 gb|EVI29973.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6065]
 gb|EVI34518.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6043]
 gb|EVI35037.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6024]
 gb|EVI40008.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6102]
 gb|EVI42981.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6115]
 gb|EVI45114.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6040]
 gb|EVI50837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC6106]
 gb|EVI57505.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6114]
 gb|EVI57717.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6123]
 gb|EVI62051.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6117]
 gb|EVI62952.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6026]
 gb|EVI68714.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6078]
 gb|EVI72260.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6080]
 gb|EVI74534.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6092]
 gb|EVI75016.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6123]
 gb|EVI79560.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6040]
 gb|EVI83085.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6027]
 gb|EVI85047.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LAMC6115]
 gb|EVI88298.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6124]
 gb|EVI88928.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6043]
 gb|EVI93037.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6130]
 gb|EVI94025.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6131]
 gb|EVI94451.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6129]
 gb|EVI99814.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6112]
 gb|EVJ04030.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6044]
 gb|EVJ06707.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6114]
 gb|EVJ11642.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6132]
 gb|EVJ15220.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6140]
 gb|EVJ16682.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6137]
 gb|EVJ17479.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6060]
 gb|EVJ21909.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6036]
 gb|EVJ23418.1| iron compound ABC transporter, permease [Staphylococcus aureus 
CHAP6035]
 gb|EVJ24965.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6062]
 gb|EVJ25696.1| iron compound ABC transporter, permease [Staphylococcus aureus 
CHAP6102]
 gb|EVJ32760.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HBHO6022]
 gb|EVJ33262.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6071]
 gb|EVJ36093.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HBHO6024]
 gb|EVJ40093.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6058]
 gb|EVJ42104.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6144]
 gb|EVJ45708.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6145]
 gb|EVJ48836.1| iron compound ABC transporter, permease [Staphylococcus aureus 
PLAC6055]
 gb|EVJ52953.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6147]
 gb|EVJ57176.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6080]
 gb|EVJ61310.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6086]
 gb|EVJ62090.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6043]
 gb|EVJ66983.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6053]
 gb|EVJ71136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6129]
 gb|EVJ72530.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6118]
 gb|EVJ76054.1| iron compound ABC transporter, permease [Staphylococcus aureus 
CHAP6022]
 gb|EVJ77788.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6047]
 gb|EVJ82506.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0746]
 gb|EVJ88000.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0744]
 gb|EVJ91951.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0772]
 gb|EVJ93346.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0752]
 gb|EVJ97046.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0775]
 gb|EVJ97741.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0774]
 gb|EVK00212.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0773]
 gb|EVK04644.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0779]
 gb|EVK12387.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0783]
 gb|EVK15331.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0784]
 gb|EVK16179.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0785]
 gb|EVK19571.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0786]
 gb|EVK22466.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0788]
 gb|EVK26660.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0789]
 gb|EVK30625.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0791]
 gb|EVK32687.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0793]
 gb|EVK33790.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0794]
 gb|EVK39350.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0796]
 gb|EVK41767.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0798]
 gb|EVK44294.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0800]
 gb|EVK45544.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0801]
 gb|EVK51516.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0802]
 gb|EVK51958.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0804]
 gb|EVK55429.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0806]
 gb|EVK58427.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0807]
 gb|EVK59680.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0808]
 gb|EVK64354.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0810]
 gb|EVK65964.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0809]
 gb|EVK69561.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0811]
 gb|EVK71943.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0812]
 gb|EVK74889.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0814]
 gb|EVK77542.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0817]
 gb|EVK81465.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0819]
 gb|EVK90240.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0824]
 gb|EVK93717.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0826]
 gb|EVK95689.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0830]
 gb|EVK99805.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0833]
 gb|EVL01998.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0834]
 gb|EVL02920.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0836]
 gb|EVL07204.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0837]
 gb|EVL10049.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0838]
 gb|EVL12686.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0839]
 gb|EVL14474.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0840]
 gb|EVL17666.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0841]
 gb|EVL20613.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0842]
 gb|EVL23132.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0843]
 gb|EVL26218.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0845]
 gb|EVL29356.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0850]
 gb|EVL31791.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0851]
 gb|EVL33803.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0852]
 gb|EVL37978.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0855]
 gb|EVL40034.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0853]
 gb|EVL42265.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0858]
 gb|EVL45691.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0861]
 gb|EVL45841.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0862]
 gb|EVL49446.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0863]
 gb|EVL54696.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0865]
 gb|EVL59546.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0868]
 gb|EVL60516.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0869]
 gb|EVL62849.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0872]
 gb|EVL65860.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0875]
 gb|EVL69345.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0876]
 gb|EVL71297.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0879]
 gb|EVL72632.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0878]
 gb|EVL80138.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0880]
 gb|EVL80381.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0883]
 gb|EVL80910.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0885]
 gb|EVL85944.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0889]
 gb|EVL89193.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0887]
 gb|EVL90017.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0890]
 gb|EVL91034.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0891]
 gb|EVL96628.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0893]
 gb|EVM01704.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0894]
 gb|EVM02224.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0895]
 gb|EVM05174.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0898]
 gb|EVM05368.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0897]
 gb|EVM11373.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0899]
 gb|EVM13396.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0902]
 gb|EVM15439.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0903]
 gb|EVM16556.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0901]
 gb|EVM19835.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0905]
 gb|EVM24344.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0909]
 gb|EVM26328.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0907]
 gb|EVM29757.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0910]
 gb|EVM33380.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0911]
 gb|EVM33732.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0913]
 gb|EVM38287.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0914]
 gb|EVM40309.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0917]
 gb|EVM44685.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0918]
 gb|EVM47870.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0920]
 gb|EVM48282.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0919]
 gb|EVM51946.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0922]
 gb|EVM55527.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0928]
 gb|EVM55927.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0924]
 gb|EVM60640.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0929]
 gb|EVM62861.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0930]
 gb|EVM67415.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0931]
 gb|EVM68233.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0932]
 gb|EVM72502.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0936]
 gb|EVM75371.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0935]
 gb|EVM80217.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0940]
 gb|EVM80439.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0941]
 gb|EVM85810.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0942]
 gb|EVM89275.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0947]
 gb|EVM90413.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0945]
 gb|EVM94049.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0948]
 gb|EVM97700.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0954]
 gb|EVM99903.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0951]
 gb|EVN04814.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0956]
 gb|EVN06160.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0957]
 gb|EVN11500.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0960]
 gb|EVN11645.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0961]
 gb|EVN15059.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0965]
 gb|EVN16803.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0966]
 gb|EVN21630.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0967]
 gb|EVN21644.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0968]
 gb|EVN24405.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0969]
 gb|EVN28991.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0970]
 gb|EVN31737.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0971]
 gb|EVN34022.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0972]
 gb|EVN36558.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0979]
 gb|EVN38351.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0974]
 gb|EVN41741.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0975]
 gb|EVN43771.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0983]
 gb|EVN48167.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0984]
 gb|EVN50019.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0982]
 gb|EVN52334.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0988]
 gb|EVN52424.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0985]
 gb|EVN57671.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0987]
 gb|EVN62031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0993]
 gb|EVN62102.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0989]
 gb|EVN66469.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0997]
 gb|EVN67338.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1002]
 gb|EVN68834.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1000]
 gb|EVN76401.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1003]
 gb|EVN76749.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1006]
 gb|EVN79295.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1009]
 gb|EVN80351.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1011]
 gb|EVN84940.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1012]
 gb|EVN88597.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1013]
 gb|EVN91477.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1019]
 gb|EVN92237.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1017]
 gb|EVN92525.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1014]
 gb|EVN99413.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1021]
 gb|EVO01288.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1022]
 gb|EVO02919.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1023]
 gb|EVO07811.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1025]
 gb|EVO09903.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1027]
 gb|EVO11648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1026]
 gb|EVO14872.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1030]
 gb|EVO16981.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1031]
 gb|EVO20540.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1033]
 gb|EVO25668.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1035]
 gb|EVO25771.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1041]
 gb|EVO32366.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1046]
 gb|EVO36383.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1048]
 gb|EVO38778.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1049]
 gb|EVO41744.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1050]
 gb|EVO44319.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1053]
 gb|EVO47442.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1054]
 gb|EVO49816.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1056]
 gb|EVO51648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1058]
 gb|EVO56361.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1059]
 gb|EVO58157.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1066]
 gb|EVO59887.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1067]
 gb|EVO63503.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1069]
 gb|EVO66288.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1074]
 gb|EVO70210.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1077]
 gb|EVO70921.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1070]
 gb|EVO74474.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1079]
 gb|EVO78082.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1080]
 gb|EVO78144.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1081]
 gb|EVO82905.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1082]
 gb|EVO85967.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1084]
 gb|EVO88816.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1085]
 gb|EVO91355.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1087]
 gb|EVO93128.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1088]
 gb|EVO96199.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1089]
 gb|EVO99374.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1090]
 gb|EVO99777.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1091]
 gb|EVP05138.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1096]
 gb|EVP08660.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1094]
 gb|EVP12269.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1102]
 gb|EVP12367.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1101]
 gb|EVP15550.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1560]
 gb|EVP17539.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1562]
 gb|EVP18179.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1566]
 gb|EVP23371.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1567]
 gb|EVP26002.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1570]
 gb|EVP27054.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1569]
 gb|EVP30291.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1571]
 gb|EVP33521.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1573]
 gb|EVP35459.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1572]
 gb|EVP40052.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1575]
 gb|EVP41039.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1574]
 gb|EVP43787.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1576]
 gb|EVP47684.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1577]
 gb|EVP48088.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1580]
 gb|EVP52970.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0747]
 gb|EVP55695.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0749]
 gb|EVP56463.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0753]
 gb|EVP61197.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0754]
 gb|EVP62532.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0757]
 gb|EVP66550.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0758]
 gb|EVP66883.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0759]
 gb|EVP71944.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0760]
 gb|EVP73513.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0762]
 gb|EVP79245.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0763]
 gb|EVP80308.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0764]
 gb|EVP84601.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0766]
 gb|EVP88452.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0767]
 gb|EVP91554.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0768]
 gb|EVP93423.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1369]
 gb|EVP95279.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1366]
 gb|EVP96972.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0771]
 gb|EVQ02383.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1371]
 gb|EVQ04462.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1370]
 gb|EVQ04887.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1372]
 gb|EVQ08861.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1378]
 gb|EVQ11868.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1380]
 gb|EVQ12905.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1377]
 gb|EVQ18689.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1383]
 gb|EVQ20674.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1386]
 gb|EVQ24327.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1387]
 gb|EVQ28663.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1390]
 gb|EVQ30162.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1391]
 gb|EVQ36642.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1396]
 gb|EVQ39500.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1395]
 gb|EVQ40370.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1397]
 gb|EVQ42667.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1398]
 gb|EVQ46292.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1401]
 gb|EVQ50510.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1402]
 gb|EVQ50936.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1400]
 gb|EVQ54165.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1403]
 gb|EVQ56494.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1406]
 gb|EVQ61216.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1409]
 gb|EVQ62594.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1408]
 gb|EVQ64725.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1410]
 gb|EVQ67577.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1412]
 gb|EVQ70138.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1411]
 gb|EVQ73222.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1413]
 gb|EVQ78357.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1415]
 gb|EVQ83656.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1416]
 gb|EVQ87297.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1420]
 gb|EVQ88170.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1421]
 gb|EVQ91368.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1424]
 gb|EVQ93203.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1422]
 gb|EVQ94508.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1423]
 gb|EVQ99464.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1425]
 gb|EVR04020.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1429]
 gb|EVR08383.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1431]
 gb|EVR09874.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1430]
 gb|EVR13212.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1432]
 gb|EVR14543.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1433]
 gb|EVR18848.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1434]
 gb|EVR21323.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1435]
 gb|EVR23850.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1437]
 gb|EVR26052.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1436]
 gb|EVR29374.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1438]
 gb|EVR33022.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1441]
 gb|EVR33148.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1443]
 gb|EVR37361.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1444]
 gb|EVR40168.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1446]
 gb|EVR47463.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1449]
 gb|EVR53107.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1452]
 gb|EVR56895.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1454]
 gb|EVR61001.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1455]
 gb|EVR64403.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1456]
 gb|EVR65685.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1457]
 gb|EVR69064.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1458]
 gb|EVR72426.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1459]
 gb|EVR75246.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1460]
 gb|EVR78400.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1461]
 gb|EVR80082.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1464]
 gb|EVR83373.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1467]
 gb|EVR84982.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1469]
 gb|EVR88136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1465]
 gb|EVR91938.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1471]
 gb|EVR94868.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1470]
 gb|EVR94946.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1472]
 gb|EVR98644.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1474]
 gb|EVS00569.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1344]
 gb|EVS04636.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1345]
 gb|EVS06449.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1347]
 gb|EVS08369.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1338]
 gb|EVS15369.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1349]
 gb|EVS16047.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1350]
 gb|EVS19711.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1348]
 gb|EVS20386.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1352]
 gb|EVS25132.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1354]
 gb|EVS25264.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1351]
 gb|EVS26851.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1353]
 gb|EVS31729.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1355]
 gb|EVS34256.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1356]
 gb|EVS37786.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1363]
 gb|EVS39877.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1360]
 gb|EVS42229.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1361]
 gb|EVS46012.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1365]
 gb|EVS48408.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1476]
 gb|EVS50217.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1477]
 gb|EVS53235.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1478]
 gb|EVS55787.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1482]
 gb|EVS59923.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1483]
 gb|EVS60399.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1484]
 gb|EVS65966.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1490]
 gb|EVS67148.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1487]
 gb|EVS68768.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1489]
 gb|EVS72474.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1491]
 gb|EVS72969.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1493]
 gb|EVS77364.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1496]
 gb|EVS79262.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1500]
 gb|EVS81630.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1497]
 gb|EVS85064.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1504]
 gb|EVS87782.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1505]
 gb|EVS92499.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1507]
 gb|EVS96279.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1508]
 gb|EVS96382.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1506]
 gb|EVT00788.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1512]
 gb|EVT04930.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1513]
 gb|EVT06006.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1511]
 gb|EVT08637.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1515]
 gb|EVT09010.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1514]
 gb|EVT16037.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1519]
 gb|EVT16340.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1516]
 gb|EVT20756.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1523]
 gb|EVT22180.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1518]
 gb|EVT24981.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1524]
 gb|EVT29090.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1528]
 gb|EVT29541.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1525]
 gb|EVT35069.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1529]
 gb|EVT36035.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1530]
 gb|EVT39444.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1532]
 gb|EVT40674.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1534]
 gb|EVT43971.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1535]
 gb|EVT44493.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1538]
 gb|EVT49145.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1541]
 gb|EVT50662.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1542]
 gb|EVT53923.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1545]
 gb|EVT58498.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1552]
 gb|EVT60446.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1551]
 gb|EVT61931.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1550]
 gb|EVT64856.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1553]
 gb|EVT68108.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1557]
 gb|EVT69565.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1559]
 gb|EVU24599.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M81490]
 gb|EVU24912.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W25097]
 gb|EVU28461.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M81424]
 gb|EVU31760.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W28469]
 gb|EVU35720.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T45974]
 gb|EVU40829.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F41886]
 gb|EVU41375.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F41906]
 gb|EVU42256.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F41913]
 gb|EVU50826.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M85201]
 gb|EVU51754.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T49441]
 gb|EVU54976.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W31936]
 gb|EVU55017.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W31852]
 gb|EVU60858.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W31862]
 gb|EVU63176.1| iron compound ABC transporter, permease [Staphylococcus aureus 
S30087]
 gb|EVU64298.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F45300]
 gb|EVU69434.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F84093]
 gb|EVU77476.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M92086]
 gb|EVU78972.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M92071]
 gb|EVU85392.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T56203]
 gb|EVU86259.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W35325]
 gb|EVU87247.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W38597]
 gb|EVU90525.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13316]
 gb|EVU94068.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13403]
 gb|EVU94705.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13384]
 gb|EVU97730.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T59607]
 gb|EVV01959.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W35356]
 gb|EVV03272.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W41914]
 gb|EVV06805.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H19520]
 gb|EVV09099.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W41918]
 gb|EVV17158.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F54461]
 gb|EVV18999.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F54467]
 gb|EVV21979.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F54494]
 gb|EVV23459.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F54471]
 gb|EVV24823.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H12818]
 gb|EVV26876.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M52055]
 gb|EVV33842.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H60145]
 gb|EVV35495.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W85047]
 gb|EVV38415.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F16077]
 gb|EVV40685.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F25913]
 gb|EVV40915.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T62328]
 gb|EVV46557.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M20676]
 gb|EVV47767.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T66282]
 gb|EVV52321.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W48872]
 gb|EVV55041.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T66286]
 gb|EVV57103.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F90608]
 gb|EVV59794.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M45245]
 gb|EVV65355.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H57070]
 gb|EVV65600.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F12874]
 gb|EVV66274.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T25611]
 gb|EVV71170.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M64164]
 gb|EVV72512.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M67290]
 gb|EVV75629.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H69239]
 gb|EVV78609.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M64191]
 gb|EVV81520.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H75198]
 gb|EVV83027.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W18443]
 gb|EVV87057.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M70590]
 gb|EVV89581.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T34703]
 gb|EVV90653.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T34696]
 gb|EVV94972.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M73849]
 gb|EVV95942.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W21472]
 gb|EVV97571.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H81437]
 gb|EVW02548.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W24216]
 gb|EVW05565.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H84489]
 gb|EVW05802.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T28847]
 gb|EVW07261.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T41081]
 gb|EVW11256.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H84492]
 gb|EVW15535.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H84507]
 gb|EVW18243.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F40814]
 gb|EVW20141.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T28854]
 gb|EVW24511.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F43676]
 gb|EVW26204.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M80333]
 gb|EVW29299.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W33796]
 gb|EVW32466.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T47181]
 gb|EVW34154.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F46632]
 gb|EVW40169.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H15665]
 gb|EVW42892.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F52748]
 gb|EVW44882.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M12703]
 gb|EVW47458.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M12714]
 gb|EVW51690.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H87658]
 gb|EVW52581.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M12717]
 gb|EVW55878.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W42929]
 gb|EVW59724.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W42932]
 gb|EVW60648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H18808]
 gb|EVW62794.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H18813]
 gb|EVW66606.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H18809]
 gb|EVW70128.1| iron compound ABC transporter, permease [Staphylococcus aureus 
S72396]
 gb|EVW70236.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M16220]
 gb|EVW75725.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H21935]
 gb|EVW76919.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H18811]
 gb|EVW80108.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H21924]
 gb|EVW83200.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F59156]
 gb|EVW84809.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T62854]
 gb|EVW87611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W48906]
 gb|EVW91123.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T62848]
 gb|EVW91816.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H24884]
 gb|EVW96264.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F62007]
 gb|EVW98742.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F62010]
 gb|EVW99093.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M20894]
 gb|EVX03084.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M20913]
 gb|EVX05415.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W51776]
 gb|EVX14985.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H27761]
 gb|EVX15309.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H27739]
 gb|EVX16512.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H27777]
 gb|EVX20716.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M24400]
 gb|EVX21565.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F65057]
 gb|EVX25642.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M27449]
 gb|EVX31752.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T71868]
 gb|EVX33688.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T71872]
 gb|EVX37579.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T71888]
 gb|EVX38736.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H33602]
 gb|EVX41632.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H33636]
 gb|EVX43770.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H33594]
 gb|EVX49951.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W60774]
 gb|EVX50174.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W60784]
 gb|EVX53719.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H30732]
 gb|EVX57155.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W60801]
 gb|EVX60082.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F74139]
 gb|EVX65289.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77005]
 gb|EVX71614.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H30737]
 gb|EVX72587.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F76996]
 gb|EVX79846.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H42737]
 gb|EVX83644.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H42759]
 gb|EVX89789.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F80358]
 gb|EVX90020.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F80381]
 gb|EVX92169.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F80349]
 gb|EVX94837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T84594]
 gb|EVX95295.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F80375]
 gb|EVX98770.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T84592]
 gb|EVY01804.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T84595]
 gb|EVY06876.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H45755]
 gb|EVY07189.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H45765]
 gb|EVY13280.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F83269]
 gb|EVY13572.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F83251]
 gb|EVY19305.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T87526]
 gb|EVY23687.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W73060]
 gb|EVY23979.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F83272]
 gb|EVY26359.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H48649]
 gb|EVY27368.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H48646]
 gb|EVY32510.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T81559]
 gb|EVY32947.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T87965]
 gb|EVY37841.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T87972]
 gb|EVY39376.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F89441]
 gb|EVY41518.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F89468]
 gb|EVY42353.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T12923]
 gb|EVY46983.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W79328]
 gb|EVY52952.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92765]
 gb|EVY53760.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92753]
 gb|EVY57820.1| iron compound ABC transporter, permease [Staphylococcus aureus 
S11444]
 gb|EVY61642.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W82303]
 gb|EVY64908.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W76127]
 gb|EVY69344.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H71785]
 gb|EVY71141.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H57815]
 gb|EVY73418.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H71781]
 gb|EVY75889.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T45945]
 gb|EVY83487.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T49833]
 gb|EVY84379.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H79477]
 gb|EVY85628.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H23829]
 gb|EVY89120.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H23830]
 gb|EVY92990.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T72838]
 gb|EVZ04655.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H37776]
 gb|EVZ08744.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H37781]
 gb|EVZ11911.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77710]
 gb|EVZ17100.1| iron compound ABC transporter, permease [Staphylococcus aureus 
S39407]
 gb|EVZ22709.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F81035]
 gb|EVZ25348.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T12805]
 gb|EVZ27627.1| iron compound ABC transporter, permease [Staphylococcus aureus 
S39411]
 gb|EVZ30894.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T12818]
 gb|EVZ31949.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T16117]
 gb|EVZ36608.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F19383]
 gb|EVZ37753.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F22893]
 gb|EVZ40631.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F26088]
 gb|EVZ42253.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F22898]
 gb|EVZ48332.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F32119]
 gb|EVZ48624.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F35307]
 gb|EVZ50442.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63154]
 gb|EVZ54237.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F66300]
 gb|EVZ54743.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63179]
 gb|EVZ59458.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F74220]
 gb|EVZ61634.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F66307]
 gb|EVZ64289.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77930]
 gb|EVZ65380.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H24637]
 gb|EVZ68054.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H24662]
 gb|EVZ71972.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H27858]
 gb|EVZ77335.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H31276]
 gb|EVZ82477.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H31290]
 gb|EVZ84200.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H40575]
 gb|EVZ87504.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H34245]
 gb|EVZ90667.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H40583]
 gb|EVZ93133.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H40569]
 gb|EVZ96109.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H57821]
 gb|EVZ96964.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H57822]
 gb|EWA01645.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H57823]
 gb|EWA04731.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H61003]
 gb|EWA06964.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H64299]
 gb|EWA12296.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H64303]
 gb|EWA12994.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H70821]
 gb|EWA18418.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H70834]
 gb|EWA22648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H74056]
 gb|EWA25764.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H77094]
 gb|EWA28097.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H77098]
 gb|EWA30569.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M16438]
 gb|EWA31257.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H77102]
 gb|EWA35871.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M31588]
 gb|EWA36420.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M28112]
 gb|EWA43166.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M65003]
 gb|EWA44304.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M39841]
 gb|EWA45830.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M68467]
 gb|EWA52996.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M68475]
 gb|EWA53192.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M71813]
 gb|EWA59469.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T26751]
 gb|EWA61386.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M74952]
 gb|EWA63672.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T30033]
 gb|EWA67183.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T33147]
 gb|EWA70784.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T33139]
 gb|EWA71992.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T39328]
 gb|EWA72967.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T39363]
 gb|EWA76332.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T62346]
 gb|EWA82979.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T69703]
 gb|EWA83492.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T69686]
 gb|EWA84599.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T69716]
 gb|EWA89132.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T69721]
 gb|EWA93504.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T72889]
 gb|EWA95834.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T72876]
 gb|EWA97046.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T76010]
 gb|EWB01801.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T76030]
 gb|EWB05648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T79159]
 gb|EWB07707.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T86006]
 gb|EWB08613.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T82627]
 gb|EWB13458.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T86045]
 gb|EWB17116.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T86048]
 gb|EWB23024.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W15997]
 gb|EWB23148.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T86055]
 gb|EWB29371.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W16001]
 gb|EWB34440.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W21940]
 gb|EWB38839.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W52104]
 gb|EWB39769.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W52117]
 gb|EWB44083.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W52120]
 gb|EWB47294.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W55442]
 gb|EWB48000.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W55446]
 gb|EWB53163.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W55451]
 gb|EWB54941.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W58473]
 gb|EWB58136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W64953]
 gb|EWB60487.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W68479]
 gb|EWB60927.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W85440]
 gb|EWB69922.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W88551]
 gb|EWB70236.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W88555]
 gb|EWB74154.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W91963]
 gb|EWB78619.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W31947]
 gb|EWB80709.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H12822]
 gb|EWB82465.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H90284]
 gb|EWB84311.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T59609]
 gb|EWB86536.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M16486]
 gb|EWB90896.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T66292]
 gb|EWB92580.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T66243]
 gb|EWB96151.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W12461]
 gb|EWB99293.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M80329]
 gb|EWC02544.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F46600]
 gb|EWC04510.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F62013]
 gb|EWC05458.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F55987]
 gb|EWC09520.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T74602]
 gb|EWC15145.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F27253]
 gb|EWC21183.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T72814]
 gb|EWC26558.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F12856]
 gb|EWC29092.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H37235]
 gb|EWC32662.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M24487]
 gb|EWC33247.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T23068]
 gb|EWG57526.1| iron ABC transporter permease [Staphylococcus aureus MUF168]
 gb|EWH48739.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T54283]
 gb|EWH51980.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M16597]
 gb|EWH54396.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13048]
 gb|EWH55777.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H85008]
 gb|EWH57531.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M80992]
 gb|EWH61518.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H81885]
 gb|EWH66895.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F50126]
 gb|EWH68112.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H81809]
 gb|EWH69036.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H81800]
 gb|EWH70890.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F36670]
 gb|EWH74544.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W92100]
 gb|EWH75491.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F50076]
 gb|EWH79459.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W92052]
 gb|EWH83192.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W85326]
 gb|EWH86058.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75132]
 gb|EWH89848.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T37849]
 gb|EWH91561.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T30569]
 gb|EWH91835.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W64921]
 gb|EWH96004.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M53356]
 gb|EWH98606.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M49691]
 gb|EWH99031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M77202]
 gb|EWI05469.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H58198]
 gb|EWI08834.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H58177]
 gb|EWI11495.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H51158]
 gb|EWI15880.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77942]
 gb|EWI16203.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F26873]
 gb|EWI18658.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F23347]
 gb|EWI23029.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F23336]
 gb|EWI27160.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F20105]
 gb|EWI28785.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W50092]
 gb|EWI31141.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W46883]
 gb|EWI34659.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W50101]
 gb|EWI37219.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W36570]
 gb|EWI38740.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W36553]
 gb|EWI43884.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W33578]
 gb|EWI44492.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W33592]
 gb|EWI48245.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W23225]
 gb|EWI55616.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W23214]
 gb|EWI57331.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W23207]
 gb|EWI59856.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T64318]
 gb|EWI62914.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T67327]
 gb|EWI64457.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T57415]
 gb|EWI68885.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T57397]
 gb|EWI70146.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T54294]
 gb|EWI70278.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T60805]
 gb|EWI76121.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T51022]
 gb|EWI79583.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T54280]
 gb|EWI81327.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T44834]
 gb|EWI82293.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T51001]
 gb|EWI86749.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T44830]
 gb|EWI89845.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T44811]
 gb|EWI91949.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T44461]
 gb|EWI95465.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T40867]
 gb|EWI99663.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M91160]
 gb|EWJ04899.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M91141]
 gb|EWJ08007.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M87641]
 gb|EWJ09709.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M87665]
 gb|EWJ13468.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M80979]
 gb|EWJ15598.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M77238]
 gb|EWJ22528.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M77225]
 gb|EWJ24306.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M20198]
 gb|EWJ27406.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M77210]
 gb|EWJ30342.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M20180]
 gb|EWJ32037.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13065]
 gb|EWJ35426.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M16586]
 gb|EWJ35685.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13060]
 gb|EWJ39956.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H91384]
 gb|EWJ43659.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H87668]
 gb|EWJ47230.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H85003]
 gb|EWJ54562.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H84973]
 gb|EWJ54728.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H25872]
 gb|EWJ59604.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H12930]
 gb|EWJ63565.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F60346]
 gb|EWJ67567.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F57036]
 gb|EWJ69617.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F57021]
 gb|EWJ71383.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F57033]
 gb|EWJ74674.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F53388]
 gb|EWJ78224.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F43252]
 gb|EWJ79750.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F43221]
 gb|EWJ82841.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F43199]
 gb|EWJ85275.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F36699]
 gb|EWJ88516.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F43212]
 gb|EWJ91739.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F36687]
 gb|EWJ95791.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W81816]
 gb|EWJ96843.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F36683]
 gb|EWJ99008.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W92106]
 gb|EWK09804.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75098]
 gb|EWK12093.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W64958]
 gb|EWK15589.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W20096]
 gb|EWK20546.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T92889]
 gb|EWK21348.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W16028]
 gb|EWK23712.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T89467]
 gb|EWK25203.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T92876]
 gb|EWK29369.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T37840]
 gb|EWK31233.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T89463]
 gb|EWK31460.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T34036]
 gb|EWK37522.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T30565]
 gb|EWK41690.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T20142]
 gb|EWK45091.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T23868]
 gb|EWK56857.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T16676]
 gb|EWK57656.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T16664]
 gb|EWK59425.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T16669]
 gb|EWK65817.1| iron compound ABC transporter, permease [Staphylococcus aureus 
S56450]
 gb|EWK68406.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M73702]
 gb|EWK71081.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M73703]
 gb|EWK74171.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M70073]
 gb|EWK78542.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M66673]
 gb|EWK79594.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M66661]
 gb|EWK85036.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M62699]
 gb|EWK86575.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M56985]
 gb|EWK88989.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M53327]
 gb|EWK91703.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M46077]
 gb|EWK93435.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M46066]
 gb|EWK96147.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M46070]
 gb|EWK97411.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H75143]
 gb|EWL00297.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H71553]
 gb|EWL02787.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H71538]
 gb|EWL08680.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H68252]
 gb|EWL17402.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H64962]
 gb|EWL21413.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H64941]
 gb|EWL21910.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H58183]
 gb|EWL26710.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H58165]
 gb|EWL28317.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H58191]
 gb|EWL31395.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H47671]
 gb|EWL35607.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F88387]
 gb|EWL37674.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F88375]
 gb|EWL40600.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F88369]
 gb|EWL40704.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F88405]
 gb|EWL46512.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F84763]
 gb|EWL47302.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F84732]
 gb|EWL52112.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F81389]
 gb|EWL52981.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F81381]
 gb|EWL53835.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77974]
 gb|EWL59068.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77967]
 gb|EWL62060.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77960]
 gb|EWL62588.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77919]
 gb|EWL67166.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F29997]
 gb|EWL73924.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F26884]
 gb|EWL76507.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F29993]
 gb|EWL80837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F26858]
 gb|EWL81334.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F23368]
 gb|EWL84906.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F20115]
 gb|EWL85297.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F23353]
 gb|EWL91345.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F16470]
 gb|EWL93028.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F16432]
 gb|EWL96023.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F13027]
 gb|EWL97774.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F13022]
 gb|EWM01216.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T60795]
 gb|EWM02902.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W29641]
 gb|EWM06690.1| iron compound ABC transporter, permease [Staphylococcus aureus 
AMMC6114]
 gb|EWM08311.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6049]
 gb|EWM79914.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1306]
 gb|EWM80192.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1316]
 gb|EWM86526.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1265]
 gb|EWM87420.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1332]
 gb|EWM89285.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1281]
 gb|EWM95757.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1226]
 gb|EWM97540.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1259]
 gb|EWM99790.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1251]
 gb|EWN02130.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1212]
 gb|EWN04264.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1202]
 gb|EWN07461.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1205]
 gb|EWN10641.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1191]
 gb|EWN14096.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1190]
 gb|EWN15172.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1179]
 gb|EWN19521.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1161]
 gb|EWN22461.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1178]
 gb|EWN23450.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1157]
 gb|EWN26630.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1154]
 gb|EWN29393.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1150]
 gb|EWN31635.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1143]
 gb|EWN34042.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1145]
 gb|EWN36331.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1123]
 gb|EWN39770.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1115]
 gb|EWN42910.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1111]
 gb|EWN45871.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1105]
 gb|EWN46857.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1106]
 gb|EWN50400.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1337]
 gb|EWN53730.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1336]
 gb|EWN56847.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1334]
 gb|EWN58649.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1333]
 gb|EWN60110.1| iron compound ABC transporter, permease, partial [Staphylococcus 
aureus M1330]
 gb|EWN60907.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1330]
 gb|EWN62876.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1331]
 gb|EWN67069.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1329]
 gb|EWN70611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1328]
 gb|EWN71979.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1326]
 gb|EWN74719.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1324]
 gb|EWN78880.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1323]
 gb|EWN79142.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1325]
 gb|EWN83247.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1318]
 gb|EWN86089.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1317]
 gb|EWN89061.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1319]
 gb|EWN90813.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1315]
 gb|EWN94136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1314]
 gb|EWN96656.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1312]
 gb|EWN96699.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1313]
 gb|EWO01605.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1310]
 gb|EWO04863.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1305]
 gb|EWO05602.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1308]
 gb|EWO10809.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1303]
 gb|EWO12722.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1304]
 gb|EWO13594.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1302]
 gb|EWO17834.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1301]
 gb|EWO20591.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1298]
 gb|EWO25838.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1296]
 gb|EWO27697.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1297]
 gb|EWO28481.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1295]
 gb|EWO32301.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1293]
 gb|EWO36855.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1290]
 gb|EWO39954.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1289]
 gb|EWO40544.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1288]
 gb|EWO44758.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1285]
 gb|EWO45990.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1282]
 gb|EWO54374.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1280]
 gb|EWO56554.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1279]
 gb|EWO61275.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1274]
 gb|EWO64395.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1276]
 gb|EWO67286.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1273]
 gb|EWO70300.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1271]
 gb|EWO77502.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1269]
 gb|EWO77947.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1268]
 gb|EWO78025.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1270]
 gb|EWO83313.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1263]
 gb|EWO84249.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1267]
 gb|EWO85371.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1264]
 gb|EWO91612.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1261]
 gb|EWO97048.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1262]
 gb|EWO98653.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1258]
 gb|EWP01582.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1254]
 gb|EWP05459.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1252]
 gb|EWP06523.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1250]
 gb|EWP09920.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1247]
 gb|EWP10831.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1249]
 gb|EWP16009.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1246]
 gb|EWP18699.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1245]
 gb|EWP22032.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1243]
 gb|EWP25159.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1241]
 gb|EWP28948.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1239]
 gb|EWP32555.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1238]
 gb|EWP36298.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1236]
 gb|EWP36633.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1235]
 gb|EWP41851.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1234]
 gb|EWP44943.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1233]
 gb|EWP46374.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1232]
 gb|EWP50575.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1231]
 gb|EWP52801.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1230]
 gb|EWP55146.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1227]
 gb|EWP58582.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1222]
 gb|EWP64489.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1221]
 gb|EWP65075.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1220]
 gb|EWP73071.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1218]
 gb|EWP78097.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1214]
 gb|EWP81864.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1209]
 gb|EWP86478.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1207]
 gb|EWP91870.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1206]
 gb|EWP93290.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1204]
 gb|EWP95371.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1203]
 gb|EWP96546.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1201]
 gb|EWQ03151.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1200]
 gb|EWQ03718.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1197]
 gb|EWQ08692.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1192]
 gb|EWQ11894.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1189]
 gb|EWQ15485.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1186]
 gb|EWQ16324.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1187]
 gb|EWQ20404.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1182]
 gb|EWQ21152.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1181]
 gb|EWQ25718.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1180]
 gb|EWQ30643.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1174]
 gb|EWQ33035.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1171]
 gb|EWQ38855.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1166]
 gb|EWQ41004.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1168]
 gb|EWQ44062.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1165]
 gb|EWQ47258.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1162]
 gb|EWQ49769.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1164]
 gb|EWQ52587.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1160]
 gb|EWQ55581.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1159]
 gb|EWQ58041.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1158]
 gb|EWQ60675.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1156]
 gb|EWQ65851.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1153]
 gb|EWQ65953.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1152]
 gb|EWQ72528.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1149]
 gb|EWQ73649.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1148]
 gb|EWQ77544.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1147]
 gb|EWQ77655.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1146]
 gb|EWQ82456.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1144]
 gb|EWQ85133.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1141]
 gb|EWQ87505.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1140]
 gb|EWQ90948.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1139]
 gb|EWQ91657.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1138]
 gb|EWQ97030.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1137]
 gb|EWQ99120.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1130]
 gb|EWR02317.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1136]
 gb|EWR05873.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1132]
 gb|EWR09461.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1128]
 gb|EWR11340.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1127]
 gb|EWR15876.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1122]
 gb|EWR19353.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1124]
 gb|EWR19393.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1121]
 gb|EWR24169.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1120]
 gb|EWR26188.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1117]
 gb|EWR27927.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1116]
 gb|EWR30962.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1113]
 gb|EWR32875.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1112]
 gb|EWR36449.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1110]
 gb|EWR39294.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1107]
 gb|EWR40328.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1108]
 gb|EWR49841.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6055]
 gb|EWR50065.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6126]
 gb|EWR50897.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HBHO6021]
 gb|EWR55323.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6115]
 gb|EWR59578.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6114]
 gb|EWR62398.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6086]
 gb|EWR65646.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6103]
 gb|EWR68957.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6109]
 gb|EWR69369.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6079]
 gb|EWR72223.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6066]
 gb|EWR78021.1| iron compound ABC transporter, permease [Staphylococcus aureus 
FVRH6040]
 gb|EWR79084.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6176]
 gb|EWR80773.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6131]
 gb|EWR82647.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6132]
 gb|EWR85881.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6025]
 gb|EWR90070.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6145]
 gb|EWR92382.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6098]
 gb|EWR92848.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6123]
 gb|EWS00405.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6014]
 gb|EWS03267.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCLE6012]
 gb|EWS03534.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6043]
 gb|EWS08913.1| iron compound ABC transporter, permease [Staphylococcus aureus 
OCMM6017]
 gb|EWS09828.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WAMC6049]
 gb|EWS12691.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SMMC6016]
 gb|EWS14823.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6037]
 gb|EWS20798.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LPIH6004]
 gb|EWS23302.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HBHO6050]
 gb|EWS28038.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6047]
 gb|EWS30602.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCA6006]
 gb|EWS33962.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SCOA6009]
 gb|EWS37083.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJUD6085]
 gb|EWS38456.1| iron compound ABC transporter, permease [Staphylococcus aureus 
GGMC6004]
 gb|EWS39842.1| iron compound ABC transporter, permease [Staphylococcus aureus 
COAS6044]
 gb|EWS42789.1| iron compound ABC transporter, permease [Staphylococcus aureus 
MISS6103]
 gb|EWS44424.1| iron compound ABC transporter, permease [Staphylococcus aureus 
LPIH6010]
 gb|EWT09810.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63704]
 gb|EWT10142.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T70944]
 gb|EWT12920.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T74005]
 gb|EWT15352.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T74154]
 gb|EWT21213.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T74060]
 gb|EWT24214.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T74141]
 gb|EWT24965.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63730]
 gb|EWT28795.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H32126]
 gb|EWT29294.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M32688]
 gb|EWT34457.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H35283]
 gb|EWT34735.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W60060]
 gb|EWT40721.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W62934]
 gb|EWT43424.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W57390]
 gb|EWT49133.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T83715]
 gb|EWT51419.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M39274]
 gb|EWT55275.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W65865]
 gb|EWT55500.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H41070]
 gb|EWT60194.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H41109]
 gb|EWT64357.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H43996]
 gb|EWT65529.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F76239]
 gb|EWT71232.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H47169]
 gb|EWT74589.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F85184]
 gb|EWT76335.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H47224]
 gb|EWT78048.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T12849]
 gb|EWT85370.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F85609]
 gb|EWT87169.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F89046]
 gb|EWT88565.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F89062]
 gb|EWT91841.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F89073]
 gb|EWT92745.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92073]
 gb|EWT93959.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92105_080312]
 gb|EWT98653.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92125]
 gb|EWU00162.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92127]
 gb|EWU01313.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92128]
 gb|EWU08747.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65830]
 gb|EWU09939.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H72115]
 gb|EWU12280.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M52622]
 gb|EWU14183.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H72129_090612]
 gb|EWU19918.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T18865]
 gb|EWU22955.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T36127]
 gb|EWU25149.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T39082]
 gb|EWU28421.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T28649]
 gb|EWU29391.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W73649]
 gb|EWU33589.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W79990_080112]
 gb|EWU33913.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W83133]
 gb|EWU38573.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W89268]
 gb|EWU43615.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F52754]
 gb|EWU47140.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F41902]
 gb|EWU48349.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W21479]
 gb|EWU51188.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M12709]
 gb|EWU53901.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F80354]
 gb|EWU57104.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M36089]
 gb|EWU58736.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T45940]
 gb|EWU63662.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W82310]
 gb|EWU64708.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H79484]
 gb|EWU66056.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W48969]
 gb|EWU67919.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M44986]
 gb|EWU71658.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W48973]
 gb|EWU73447.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M44987]
 gb|EWU76189.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F77709]
 gb|EWU82526.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F74039]
 gb|EWU84382.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F74035]
 gb|EWU89622.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F31094]
 gb|EWU89692.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H41336]
 gb|EWU90972.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H44713]
 gb|EWU94639.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F46780]
 gb|EWU96729.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F46785]
 gb|EWU98390.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F50093]
 gb|EWV03136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F46798]
 gb|EWV05979.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F50121]
 gb|EWV06862.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F53393]
 gb|EWV11382.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F53404]
 gb|EWV11657.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H16097]
 gb|EWV14202.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F53399]
 gb|EWV19973.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H19476]
 gb|EWV21691.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H25869]
 gb|EWV23034.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M16552]
 gb|EWV24262.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T57402]
 gb|EWV27611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T67319]
 gb|EWV33106.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W29625]
 gb|EWV34660.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W39821]
 gb|EWV36774.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W46839]
 gb|EWV38759.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W50110]
 gb|EWV38489.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F60349]
 gb|EWV45323.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F60360]
 gb|EWV45547.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F60357]
 gb|EWV51254.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63750]
 gb|EWV53201.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63687]
 gb|EWV55550.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W18442]
 gb|EWV56950.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63787]
 gb|EWV60182.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M28487]
 gb|EWV64838.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M29068]
 gb|EWV67358.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M28485]
 gb|EWV68801.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T74091]
 gb|EWV71835.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W56912]
 gb|EWV74102.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H32135]
 gb|EWV75778.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H32166]
 gb|EWV77899.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H32181]
 gb|EWV83420.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63786]
 gb|EWV85351.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M32679]
 gb|EWV85619.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F66778]
 gb|EWV91312.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T77618]
 gb|EWV91902.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T77565]
 gb|EWV98260.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F70077]
 gb|EWV99439.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M35938]
 gb|EWW04412.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W62972]
 gb|EWW05333.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M35955]
 gb|EWW10147.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H38226]
 gb|EWW11630.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M35965]
 gb|EWW14727.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H38239]
 gb|EWW16623.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F73229]
 gb|EWW23632.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M39265]
 gb|EWW23750.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H38215]
 gb|EWW30687.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T83705]
 gb|EWW31588.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W65910]
 gb|EWW34792.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W65904]
 gb|EWW36667.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H41079]
 gb|EWW37510.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F76218]
 gb|EWW40190.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W65885]
 gb|EWW44854.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M42507]
 gb|EWW48169.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M42485]
 gb|EWW51130.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H43986]
 gb|EWW53963.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H44015]
 gb|EWW59437.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M45704]
 gb|EWW60731.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T89906]
 gb|EWW62929.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M42496]
 gb|EWW64602.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W70590]
 gb|EWW68475.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W70599]
 gb|EWW69294.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W70568]
 gb|EWW80813.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H47183]
 gb|EWW81485.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F82568]
 gb|EWW87972.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F82573]
 gb|EWW91325.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M49455]
 gb|EWW96286.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M49474]
 gb|EWW98875.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W73676]
 gb|EWX00081.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W73592]
 gb|EWX04720.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H49922]
 gb|EWX08222.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H49917]
 gb|EWX10997.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F16106]
 gb|EWX13198.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F16107]
 gb|EWX15944.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F26021]
 gb|EWX20398.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F85414]
 gb|EWX21045.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F85691]
 gb|EWX23674.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F85660]
 gb|EWX29593.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F89053]
 gb|EWX34001.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F89078]
 gb|EWX34633.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92047]
 gb|EWX35013.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F89075]
 gb|EWX43701.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92119_080312]
 gb|EWX44263.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92089]
 gb|EWX45133.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H49831]
 gb|EWX48450.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H49864]
 gb|EWX51552.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H56219]
 gb|EWX59104.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H56227]
 gb|EWX59878.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H59298]
 gb|EWX60010.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H53188]
 gb|EWX62953.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H75423]
 gb|EWX64177.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H75425]
 gb|EWX64488.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65794]
 gb|EWX72493.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M55878]
 gb|EWX72719.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M49501]
 gb|EWX74230.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M55902]
 gb|EWX76049.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M55890]
 gb|EWX80484.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M59248]
 gb|EWX83466.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M59257]
 gb|EWX86438.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M70006]
 gb|EWX87982.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M59255]
 gb|EWX92123.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M70013]
 gb|EWX93311.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T15889]
 gb|EWX98303.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T22051]
 gb|EWX99225.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T22071_080712]
 gb|EWY01329.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T28640]
 gb|EWY05839.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T36111]
 gb|EWY10268.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W15951]
 gb|EWY10493.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T39093]
 gb|EWY14946.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W73601]
 gb|EWY16150.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W76930]
 gb|EWY21098.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W76994_072512]
 gb|EWY26192.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W79968]
 gb|EWY29539.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W86063]
 gb|EWY30108.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W83140]
 gb|EXM41867.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5852]
 gb|EXM43044.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5814]
 gb|EXM48238.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5855]
 gb|EXM50149.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR126]
 gb|EXM55149.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR133]
 gb|EXM55509.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR116]
 gb|EXM56897.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR104]
 gb|EXM89520.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5798]
 gb|EXM96858.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5802]
 gb|EXN07761.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5806]
 gb|EXN29205.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5816]
 gb|EXN99407.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5846]
 gb|EXO49915.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3515]
 gb|EXO56994.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3508]
 gb|EXO59154.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3512]
 gb|EXO62228.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3505]
 gb|EXO63340.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3507]
 gb|EXO66327.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3504]
 gb|EXO70053.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W12586]
 gb|EXO72027.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W45757]
 gb|EXO73322.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W19276]
 gb|EXO77068.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T86792]
 gb|EXO79647.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T39102]
 gb|EXO84361.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T32092]
 gb|EXO87229.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T24515]
 gb|EXO88414.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T13127]
 gb|EXO89931.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T13126]
 gb|EXO93321.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T13125]
 gb|EXO96421.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79684]
 gb|EXO99671.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H84958]
 gb|EXP00601.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H84956]
 gb|EXP04488.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H75430]
 gb|EXP07287.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H72152]
 gb|EXP07988.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H71778]
 gb|EXP13404.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65853]
 gb|EXP14981.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H31085]
 gb|EXP16653.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F64897]
 gb|EXP20592.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F45779]
 gb|EXP23753.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F36091]
 gb|EXP26350.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W82239]
 gb|EXP34648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W28921]
 gb|EXP40913.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W19270]
 gb|EXP44948.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W19256]
 gb|EXP48736.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W15995]
 gb|EXP50530.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W15990]
 gb|EXP53846.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W15976]
 gb|EXP55649.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W15974]
 gb|EXP61618.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W12582]
 gb|EXP63425.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T62976]
 gb|EXP66449.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T55959]
 gb|EXP68069.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T35622]
 gb|EXP70759.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T55960]
 gb|EXP76648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T32086]
 gb|EXP77147.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M86943]
 gb|EXP81903.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M86940]
 gb|EXP82858.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M90388]
 gb|EXP84112.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79686]
 gb|EXP88525.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79671]
 gb|EXP89333.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79256]
 gb|EXP94318.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79254]
 gb|EXP95546.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M72097]
 gb|EXP97179.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M70018]
 gb|EXQ02747.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M70017]
 gb|EXQ03884.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M67938]
 gb|EXQ07305.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M42184]
 gb|EXQ08921.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M17074]
 gb|EXQ11556.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H88185]
 gb|EXQ13957.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H84959]
 gb|EXQ16761.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H75421]
 gb|EXQ20689.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H68996]
 gb|EXQ23453.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65883]
 gb|EXQ23600.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H72131]
 gb|EXQ28710.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65882]
 gb|EXQ34688.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65878]
 gb|EXQ34953.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65881]
 gb|EXQ36752.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H31086]
 gb|EXQ36791.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65863]
 gb|EXQ41206.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H31084]
 gb|EXQ44303.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H22656]
 gb|EXQ48441.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F64896]
 gb|EXQ56877.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F36090]
 gb|EXQ60711.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F27252]
 gb|EXQ64140.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F26032]
 gb|EXQ66829.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F26051]
 gb|EXQ73311.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F22648]
 gb|AHM69119.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EXX97774.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3769]
 gb|EXX99931.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3907]
 gb|EXY03619.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2070]
 gb|EYF10066.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F16108]
 gb|EYF14101.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F16104]
 gb|EYF19495.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F19470]
 gb|EYF24051.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F29447]
 gb|EYF24602.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H59303_080912]
 gb|EYF30322.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H59329]
 gb|EYF31314.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H59312_080912]
 gb|EYF34448.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M62794]
 gb|EYF38389.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M66468]
 gb|EYF39761.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T25283]
 gb|EYF42435.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T35596]
 gb|EYF44652.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T35594]
 gb|EYF47310.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W12538]
 gb|EYF50955.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T35604]
 gb|EYF52522.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W31983]
 gb|EYF57062.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F45749]
 gb|EYF60036.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W45755_111412]
 gb|EYF60429.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F12749]
 gb|EYF65270.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F12753]
 gb|EYF67883.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F91072]
 gb|EYF68611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F19955]
 gb|EYF73577.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F91077]
 gb|EYF75393.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M72054]
 gb|EYF75628.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F87602]
 gb|EYF80228.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M72087]
 gb|EYF86120.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T16615]
 gb|EYF89969.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75229]
 gb|EYF90815.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T16619]
 gb|EYF94980.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W82215]
 gb|EYF95742.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75234]
 gb|EYF99866.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W85837]
 gb|EYG06728.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W89581]
 gb|EYG09450.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F48959]
 gb|EYG09871.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F42559]
 gb|EYG15049.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F52326]
 gb|EYG15785.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F71576]
 gb|EYG17290.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F74820]
 gb|EYG22636.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H15899]
 gb|EYG23129.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H19398]
 gb|EYG28524.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H19420]
 gb|EYG29296.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H43694]
 gb|EYG35907.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H47117]
 gb|EYG39237.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M20726]
 gb|EYG39770.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H81898]
 gb|EYG42864.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M42212]
 gb|EYG46704.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M57729]
 gb|EYG50107.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79667]
 gb|EYG51198.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M90383]
 gb|EYG55080.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T42550]
 gb|EYG56385.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T47161]
 gb|EYG63582.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W35455]
 gb|EYG67108.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W42270]
 gb|EYG67242.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W42196]
 gb|EYG70762.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F31078]
 gb|EYG72409.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W52298]
 gb|EYG77272.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F48611]
 gb|EYG81386.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F48607]
 gb|EYG84392.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H12890]
 gb|EYG87956.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H20315]
 gb|EYG90489.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H50411]
 gb|EYG95710.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M67929_020413]
 gb|EYG99147.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M66407]
 gb|EYH00864.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M67957]
 gb|EYH03764.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T22073]
 gb|EYH08337.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W24177]
 gb|EYH11957.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W41765]
 gb|EYH15725.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W80041]
 gb|EYH17129.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W80011]
 gb|EYH17868.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W80042]
 gb|EYH22431.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F71592]
 gb|EYH25845.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F91084]
 gb|EYH30707.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H47139]
 gb|EYH31762.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H65856]
 gb|EYH34539.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H88188]
 gb|EYH39850.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T39105]
 gb|EYH42653.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W45758]
 gb|EYH46719.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W82238]
 gb|EYJ02683.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W53395]
 gb|EYJ05084.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F63712]
 gb|EYJ06752.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M32669]
 gb|EYJ12090.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M35954]
 gb|EYJ13200.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F12915]
 gb|EYJ17431.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F12917]
 gb|EYJ22091.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H72119]
 gb|EYJ24694.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F19466]
 gb|EYJ28212.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T28653]
 gb|EYJ33273.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T35615]
 gb|EYJ35724.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W86059]
 gb|EYJ40935.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F42568]
 gb|EYJ44659.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F42580]
 gb|EYJ44766.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F42579]
 gb|EYJ48906.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F42582]
 gb|EYJ49992.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F48950]
 gb|EYJ53317.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F45759]
 gb|EYJ59003.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F80972]
 gb|EYJ59425.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F59332]
 gb|EYJ63028.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F59335]
 gb|EYJ64775.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H12662]
 gb|EYJ68379.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H15911]
 gb|EYJ70524.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H19392]
 gb|EYJ72208.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H22632]
 gb|EYJ78582.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H43687]
 gb|EYJ78903.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H22637]
 gb|EYJ82359.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H43690]
 gb|EYJ83935.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H81901]
 gb|EYJ90333.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H88170]
 gb|EYJ93072.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H88163]
 gb|EYJ96464.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13099]
 gb|EYK04250.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M17027]
 gb|EYK07013.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M24416]
 gb|EYK10382.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M24418]
 gb|EYK13334.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M35158]
 gb|EYK14550.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M45726]
 gb|EYK14611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M24419]
 gb|EYK22074.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M54162]
 gb|EYK25280.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M57746]
 gb|EYK26480.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M79664]
 gb|EYK31396.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M83332]
 gb|EYK33160.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M90396]
 gb|EYK37545.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T13128]
 gb|EYK39588.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T13096]
 gb|EYK43183.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T42547]
 gb|EYK45357.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T45839]
 gb|EYK49038.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T45836]
 gb|EYK49612.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T49198]
 gb|EYK53557.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T52642]
 gb|EYK54950.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T49201]
 gb|EYK59703.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T52649]
 gb|EYK61291.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T55950]
 gb|EYK64111.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T59618]
 gb|EYK67002.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T66622]
 gb|EYK73223.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T83543]
 gb|EYK74040.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T70161]
 gb|EYK74265.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T66632]
 gb|EYK84000.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T83563]
 gb|EYK84274.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T86825]
 gb|EYK85213.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W19220]
 gb|EYK87623.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W25787]
 gb|EYK90897.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W25814]
 gb|EYK93797.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W32014]
 gb|EYK95043.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W38532]
 gb|EYK99895.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W42255]
 gb|EYL03711.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W45750]
 gb|EYL10766.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W52294]
 gb|EYL12890.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W55536]
 gb|EYL15519.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W62344]
 gb|EYL18357.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F16533]
 gb|EYL18486.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W62354]
 gb|EYL22967.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F23585]
 gb|EYL24678.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F27233]
 gb|EYL29672.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F38211]
 gb|EYL30563.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F29214]
 gb|EYL30834.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F48420]
 gb|EYL37428.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F48422]
 gb|EYL38123.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F48603]
 gb|EYL44115.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F92121]
 gb|EYL47330.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F76253]
 gb|EYL51431.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H20322]
 gb|EYL52510.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H32175]
 gb|EYL60798.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H50387]
 gb|EYL61359.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H59325]
 gb|EYL61584.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H50403]
 gb|EYL67076.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H64570]
 gb|EYL71499.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H89939]
 gb|EYL73711.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H89941]
 gb|EYL73931.1| iron compound ABC transporter, permease [Staphylococcus aureus 
H83025]
 gb|EYL76758.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M13559]
 gb|EYL78474.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M17301]
 gb|EYL80160.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M17299]
 gb|EYL85306.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M25139]
 gb|EYL92189.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M67953]
 gb|EYL93915.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M66410]
 gb|EYL97163.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M72095_021113]
 gb|EYM01084.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M91652]
 gb|EYM03531.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T15928]
 gb|EYM06548.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T15898]
 gb|EYM07973.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T31892]
 gb|EYM13624.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T22074]
 gb|EYM15532.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T59813]
 gb|EYM19973.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W13012_022013]
 gb|EYM25330.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W27852]
 gb|EYM28002.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W34837]
 gb|EYM30770.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W34839]
 gb|EYM36266.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W34848]
 gb|EYM36757.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W41757]
 gb|EYM41616.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W45421]
 gb|EYM42905.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75242]
 gb|EYM47313.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W75262]
 gb|EYM48166.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W76995]
 gb|EYM52832.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W82228]
 gb|EYM55110.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W89577]
 gb|EYM56392.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W80013]
 gb|EYM60171.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W89579]
 gb|EYM66519.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3519]
 gb|EYM67190.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3525]
 gb|EYM76170.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3529]
 gb|EYM76699.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3548]
 gb|EYM77015.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3534]
 gb|EYM80617.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3551]
 gb|EYM82895.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3562]
 gb|EYM83605.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3555]
 gb|EYM87735.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3567]
 gb|EYM91249.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3574]
 gb|EYM92257.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3565]
 gb|EYM96573.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3575]
 gb|EYM99336.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3576]
 gb|EYN00221.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3578]
 gb|EYN05377.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3583]
 gb|EYN08445.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3586]
 gb|EYN09579.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3584]
 gb|EYN13227.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3587]
 gb|EYN17582.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3590]
 gb|EYN22908.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3592]
 gb|EYN23267.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3596]
 gb|EYN25192.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3591]
 gb|EYN28283.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3599]
 gb|EYN30049.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3609]
 gb|EYN31844.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3608]
 gb|EYN36261.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3612]
 gb|EYN37283.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3613]
 gb|EYN39397.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3616]
 gb|EYN39799.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3617]
 gb|EYN49648.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3628]
 gb|EYN50205.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3627]
 gb|EYN51089.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3624]
 gb|EYN54288.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3632]
 gb|EYN56079.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3629]
 gb|EYN57500.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3752]
 gb|EYN59974.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3760]
 gb|EYN66699.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3761]
 gb|EYN69456.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3762]
 gb|EYN72493.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3765]
 gb|EYN73944.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3767]
 gb|EYN79636.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3776]
 gb|EYN81611.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3772]
 gb|EYN83854.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3781]
 gb|EYN85819.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3782]
 gb|EYN88124.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3779]
 gb|EYN91709.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3788]
 gb|EYN94922.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3794]
 gb|EYN98107.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3790]
 gb|EYN99521.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3796]
 gb|EYO01783.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3799]
 gb|EYO07570.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3842]
 gb|EYO10416.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3844]
 gb|EYO13077.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3845]
 gb|EYO20661.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3861]
 gb|EYO24975.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3862]
 gb|EYO31049.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3870]
 gb|EYO31301.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3868]
 gb|EYO38558.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3886]
 gb|EYO38880.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3871]
 gb|EYO40211.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3885]
 gb|EYO41950.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3891]
 gb|EYO43377.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3892]
 gb|EYO48953.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3894]
 gb|EYO51201.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3901]
 gb|EYO51723.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3897]
 gb|EYO55332.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3902]
 gb|EYO60476.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3911]
 gb|EYO63465.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3918]
 gb|EYO64113.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3913]
 gb|EYO69553.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3924]
 gb|EYO72958.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3928]
 gb|EYO73833.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3930]
 gb|EYO78121.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3933]
 gb|EYO83186.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR22]
 gb|EYP00680.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR966]
 gb|EYP09537.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1082]
 gb|EYP13597.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1083]
 gb|EYP17051.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1084]
 gb|EYP20114.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1086]
 gb|EYP21415.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1090]
 gb|EYP22724.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1158]
 gb|EYP27195.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1161]
 gb|EYP27535.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1157]
 gb|EYP32673.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1174]
 gb|EYP33645.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1176]
 gb|EYP38507.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1183]
 gb|EYP42278.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1275]
 gb|EYP42662.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1200]
 gb|EYP46554.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1291]
 gb|EYP47289.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1276]
 gb|EYP50803.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1278]
 gb|EYP56820.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1295]
 gb|EYP58518.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1310]
 gb|EYP58642.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1293]
 gb|EYP62404.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1313]
 gb|EYP67388.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1370]
 gb|EYP69444.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1369]
 gb|EYP71313.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1490]
 gb|EYP74378.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1507]
 gb|EYP76958.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1492]
 gb|EYP80988.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1692]
 gb|EYP82637.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1698]
 gb|EYP86332.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1810]
 gb|EYP89134.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1800]
 gb|EYP91947.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1811]
 gb|EYP93634.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1813]
 gb|EYP95871.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1814]
 gb|EYQ01023.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1842]
 gb|EYQ01591.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1815]
 gb|EYQ02168.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1859]
 gb|EYQ07100.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1862]
 gb|EYQ08954.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1874]
 gb|EYQ13510.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1885]
 gb|EYQ13828.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1883]
 gb|EYQ19599.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1936]
 gb|EYQ19875.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1890]
 gb|EYQ23031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1926]
 gb|EYQ24350.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1938]
 gb|EYQ25430.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1937]
 gb|EYQ26582.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1939]
 gb|EYQ33496.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1942]
 gb|EYQ34111.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1941]
 gb|EYQ35781.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1955]
 gb|EYQ38222.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1954]
 gb|EYQ39539.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1956]
 gb|EYQ44887.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1961]
 gb|EYQ48527.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1995]
 gb|EYQ49840.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2000]
 gb|EYQ52250.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR1980]
 gb|EYQ52528.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2002]
 gb|EYQ61733.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2018]
 gb|EYQ63879.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2026]
 gb|EYQ64361.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2019]
 gb|EYQ67401.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2067]
 gb|EYQ70792.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2072]
 gb|EYQ72382.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2068]
 gb|EYQ76580.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR2075]
 gb|EYQ98066.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3157]
 gb|EYR02686.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3162]
 gb|EYR04030.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3166]
 gb|EYR04372.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3163]
 gb|EYR10300.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3177]
 gb|EYR10863.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3176]
 gb|EYR16100.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3178]
 gb|EYR19259.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3179]
 gb|EYR21234.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3183]
 gb|EYR22800.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3198]
 gb|EZR77809.1| hypothetical protein W784_01329 [Staphylococcus aureus VET1373S]
 gb|EZR82545.1| hypothetical protein W783_00561 [Staphylococcus aureus VET1368S]
 gb|EZV48678.1| hypothetical protein U947_02039 [Staphylococcus aureus 18754-2]
 gb|EZW72558.1| hypothetical protein U973_00176 [Staphylococcus aureus 56864-11]
 gb|KAG16896.1| hypothetical protein W753_00868 [Staphylococcus aureus VET0632S]
 gb|KAG21052.1| hypothetical protein W756_01273 [Staphylococcus aureus VET0678S]
 gb|KAG25840.1| hypothetical protein W757_00896 [Staphylococcus aureus VET0679S]
 gb|KAG45515.1| hypothetical protein W767_00652 [Staphylococcus aureus VET1020S]
 gb|KAG46434.1| hypothetical protein W768_01104 [Staphylococcus aureus VET1024S]
 gb|KAG49209.1| hypothetical protein W769_00930 [Staphylococcus aureus VET1025S]
 gb|KAG52329.1| hypothetical protein W770_00961 [Staphylococcus aureus VET1026S]
 gb|KAH01103.1| hypothetical protein W796_00981 [Staphylococcus aureus VET1646S]
 gb|KAH03269.1| hypothetical protein W797_01422 [Staphylococcus aureus VET1653S]
 gb|KDA10856.1| iron ABC transporter permease [Staphylococcus aureus MM66]
 gb|KDA11680.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|AIA27310.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|KFD36098.1| iron ABC transporter permease [Staphylococcus aureus subsp. aureus]
 gb|AIL57231.1| iron ABC transporter permease [Staphylococcus aureus]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_000605324.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EWC67076.1| iron ABC transporter permease [Staphylococcus aureus subsp. aureus 
ST 1413]
Length=336

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>emb|CDR26280.1| FatD [Staphylococcus aureus]
 emb|CDR62914.1| FatD [Staphylococcus aureus]
 emb|CDR65907.1| FatD [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031904894.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|EXM59975.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR26]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EFB50370.1| iron complex transport system permease [Staphylococcus aureus 
subsp. aureus D139]
 gb|EFC07133.1| iron complex transport system permease [Staphylococcus aureus 
subsp. aureus H19]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031914767.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|KAB77912.1| hypothetical protein W478_01004 [Staphylococcus aureus VET0176R]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031894963.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EXO54242.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5867]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876311.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_040214.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus MRSA252]
 ref|YP_005733610.1| ttg start [Staphylococcus aureus subsp. aureus ST398]
 ref|YP_006709563.1| FecCD transport family protein [Staphylococcus aureus 08BA02176]
 emb|CAG39797.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus MRSA252]
 gb|EFB48032.1| iron complex transport system permease [Staphylococcus aureus 
subsp. aureus C427]
 gb|EFB56078.1| FecCD transporter [Staphylococcus aureus subsp. aureus WBG10049]
 gb|EFB58066.1| FecCD transporter [Staphylococcus aureus subsp. aureus WW2703/97]
 gb|EFB61477.1| iron complex transport system permease [Staphylococcus aureus 
subsp. aureus Btn1260]
 gb|EFC01279.1| enterochelin ABC transporter, permease protein [Staphylococcus 
aureus subsp. aureus C160]
 emb|CAQ49238.1| ttg start [Staphylococcus aureus subsp. aureus ST398]
 gb|EFC29831.1| enterochelin ABC transporter, permease protein [Staphylococcus 
aureus subsp. aureus A017934/97]
 gb|EFG58329.1| iron complex transport system permease [Staphylococcus aureus 
subsp. aureus EMRSA16]
 gb|EFU24744.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus CGS00]
 gb|EGS99028.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21195]
 gb|EHM79645.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21331]
 gb|EHO90726.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21264]
 gb|EHQ68731.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21345]
 gb|EHQ71520.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21342]
 gb|EHT29510.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1214]
 gb|EHT31411.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1500]
 gb|EHT31749.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1242]
 gb|EHT35904.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1605]
 gb|EHT56383.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1176]
 gb|EHT59756.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1233]
 gb|EHT75037.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1267]
 gb|EHT79763.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG149]
 gb|AFR72815.1| FecCD transport family protein [Staphylococcus aureus 08BA02176]
 gb|ENK03134.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0408]
 gb|ENK49535.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0513]
 gb|ENL88310.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1034]
 gb|ENM56443.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1256]
 gb|ENN45302.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0946]
 gb|EPZ06228.1| iron ABC transporter permease [Staphylococcus aureus S130]
 gb|EPZ10106.1| iron ABC transporter permease [Staphylococcus aureus S100]
 gb|EPZ10723.1| iron ABC transporter permease [Staphylococcus aureus S123]
 gb|EPZ11911.1| iron ABC transporter permease [Staphylococcus aureus S94]
 gb|EQM91759.1| iron ABC transporter permease [Staphylococcus aureus S1]
 gb|EUG18896.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0594]
 gb|EUX81386.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0359]
 gb|EUY89345.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0426]
 gb|EUZ01219.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0437]
 gb|EUZ52761.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0465]
 gb|EVA33637.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0522]
 gb|EVA57423.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0541]
 gb|EVA82039.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0552]
 gb|EVB47705.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0590]
 gb|EVD08128.1| iron compound ABC transporter, permease [Staphylococcus aureus 
WMCS6019]
 gb|EVI47045.1| iron compound ABC transporter, permease [Staphylococcus aureus 
UCIM6119]
 gb|EVJ46819.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6056]
 gb|EVJ53943.1| iron compound ABC transporter, permease [Staphylococcus aureus 
KINW6066]
 gb|EWI95338.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T44444]
 gb|EWW47669.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T86574]
 gb|EWW87008.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F82600]
 gb|EYF82821.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T16600]
 gb|EYJ36121.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F42556]
 gb|EYK62404.1| iron compound ABC transporter, permease [Staphylococcus aureus 
T55954]
 gb|EZH94225.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21230]
 gb|EZR35140.1| hypothetical protein V138_01340 [Staphylococcus aureus ZTA11/03130-3ST]
 gb|EZR35368.1| hypothetical protein V135_00789 [Staphylococcus aureus ZTA09/03576-9HST]
 gb|EZR42382.1| hypothetical protein W750_00133 [Staphylococcus aureus VET1915R]
 gb|EZR43323.1| hypothetical protein W805_01004 [Staphylococcus aureus VET1918S]
 gb|EZR46636.1| hypothetical protein W745_00785 [Staphylococcus aureus VET1910R]
 gb|EZR48803.1| hypothetical protein W742_00764 [Staphylococcus aureus VET1907R]
 gb|EZR51743.1| hypothetical protein W736_00785 [Staphylococcus aureus VET1898R]
 gb|EZR53226.1| hypothetical protein W734_01166 [Staphylococcus aureus VET1896R]
 gb|EZR56563.1| hypothetical protein W725_00863 [Staphylococcus aureus VET1876R]
 gb|EZR62639.1| hypothetical protein W698_01186 [Staphylococcus aureus VET1842R]
 gb|EZR64589.1| hypothetical protein W712_00028 [Staphylococcus aureus VET1858R]
 gb|EZR67706.1| hypothetical protein W693_00133 [Staphylococcus aureus VET1833R]
 gb|EZR71344.1| hypothetical protein W792_00068 [Staphylococcus aureus VET1515S]
 gb|EZR72237.1| hypothetical protein W787_00969 [Staphylococcus aureus VET1422S]
 gb|EZR74130.1| hypothetical protein W786_01075 [Staphylococcus aureus VET1419S]
 gb|EZR80397.1| hypothetical protein W778_00133 [Staphylococcus aureus VET1103S]
 gb|EZR85800.1| hypothetical protein W761_00133 [Staphylococcus aureus VET0798S]
 gb|EZR88026.1| hypothetical protein W758_01124 [Staphylococcus aureus VET0765S]
 gb|EZR89714.1| hypothetical protein W752_00133 [Staphylococcus aureus VET0612S]
 gb|EZR93672.1| hypothetical protein W689_00762 [Staphylococcus aureus VET0489R]
 gb|EZR94507.1| hypothetical protein W682_01342 [Staphylococcus aureus VET0472R]
 gb|EZR97746.1| hypothetical protein W683_00955 [Staphylococcus aureus VET0473R]
 gb|EZS00658.1| hypothetical protein W679_00944 [Staphylococcus aureus VET0469R]
 gb|EZS02628.1| hypothetical protein W681_01250 [Staphylococcus aureus VET0471R]
 gb|EZS05500.1| hypothetical protein W677_01058 [Staphylococcus aureus VET0467R]
 gb|EZS07697.1| hypothetical protein W658_00852 [Staphylococcus aureus VET0437R]
 gb|EZS11225.1| hypothetical protein W649_00123 [Staphylococcus aureus VET0426R]
 gb|EZS13142.1| hypothetical protein W647_00994 [Staphylococcus aureus VET0424R]
 gb|EZS16277.1| hypothetical protein W645_00965 [Staphylococcus aureus VET0422R]
 gb|EZS20231.1| hypothetical protein W640_00122 [Staphylococcus aureus VET0414R]
 gb|EZS21120.1| hypothetical protein W657_00702 [Staphylococcus aureus VET0436R]
 gb|EZS23762.1| hypothetical protein W630_01340 [Staphylococcus aureus VET0400R]
 gb|EZS26551.1| hypothetical protein W609_01173 [Staphylococcus aureus VET0361R]
 gb|EZS28563.1| hypothetical protein W614_01206 [Staphylococcus aureus VET0368R]
 gb|EZS31016.1| hypothetical protein W606_01460 [Staphylococcus aureus VET0358R]
 gb|EZS33913.1| hypothetical protein W603_01206 [Staphylococcus aureus VET0353R]
 gb|EZS36451.1| hypothetical protein W601_01209 [Staphylococcus aureus VET0343R]
 gb|EZS39041.1| hypothetical protein W600_01171 [Staphylococcus aureus VET0342R]
 gb|EZS41314.1| hypothetical protein W591_01365 [Staphylococcus aureus VET0332R]
 gb|EZS43677.1| hypothetical protein W583_01547 [Staphylococcus aureus VET0319R]
 gb|EZS47395.1| hypothetical protein W572_00923 [Staphylococcus aureus VET0306R]
 gb|EZS48842.1| hypothetical protein W567_01673 [Staphylococcus aureus VET0301R]
 gb|EZS51767.1| hypothetical protein W564_01240 [Staphylococcus aureus VET0298R]
 gb|EZS54471.1| hypothetical protein W559_01407 [Staphylococcus aureus VET0293R]
 gb|EZS54918.1| hypothetical protein W531_02107 [Staphylococcus aureus VET0251R]
 gb|EZS60076.1| hypothetical protein W528_00851 [Staphylococcus aureus VET0244R]
 gb|EZS61693.1| hypothetical protein W523_01570 [Staphylococcus aureus VET0235R]
 gb|EZS64948.1| hypothetical protein W522_01263 [Staphylococcus aureus VET0232R]
 gb|EZS66828.1| hypothetical protein W520_01516 [Staphylococcus aureus VET0229R]
 gb|EZS71193.1| hypothetical protein W502_01075 [Staphylococcus aureus VET0203R]
 gb|EZS72969.1| hypothetical protein W514_00945 [Staphylococcus aureus VET0219R]
 gb|EZS75733.1| hypothetical protein W496_00133 [Staphylococcus aureus VET0197R]
 gb|EZS79030.1| hypothetical protein W484_01171 [Staphylococcus aureus VET0184R]
 gb|EZS81047.1| hypothetical protein W490_00740 [Staphylococcus aureus VET0191R]
 gb|EZS82720.1| hypothetical protein W483_01237 [Staphylococcus aureus VET0183R]
 gb|EZS85645.1| hypothetical protein W469_01157 [Staphylococcus aureus VET0158R]
 gb|EZS88691.1| hypothetical protein W468_01786 [Staphylococcus aureus VET0157R]
 gb|EZS90904.1| hypothetical protein W470_00296 [Staphylococcus aureus VET0159R]
 gb|EZS92749.1| hypothetical protein W465_01537 [Staphylococcus aureus VET0154R]
 gb|EZS96261.1| hypothetical protein W462_01161 [Staphylococcus aureus VET0150R]
 gb|EZS96298.1| hypothetical protein W460_02103 [Staphylococcus aureus VET0141R]
 gb|EZT00628.1| hypothetical protein W458_01524 [Staphylococcus aureus VET0136R]
 gb|EZT04583.1| hypothetical protein W449_00875 [Staphylococcus aureus VET0125R]
 gb|EZT07731.1| hypothetical protein W446_00133 [Staphylococcus aureus VET0120R]
 gb|EZT09711.1| hypothetical protein W440_00865 [Staphylococcus aureus VET0113R]
 gb|EZT11613.1| hypothetical protein W438_01282 [Staphylococcus aureus VET0111R]
 gb|EZT14008.1| hypothetical protein W432_01157 [Staphylococcus aureus VET0102R]
 gb|EZT17276.1| hypothetical protein W414_01075 [Staphylococcus aureus VET0081R]
 gb|EZT20308.1| hypothetical protein W396_01202 [Staphylococcus aureus VET0058R]
 gb|EZT20978.1| hypothetical protein W412_01229 [Staphylococcus aureus VET0078R]
 gb|EZT24996.1| hypothetical protein W389_01088 [Staphylococcus aureus VET0050R]
 gb|EZT28005.1| hypothetical protein V010_00862 [Staphylococcus aureus VE08/02242ST1]
 gb|EZT29694.1| hypothetical protein V163_01109 [Staphylococcus aureus USA_6]
 gb|EZT35453.1| hypothetical protein V126_00057 [Staphylococcus aureus Tur-5]
 gb|EZT36089.1| hypothetical protein V113_00815 [Staphylococcus aureus Tur-4]
 gb|EZT38185.1| hypothetical protein V047_00551 [Staphylococcus aureus S64_POEL]
 gb|EZT40975.1| hypothetical protein V125_00741 [Staphylococcus aureus Rd.290]
 gb|EZT43401.1| hypothetical protein V046_00892 [Staphylococcus aureus S63_POEL]
 gb|EZT46443.1| hypothetical protein V054_00524 [Staphylococcus aureus MSSA-47]
 gb|EZT48976.1| hypothetical protein V053_00876 [Staphylococcus aureus MSSA-37]
 gb|EZT51989.1| hypothetical protein V056_00857 [Staphylococcus aureus MSSA-123]
 gb|EZT53812.1| hypothetical protein V096_01226 [Staphylococcus aureus GD2010-169]
 gb|EZT56911.1| hypothetical protein V095_00129 [Staphylococcus aureus GD2010-159]
 gb|EZT58848.1| hypothetical protein V033_01435 [Staphylococcus aureus C3452]
 gb|EZT64216.1| hypothetical protein V067_00167 [Staphylococcus aureus C0626]
 gb|EZT68581.1| hypothetical protein U885_00064 [Staphylococcus aureus 81629]
 gb|EZT71826.1| hypothetical protein U903_00655 [Staphylococcus aureus 63-D10]
 gb|EZT72004.1| hypothetical protein U948_00133 [Staphylococcus aureus 53180-1]
 gb|EZT75561.1| hypothetical protein V107_00929 [Staphylococcus aureus 45(2607)]
 gb|EZT78461.1| hypothetical protein V104_00579 [Staphylococcus aureus 28(3K2-5)]
 gb|EZT80636.1| hypothetical protein V103_00453 [Staphylococcus aureus 22(2K81-5)]
 gb|EZT84986.1| hypothetical protein V082_00547 [Staphylococcus aureus 2011-60-2275-7]
 gb|EZT85854.1| hypothetical protein U954_00009 [Staphylococcus aureus 1484-9]
 gb|EZT91529.1| hypothetical protein U990_00782 [Staphylococcus aureus 1111001578]
 gb|EZT96363.1| hypothetical protein U917_00138 [Staphylococcus aureus 10S00488]
 gb|EZT98977.1| hypothetical protein V120_00166 [Staphylococcus aureus 1(04GN_04-02-52-07)]
 gb|EZT99628.1| hypothetical protein U916_01897 [Staphylococcus aureus 09S01694]
 gb|EZU02344.1| hypothetical protein U909_01559 [Staphylococcus aureus 09-00736]
 gb|EZU05897.1| hypothetical protein U906_00958 [Staphylococcus aureus 08-01229]
 gb|EZU08486.1| hypothetical protein U905_01118 [Staphylococcus aureus 08-01062]
 gb|EZU11379.1| hypothetical protein U904_00776 [Staphylococcus aureus 08-01059]
 gb|EZU17638.1| hypothetical protein U912_01546 [Staphylococcus aureus 08-01084]
 gb|EZU19170.1| hypothetical protein U913_00133 [Staphylococcus aureus 08-01085]
 gb|EZU23340.1| hypothetical protein U907_01377 [Staphylococcus aureus 08-01728]
 gb|EZU26617.1| hypothetical protein V157_01237 [Staphylococcus aureus 08134-6]
 gb|EZU31840.1| hypothetical protein V158_00166 [Staphylococcus aureus 08139-6]
 gb|EZU33911.1| hypothetical protein V159_01232 [Staphylococcus aureus 08142-8]
 gb|EZU36638.1| hypothetical protein V160_01556 [Staphylococcus aureus 08143-5]
 gb|EZU37726.1| hypothetical protein U915_01345 [Staphylococcus aureus 09S00475]
 gb|EZU41569.1| hypothetical protein U918_01470 [Staphylococcus aureus 10S01493]
 gb|EZU45756.1| hypothetical protein U983_00133 [Staphylococcus aureus 110802495]
 gb|EZU46276.1| hypothetical protein U978_01685 [Staphylococcus aureus 1110601704]
 gb|EZU50064.1| hypothetical protein U979_00888 [Staphylococcus aureus 1110601896]
 gb|EZU50244.1| hypothetical protein U980_01796 [Staphylococcus aureus 1110700562]
 gb|EZU54161.1| hypothetical protein U981_01241 [Staphylococcus aureus 1110700610]
 gb|EZU59161.1| hypothetical protein U982_00133 [Staphylococcus aureus 1110701127]
 gb|EZU59379.1| hypothetical protein U984_01067 [Staphylococcus aureus 1110802883]
 gb|EZU62651.1| hypothetical protein U986_01312 [Staphylococcus aureus 1110807699]
 gb|EZU64912.1| hypothetical protein U987_01870 [Staphylococcus aureus 1110904178]
 gb|EZU77844.1| hypothetical protein U992_00133 [Staphylococcus aureus 1111101949]
 gb|EZU79402.1| hypothetical protein U993_01565 [Staphylococcus aureus 1111102620]
 gb|EZU83736.1| hypothetical protein U994_00166 [Staphylococcus aureus 1111200013]
 gb|EZU84694.1| hypothetical protein U995_01375 [Staphylococcus aureus 1111203374]
 gb|EZU89874.1| hypothetical protein U996_00028 [Staphylococcus aureus 1111205429]
 gb|EZU90815.1| hypothetical protein U997_01069 [Staphylococcus aureus 1111206270]
 gb|EZU92727.1| hypothetical protein V147_00869 [Staphylococcus aureus 11P4]
 gb|EZU96242.1| hypothetical protein V148_01069 [Staphylococcus aureus 11P8]
 gb|EZV00374.1| hypothetical protein U920_00140 [Staphylococcus aureus 11S00627]
 gb|EZV03188.1| hypothetical protein U923_01665 [Staphylococcus aureus 11S01586]
 gb|EZV10647.1| hypothetical protein V051_01175 [Staphylococcus aureus 122]
 gb|EZV13041.1| hypothetical protein U976_01438 [Staphylococcus aureus 12464]
 gb|EZV18553.1| hypothetical protein U926_01792 [Staphylococcus aureus 12S00881]
 gb|EZV21695.1| hypothetical protein U925_00028 [Staphylococcus aureus 12S00579]
 gb|EZV25473.1| hypothetical protein U928_00133 [Staphylococcus aureus 12S01153]
 gb|EZV27900.1| hypothetical protein U929_00133 [Staphylococcus aureus 12S01399]
 gb|EZV32767.1| hypothetical protein U931_00134 [Staphylococcus aureus 12-ST01988]
 gb|EZV37212.1| hypothetical protein V122_00134 [Staphylococcus aureus 14(11MN_17-08-66-05)]
 gb|EZV39430.1| hypothetical protein U961_00882 [Staphylococcus aureus 150211/pool 
1]
 gb|EZV43145.1| hypothetical protein U962_00122 [Staphylococcus aureus 18439-17]
 gb|EZV43765.1| hypothetical protein V118_01475 [Staphylococcus aureus 16(11S1S4-09)]
 gb|EZV46301.1| hypothetical protein U965_01559 [Staphylococcus aureus 18439-62]
 gb|EZV51888.1| hypothetical protein U893_00390 [Staphylococcus aureus 19571]
 gb|EZV54579.1| hypothetical protein V121_00167 [Staphylococcus aureus 2(04HN_17-03-52-05)]
 gb|EZV57264.1| hypothetical protein V079_01480 [Staphylococcus aureus 2009-60-561-1]
 gb|EZV61855.1| hypothetical protein U888_00173 [Staphylococcus aureus 2010-60-6063-29]
 gb|EZV62763.1| hypothetical protein V074_00971 [Staphylococcus aureus 2010-60-1240-1]
 gb|EZV66068.1| hypothetical protein V076_00175 [Staphylococcus aureus 2010-60-6063-39]
 gb|EZV68671.1| hypothetical protein V075_00624 [Staphylococcus aureus 2010-60-6511-10]
 gb|EZV71138.1| hypothetical protein V077_00748 [Staphylococcus aureus 2010-60-6511-39]
 gb|EZV73897.1| hypothetical protein V078_01042 [Staphylococcus aureus 2010-60-6511-5]
 gb|EZV76207.1| hypothetical protein U889_00131 [Staphylococcus aureus 2010-60-7626-19]
 gb|EZV80431.1| hypothetical protein V084_01017 [Staphylococcus aureus 2011-60-1490-31]
 gb|EZV81536.1| hypothetical protein V083_00735 [Staphylococcus aureus 2011-60-2078-5]
 gb|EZV83428.1| hypothetical protein U890_01105 [Staphylococcus aureus 2011-60-2256-5]
 gb|EZV86991.1| hypothetical protein U894_01029 [Staphylococcus aureus 22825]
 gb|EZV90001.1| hypothetical protein V081_00546 [Staphylococcus aureus 2011-60-2275-1]
 gb|EZV91209.1| hypothetical protein U896_00871 [Staphylococcus aureus 22835]
 gb|EZV95592.1| hypothetical protein U897_00134 [Staphylococcus aureus 22837]
 gb|EZV96185.1| hypothetical protein U898_01396 [Staphylococcus aureus 22838]
 gb|EZV99720.1| hypothetical protein U899_00133 [Staphylococcus aureus 22841]
 gb|EZW03404.1| hypothetical protein U900_00158 [Staphylococcus aureus 22843]
 gb|EZW05456.1| hypothetical protein U901_00133 [Staphylococcus aureus 22846]
 gb|EZW07726.1| hypothetical protein U998_00028 [Staphylococcus aureus 22P79]
 gb|EZW10252.1| hypothetical protein U902_00133 [Staphylococcus aureus 23237]
 gb|EZW13588.1| hypothetical protein U974_00133 [Staphylococcus aureus 2393-15]
 gb|EZW15330.1| hypothetical protein U975_00133 [Staphylococcus aureus 2393-19]
 gb|EZW17529.1| hypothetical protein V105_00706 [Staphylococcus aureus 25(2889)]
 gb|EZW20296.1| hypothetical protein U966_00133 [Staphylococcus aureus 27999-3]
 gb|EZW23065.1| hypothetical protein V149_01089 [Staphylococcus aureus 36P1]
 gb|EZW24270.1| hypothetical protein V117_00945 [Staphylococcus aureus 28(18S1K13-24-05)]
 gb|EZW26911.1| hypothetical protein V150_01120 [Staphylococcus aureus 36P5]
 gb|EZW30455.1| hypothetical protein V152_00908 [Staphylococcus aureus 40P10]
 gb|EZW32356.1| hypothetical protein V119_01162 [Staphylococcus aureus 37(18S2S5-05)]
 gb|EZW35520.1| hypothetical protein V151_01079 [Staphylococcus aureus 40P5 1_1]
 gb|EZW37658.1| hypothetical protein V153_00133 [Staphylococcus aureus 43P3]
 gb|EZW41107.1| hypothetical protein V154_00133 [Staphylococcus aureus 43P8]
 gb|EZW43340.1| hypothetical protein V155_01240 [Staphylococcus aureus 47P5]
 gb|EZW46135.1| hypothetical protein V106_00135 [Staphylococcus aureus 44(2608)]
 gb|EZW47564.1| hypothetical protein V156_01238 [Staphylococcus aureus 47P9]
 gb|EZW51134.1| hypothetical protein U944_00133 [Staphylococcus aureus 5670-1]
 gb|EZW54074.1| hypothetical protein U970_00983 [Staphylococcus aureus 56824-10]
 gb|EZW56647.1| hypothetical protein U971_00133 [Staphylococcus aureus 56824-15]
 gb|EZW57882.1| hypothetical protein U967_01106 [Staphylococcus aureus 56824-2]
 gb|EZW62209.1| hypothetical protein U968_00133 [Staphylococcus aureus 56824-5]
 gb|EZW64426.1| hypothetical protein U972_00133 [Staphylococcus aureus 56824-21]
 gb|EZW66821.1| hypothetical protein U969_00134 [Staphylococcus aureus 56824-7]
 gb|EZW70248.1| hypothetical protein U945_00133 [Staphylococcus aureus 6665-5]
 gb|EZW74937.1| hypothetical protein U955_00133 [Staphylococcus aureus 75495-3]
 gb|EZW77231.1| hypothetical protein U956_00134 [Staphylococcus aureus 76669-6]
 gb|EZW82124.1| hypothetical protein U884_00064 [Staphylococcus aureus 81070]
 gb|EZW82665.1| hypothetical protein U957_01332 [Staphylococcus aureus 84069-2]
 gb|EZW88424.1| hypothetical protein U949_01442 [Staphylococcus aureus 87807-1]
 gb|EZW88656.1| hypothetical protein U958_00133 [Staphylococcus aureus 86770-7]
 gb|EZW93150.1| hypothetical protein U950_00172 [Staphylococcus aureus 87807-11]
 gb|EZW95471.1| hypothetical protein U952_00509 [Staphylococcus aureus 87807-12]
 gb|EZW97865.1| hypothetical protein U953_00134 [Staphylococcus aureus 87807-16]
 gb|EZW99972.1| hypothetical protein U951_00133 [Staphylococcus aureus 87807-9]
 gb|EZX03959.1| hypothetical protein U959_00133 [Staphylococcus aureus 88088-1]
 gb|EZX05642.1| hypothetical protein V146_01597 [Staphylococcus aureus 9P9]
 gb|EZX06236.1| hypothetical protein U960_00133 [Staphylococcus aureus 88088-2]
 gb|EZX12815.1| hypothetical protein U943_00079 [Staphylococcus aureus BG407]
 gb|EZX13016.1| hypothetical protein V068_00892 [Staphylococcus aureus C0630]
 gb|EZX15234.1| hypothetical protein V069_00167 [Staphylococcus aureus C0637]
 gb|EZX19364.1| hypothetical protein V026_00123 [Staphylococcus aureus C1655]
 gb|EZX21513.1| hypothetical protein V030_00470 [Staphylococcus aureus C1673]
 gb|EZX25332.1| hypothetical protein V021_00831 [Staphylococcus aureus C1842]
 gb|EZX28023.1| hypothetical protein V018_01257 [Staphylococcus aureus C1891]
 gb|EZX31502.1| hypothetical protein V041_01158 [Staphylococcus aureus C2549]
 gb|EZX32951.1| hypothetical protein V019_00968 [Staphylococcus aureus C1894]
 gb|EZX36491.1| hypothetical protein V042_00166 [Staphylococcus aureus C2679]
 gb|EZX38677.1| hypothetical protein V027_01218 [Staphylococcus aureus C2706]
 gb|EZX41043.1| hypothetical protein V034_01256 [Staphylococcus aureus C2928]
 gb|EZX42058.1| hypothetical protein V032_01773 [Staphylococcus aureus C2930]
 gb|EZX47335.1| hypothetical protein V014_01581 [Staphylococcus aureus C3489]
 gb|EZX48126.1| hypothetical protein V035_01035 [Staphylococcus aureus C2942]
 gb|EZX51243.1| hypothetical protein V036_01131 [Staphylococcus aureus C3672]
 gb|EZX54979.1| hypothetical protein V043_01233 [Staphylococcus aureus C3965]
 gb|EZX56658.1| hypothetical protein V016_00816 [Staphylococcus aureus C3865]
 gb|EZX59893.1| hypothetical protein V037_00134 [Staphylococcus aureus C4151]
 gb|EZX63213.1| hypothetical protein V031_00133 [Staphylococcus aureus C4155]
 gb|EZX64491.1| hypothetical protein V017_01319 [Staphylococcus aureus C4668]
 gb|EZX67853.1| hypothetical protein V015_00056 [Staphylococcus aureus C5086]
 gb|EZX68769.1| hypothetical protein V040_01510 [Staphylococcus aureus C5453]
 gb|EZX72412.1| hypothetical protein V108_01460 [Staphylococcus aureus Chi-4]
 gb|EZX75592.1| hypothetical protein V109_00047 [Staphylococcus aureus Chi-10]
 gb|EZX77201.1| hypothetical protein V110_01286 [Staphylococcus aureus Chi-8]
 gb|EZX81628.1| hypothetical protein V140_00133 [Staphylococcus aureus DICM09/01587-13HST]
 gb|EZX82496.1| hypothetical protein V137_01197 [Staphylococcus aureus DICM09/00997-9HST2]
 gb|EZX85316.1| hypothetical protein U999_01117 [Staphylococcus aureus FP_N239]
 gb|EZX89546.1| hypothetical protein V000_00130 [Staphylococcus aureus FP_N5203 
OX]
 gb|EZX91670.1| hypothetical protein V001_00590 [Staphylococcus aureus FP_N5208 
OX]
 gb|EZX94142.1| hypothetical protein V127_00167 [Staphylococcus aureus GD2010-052]
 gb|EZX96258.1| hypothetical protein V128_00565 [Staphylococcus aureus GD2010-061]
 gb|EZX99516.1| hypothetical protein V086_00758 [Staphylococcus aureus GD2010-090]
 gb|EZY00730.1| hypothetical protein V129_01186 [Staphylococcus aureus GD2010-102]
 gb|EZY02936.1| hypothetical protein V088_01222 [Staphylococcus aureus GD2010-107]
 gb|EZY06376.1| hypothetical protein V087_00923 [Staphylococcus aureus GD2010-110]
 gb|EZY08730.1| hypothetical protein V090_01044 [Staphylococcus aureus GD2010-112]
 gb|EZY09631.1| hypothetical protein V089_01675 [Staphylococcus aureus GD2010-115]
 gb|EZY14695.1| hypothetical protein V091_01142 [Staphylococcus aureus GD2010-131]
 gb|EZY17742.1| hypothetical protein V092_00141 [Staphylococcus aureus GD2010-147]
 gb|EZY18605.1| hypothetical protein V093_00744 [Staphylococcus aureus GD2010-155]
 gb|EZY21016.1| hypothetical protein V094_01642 [Staphylococcus aureus GD2010-158]
 gb|EZY24127.1| hypothetical protein V097_01165 [Staphylococcus aureus GD2010-168]
 gb|EZY25145.1| hypothetical protein V085_01528 [Staphylococcus aureus GD2010-177]
 gb|EZY29912.1| hypothetical protein V002_01715 [Staphylococcus aureus M267-1]
 gb|EZY30976.1| hypothetical protein U883_00133 [Staphylococcus aureus M118-B]
 gb|EZY34032.1| hypothetical protein V003_01109 [Staphylococcus aureus M357]
 gb|EZY39018.1| hypothetical protein V004_00129 [Staphylococcus aureus M457-1]
 gb|EZY40519.1| hypothetical protein V055_01639 [Staphylococcus aureus MRSA-118]
 gb|EZY41196.1| hypothetical protein V005_00135 [Staphylococcus aureus M520-1]
 gb|EZY45355.1| hypothetical protein V057_01033 [Staphylococcus aureus MRSA-136]
 gb|EZY49621.1| hypothetical protein V058_01053 [Staphylococcus aureus N0426]
 gb|EZY52713.1| hypothetical protein V059_01186 [Staphylococcus aureus N1343]
 gb|EZY55296.1| hypothetical protein V072_01002 [Staphylococcus aureus P0218]
 gb|EZY57603.1| hypothetical protein V049_00848 [Staphylococcus aureus PA11]
 gb|EZY60465.1| hypothetical protein V050_00493 [Staphylococcus aureus PA57]
 gb|EZY63457.1| hypothetical protein V061_01373 [Staphylococcus aureus R0353]
 gb|EZY64785.1| hypothetical protein V060_01060 [Staphylococcus aureus R0294]
 gb|EZY68481.1| hypothetical protein V062_00618 [Staphylococcus aureus R0357]
 gb|EZY73249.1| hypothetical protein V063_00140 [Staphylococcus aureus R0487]
 gb|EZY73874.1| hypothetical protein V064_00795 [Staphylococcus aureus R0545]
 gb|EZY76181.1| hypothetical protein V065_01039 [Staphylococcus aureus R0611]
 gb|EZY79077.1| hypothetical protein V098_01333 [Staphylococcus aureus Rd.3]
 gb|EZY80540.1| hypothetical protein V066_01403 [Staphylococcus aureus R0615]
 gb|EZY83606.1| hypothetical protein V100_01251 [Staphylococcus aureus Rd.40]
 gb|EZY88461.1| hypothetical protein V101_00140 [Staphylococcus aureus Rd.51]
 gb|EZY89667.1| hypothetical protein V123_01260 [Staphylococcus aureus Rd.545]
 gb|EZY92664.1| hypothetical protein V102_00133 [Staphylococcus aureus Rd.60]
 gb|EZY94256.1| hypothetical protein V124_01347 [Staphylococcus aureus Rd.614]
 gb|EZY97028.1| hypothetical protein V099_01328 [Staphylococcus aureus Rd.9]
 gb|EZY99878.1| hypothetical protein V044_01316 [Staphylococcus aureus S56_POEL]
 gb|EZZ02491.1| hypothetical protein V045_01230 [Staphylococcus aureus S62_POEL]
 gb|EZZ07620.1| hypothetical protein V048_00663 [Staphylococcus aureus S69_POEL]
 gb|EZZ08881.1| hypothetical protein V006_00134 [Staphylococcus aureus SARM C4155]
 gb|EZZ10669.1| hypothetical protein V007_00133 [Staphylococcus aureus SARM C5621]
 gb|EZZ14878.1| hypothetical protein U942_01254 [Staphylococcus aureus Sau 194]
 gb|EZZ17436.1| hypothetical protein U934_00134 [Staphylococcus aureus Sau 44]
 gb|EZZ18471.1| hypothetical protein U935_00043 [Staphylococcus aureus Sau 46]
 gb|EZZ21396.1| hypothetical protein U937_01420 [Staphylococcus aureus Sau 74]
 gb|EZZ23021.1| hypothetical protein U936_00850 [Staphylococcus aureus Sau 47]
 gb|EZZ25220.1| hypothetical protein U938_01393 [Staphylococcus aureus Sau 93]
 gb|EZZ29339.1| hypothetical protein U940_00701 [Staphylococcus aureus Sau 98]
 gb|EZZ32090.1| hypothetical protein U939_00133 [Staphylococcus aureus Sau 95]
 gb|EZZ34951.1| hypothetical protein U941_00134 [Staphylococcus aureus Sau 99]
 gb|EZZ36663.1| hypothetical protein V115_01666 [Staphylococcus aureus Tur-12]
 gb|EZZ36850.1| hypothetical protein V116_01155 [Staphylococcus aureus Tur-15]
 gb|EZZ41160.1| hypothetical protein U933_01042 [Staphylococcus aureus Tur-16]
 gb|EZZ46873.1| hypothetical protein V111_00133 [Staphylococcus aureus Tur-20]
 gb|EZZ47395.1| hypothetical protein V112_00837 [Staphylococcus aureus Tur-22]
 gb|EZZ49024.1| hypothetical protein V114_01111 [Staphylococcus aureus Tur-6]
 gb|EZZ54595.1| hypothetical protein U891_00140 [Staphylococcus aureus UB 08-116]
 gb|EZZ55615.1| hypothetical protein U892_00133 [Staphylococcus aureus UB 08-172]
 gb|EZZ56868.1| hypothetical protein V162_01104 [Staphylococcus aureus USA_1]
 gb|EZZ59688.1| hypothetical protein V167_01373 [Staphylococcus aureus USA_11]
 gb|EZZ63200.1| hypothetical protein V168_00133 [Staphylococcus aureus USA_12]
 gb|EZZ65435.1| hypothetical protein V169_00134 [Staphylococcus aureus USA_15]
 gb|EZZ69356.1| hypothetical protein V166_00134 [Staphylococcus aureus USA_9]
 gb|EZZ69729.1| hypothetical protein V164_01998 [Staphylococcus aureus USA7]
 gb|EZZ71299.1| hypothetical protein V165_00735 [Staphylococcus aureus USA_8]
 gb|EZZ78220.1| hypothetical protein V008_00133 [Staphylococcus aureus VE07/03048STA]
 gb|EZZ78408.1| hypothetical protein V011_01210 [Staphylococcus aureus VE08/02244ST1]
 gb|EZZ78849.1| hypothetical protein V009_00807 [Staphylococcus aureus VE08/02126ST1]
 gb|EZZ83132.1| hypothetical protein W390_01160 [Staphylococcus aureus VET0051R]
 gb|EZZ86249.1| hypothetical protein W391_01290 [Staphylococcus aureus VET0052R]
 gb|EZZ86383.1| hypothetical protein W392_00981 [Staphylococcus aureus VET0053R]
 gb|EZZ89774.1| hypothetical protein W393_01492 [Staphylococcus aureus VET0054R]
 gb|EZZ94201.1| hypothetical protein W395_00838 [Staphylococcus aureus VET0057R]
 gb|EZZ96345.1| hypothetical protein W394_00948 [Staphylococcus aureus VET0055R]
 gb|EZZ98104.1| hypothetical protein W397_01081 [Staphylococcus aureus VET0059R]
 gb|KAA07276.1| hypothetical protein W400_01252 [Staphylococcus aureus VET0062R]
 gb|KAA07590.1| hypothetical protein W398_01080 [Staphylococcus aureus VET0060R]
 gb|KAA08476.1| hypothetical protein W399_01199 [Staphylococcus aureus VET0061R]
 gb|KAA14806.1| hypothetical protein W402_01208 [Staphylococcus aureus VET0065R]
 gb|KAA16046.1| hypothetical protein W403_01254 [Staphylococcus aureus VET0066R]
 gb|KAA17998.1| hypothetical protein W401_00992 [Staphylococcus aureus VET0063R]
 gb|KAA20541.1| hypothetical protein W404_01930 [Staphylococcus aureus VET0067R]
 gb|KAA25299.1| hypothetical protein W406_01061 [Staphylococcus aureus VET0070R]
 gb|KAA25927.1| hypothetical protein W405_00519 [Staphylococcus aureus VET0069R]
 gb|KAA31764.1| hypothetical protein W409_01283 [Staphylococcus aureus VET0075R]
 gb|KAA31906.1| hypothetical protein W407_00133 [Staphylococcus aureus VET0072R]
 gb|KAA33417.1| hypothetical protein W408_01076 [Staphylococcus aureus VET0073R]
 gb|KAA36989.1| hypothetical protein W410_01204 [Staphylococcus aureus VET0076R]
 gb|KAA40068.1| hypothetical protein W411_01134 [Staphylococcus aureus VET0077R]
 gb|KAA40568.1| hypothetical protein W413_01379 [Staphylococcus aureus VET0080R]
 gb|KAA45536.1| hypothetical protein W415_00133 [Staphylococcus aureus VET0083R]
 gb|KAA47320.1| hypothetical protein W416_01200 [Staphylococcus aureus VET0084R]
 gb|KAA49838.1| hypothetical protein W417_01130 [Staphylococcus aureus VET0085R]
 gb|KAA52414.1| hypothetical protein W418_00974 [Staphylococcus aureus VET0086R]
 gb|KAA54346.1| hypothetical protein W419_01272 [Staphylococcus aureus VET0087R]
 gb|KAA56913.1| hypothetical protein W421_01623 [Staphylococcus aureus VET0089R]
 gb|KAA59904.1| hypothetical protein W420_01222 [Staphylococcus aureus VET0088R]
 gb|KAA62480.1| hypothetical protein W422_01269 [Staphylococcus aureus VET0090R]
 gb|KAA65220.1| hypothetical protein W423_01178 [Staphylococcus aureus VET0091R]
 gb|KAA68369.1| hypothetical protein W424_00991 [Staphylococcus aureus VET0092R]
 gb|KAA70702.1| hypothetical protein W425_00992 [Staphylococcus aureus VET0093R]
 gb|KAA72271.1| hypothetical protein W426_01848 [Staphylococcus aureus VET0094R]
 gb|KAA76002.1| hypothetical protein W427_01168 [Staphylococcus aureus VET0095R]
 gb|KAA78376.1| hypothetical protein W428_01233 [Staphylococcus aureus VET0097R]
 gb|KAA81003.1| hypothetical protein W429_01164 [Staphylococcus aureus VET0098R]
 gb|KAA84379.1| hypothetical protein W430_00925 [Staphylococcus aureus VET0099R]
 gb|KAA86465.1| hypothetical protein W431_01163 [Staphylococcus aureus VET0101R]
 gb|KAA88752.1| hypothetical protein W433_01107 [Staphylococcus aureus VET0103R]
 gb|KAA92093.1| hypothetical protein W434_00133 [Staphylococcus aureus VET0104R]
 gb|KAA95088.1| hypothetical protein W435_01248 [Staphylococcus aureus VET0105R]
 gb|KAA97932.1| hypothetical protein W436_00123 [Staphylococcus aureus VET0107R]
 gb|KAA99873.1| hypothetical protein W437_00133 [Staphylococcus aureus VET0110R]
 gb|KAB01753.1| hypothetical protein W439_01241 [Staphylococcus aureus VET0112R]
 gb|KAB06061.1| hypothetical protein W442_01649 [Staphylococcus aureus VET0115R]
 gb|KAB06235.1| hypothetical protein W441_00168 [Staphylococcus aureus VET0114R]
 gb|KAB10279.1| hypothetical protein W443_01069 [Staphylococcus aureus VET0116R]
 gb|KAB12903.1| hypothetical protein W444_01213 [Staphylococcus aureus VET0117R]
 gb|KAB15773.1| hypothetical protein W445_00123 [Staphylococcus aureus VET0119R]
 gb|KAB18857.1| hypothetical protein W447_00133 [Staphylococcus aureus VET0123R]
 gb|KAB21777.1| hypothetical protein W448_00133 [Staphylococcus aureus VET0124R]
 gb|KAB22712.1| hypothetical protein W450_01033 [Staphylococcus aureus VET0126R]
 gb|KAB24956.1| hypothetical protein W451_01416 [Staphylococcus aureus VET0127R]
 gb|KAB27608.1| hypothetical protein W453_01807 [Staphylococcus aureus VET0129R]
 gb|KAB30230.1| hypothetical protein W452_01469 [Staphylococcus aureus VET0128R]
 gb|KAB33156.1| hypothetical protein W454_01337 [Staphylococcus aureus VET0130R]
 gb|KAB35790.1| hypothetical protein W455_01146 [Staphylococcus aureus VET0132R]
 gb|KAB40352.1| hypothetical protein W456_00931 [Staphylococcus aureus VET0133R]
 gb|KAB41823.1| hypothetical protein W457_00133 [Staphylococcus aureus VET0134R]
 gb|KAB43265.1| hypothetical protein W459_01574 [Staphylococcus aureus VET0140R]
 gb|KAB47986.1| hypothetical protein W461_00140 [Staphylococcus aureus VET0148R]
 gb|KAB48590.1| hypothetical protein W463_01242 [Staphylococcus aureus VET0151R]
 gb|KAB53833.1| hypothetical protein W464_00036 [Staphylococcus aureus VET0152R]
 gb|KAB54558.1| hypothetical protein W466_01175 [Staphylococcus aureus VET0155R]
 gb|KAB56633.1| hypothetical protein W467_01169 [Staphylococcus aureus VET0156R]
 gb|KAB61286.1| hypothetical protein W471_00129 [Staphylococcus aureus VET0161R]
 gb|KAB61873.1| hypothetical protein W472_01240 [Staphylococcus aureus VET0162R]
 gb|KAB64405.1| hypothetical protein W473_01263 [Staphylococcus aureus VET0164R]
 gb|KAB67959.1| hypothetical protein W474_00874 [Staphylococcus aureus VET0165R]
 gb|KAB72464.1| hypothetical protein W476_01081 [Staphylococcus aureus VET0167R]
 gb|KAB74394.1| hypothetical protein W477_01681 [Staphylococcus aureus VET0171R]
 gb|KAB81025.1| hypothetical protein W479_00133 [Staphylococcus aureus VET0177R]
 gb|KAB83762.1| hypothetical protein W480_00133 [Staphylococcus aureus VET0178R]
 gb|KAB87871.1| hypothetical protein W482_00133 [Staphylococcus aureus VET0180R]
 gb|KAB88539.1| hypothetical protein W481_00156 [Staphylococcus aureus VET0179R]
 gb|KAB90392.1| hypothetical protein W487_01392 [Staphylococcus aureus VET0188R]
 gb|KAB94005.1| hypothetical protein W488_00975 [Staphylococcus aureus VET0189R]
 gb|KAB95777.1| hypothetical protein W489_01130 [Staphylococcus aureus VET0190R]
 gb|KAB99830.1| hypothetical protein W491_00703 [Staphylococcus aureus VET0192R]
 gb|KAC01131.1| hypothetical protein W492_01095 [Staphylococcus aureus VET0193R]
 gb|KAC03886.1| hypothetical protein W493_01165 [Staphylococcus aureus VET0194R]
 gb|KAC07756.1| hypothetical protein W494_00168 [Staphylococcus aureus VET0195R]
 gb|KAC08448.1| hypothetical protein W497_01467 [Staphylococcus aureus VET0198R]
 gb|KAC11698.1| hypothetical protein W499_01116 [Staphylococcus aureus VET0200R]
 gb|KAC14557.1| hypothetical protein W507_00932 [Staphylococcus aureus VET0212R]
 gb|KAC16405.1| hypothetical protein W508_01467 [Staphylococcus aureus VET0213R]
 gb|KAC19570.1| hypothetical protein W509_01189 [Staphylococcus aureus VET0214R]
 gb|KAC22469.1| hypothetical protein W510_00868 [Staphylococcus aureus VET0215R]
 gb|KAC24647.1| hypothetical protein W511_01295 [Staphylococcus aureus VET0216R]
 gb|KAC28765.1| hypothetical protein W512_00036 [Staphylococcus aureus VET0217R]
 gb|KAC29911.1| hypothetical protein W513_01157 [Staphylococcus aureus VET0218R]
 gb|KAC32249.1| hypothetical protein W515_01425 [Staphylococcus aureus VET0221R]
 gb|KAC35680.1| hypothetical protein W516_01042 [Staphylococcus aureus VET0222R]
 gb|KAC37883.1| hypothetical protein W517_01394 [Staphylococcus aureus VET0224R]
 gb|KAC40285.1| hypothetical protein W518_00820 [Staphylococcus aureus VET0227R]
 gb|KAC42704.1| hypothetical protein W519_01675 [Staphylococcus aureus VET0228R]
 gb|KAC46022.1| hypothetical protein W521_01346 [Staphylococcus aureus VET0230R]
 gb|KAC47479.1| hypothetical protein W524_01376 [Staphylococcus aureus VET0236R]
 gb|KAC49766.1| hypothetical protein W525_02214 [Staphylococcus aureus VET0237R]
 gb|KAC53376.1| hypothetical protein W526_01181 [Staphylococcus aureus VET0241R]
 gb|KAC56795.1| hypothetical protein W527_00133 [Staphylococcus aureus VET0243R]
 gb|KAC60158.1| hypothetical protein W530_01658 [Staphylococcus aureus VET0249R]
 gb|KAC61214.1| hypothetical protein W529_00133 [Staphylococcus aureus VET0247R]
 gb|KAC64137.1| hypothetical protein W532_01241 [Staphylococcus aureus VET0252R]
 gb|KAC68219.1| hypothetical protein W533_00133 [Staphylococcus aureus VET0253R]
 gb|KAC69982.1| hypothetical protein W534_00129 [Staphylococcus aureus VET0254R]
 gb|KAC73126.1| hypothetical protein W536_00125 [Staphylococcus aureus VET0259R]
 gb|KAC74577.1| hypothetical protein W535_01357 [Staphylococcus aureus VET0256R]
 gb|KAC76726.1| hypothetical protein W537_01301 [Staphylococcus aureus VET0260R]
 gb|KAC79875.1| hypothetical protein W538_01263 [Staphylococcus aureus VET0261R]
 gb|KAC84349.1| hypothetical protein W540_00133 [Staphylococcus aureus VET0267R]
 gb|KAC84752.1| hypothetical protein W539_01082 [Staphylococcus aureus VET0263R]
 gb|KAC88544.1| hypothetical protein W541_00133 [Staphylococcus aureus VET0268R]
 gb|KAC91396.1| hypothetical protein W543_01319 [Staphylococcus aureus VET0270R]
 gb|KAC92157.1| hypothetical protein W542_00133 [Staphylococcus aureus VET0269R]
 gb|KAC94988.1| hypothetical protein W544_01138 [Staphylococcus aureus VET0271R]
 gb|KAC97799.1| hypothetical protein W545_01376 [Staphylococcus aureus VET0275R]
 gb|KAC99992.1| hypothetical protein W546_01591 [Staphylococcus aureus VET0278R]
 gb|KAD01926.1| hypothetical protein W547_01292 [Staphylococcus aureus VET0279R]
 gb|KAD06970.1| hypothetical protein W548_00133 [Staphylococcus aureus VET0280R]
 gb|KAD07759.1| hypothetical protein W549_01675 [Staphylococcus aureus VET0282R]
 gb|KAD10483.1| hypothetical protein W550_01204 [Staphylococcus aureus VET0283R]
 gb|KAD12315.1| hypothetical protein W551_02009 [Staphylococcus aureus VET0284R]
 gb|KAD14921.1| hypothetical protein W552_01629 [Staphylococcus aureus VET0286R]
 gb|KAD18921.1| hypothetical protein W553_00767 [Staphylococcus aureus VET0287R]
 gb|KAD22172.1| hypothetical protein W554_00876 [Staphylococcus aureus VET0288R]
 gb|KAD24027.1| hypothetical protein W555_00913 [Staphylococcus aureus VET0289R]
 gb|KAD25557.1| hypothetical protein W556_01562 [Staphylococcus aureus VET0290R]
 gb|KAD28907.1| hypothetical protein W557_01024 [Staphylococcus aureus VET0291R]
 gb|KAD31729.1| hypothetical protein W558_01094 [Staphylococcus aureus VET0292R]
 gb|KAD33940.1| hypothetical protein W560_00951 [Staphylococcus aureus VET0294R]
 gb|KAD36956.1| hypothetical protein W561_00819 [Staphylococcus aureus VET0295R]
 gb|KAD39259.1| hypothetical protein W563_01309 [Staphylococcus aureus VET0297R]
 gb|KAD42462.1| hypothetical protein W562_00745 [Staphylococcus aureus VET0296R]
 gb|KAD44137.1| hypothetical protein W565_01153 [Staphylococcus aureus VET0299R]
 gb|KAD46473.1| hypothetical protein W566_01273 [Staphylococcus aureus VET0300R]
 gb|KAD49577.1| hypothetical protein W569_01337 [Staphylococcus aureus VET0303R]
 gb|KAD51453.1| hypothetical protein W568_01349 [Staphylococcus aureus VET0302R]
 gb|KAD55300.1| hypothetical protein W570_00640 [Staphylococcus aureus VET0304R]
 gb|KAD57734.1| hypothetical protein W571_01080 [Staphylococcus aureus VET0305R]
 gb|KAD60337.1| hypothetical protein W573_01065 [Staphylococcus aureus VET0307R]
 gb|KAD62195.1| hypothetical protein W574_01320 [Staphylococcus aureus VET0308R]
 gb|KAD64697.1| hypothetical protein W575_01620 [Staphylococcus aureus VET0309R]
 gb|KAD68813.1| hypothetical protein W576_00168 [Staphylococcus aureus VET0312R]
 gb|KAD73062.1| hypothetical protein W578_01393 [Staphylococcus aureus VET0314R]
 gb|KAD73246.1| hypothetical protein W577_00941 [Staphylococcus aureus VET0313R]
 gb|KAD74361.1| hypothetical protein W579_00133 [Staphylococcus aureus VET0315R]
 gb|KAD78283.1| hypothetical protein W581_01583 [Staphylococcus aureus VET0317R]
 gb|KAD81881.1| hypothetical protein W580_00724 [Staphylococcus aureus VET0316R]
 gb|KAD83488.1| hypothetical protein W582_00996 [Staphylococcus aureus VET0318R]
 gb|KAD86852.1| hypothetical protein W584_01278 [Staphylococcus aureus VET0320R]
 gb|KAD88252.1| hypothetical protein W585_01112 [Staphylococcus aureus VET0322R]
 gb|KAD92405.1| hypothetical protein W586_00865 [Staphylococcus aureus VET0323R]
 gb|KAD94646.1| hypothetical protein W587_01238 [Staphylococcus aureus VET0325R]
 gb|KAD95535.1| hypothetical protein W588_01260 [Staphylococcus aureus VET0326R]
 gb|KAE00890.1| hypothetical protein W589_00715 [Staphylococcus aureus VET0329R]
 gb|KAE02392.1| hypothetical protein W590_00625 [Staphylococcus aureus VET0331R]
 gb|KAE04182.1| hypothetical protein W592_01370 [Staphylococcus aureus VET0333R]
 gb|KAE08385.1| hypothetical protein W594_00619 [Staphylococcus aureus VET0336R]
 gb|KAE09474.1| hypothetical protein W593_01297 [Staphylococcus aureus VET0335R]
 gb|KAE12368.1| hypothetical protein W595_00888 [Staphylococcus aureus VET0337R]
 gb|KAE14858.1| hypothetical protein W596_01172 [Staphylococcus aureus VET0338R]
 gb|KAE18034.1| hypothetical protein W597_01036 [Staphylococcus aureus VET0339R]
 gb|KAE20139.1| hypothetical protein W598_01020 [Staphylococcus aureus VET0340R]
 gb|KAE24347.1| hypothetical protein W599_00133 [Staphylococcus aureus VET0341R]
 gb|KAE26414.1| hypothetical protein W602_00133 [Staphylococcus aureus VET0352R]
 gb|KAE28533.1| hypothetical protein W604_00925 [Staphylococcus aureus VET0354R]
 gb|KAE31109.1| hypothetical protein W605_01075 [Staphylococcus aureus VET0357R]
 gb|KAE33720.1| hypothetical protein W607_00133 [Staphylococcus aureus VET0359R]
 gb|KAE35744.1| hypothetical protein W608_01375 [Staphylococcus aureus VET0360R]
 gb|KAE38646.1| hypothetical protein W610_01229 [Staphylococcus aureus VET0363R]
 gb|KAE42070.1| hypothetical protein W612_00133 [Staphylococcus aureus VET0366R]
 gb|KAE44543.1| hypothetical protein W613_00133 [Staphylococcus aureus VET0367R]
 gb|KAE46898.1| hypothetical protein W615_01057 [Staphylococcus aureus VET0369R]
 gb|KAE54098.1| hypothetical protein W618_00924 [Staphylococcus aureus VET0382R]
 gb|KAE57319.1| hypothetical protein W620_01725 [Staphylococcus aureus VET0384R]
 gb|KAE59496.1| hypothetical protein W619_00456 [Staphylococcus aureus VET0383R]
 gb|KAE63018.1| hypothetical protein W621_00133 [Staphylococcus aureus VET0387R]
 gb|KAE65197.1| hypothetical protein W623_01310 [Staphylococcus aureus VET0389R]
 gb|KAE65770.1| hypothetical protein W622_01199 [Staphylococcus aureus VET0388R]
 gb|KAE71212.1| hypothetical protein W624_00133 [Staphylococcus aureus VET0390R]
 gb|KAE72328.1| hypothetical protein W625_00943 [Staphylococcus aureus VET0393R]
 gb|KAE74884.1| hypothetical protein W626_01055 [Staphylococcus aureus VET0394R]
 gb|KAE78335.1| hypothetical protein W628_01247 [Staphylococcus aureus VET0396R]
 gb|KAE79601.1| hypothetical protein W627_01036 [Staphylococcus aureus VET0395R]
 gb|KAE83191.1| hypothetical protein W629_01027 [Staphylococcus aureus VET0399R]
 gb|KAE85612.1| hypothetical protein W631_01449 [Staphylococcus aureus VET0401R]
 gb|KAE88072.1| hypothetical protein W632_00799 [Staphylococcus aureus VET0402R]
 gb|KAE93061.1| hypothetical protein W633_00133 [Staphylococcus aureus VET0403R]
 gb|KAE94069.1| hypothetical protein W634_00868 [Staphylococcus aureus VET0406R]
 gb|KAE95554.1| hypothetical protein W635_01245 [Staphylococcus aureus VET0407R]
 gb|KAE98778.1| hypothetical protein W636_01080 [Staphylococcus aureus VET0410R]
 gb|KAF01779.1| hypothetical protein W637_01363 [Staphylococcus aureus VET0411R]
 gb|KAF03560.1| hypothetical protein W638_00133 [Staphylococcus aureus VET0412R]
 gb|KAF07110.1| hypothetical protein W639_00133 [Staphylococcus aureus VET0413R]
 gb|KAF08584.1| hypothetical protein W642_01434 [Staphylococcus aureus VET0417R]
 gb|KAF11704.1| hypothetical protein W641_00839 [Staphylococcus aureus VET0415R]
 gb|KAF13420.1| hypothetical protein W643_01594 [Staphylococcus aureus VET0418R]
 gb|KAF16828.1| hypothetical protein W644_00984 [Staphylococcus aureus VET0421R]
 gb|KAF19080.1| hypothetical protein W646_01145 [Staphylococcus aureus VET0423R]
 gb|KAF23714.1| hypothetical protein W648_01115 [Staphylococcus aureus VET0425R]
 gb|KAF24078.1| hypothetical protein W650_00133 [Staphylococcus aureus VET0427R]
 gb|KAF28835.1| hypothetical protein W651_00133 [Staphylococcus aureus VET0428R]
 gb|KAF31367.1| hypothetical protein W653_00133 [Staphylococcus aureus VET0432R]
 gb|KAF32453.1| hypothetical protein W652_00942 [Staphylococcus aureus VET0431R]
 gb|KAF35538.1| hypothetical protein W654_00827 [Staphylococcus aureus VET0433R]
 gb|KAF37568.1| hypothetical protein W655_01168 [Staphylococcus aureus VET0434R]
 gb|KAF41511.1| hypothetical protein W656_00133 [Staphylococcus aureus VET0435R]
 gb|KAF42709.1| hypothetical protein W659_01514 [Staphylococcus aureus VET0438R]
 gb|KAF45603.1| hypothetical protein W660_00858 [Staphylococcus aureus VET0439R]
 gb|KAF48679.1| hypothetical protein W661_01085 [Staphylococcus aureus VET0440R]
 gb|KAF50725.1| hypothetical protein W662_00927 [Staphylococcus aureus VET0442R]
 gb|KAF53114.1| hypothetical protein W663_01405 [Staphylococcus aureus VET0443R]
 gb|KAF56967.1| hypothetical protein W665_01064 [Staphylococcus aureus VET0446R]
 gb|KAF57430.1| hypothetical protein W664_01101 [Staphylococcus aureus VET0444R]
 gb|KAF60678.1| hypothetical protein W666_01479 [Staphylococcus aureus VET0451R]
 gb|KAF63543.1| hypothetical protein W667_01261 [Staphylococcus aureus VET0452R]
 gb|KAF65214.1| hypothetical protein W668_01709 [Staphylococcus aureus VET0454R]
 gb|KAF68228.1| hypothetical protein W669_01554 [Staphylococcus aureus VET0455R]
 gb|KAF71094.1| hypothetical protein W670_01463 [Staphylococcus aureus VET0456R]
 gb|KAF73748.1| hypothetical protein W671_01338 [Staphylococcus aureus VET0459R]
 gb|KAF76681.1| hypothetical protein W672_01346 [Staphylococcus aureus VET0460R]
 gb|KAF79495.1| hypothetical protein W673_01090 [Staphylococcus aureus VET0462R]
 gb|KAF82007.1| hypothetical protein W674_01093 [Staphylococcus aureus VET0463R]
 gb|KAF85578.1| hypothetical protein W675_00795 [Staphylococcus aureus VET0464R]
 gb|KAF87877.1| hypothetical protein W676_00777 [Staphylococcus aureus VET0465R]
 gb|KAF90041.1| hypothetical protein W678_00957 [Staphylococcus aureus VET0468R]
 gb|KAF93234.1| hypothetical protein W680_01431 [Staphylococcus aureus VET0470R]
 gb|KAF94778.1| hypothetical protein W684_00133 [Staphylococcus aureus VET0478R]
 gb|KAF98146.1| hypothetical protein W687_01730 [Staphylococcus aureus VET0486R]
 gb|KAG01697.1| hypothetical protein W685_01060 [Staphylococcus aureus VET0481R]
 gb|KAG04311.1| hypothetical protein W688_01972 [Staphylococcus aureus VET0488R]
 gb|KAG08829.1| hypothetical protein W751_00133 [Staphylococcus aureus VET0519S]
 gb|KAG10173.1| hypothetical protein W690_01205 [Staphylococcus aureus VET0596R]
 gb|KAG14404.1| hypothetical protein W754_00836 [Staphylococcus aureus VET0645S]
 gb|KAG19033.1| hypothetical protein W755_00133 [Staphylococcus aureus VET0657S]
 gb|KAG23499.1| hypothetical protein W759_01087 [Staphylococcus aureus VET0779S]
 gb|KAG27874.1| hypothetical protein W760_01478 [Staphylococcus aureus VET0787S]
 gb|KAG30327.1| hypothetical protein W762_01545 [Staphylococcus aureus VET0809S]
 gb|KAG34270.1| hypothetical protein W763_00133 [Staphylococcus aureus VET0810S]
 gb|KAG34777.1| hypothetical protein W764_02237 [Staphylococcus aureus VET0889S]
 gb|KAG38243.1| hypothetical protein W765_00827 [Staphylococcus aureus VET0919S]
 gb|KAG41823.1| hypothetical protein W766_00133 [Staphylococcus aureus VET0920S]
 gb|KAG53677.1| hypothetical protein W771_01164 [Staphylococcus aureus VET1035S]
 gb|KAG56800.1| hypothetical protein W772_01050 [Staphylococcus aureus VET1048S]
 gb|KAG59332.1| hypothetical protein W774_01037 [Staphylococcus aureus VET1054S]
 gb|KAG63247.1| hypothetical protein W773_00121 [Staphylococcus aureus VET1052S]
 gb|KAG64762.1| hypothetical protein W776_01058 [Staphylococcus aureus VET1068S]
 gb|KAG66480.1| hypothetical protein W777_01243 [Staphylococcus aureus VET1088S]
 gb|KAG69545.1| hypothetical protein W779_01183 [Staphylococcus aureus VET1104S]
 gb|KAG72759.1| hypothetical protein W780_00133 [Staphylococcus aureus VET1168S]
 gb|KAG76177.1| hypothetical protein W781_00060 [Staphylococcus aureus VET1181S]
 gb|KAG79229.1| hypothetical protein W782_00140 [Staphylococcus aureus VET1245S]
 gb|KAG80122.1| hypothetical protein W785_00133 [Staphylococcus aureus VET1411S]
 gb|KAG84408.1| hypothetical protein W788_00008 [Staphylococcus aureus VET1434S]
 gb|KAG85388.1| hypothetical protein W790_01911 [Staphylococcus aureus VET1495S]
 gb|KAG85576.1| hypothetical protein W789_00640 [Staphylococcus aureus VET1468S]
 gb|KAG91178.1| hypothetical protein W791_00060 [Staphylococcus aureus VET1499S]
 gb|KAG94560.1| hypothetical protein W794_00756 [Staphylococcus aureus VET1519S]
 gb|KAG98487.1| hypothetical protein W795_00008 [Staphylococcus aureus VET1526S]
 gb|KAH04108.1| hypothetical protein W798_01021 [Staphylococcus aureus VET1727S]
 gb|KAH08552.1| hypothetical protein W799_01107 [Staphylococcus aureus VET1738S]
 gb|KAH11332.1| hypothetical protein W801_00133 [Staphylococcus aureus VET1816S]
 gb|KAH14221.1| hypothetical protein W800_00123 [Staphylococcus aureus VET1779S]
 gb|KAH14783.1| hypothetical protein W802_01828 [Staphylococcus aureus VET1817S]
 gb|KAH18629.1| hypothetical protein W803_00133 [Staphylococcus aureus VET1822S]
 gb|KAH24738.1| hypothetical protein W692_00140 [Staphylococcus aureus VET1832R]
 gb|KAH26573.1| hypothetical protein W694_00682 [Staphylococcus aureus VET1834R]
 gb|KAH29577.1| hypothetical protein W695_01134 [Staphylococcus aureus VET1835R]
 gb|KAH32312.1| hypothetical protein W696_00066 [Staphylococcus aureus VET1838R]
 gb|KAH34562.1| hypothetical protein W697_00066 [Staphylococcus aureus VET1839R]
 gb|KAH36198.1| hypothetical protein W699_01552 [Staphylococcus aureus VET1843R]
 gb|KAH39578.1| hypothetical protein W700_00963 [Staphylococcus aureus VET1844R]
 gb|KAH42350.1| hypothetical protein W701_01133 [Staphylococcus aureus VET1845R]
 gb|KAH44078.1| hypothetical protein W702_01202 [Staphylococcus aureus VET1846R]
 gb|KAH47160.1| hypothetical protein W703_01201 [Staphylococcus aureus VET1848R]
 gb|KAH49859.1| hypothetical protein W704_01131 [Staphylococcus aureus VET1849R]
 gb|KAH51751.1| hypothetical protein W705_01430 [Staphylococcus aureus VET1850R]
 gb|KAH56384.1| hypothetical protein W706_00483 [Staphylococcus aureus VET1851R]
 gb|KAH59292.1| hypothetical protein W707_00133 [Staphylococcus aureus VET1852R]
 gb|KAH59392.1| hypothetical protein W708_01722 [Staphylococcus aureus VET1853R]
 gb|KAH62260.1| hypothetical protein W709_01619 [Staphylococcus aureus VET1854R]
 gb|KAH65501.1| hypothetical protein W710_01250 [Staphylococcus aureus VET1855R]
 gb|KAH67961.1| hypothetical protein W711_01298 [Staphylococcus aureus VET1856R]
 gb|KAH72512.1| hypothetical protein W713_00028 [Staphylococcus aureus VET1859R]
 gb|KAH73113.1| hypothetical protein W714_01344 [Staphylococcus aureus VET1860R]
 gb|KAH76961.1| hypothetical protein W715_00886 [Staphylococcus aureus VET1861R]
 gb|KAH79485.1| hypothetical protein W716_01303 [Staphylococcus aureus VET1865R]
 gb|KAH80510.1| hypothetical protein W717_00528 [Staphylococcus aureus VET1866R]
 gb|KAH84271.1| hypothetical protein W718_00133 [Staphylococcus aureus VET1867R]
 gb|KAH90317.1| hypothetical protein W721_00036 [Staphylococcus aureus VET1871R]
 gb|KAH91232.1| hypothetical protein W722_01404 [Staphylococcus aureus VET1872R]
 gb|KAH95094.1| hypothetical protein W723_00133 [Staphylococcus aureus VET1873R]
 gb|KAH98060.1| hypothetical protein W724_01137 [Staphylococcus aureus VET1875R]
 gb|KAH99201.1| hypothetical protein W726_00134 [Staphylococcus aureus VET1877R]
 gb|KAI04268.1| hypothetical protein W727_00133 [Staphylococcus aureus VET1880R]
 gb|KAI05138.1| hypothetical protein W729_01141 [Staphylococcus aureus VET1886R]
 gb|KAI07343.1| hypothetical protein W728_00809 [Staphylococcus aureus VET1884R]
 gb|KAI09941.1| hypothetical protein W730_01126 [Staphylococcus aureus VET1890R]
 gb|KAI12419.1| hypothetical protein W731_01195 [Staphylococcus aureus VET1892R]
 gb|KAI15268.1| hypothetical protein W732_01101 [Staphylococcus aureus VET1893R]
 gb|KAI17394.1| hypothetical protein W733_01308 [Staphylococcus aureus VET1895R]
 gb|KAI19922.1| hypothetical protein W735_01267 [Staphylococcus aureus VET1897R]
 gb|KAI24036.1| hypothetical protein W738_01402 [Staphylococcus aureus VET1901R]
 gb|KAI24750.1| hypothetical protein W737_00782 [Staphylococcus aureus VET1899R]
 gb|KAI28154.1| hypothetical protein W739_01106 [Staphylococcus aureus VET1904R]
 gb|KAI31431.1| hypothetical protein W740_01127 [Staphylococcus aureus VET1905R]
 gb|KAI31936.1| hypothetical protein W741_01639 [Staphylococcus aureus VET1906R]
 gb|KAI36131.1| hypothetical protein W743_00975 [Staphylococcus aureus VET1908R]
 gb|KAI38787.1| hypothetical protein W744_01410 [Staphylococcus aureus VET1909R]
 gb|KAI40154.1| hypothetical protein W746_01339 [Staphylococcus aureus VET1911R]
 gb|KAI44002.1| hypothetical protein W747_01197 [Staphylococcus aureus VET1912R]
 gb|KAI47761.1| hypothetical protein W748_00133 [Staphylococcus aureus VET1913R]
 gb|KAI49342.1| hypothetical protein W749_00133 [Staphylococcus aureus VET1914R]
 gb|KAI53407.1| hypothetical protein W804_00133 [Staphylococcus aureus VET1917S]
 gb|KAI54963.1| hypothetical protein W806_01267 [Staphylococcus aureus VET1923S]
 gb|KAI55650.1| hypothetical protein W808_00963 [Staphylococcus aureus VET1949S]
 gb|KAI58997.1| hypothetical protein W809_01188 [Staphylococcus aureus VET1950S]
 gb|KAI61834.1| hypothetical protein W811_00942 [Staphylococcus aureus VET1956S]
 gb|KAI63425.1| hypothetical protein W812_01489 [Staphylococcus aureus VET1959S]
 gb|KAI66965.1| hypothetical protein V136_01107 [Staphylococcus aureus ZTA09/03576-8HST]
 gb|KAI68784.1| hypothetical protein V142_01448 [Staphylococcus aureus ZTA09/03734-9HSA]
 gb|KAI72132.1| hypothetical protein V144_01026 [Staphylococcus aureus ZTA09/03745-9HSA]
 gb|KAI73926.1| hypothetical protein V130_01463 [Staphylococcus aureus ZTA10/00045-9HST]
 gb|KAI76797.1| hypothetical protein V134_01286 [Staphylococcus aureus ZTA10/00047-8HST]
 gb|KAI79903.1| hypothetical protein V132_01082 [Staphylococcus aureus ZTA10/00058-8HST]
 gb|KAI81693.1| hypothetical protein V141_01305 [Staphylococcus aureus ZTA10/02412-8HSA]
 gb|KAI84714.1| hypothetical protein V145_00858 [Staphylococcus aureus ZTA11/00189-8HSA]
 gb|AIO20403.1| iron ABC transporter permease [Staphylococcus aureus subsp. aureus]
 gb|AIW26426.1| iron compound ABC uptake transporter, permease protein [Staphylococcus 
aureus subsp. aureus]
 gb|KHF81542.1| iron ABC transporter permease [Staphylococcus aureus subsp. aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_000876315.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_005325202.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus MSHR1132]
 emb|CCE58533.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus MSHR1132]
 gb|EYG92293.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F87619]
 gb|EYL88067.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M21126]
 emb|CDR23478.1| FatD [Staphylococcus aureus]
 emb|CDR57356.1| FatD [Staphylococcus aureus]
 emb|CDR20631.1| FatD [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_037567298.1| iron ABC transporter permease [Staphylococcus agnetis]
 gb|KFE41136.1| cobalamin Fe3+-siderophores ABC transporter permease [Staphylococcus 
agnetis]
Length=321

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY+ IINIGLFITATITALVVVTVGTLPF
Sbjct  203  FTIAGMGRDFSKNLGLNYDLIINIGLFITATITALVVVTVGTLPF  247



>gb|AIU85494.1| iron complex transport system permease protein [Staphylococcus 
aureus subsp. aureus]
Length=335

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  215  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  259



>emb|CDR60454.1| FatD [Staphylococcus aureus]
 emb|CDR28435.1| FatD [Staphylococcus aureus]
Length=323

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|EYP03787.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR951]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EYN65468.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3758]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>gb|EVE96581.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6022]
 gb|EVE99191.1| iron compound ABC transporter, permease [Staphylococcus aureus 
SJOS6027]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>dbj|GAK14558.1| iron compound ABC uptake transporter, permease protein [Geomicrobium 
sp. JCM 19039]
Length=288

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS+NLG+NY++I+NIGLFI A ITA VVVT+G++PF
Sbjct  170  FTVAGMGRDFSSNLGLNYKQIMNIGLFIVAIITAAVVVTIGSIPF  214



>gb|EVA15264.1| iron compound ABC transporter, permease, partial [Staphylococcus 
aureus M0515]
Length=333

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_031887088.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EZT63063.1| hypothetical protein V071_00947 [Staphylococcus aureus C0676]
Length=323

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_031926071.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EZR37995.1| hypothetical protein V143_00835 [Staphylococcus aureus ZTA09/03739-9HSA]
Length=323

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>gb|EYO27027.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3864]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_001825705.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_006194882.1| FatD [Staphylococcus aureus subsp. aureus 71193]
 gb|EIA14400.1| FatD [Staphylococcus aureus subsp. aureus DR10]
 gb|AFH69039.1| FatD [Staphylococcus aureus subsp. aureus 71193]
Length=340

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  220  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  264



>ref|WP_031864590.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EWR97371.1| iron compound ABC transporter, permease [Staphylococcus aureus 
HOAG6047]
Length=323

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_025173897.1| iron ABC transporter permease [Staphylococcus aureus]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_001793672.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_005748533.1| iron (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Staphylococcus aureus subsp. aureus TCH60]
 gb|EFH95351.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus MN8]
 gb|ADQ77913.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus TCH60]
Length=337

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_031920098.1| iron ABC transporter permease [Staphylococcus aureus]
Length=319

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  199  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  243



>ref|WP_000876310.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_006237029.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus HO 5096 0412]
 gb|EGL93798.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21310]
 gb|EHS27119.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus IS-105]
 emb|CCG15376.1| FecCD transport family protein [Staphylococcus aureus subsp. 
aureus HO 5096 0412]
 gb|EMZ05581.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1228]
 gb|ETO52832.1| iron ABC transporter permease [Staphylococcus aureus MUM270]
 gb|EWB72412.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W85432]
 gb|EWI53577.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W33563]
 gb|EWP22477.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1242]
 gb|KDP56202.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21251]
Length=323

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_024928047.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|AHZ98624.1| iron ABC transporter permease [Staphylococcus aureus subsp. aureus]
Length=337

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVVTVGTLPF  261



>ref|WP_016911805.1| hypothetical protein [Staphylococcus vitulinus]
Length=323

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS NLG+NY+K++NIGL I + ITALVVVTVG +PF
Sbjct  204  FTIAGMGKDFSVNLGLNYQKVVNIGLIIASIITALVVVTVGMMPF  248



>gb|EVO14917.1| iron compound ABC transporter, permease, partial [Staphylococcus 
aureus M1031]
Length=248

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLF  57
            FTI GMGKDF+NNLG++YEK+INI LF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALF  243



>ref|WP_025905417.1| MULTISPECIES: iron ABC transporter permease [Staphylococcus]
 gb|EZX23655.1| hypothetical protein V070_00873 [Staphylococcus aureus C0673]
Length=323

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS NLG+NY+K++NIGL I + ITALVVVTVG +PF
Sbjct  204  FTIAGMGKDFSVNLGLNYQKVVNIGLIIASIITALVVVTVGMMPF  248



>ref|WP_017175943.1| MULTISPECIES: iron ABC transporter permease [Staphylococcus]
 gb|EUZ68673.1| iron compound ABC transporter, permease [Staphylococcus sp. M0480]
Length=322

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV YE+IINI L ITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVKYEQIINIALLITATLTALVVVTVGTLPF  247



>ref|WP_002449086.1| MULTISPECIES: iron ABC transporter permease [Staphylococcus]
 gb|EEK12102.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus hominis SK119]
 gb|EFS19332.1| enterochelin ABC transporter, permease protein [Staphylococcus 
hominis subsp. hominis C80]
 gb|EHR90916.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus hominis VCU122]
Length=322

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS+NLGV YE+IINI L ITAT+TALVVVTVGTLPF
Sbjct  203  FTIAGMGKDFSHNLGVKYEQIINIALLITATLTALVVVTVGTLPF  247



>ref|WP_031877019.1| iron ABC transporter permease [Staphylococcus aureus]
 gb|EWQ37563.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1169]
Length=323

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+IN+ LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINVALFITATITALVVVTVGTLPF  247



>gb|EJU81847.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus CM05]
 gb|EUJ79118.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5898]
 gb|EUJ79369.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5897]
 gb|EUJ81553.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5896]
 gb|EUJ87235.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5895]
 gb|EUJ88948.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5894]
 gb|EUJ89821.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5893]
 gb|EUJ96128.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5891]
 gb|EUJ96905.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5892]
 gb|EUJ97864.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5882]
 gb|EUK01433.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5883]
 gb|EUK04628.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5876]
 gb|EUK07212.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5866]
 gb|EUK10009.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5844]
 gb|EUK10221.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5860]
 gb|EUK16681.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5842]
 gb|EUK17322.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5810]
 gb|EXM64577.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5789]
 gb|EXM65229.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5790]
 gb|EXM69721.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5791]
 gb|EXM72278.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5792]
 gb|EXM72726.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5793]
 gb|EXM76936.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5794]
 gb|EXM81346.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5795]
 gb|EXM82294.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5796]
 gb|EXM85043.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5797]
 gb|EXM89011.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5799]
 gb|EXM93201.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5800]
 gb|EXN01171.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5803]
 gb|EXN04298.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5804]
 gb|EXN07136.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5805]
 gb|EXN12515.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5807]
 gb|EXN15295.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5808]
 gb|EXN19208.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5809]
 gb|EXN20908.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5811]
 gb|EXN23337.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5812]
 gb|EXN27080.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5813]
 gb|EXN28614.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5815]
 gb|EXN34224.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5817]
 gb|EXN36368.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5819]
 gb|EXN39064.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5820]
 gb|EXN43911.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5821]
 gb|EXN45914.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5822]
 gb|EXN48237.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5823]
 gb|EXN51091.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5824]
 gb|EXN51499.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5825]
 gb|EXN56724.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5826]
 gb|EXN59202.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5827]
 gb|EXN61784.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5828]
 gb|EXN64141.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5829]
 gb|EXN65612.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5830]
 gb|EXN70494.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5831]
 gb|EXN72075.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5832]
 gb|EXN76392.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5833]
 gb|EXN77238.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5834]
 gb|EXN80041.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5835]
 gb|EXN80579.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5836]
 gb|EXN86137.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5837]
 gb|EXN88033.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5838]
 gb|EXN91328.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5839]
 gb|EXN93756.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5840]
 gb|EXN95999.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5841]
 gb|EXO00451.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5843]
 gb|EXO04560.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5845]
 gb|EXO07662.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5847]
 gb|EXO10914.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5848]
 gb|EXO11626.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5849]
 gb|EXO14735.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5850]
 gb|EXO17986.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5851]
 gb|EXO21478.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5853]
 gb|EXO25878.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5854]
 gb|EXO26368.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5856]
 gb|EXO29223.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5857]
 gb|EXO32484.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5858]
 gb|EXO35238.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5859]
 gb|EXO37946.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5861]
 gb|EXO40378.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5862]
 gb|EXO43588.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5863]
 gb|EXO44087.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5864]
 gb|EXO51093.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5865]
 gb|EYO83927.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5880]
 gb|EYO85361.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5878]
 gb|EYO89086.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5875]
 gb|EYO91190.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5877]
 gb|EYO93360.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5874]
 gb|EYO97184.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5873]
 gb|EYQ78513.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3143]
 gb|EYQ78764.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3144]
 gb|EYQ82647.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3150]
 gb|EYQ83988.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3148]
 gb|EYQ87838.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3153]
 gb|EYQ89411.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3152]
 gb|EYR11556.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3175]
 gb|EYR29763.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5890]
 gb|EYR30212.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR3236]
 gb|EYR30979.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5889]
 gb|EYR37261.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5888]
 gb|EYR37504.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5886]
 gb|EYR38404.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5887]
 gb|EYR40678.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5885]
 gb|EYR45687.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5872]
 gb|EYR47601.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5881]
 gb|EYR47829.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5884]
 gb|EYR51958.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5871]
 gb|EYR54409.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5870]
 gb|EYR59124.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5869]
 gb|EYR60837.1| iron compound ABC transporter, permease [Staphylococcus aureus 
DAR5868]
Length=277

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLF  57
            FTI GMGKDF+NNLG++YEK+INI LF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALF  243



>ref|WP_009383096.1| cobalamin Fe3+-siderophores ABC transporter permease [Staphylococcus 
massiliensis]
 gb|EKU48532.1| cobalamin Fe3+-siderophores ABC transporter permease [Staphylococcus 
massiliensis S46]
Length=318

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS NLG+NY+ IIN+GLF T+ ITALVVVTVGTLPF
Sbjct  199  FTIAGMGKDFSQNLGLNYQFIINLGLFFTSIITALVVVTVGTLPF  243



>ref|WP_026859895.1| iron ABC transporter permease [Jeotgalicoccus psychrophilus]
Length=321

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY++I+NIGLF+TA +TA+VVV+VG LPF
Sbjct  204  FTVAGMGEDFSINLGMNYKRIVNIGLFLTAAMTAIVVVSVGMLPF  248



>ref|WP_000876313.1| iron ABC transporter permease [Staphylococcus aureus]
 ref|YP_008127613.1| fecCD transport family protein [Staphylococcus aureus CA-347]
 gb|EEV70466.1| FecCD transporter [Staphylococcus aureus A9635]
 gb|EGS95541.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21200]
 gb|EHM58326.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21202]
 gb|EHO89035.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21252]
 gb|EHT70575.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG290]
 gb|EHT78051.1| enterochelin uptake permease [Staphylococcus aureus subsp. aureus 
CIG1524]
 gb|ENL43141.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0877]
 gb|ENM73727.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1311]
 gb|AGO29108.1| fecCD transport family protein [Staphylococcus aureus CA-347]
 gb|EUE76740.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0684]
 gb|EUE87208.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0690]
 gb|EUF25022.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0715]
 gb|EUH29181.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0745]
 gb|EUH63592.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0896]
 gb|EUN37123.1| iron ABC transporter permease [Staphylococcus aureus subsp. aureus 
300-169]
 gb|EUN37255.1| iron ABC transporter permease [Staphylococcus aureus subsp. aureus 
301-188]
 gb|EUV89839.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0236]
 gb|EUX11973.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0318]
 gb|EVJ85476.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0750]
 gb|EVK06579.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0777]
 gb|EVK25234.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0790]
 gb|EVK85553.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0820]
 gb|EVK88615.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0821]
 gb|EVL56672.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0866]
 gb|EVM40227.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0916]
 gb|EVM74017.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0937]
 gb|EVP75179.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0761]
 gb|EVY95031.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W56227]
 gb|EVY97776.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W56243]
 gb|EVZ00799.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W56246]
 gb|EWO34792.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1292]
 gb|EWO59094.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1278]
 gb|EWO71600.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1272]
 gb|EWO97176.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1260]
 gb|EWP31597.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1237]
 gb|EWP61589.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1225]
 gb|EWP79449.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1213]
 gb|EWP88350.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1208]
 gb|EWQ69372.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M1151]
 gb|EXP28708.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W85807]
 gb|EXP31637.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W85810]
 gb|EXP37924.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W42304]
 gb|EYF16150.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F12926_081012]
 gb|EYG01882.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W85806_020613]
 gb|EYJ26082.1| iron compound ABC transporter, permease [Staphylococcus aureus 
F29450_091412]
 gb|EYL01495.1| iron compound ABC transporter, permease [Staphylococcus aureus 
W42298_110712]
 gb|EZI03103.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21314]
 gb|KFD32590.1| Iron(III) dicitrate transport system permease protein fecD [Staphylococcus 
aureus subsp. aureus SK1585]
 emb|CEF80467.1| Uncharacterized ABC transporter permease protein YclN [Staphylococcus 
aureus]
Length=323

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+IN+ LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINVALFITATITALVVVTVGTLPF  247



>ref|WP_031835336.1| iron ABC transporter permease [Staphylococcus aureus]
Length=323

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFIT TITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTNNLGLSYEKLINIALFITPTITALVVVTVGTLPF  247



>gb|KIH71660.1| iron ABC transporter permease [Salinicoccus roseus]
Length=322

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY ++INIGL ITA ITALVVVTVG LPF
Sbjct  204  FTIAGMGQDFSKNLGLNYRRVINIGLLITAVITALVVVTVGMLPF  248



>ref|WP_031547298.1| iron ABC transporter permease [Salinicoccus luteus]
Length=322

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY ++INIGL ITA ITALVVVTVG LPF
Sbjct  204  FTIAGMGQDFSKNLGLNYRRVINIGLLITAVITALVVVTVGMLPF  248



>gb|ENI57910.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0029]
 gb|EUS10218.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0034]
 gb|EUS60986.1| iron compound ABC transporter, permease [Staphylococcus aureus 
M0064]
Length=337

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+NNLG++YEK+INI LFIT TITALVVVTVGTLPF
Sbjct  217  FTIVGMGKDFTNNLGLSYEKLINIALFITPTITALVVVTVGTLPF  261



>ref|WP_035807487.1| iron ABC transporter permease [Jeotgalicoccus sp. 13MG44_air]
 emb|CDZ99049.1| Fe(3+) dicitrate transport system permease protein FecD [Jeotgalicoccus 
sp. 13MG44_air]
Length=321

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY+ I+NIGLF+TA +TA+VVV+VG LPF
Sbjct  204  FTVAGMGEDFSTNLGLNYKLIVNIGLFLTAAMTAIVVVSVGMLPF  248



>ref|WP_017000362.1| hypothetical protein [Staphylococcus lentus]
Length=322

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMGKDFS NLG+NY +I+NIGL I + ITALVVVTVG +PF
Sbjct  204  FTIAGMGKDFSVNLGLNYHRIVNIGLIIASIITALVVVTVGMMPF  248



>ref|WP_017176639.1| iron ABC transporter permease [Staphylococcus massiliensis]
Length=322

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMGKDFS NLG+NY+ IIN+GLF T+ ITALVVVTVGTLPF
Sbjct  203  FTMAGMGKDFSQNLGLNYQFIINLGLFFTSIITALVVVTVGTLPF  247



>ref|WP_002463844.1| iron ABC transporter permease [Staphylococcus simiae]
 gb|EHJ08014.1| hypothetical protein SS7213T_06361 [Staphylococcus simiae CCM 
7213]
Length=323

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGKDF+ NLG++YEK+INI LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKDFTKNLGLSYEKLINIALFITATITALVVVTVGTLPF  247



>ref|WP_005544126.1| iron ABC transporter permease [Paenibacillus alvei]
 gb|EJW20123.1| putative ABC transporter permease protein YclN [Paenibacillus 
alvei DSM 29]
Length=317

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY++I+NIGL + A +T  VV+TVGT+PF
Sbjct  199  FTVAGMGEDFSKNLGLNYKRIVNIGLILVALVTCTVVLTVGTIPF  243



>ref|WP_002492143.1| iron ABC transporter permease [Staphylococcus lugdunensis]
 ref|YP_003472310.1| iron ABC transporter permease [Staphylococcus lugdunensis HKU09-01]
 gb|ADC88182.1| Uncharacterized iron compound ABC uptake transporter, permease 
protein [Staphylococcus lugdunensis HKU09-01]
 gb|EHS05066.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus lugdunensis VCU139]
 gb|KAK57106.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus lugdunensis VCU150]
 gb|KAK57529.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus lugdunensis VCU148]
Length=325

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGK+FS+NLGVNYE ++NI LFITAT+TALVVVTVGTLPF
Sbjct  203  FTIVGMGKEFSHNLGVNYELMVNIALFITATMTALVVVTVGTLPF  247



>dbj|GAK03227.1| LOW QUALITY PROTEIN: iron compound ABC uptake transporter, permease 
protein [Geomicrobium sp. JCM 19037]
Length=317

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS+NLG+NY++I+NIGL I A ITA VVVT+G++PF
Sbjct  199  FTVAGMGRDFSSNLGLNYKQIMNIGLLIVAIITAAVVVTIGSIPF  243



>ref|WP_002459736.1| iron ABC transporter permease [Staphylococcus lugdunensis]
 ref|YP_005761182.1| FecCD family protein [Staphylococcus lugdunensis N920143]
 gb|EFU84366.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus lugdunensis M23590]
 emb|CCB54589.1| FecCD family protein [Staphylococcus lugdunensis N920143]
 gb|EKS21583.1| hypothetical protein HMPREF9308_02159 [Staphylococcus lugdunensis 
ACS-027-V-Sch2]
 gb|EVI47855.1| iron compound ABC transporter, permease [Staphylococcus lugdunensis 
UCIM6116]
Length=327

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGK+FS+NLGVNYE ++NI LFITAT+TALVVVTVGTLPF
Sbjct  205  FTIVGMGKEFSHNLGVNYELMVNIALFITATMTALVVVTVGTLPF  249



>ref|WP_020007043.1| hypothetical protein [Salinicoccus albus]
Length=322

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY+K++ IGLFITA ITALVVVTVG LPF
Sbjct  204  FTVAGMGEDFSRNLGLNYQKVLYIGLFITAVITALVVVTVGMLPF  248



>ref|WP_011247737.1| iron ABC transporter permease [Bacillus clausii]
 ref|YP_176390.1| enterochelin ABC transporter permease [Bacillus clausii KSM-K16]
 dbj|BAD65429.1| enterochelin ABC transporter permease [Bacillus clausii KSM-K16]
 gb|KFE62041.1| hypothetical protein DB29_0628 [Bacillus clausii]
Length=317

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLF  57
            FT+AGMGKDFS NLG+NY +I+NIGLF
Sbjct  199  FTVAGMGKDFSTNLGLNYNQIMNIGLF  225



>ref|WP_012703844.1| iron ABC transporter permease [Clostridium botulinum]
 ref|YP_002803412.1| iron chelate uptake ABC transporter permease [Clostridium botulinum 
A2 str. Kyoto]
 gb|ACO83737.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum A2 str. Kyoto]
Length=317

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLGVNY +IINIGL + A I++LVV+TVG +PF
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGLVVVALISSLVVITVGKIPF  243



>ref|WP_014520257.1| iron ABC transporter permease [Clostridium botulinum]
 ref|YP_005677676.1| iron compound ABC uptake transporter, permease protein [Clostridium 
botulinum H04402 065]
 emb|CBZ02937.1| uncharacterized iron compound ABC uptake transporter, permease 
protein [Clostridium botulinum H04402 065]
 gb|KEI99022.1| iron ABC transporter permease [Clostridium botulinum A2B3 87]
 dbj|BAQ13069.1| putative iron chelate uptake ABC transporter FeCT family, permease 
[Clostridium botulinum]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLGVNY +IINIGL I A I++LVV+TVG +PF
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGLVIVALISSLVVITVGKIPF  243



>ref|WP_024932718.1| iron ABC transporter permease [Clostridium botulinum]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_030034161.1| iron ABC transporter permease [Clostridium botulinum]
 dbj|GAE01552.1| iron chelate uptake ABC transporter FeCT family, permease [Clostridium 
botulinum B str. Osaka05]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLGVNY +IINIGL I A I++LVV+TVG +PF
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGLVIVALISSLVVITVGKIPF  243



>ref|WP_015957555.1| iron ABC transporter permease [Clostridium botulinum]
 ref|YP_001780680.1| iron ABC transporter permease [Clostridium botulinum B1 str. 
Okra]
 gb|ACA44047.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum B1 str. Okra]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_011948718.1| iron ABC transporter permease [Clostridium botulinum]
 ref|YP_001253576.1| iron chelate uptake ABC transporter FeCT family, permease [Clostridium 
botulinum A str. ATCC 3502]
 ref|YP_001383417.1| iron ABC transporter permease [Clostridium botulinum A str. ATCC 
19397]
 ref|YP_001386964.1| iron ABC transporter permease [Clostridium botulinum A str. Hall]
 ref|YP_001390403.1| iron ABC transporter permease [Clostridium botulinum F str. Langeland]
 ref|YP_005674068.1| iron chelate uptake ABC transporter permease [Clostridium botulinum 
F str. 230613]
 emb|CAL82598.1| ferric siderophore ABC transporter, permease protein [Clostridium 
botulinum A str. ATCC 3502]
 gb|ABS32594.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum A str. ATCC 19397]
 gb|ABS38803.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum A str. Hall]
 gb|ABS40417.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum F str. Langeland]
 gb|ADF98867.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum F str. 230613]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_003489433.1| iron ABC transporter permease [Clostridium sporogenes]
 gb|EDU38911.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium sporogenes ATCC 15579]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLGVNY +IINIGL I A I++LVV+TVG +PF
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGLVIVALISSLVVITVGKIPF  243



>ref|WP_012343576.1| iron ABC transporter permease [Clostridium botulinum]
 ref|YP_001786440.1| iron ABC transporter permease [Clostridium botulinum A3 str. 
Loch Maree]
 gb|ACA55616.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum A3 str. Loch Maree]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_025773893.1| iron ABC transporter permease [Clostridium botulinum]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_003361009.1| iron ABC transporter permease [Clostridium botulinum]
 gb|EDT85916.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum Bf]
 gb|KGO14821.1| iron ABC transporter permease [Clostridium botulinum]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_021136621.1| iron ABC transporter permease [Clostridium botulinum]
 gb|EPS47307.1| iron ABC transporter permease [Clostridium botulinum A1 str. 
CFSAN002368]
 gb|AJD28492.1| fecCD transport family protein [Clostridium botulinum CDC_297]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_012720573.1| iron ABC transporter permease [Clostridium botulinum]
 ref|YP_002861893.1| iron chelate uptake ABC transporter permease [Clostridium botulinum 
Ba4 str. 657]
 gb|ACQ52123.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum Ba4 str. 657]
 gb|AJE10203.1| fecCD transport family protein [Clostridium botulinum CDC_1436]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_003356131.1| iron ABC transporter permease [Clostridium botulinum]
 gb|EDT82605.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Clostridium botulinum NCTC 2916]
 gb|EPS53856.1| iron chelate uptake ABC transporter permease [Clostridium botulinum 
Af84]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLGVNY +IINIGL
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINIGL  224



>ref|WP_015899640.1| iron ABC transporter permease [Staphylococcus carnosus]
 ref|YP_002633480.1| FecCD transport family protein SstA [Staphylococcus carnosus 
subsp. carnosus TM300]
 emb|CAL27295.1| homolog of FecCD transport family protein SstA [Staphylococcus 
carnosus subsp. carnosus TM300]
Length=324

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FTIAGMGKDFS+NLGVNYE+I+  GL
Sbjct  205  FTIAGMGKDFSHNLGVNYERIMMFGL  230



>ref|WP_003392809.1| transport system permease [Brevibacillus borstelensis]
 gb|EMT50054.1| transport system permease [Brevibacillus borstelensis AK1]
Length=317

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY +++NIGL I A +TA VV+TVG +PF
Sbjct  199  FTIAGMGEDFSKNLGLNYRRVVNIGLVIVALVTASVVLTVGMIPF  243



>gb|EKN41334.1| iron ABC transporter permease, partial [Clostridium botulinum 
CFSAN001627]
Length=118

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  134  TIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            T+AGMG+DFS NLGVNY +IINIGL I A I++LVV+TVG +PF
Sbjct  1    TVAGMGEDFSKNLGVNYNRIINIGLVIVALISSLVVITVGKIPF  44



>ref|WP_029267392.1| iron ABC transporter permease [Virgibacillus alimentarius]
Length=317

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY +++NIGL I A +TA VV++VG +PF
Sbjct  199  FTIAGMGEDFSRNLGLNYRQVVNIGLIIVALVTASVVLSVGMIPF  243



>ref|WP_025174771.1| iron ABC transporter permease [Staphylococcus aureus]
Length=337

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGK+F+NNLG++YEK+IN+ LFITATITALVVVTVGTLPF
Sbjct  217  FTIVGMGKNFTNNLGLSYEKLINVALFITATITALVVVTVGTLPF  261



>gb|EHM82732.1| iron chelate uptake ABC transporter, FeCT family, permease protein 
[Staphylococcus aureus subsp. aureus 21194]
Length=323

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTI GMGK+F+NNLG++YEK+IN+ LFITATITALVVVTVGTLPF
Sbjct  203  FTIVGMGKNFTNNLGLSYEKLINVALFITATITALVVVTVGTLPF  247



>ref|WP_006287304.1| permease component [Paenibacillus popilliae]
 dbj|GAC43617.1| permease component [Paenibacillus popilliae ATCC 14706]
Length=317

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY++++NIGL + A +T  VV+TVGT+PF
Sbjct  199  FTVAGMGEDFSKNLGLNYKRVVNIGLILVALVTCTVVLTVGTIPF  243



>ref|WP_017547863.1| hypothetical protein [Salinicoccus carnicancri]
Length=322

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY++++ IGLFITA ITALVVV+VG LPF
Sbjct  204  FTVAGMGEDFSKNLGLNYQRVLYIGLFITAVITALVVVSVGMLPF  248



>ref|WP_019423448.1| iron ABC transporter permease [Paenibacillus sp. OSY-SE]
Length=317

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY++++NIGL I A +T+ VV+TVGT+PF
Sbjct  199  FTVAGMGEDFSKNLGLNYKRVVNIGLVIVALVTSSVVLTVGTIPF  243



>ref|WP_006679306.1| iron ABC transporter permease [Paenibacillus dendritiformis]
 gb|EHQ59686.1| ABC transporter permease [Paenibacillus dendritiformis C454]
Length=317

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY++++NIGL + A +T  VV+TVGT+PF
Sbjct  199  FTVAGMGEDFSKNLGLNYKRVVNIGLILVALVTCTVVLTVGTIPF  243



>ref|WP_027955641.1| iron ABC transporter permease [Halobacillus kuroshimensis]
Length=317

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FTIAGMGKDF++NLG+ Y++I+NIGL
Sbjct  199  FTIAGMGKDFASNLGLQYKQIVNIGL  224



>ref|WP_024094004.1| iron-siderophore ABC transporter-like protein [Paenibacillus 
larvae]
 ref|YP_008967490.1| iron-siderophore ABC transporter-like protein [Paenibacillus 
larvae subsp. larvae DSM 25430]
 gb|ETK27066.1| iron-siderophore ABC transporter-like protein [Paenibacillus 
larvae subsp. larvae DSM 25719]
 gb|AHD05543.1| iron-siderophore ABC transporter-like protein [Paenibacillus 
larvae subsp. larvae DSM 25430]
Length=317

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLGVNY +++N+GL I A ++A+V++TVGT+PF
Sbjct  199  FTVAGMGEDFSKNLGVNYNRVVNVGLVIVALVSAVVILTVGTIPF  243



>ref|WP_019395381.1| iron ABC transporter permease [Bacillus endophyticus]
Length=316

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DF+ NLG+NY+K++NIGL + A I+++V++TVG +PF
Sbjct  199  FTIAGMGEDFAVNLGLNYKKVVNIGLILVALISSVVLLTVGMIPF  243



>ref|WP_003491502.1| iron ABC transporter permease [Clostridium sporogenes]
 gb|EHN15939.1| iron chelate uptake ABC transporter permease [Clostridium sporogenes 
PA 3679]
 gb|KCZ69079.1| iron chelate uptake ABC transporter permease [Clostridium sporogenes]
 gb|AJD32113.1| fecCD transport family protein [Clostridium botulinum Prevot_594]
Length=317

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLGVNY +IIN+GL I A I++LVV+TVG +PF
Sbjct  199  FTVAGMGEDFSKNLGVNYNRIINMGLVIVALISSLVVITVGKIPF  243



>ref|WP_036577082.1| iron ABC transporter permease [Oceanobacillus picturae]
 emb|CDO04024.1| Iron-uptake system permease protein FeuB [Oceanobacillus picturae]
Length=317

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY +++N+GL I A +TA VV++VG +PF
Sbjct  199  FTIAGMGEDFSRNLGLNYRQVVNLGLVIVALVTASVVLSVGLIPF  243



>ref|WP_027632822.1| iron ABC transporter permease [Clostridium hydrogeniformans]
Length=317

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+NY K++NIGL I + I+++VV+TVG +PF
Sbjct  199  FTVAGMGEDFSKNLGLNYNKVVNIGLIIVSLISSVVVITVGKIPF  243



>ref|WP_026683096.1| iron ABC transporter permease [Bacillus megaterium]
Length=317

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY +++N+GL I A +TA VV+ VG +PF
Sbjct  199  FTIAGMGEDFSKNLGLNYRQVVNLGLIIVALVTASVVLAVGVIPF  243



>ref|WP_007441116.1| transporter [Candidatus Arthromitus sp. SFB-2]
 gb|EIA21976.1| Iron chelate uptake ABC transporter, FeCT family, permease protein 
[Candidatus Arthromitus sp. SFB-2]
Length=207

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMGKDF+ NLG+NY++++NIG+
Sbjct  89   FTVAGMGKDFATNLGLNYDRVVNIGV  114



>ref|WP_019379135.1| iron ABC transporter permease [Virgibacillus halodenitrificans]
 emb|CDQ37394.1| Iron-uptake system permease protein FeuB [Virgibacillus halodenitrificans]
Length=317

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY +++N+GL I A +TA VV+ VG +PF
Sbjct  199  FTIAGMGEDFSKNLGLNYRQVVNLGLVIVALVTASVVLAVGMIPF  243



>gb|AIF42309.1| iron ABC transporter permease [Virgibacillus sp. SK37]
Length=317

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+NY +++N+GL I A +TA VV+ VG +PF
Sbjct  199  FTIAGMGEDFSKNLGLNYRQVVNLGLVIVALVTASVVLAVGMIPF  243



>ref|WP_019538238.1| hypothetical protein [Proteiniphilum acetatigenes]
Length=313

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+ GMG+DFS NLG+NY  I+NIGLF  +   + VV+T G +PF
Sbjct  199  FTVVGMGEDFSRNLGLNYTAIMNIGLFCVSLTVSAVVITAGAIPF  243



>ref|WP_029142520.1| iron ABC transporter permease [Bacillus coagulans]
Length=316

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DF+ NLG+NY+++INIGL
Sbjct  199  FTVAGMGEDFAKNLGLNYKQVINIGL  224



>ref|WP_031262609.1| iron ABC transporter permease [Staphylococcus simulans]
Length=322

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FTIAGMGKDFS+NLGVNY++I+  GL
Sbjct  203  FTIAGMGKDFSHNLGVNYDRIMMFGL  228



>ref|WP_026901737.1| iron ABC transporter permease [Peptostreptococcaceae bacterium 
VA2]
Length=317

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FTIAGMG+DF+ NLG+NY KI+NIGL
Sbjct  199  FTIAGMGEDFATNLGLNYNKIVNIGL  224



>gb|EKS24207.1| hypothetical protein HMPREF9310_02034 [Staphylococcus simulans 
ACS-120-V-Sch1]
 gb|ERS93665.1| iron ABC transporter permease [Staphylococcus simulans UMC-CNS-990]
Length=323

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FTIAGMGKDFS+NLGVNY++I+  GL
Sbjct  204  FTIAGMGKDFSHNLGVNYDRIMMFGL  229



>ref|WP_007444438.1| MULTISPECIES: Putative iron compound ABC transporter, permease 
protein, partial [Candidatus Arthromitus]
 gb|EIA26635.1| Putative iron compound ABC transporter, permease protein, partial 
[Candidatus Arthromitus sp. SFB-5]
 gb|EIA27685.1| Putative iron compound ABC transporter, permease protein, partial 
[Candidatus Arthromitus sp. SFB-co]
Length=313

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMGKDF+ NLG+NY++++NIG+
Sbjct  201  FTVAGMGKDFATNLGLNYDRVVNIGV  226



>ref|WP_014095860.1| iron ABC transporter permease [Bacillus coagulans]
 ref|YP_004858487.1| ABC transporter integral membrane protein [Bacillus coagulans 
36D1]
 gb|AEO99706.1| ABC-type transporter, integral membrane subunit [Bacillus coagulans 
36D1]
Length=316

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DF+ NLG+NY++++NIGL + A IT+  V+TVGT+PF
Sbjct  199  FTVAGMGEDFAKNLGLNYKQVVNIGLVLVALITSATVLTVGTIPF  243



>ref|WP_026684165.1| iron ABC transporter permease [Bacillus coagulans]
Length=316

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DF+ NLG+NY++++NIGL + A IT+  V+TVGT+PF
Sbjct  199  FTVAGMGEDFAKNLGLNYKQVVNIGLVLVALITSATVLTVGTIPF  243



>ref|WP_017553918.1| iron ABC transporter permease [Bacillus coagulans]
Length=316

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DF+ NLG+NY++++NIGL + A IT+  V+TVGT+PF
Sbjct  199  FTVAGMGEDFAKNLGLNYKQVVNIGLVLVALITSATVLTVGTIPF  243



>dbj|BAQ09003.1| ABC transporter permease [Bacillus sp. OxB-1]
Length=316

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+ Y++I+NIGL + A IT  VV+TVG +PF
Sbjct  199  FTVAGMGEDFSKNLGLAYKRIVNIGLILVALITTTVVLTVGMIPF  243



>ref|WP_038482138.1| iron ABC transporter permease [Bacillus lehensis]
Length=317

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AG+GKDF+ NLG+NY +I+NIGL I A +TA +VVT+G++PF
Sbjct  199  FTVAGLGKDFATNLGMNYNRIMNIGLLIVAMVTATIVVTIGSVPF  243



>ref|WP_009498922.1| iron ABC transporter permease [Sporosarcina newyorkensis]
 gb|EGQ25151.1| ferric (Fe+3) ABC superfamily ATP binding cassette transporter, 
membrane protein [Sporosarcina newyorkensis 2681]
Length=316

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG+DFS NLG+ Y++I+NIGL + A IT  VV+TVG +PF
Sbjct  199  FTVAGMGEDFSKNLGLAYKRIVNIGLILVALITTTVVLTVGMIPF  243



>gb|AIC95375.1| ABC transporter permease [Bacillus lehensis G1]
Length=337

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AG+GKDF+ NLG+NY +I+NIGL I A +TA +VVT+G++PF
Sbjct  219  FTVAGLGKDFATNLGMNYNRIMNIGLLIVAMVTATIVVTIGSVPF  263



>ref|WP_005805565.1| MULTISPECIES: iron ABC transporter permease [Candidatus Arthromitus]
 ref|YP_005668788.1| putative iron compound ABC transporter permease [Candidatus Arthromitus 
sp. SFB-mouse-Yit]
 gb|EGX28405.1| iron complex transport system permease protein [Candidatus Arthromitus 
sp. SFB-mouse-NYU]
 dbj|BAK80212.1| putative iron compound ABC transporter, permease protein [Candidatus 
Arthromitus sp. SFB-mouse-Yit]
 gb|EIA29935.1| Putative iron compound ABC transporter, permease protein [Candidatus 
Arthromitus sp. SFB-mouse-SU]
 gb|EIA31646.1| Putative iron compound ABC transporter, permease protein [Candidatus 
Arthromitus sp. SFB-4]
 gb|AID45125.1| putative iron compound ABC uptake transporter, permease protein 
[Candidatus Arthromitus sp. SFB-mouse-NL]
Length=319

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMGKDF+ NLG+NY++++NIG+
Sbjct  201  FTVAGMGKDFATNLGLNYDRVVNIGV  226



>ref|WP_014018021.1| iron ABC transporter permease [Candidatus Arthromitus sp. SFB-mouse]
 ref|YP_004771648.1| iron compound ABC transporter permease [Candidatus Arthromitus 
sp. SFB-mouse-Japan]
 dbj|BAK56906.1| iron compound ABC transporter, permease protein [Candidatus Arthromitus 
sp. SFB-mouse-Japan]
Length=319

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMGKDF+ NLG+NY++++NIG+
Sbjct  201  FTVAGMGKDFATNLGLNYDRVVNIGV  226



>gb|AHM67980.1| ceuB [Paenibacillus polymyxa SQR-21]
Length=151

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DF+ NLGV+Y++ +N+GL I A ++++V++TVGT+PF
Sbjct  33   FTIAGMGEDFAANLGVHYKRTVNVGLVIVALVSSVVILTVGTIPF  77



>ref|WP_019637373.1| iron ABC transporter permease [Paenibacillus fonticola]
Length=317

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLF  57
            FT+AGMG++FS NLG+NY++++NIGLF
Sbjct  199  FTVAGMGEEFSVNLGLNYKQVVNIGLF  225



>dbj|GAK09307.1| LOW QUALITY PROTEIN: iron compound ABC uptake transporter, permease 
protein [Geomicrobium sp. JCM 19038]
Length=317

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLF  57
            FT+AGMG+DFS +LG+NY++I+NIGL 
Sbjct  199  FTVAGMGRDFSQSLGLNYKQIMNIGLL  225



>dbj|GAJ99254.1| iron compound ABC uptake transporter, permease protein [Geomicrobium 
sp. JCM 19055]
Length=317

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLF  57
            FT+AGMG+DFS +LG+NY++I+NIGL 
Sbjct  199  FTVAGMGRDFSQSLGLNYKQIMNIGLL  225



>ref|WP_032122357.1| iron ABC transporter permease [Clostridium sp. LF2]
Length=317

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLG+NY K++N+GL
Sbjct  199  FTVAGMGEDFSKNLGLNYNKVVNVGL  224



>ref|WP_007439824.1| iron ABC transporter permease [Candidatus Arthromitus sp. SFB-1]
 gb|EIA24634.1| Putative iron compound ABC transporter, permease protein [Candidatus 
Arthromitus sp. SFB-1]
Length=319

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMGKDF+ NLG+NY++++NIG+
Sbjct  201  FTVAGMGKDFATNLGLNYDRVVNIGV  226



>ref|WP_013487013.1| iron ABC transporter permease [Bacillus cellulosilyticus]
 ref|YP_004093403.1| transporter permease [Bacillus cellulosilyticus DSM 2522]
 gb|ADU28672.1| transport system permease protein [Bacillus cellulosilyticus 
DSM 2522]
Length=317

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FT+AGMG++FS NLG+NY++++NIGL I A + ++V++TVG +PF
Sbjct  199  FTVAGMGEEFSVNLGINYKRVVNIGLIIVAAVASVVLLTVGMIPF  243



>ref|WP_014095008.1| iron ABC transporter permease [Candidatus Arthromitus sp. SFB-rat-Yit]
 ref|YP_004857474.1| putative iron compound ABC transporter permease [Candidatus Arthromitus 
sp. SFB-rat-Yit]
 dbj|BAK81548.1| putative iron compound ABC transporter, permease protein [Candidatus 
Arthromitus sp. SFB-rat-Yit]
Length=319

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+ GMGKDF+ NLG+NY+KI+NIG+
Sbjct  201  FTVVGMGKDFATNLGLNYDKIVNIGV  226



>ref|WP_003468532.1| transport system permease [Gracilibacillus halophilus]
 gb|ENH96797.1| transport system permease [Gracilibacillus halophilus YIM-C55.5]
Length=136

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DF+ NLG+++ +++NIGL I A ITA+V++TVG +PF
Sbjct  19   FTIAGMGEDFATNLGLHHRRVVNIGLVIVAIITAVVILTVGMIPF  63



>ref|WP_035182202.1| iron ABC transporter permease [Bacillus coagulans]
 gb|KGB30778.1| iron ABC transporter permease [Bacillus coagulans]
Length=316

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DF+ NLG+NY++++NIGL
Sbjct  199  FTVAGMGEDFAKNLGLNYKQVVNIGL  224



>ref|WP_021881316.1| Uncharacterized ABC transporter permease protein YclN [Paenibacillus 
sp. P22]
 emb|CDN44841.1| Uncharacterized ABC transporter permease protein YclN [Paenibacillus 
sp. P22]
Length=320

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FTIAGMG++FS NLG++Y KI+NIGL
Sbjct  202  FTIAGMGEEFSVNLGISYRKIVNIGL  227



>ref|WP_022212974.1| transport system permease protein [Clostridium sp. CAG:265]
 emb|CDB75993.1| transport system permease protein [Clostridium sp. CAG:265]
Length=314

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+ FS NLG+N+E+I+NIGL + + ++AL +V VG +PF
Sbjct  199  FTIAGMGESFSTNLGLNHERIVNIGLILVSAVSALTLVMVGNIPF  243



>ref|WP_011195730.1| iron ABC transporter permease [Symbiobacterium thermophilum]
 ref|YP_075430.1| ferrichrome ABC transporter permease [Symbiobacterium thermophilum 
IAM 14863]
 dbj|BAD40586.1| ferrichrome ABC transporter permease protein [Symbiobacterium 
thermophilum IAM 14863]
Length=322

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FTIAGMG+DF+ NLGVNY  ++N+GL
Sbjct  203  FTIAGMGEDFATNLGVNYRSVVNVGL  228



>ref|WP_025850941.1| iron ABC transporter permease [Paenibacillus ehimensis]
Length=317

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FT+AGMG+DFS NLG+NY +++NIGL
Sbjct  199  FTVAGMGEDFSVNLGLNYRQVVNIGL  224



>ref|WP_031573075.1| iron ABC transporter permease [Proteiniclasticum ruminis]
Length=315

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGL  60
            FTIAGMG+DF+ NLG+NY+ I+NIGL
Sbjct  199  FTIAGMGEDFAKNLGLNYQLIVNIGL  224



>ref|WP_021428711.1| fecCD transport family protein [[Clostridium] bifermentans]
 gb|EQK47284.1| fecCD transport family protein [ [[Clostridium] bifermentans 
ATCC 19299]
Length=318

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DF+ NLG+NY K++N+GL I A +T  VV+T G++PF
Sbjct  199  FTIAGMGEDFATNLGLNYNKVVNLGLMIVAIVTVCVVITAGSIPF  243



>ref|WP_035510293.1| MULTISPECIES: iron ABC transporter permease [Halobacillus]
 emb|CDQ28642.1| Iron-uptake system permease protein FeuB [Halobacillus trueperi]
 emb|CDQ20939.1| Iron-uptake system permease protein FeuB [Halobacillus dabanensis]
 emb|CDQ24997.1| Iron-uptake system permease protein FeuB [Halobacillus karajensis]
Length=319

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DFS NLG+N+++++ IGLFI A +TA+VV+TVG +PF
Sbjct  199  FTIAGMGEDFSKNLGLNHKQVVYIGLFIVALMTAVVVLTVGAIPF  243



>ref|WP_025162825.1| iron ABC transporter permease [[Clostridium] bifermentans]
Length=318

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  FTIAGMGKDFSNNLGVNYEKIINIGLFitatitalvvvtvgtLPF  3
            FTIAGMG+DF+ NLG+NY K++N+GL I A +T  VV+T G++PF
Sbjct  199  FTIAGMGEDFATNLGLNYNKVVNLGLMIVAIVTVCVVITAGSIPF  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510661775884