BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6563_g2_i1 len=335 path=[591:0-334]

Length=335
                                                                      Score     E

ref|XP_007024474.1|  Receptor-like protein kinase-related family ...    150   3e-42   
ref|XP_006380319.1|  hypothetical protein POPTR_0007s02730g             147   4e-41   
ref|XP_006387991.1|  receptor-like protein kinase                       145   2e-40   
ref|XP_006447470.1|  hypothetical protein CICLE_v10017568mg             145   3e-40   
ref|XP_006469729.1|  PREDICTED: cysteine-rich repeat secretory pr...    144   3e-40   
ref|XP_010051171.1|  PREDICTED: cysteine-rich repeat secretory pr...    144   4e-40   
ref|XP_010069655.1|  PREDICTED: cysteine-rich repeat secretory pr...    144   7e-40   
ref|XP_006351952.1|  PREDICTED: cysteine-rich repeat secretory pr...    143   1e-39   
ref|XP_004251507.1|  PREDICTED: cysteine-rich repeat secretory pr...    142   2e-39   
ref|XP_006352035.1|  PREDICTED: cysteine-rich repeat secretory pr...    142   2e-39   
ref|XP_009794300.1|  PREDICTED: cysteine-rich repeat secretory pr...    139   2e-39   
ref|XP_002309843.2|  hypothetical protein POPTR_0007s02720g             142   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006351953.1|  PREDICTED: cysteine-rich repeat secretory pr...    141   7e-39   
ref|XP_011003220.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   9e-39   
ref|XP_009787632.1|  PREDICTED: cysteine-rich repeat secretory pr...    139   9e-39   
gb|KDP25874.1|  hypothetical protein JCGZ_22904                         140   1e-38   
ref|XP_009787631.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-38   
ref|XP_009793791.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-38   
ref|XP_009605992.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-38   
ref|XP_009591406.1|  PREDICTED: cysteine-rich repeat secretory pr...    139   3e-38   
ref|XP_010051179.1|  PREDICTED: cysteine-rich repeat secretory pr...    139   6e-38   
ref|XP_006372985.1|  hypothetical protein POPTR_0017s06790g             138   8e-38   
ref|XP_010051161.1|  PREDICTED: cysteine-rich repeat secretory pr...    137   1e-37   
ref|XP_006372978.1|  hypothetical protein POPTR_0017s06720g             137   1e-37   
ref|XP_002515716.1|  DUF26 domain-containing protein 2 precursor,...    137   2e-37   Ricinus communis
ref|XP_006372979.1|  hypothetical protein POPTR_0017s06730g             137   2e-37   
ref|XP_007010459.1|  Receptor-like protein kinase-related family ...    137   2e-37   
ref|XP_007149948.1|  hypothetical protein PHAVU_005G112800g             136   6e-37   
gb|KHN36561.1|  Cysteine-rich repeat secretory protein 38               135   8e-37   
gb|ACU16205.1|  unknown                                                 133   1e-35   Glycine max [soybeans]
ref|XP_003543377.1|  PREDICTED: cysteine-rich repeat secretory pr...    132   1e-35   
ref|XP_006387993.1|  hypothetical protein POPTR_0421s00220g             132   1e-35   
ref|XP_010051151.1|  PREDICTED: cysteine-rich repeat secretory pr...    132   3e-35   
ref|XP_006372981.1|  hypothetical protein POPTR_0017s06750g             132   3e-35   
emb|CAN73038.1|  hypothetical protein VITISV_044348                     131   5e-35   Vitis vinifera
ref|XP_010109547.1|  hypothetical protein L484_018282                   130   8e-35   
ref|XP_006380320.1|  hypothetical protein POPTR_0007s02740g             130   1e-34   
ref|XP_011003221.1|  PREDICTED: cysteine-rich repeat secretory pr...    130   1e-34   
gb|AFK48353.1|  unknown                                                 130   2e-34   
gb|KDO59869.1|  hypothetical protein CISIN_1g041051mg                   127   2e-34   
ref|XP_006387992.1|  hypothetical protein POPTR_0421s00210g             129   2e-34   
gb|AES67291.2|  cysteine-rich RLK (receptor-like kinase) protein        129   3e-34   
gb|AFK43074.1|  unknown                                                 129   3e-34   
ref|XP_006469774.1|  PREDICTED: cysteine-rich repeat secretory pr...    128   8e-34   
ref|XP_010247023.1|  PREDICTED: cysteine-rich repeat secretory pr...    127   1e-33   
ref|XP_007216947.1|  hypothetical protein PRUPE_ppa016345mg             126   1e-33   
ref|XP_006447471.1|  hypothetical protein CICLE_v10018332mg             126   2e-33   
ref|XP_010247024.1|  PREDICTED: cysteine-rich repeat secretory pr...    127   2e-33   
ref|XP_003597040.1|  Cysteine-rich repeat secretory protein             128   4e-33   
ref|XP_006372983.1|  hypothetical protein POPTR_0017s06770g             126   4e-33   
gb|KDO59870.1|  hypothetical protein CISIN_1g046481mg                   126   5e-33   
ref|XP_002274668.1|  PREDICTED: cysteine-rich repeat secretory pr...    125   8e-33   Vitis vinifera
ref|XP_007216907.1|  hypothetical protein PRUPE_ppa019252mg             124   1e-32   
ref|XP_011037143.1|  PREDICTED: cysteine-rich repeat secretory pr...    125   1e-32   
ref|XP_002533571.1|  DUF26 domain-containing protein 2 precursor,...    125   1e-32   Ricinus communis
ref|XP_006372982.1|  hypothetical protein POPTR_0017s06760g             124   2e-32   
ref|XP_011037144.1|  PREDICTED: cysteine-rich repeat secretory pr...    124   3e-32   
emb|CAN73036.1|  hypothetical protein VITISV_044346                     123   3e-32   Vitis vinifera
ref|XP_008228882.1|  PREDICTED: cysteine-rich repeat secretory pr...    124   3e-32   
gb|KHN36560.1|  Cysteine-rich repeat secretory protein 38               123   5e-32   
emb|CAN73040.1|  hypothetical protein VITISV_044350                     121   1e-31   Vitis vinifera
ref|XP_002274745.2|  PREDICTED: cysteine-rich repeat secretory pr...    122   1e-31   Vitis vinifera
emb|CBI28973.3|  unnamed protein product                                122   2e-31   
ref|XP_003541936.1|  PREDICTED: cysteine-rich repeat secretory pr...    122   2e-31   
emb|CDY68211.1|  BnaCnng58060D                                          121   3e-31   
gb|KDP25619.1|  hypothetical protein JCGZ_20775                         120   4e-31   
ref|XP_008342465.1|  PREDICTED: cysteine-rich repeat secretory pr...    121   4e-31   
ref|XP_011079182.1|  PREDICTED: cysteine-rich repeat secretory pr...    121   4e-31   
ref|XP_004144581.1|  PREDICTED: cysteine-rich repeat secretory pr...    120   9e-31   
ref|XP_003633310.1|  PREDICTED: cysteine-rich repeat secretory pr...    119   1e-30   
emb|CAN73039.1|  hypothetical protein VITISV_044349                     119   1e-30   Vitis vinifera
ref|XP_010532487.1|  PREDICTED: cysteine-rich repeat secretory pr...    120   1e-30   
ref|XP_009145437.1|  PREDICTED: cysteine-rich repeat secretory pr...    119   2e-30   
gb|AAN46194.1|  unknown protein                                         117   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46205.1|  unknown protein                                         117   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069666.1|  PREDICTED: cysteine-rich repeat secretory pr...    118   3e-30   
ref|XP_002274604.1|  PREDICTED: cysteine-rich repeat secretory pr...    118   3e-30   Vitis vinifera
emb|CAN73037.1|  hypothetical protein VITISV_044347                     120   4e-30   Vitis vinifera
ref|XP_010684085.1|  PREDICTED: cysteine-rich repeat secretory pr...    118   5e-30   
ref|XP_004292427.1|  PREDICTED: cysteine-rich repeat secretory pr...    117   8e-30   
gb|AAN46195.1|  unknown protein                                         116   9e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57408.1|  BnaA05g36230D                                          117   1e-29   
ref|XP_006406217.1|  hypothetical protein EUTSA_v10021371mg             117   1e-29   
ref|NP_566697.1|  Receptor-like protein kinase-related family pro...    117   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455405.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   6e-29   
gb|EYU43106.1|  hypothetical protein MIMGU_mgv1a021349mg                115   6e-29   
gb|KDP32106.1|  hypothetical protein JCGZ_12567                         114   1e-28   
ref|XP_008237024.1|  PREDICTED: cysteine-rich repeat secretory pr...    113   4e-28   
gb|EYU43108.1|  hypothetical protein MIMGU_mgv1a018557mg                112   5e-28   
ref|XP_008455543.1|  PREDICTED: cysteine-rich repeat secretory pr...    112   1e-27   
ref|XP_003597035.1|  Cysteine-rich repeat secretory protein             112   1e-27   
ref|XP_004144580.1|  PREDICTED: cysteine-rich repeat secretory pr...    110   2e-27   
ref|XP_004168058.1|  PREDICTED: cysteine-rich repeat secretory pr...    110   2e-27   
ref|XP_008391617.1|  PREDICTED: cysteine-rich repeat secretory pr...    111   2e-27   
gb|KGN43546.1|  hypothetical protein Csa_7G044860                       111   3e-27   
gb|EYU43107.1|  hypothetical protein MIMGU_mgv1a022379mg                111   3e-27   
ref|XP_006850462.1|  hypothetical protein AMTR_s00035p00084590          108   5e-27   
ref|XP_008342466.1|  PREDICTED: cysteine-rich repeat secretory pr...    110   7e-27   
gb|KFK39506.1|  hypothetical protein AALP_AA3G252600                    110   9e-27   
gb|AAN46207.1|  unknown protein                                         108   1e-26   Arabidopsis lyrata [lyrate rockcress]
ref|XP_004487372.1|  PREDICTED: cysteine-rich repeat secretory pr...    109   1e-26   
ref|XP_008228908.1|  PREDICTED: cysteine-rich repeat secretory pr...    108   2e-26   
ref|XP_010051188.1|  PREDICTED: cysteine-rich repeat secretory pr...    108   2e-26   
ref|XP_002878210.1|  hypothetical protein ARALYDRAFT_348900             108   3e-26   
gb|AAN46206.1|  unknown protein                                         107   4e-26   Arabidopsis lyrata [lyrate rockcress]
ref|XP_008455404.1|  PREDICTED: cysteine-rich repeat secretory pr...    108   4e-26   
ref|XP_010496825.1|  PREDICTED: cysteine-rich repeat secretory pr...    107   6e-26   
ref|XP_008236988.1|  PREDICTED: cysteine-rich repeat secretory pr...    107   9e-26   
ref|XP_008237025.1|  PREDICTED: cysteine-rich repeat secretory pr...    107   1e-25   
ref|XP_007149947.1|  hypothetical protein PHAVU_005G112700g             106   1e-25   
ref|XP_002883339.1|  hypothetical protein ARALYDRAFT_479720             106   2e-25   
ref|XP_010431451.1|  PREDICTED: putative cysteine-rich repeat sec...    105   3e-25   
ref|XP_010516475.1|  PREDICTED: putative cysteine-rich repeat sec...    105   4e-25   
ref|XP_004144485.1|  PREDICTED: cysteine-rich repeat secretory pr...    105   4e-25   
ref|XP_010510855.1|  PREDICTED: cysteine-rich repeat secretory pr...    104   1e-24   
ref|NP_191390.1|  uncharacterized protein                               103   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398186.1|  PREDICTED: cysteine-rich repeat secretory pr...    102   3e-24   
ref|XP_006592824.1|  PREDICTED: cysteine-rich repeat secretory pr...    100   6e-24   
ref|XP_006298384.1|  hypothetical protein CARUB_v10014454mg             102   7e-24   
ref|XP_006292774.1|  hypothetical protein CARUB_v10019024mg             102   8e-24   
ref|XP_010466466.1|  PREDICTED: putative cysteine-rich repeat sec...    100   3e-23   
ref|XP_010504787.1|  PREDICTED: putative cysteine-rich repeat sec...  99.4    1e-22   
ref|XP_004144484.1|  PREDICTED: cysteine-rich repeat secretory pr...  98.2    2e-22   
sp|Q9LRL8.2|CRR21_ARATH  RecName: Full=Putative cysteine-rich rep...  98.2    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850460.1|  hypothetical protein AMTR_s00035p00082360        97.4    4e-22   
ref|XP_004168056.1|  PREDICTED: cysteine-rich repeat secretory pr...  97.4    5e-22   
ref|XP_009150860.1|  PREDICTED: putative cysteine-rich repeat sec...  97.4    5e-22   
dbj|BAB01372.1|  unnamed protein product                              97.4    5e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88009.1|  BnaA06g26000D                                        97.4    5e-22   
ref|XP_007201324.1|  hypothetical protein PRUPE_ppa009992mg           97.1    6e-22   
ref|XP_006299328.1|  hypothetical protein CARUB_v10015485mg           95.9    2e-21   
ref|XP_008455406.1|  PREDICTED: cysteine-rich repeat secretory pr...  95.1    3e-21   
emb|CDY07878.1|  BnaC03g47440D                                        94.7    5e-21   
sp|Q9LRL7.2|CRR22_ARATH  RecName: Full=Putative cysteine-rich rep...  94.0    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466465.1|  PREDICTED: putative cysteine-rich repeat sec...  92.4    4e-20   
ref|XP_010908140.1|  PREDICTED: cysteine-rich repeat secretory pr...  92.4    5e-20   
ref|XP_006406223.1|  hypothetical protein EUTSA_v10021973mg           91.7    5e-20   
ref|XP_010910400.1|  PREDICTED: cysteine-rich repeat secretory pr...  92.0    6e-20   
ref|XP_006467960.1|  PREDICTED: cysteine-rich repeat secretory pr...  92.0    6e-20   
gb|KDO75586.1|  hypothetical protein CISIN_1g021048mg                 92.0    6e-20   
sp|Q9LRK9.2|CRR28_ARATH  RecName: Full=Putative cysteine-rich rep...  91.7    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008800494.1|  PREDICTED: putative receptor-like protein ki...  94.7    7e-20   
ref|XP_006406033.1|  hypothetical protein EUTSA_v10022150mg           90.9    1e-19   
ref|XP_007049618.1|  Receptor-like protein kinase-related family ...  89.7    3e-19   
ref|XP_010466464.1|  PREDICTED: putative cysteine-rich repeat sec...  89.7    4e-19   
ref|XP_010910239.1|  PREDICTED: putative receptor-like protein ki...  91.7    7e-19   
ref|XP_006449122.1|  hypothetical protein CICLE_v10015972mg           89.0    8e-19   
ref|XP_006299311.1|  hypothetical protein CARUB_v10015466mg           88.2    1e-18   
ref|XP_006406226.1|  hypothetical protein EUTSA_v10022184mg           87.4    3e-18   
ref|XP_010646646.1|  PREDICTED: cysteine-rich repeat secretory pr...  87.4    3e-18   
ref|XP_002264674.2|  PREDICTED: cysteine-rich repeat secretory pr...  87.0    3e-18   Vitis vinifera
ref|XP_006828418.1|  hypothetical protein AMTR_s00060p00084230        86.7    4e-18   
ref|XP_006838099.1|  hypothetical protein AMTR_s00106p00036910        86.3    5e-18   
ref|NP_188837.1|  cysteine-rich repeat secretory protein 29           85.9    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481161.1|  PREDICTED: putative cysteine-rich repeat sec...  85.9    6e-18   
ref|XP_010646957.1|  PREDICTED: cysteine-rich receptor-like prote...  89.0    7e-18   
ref|XP_002894412.1|  predicted protein                                85.9    7e-18   
sp|Q9LRL0.2|CRR27_ARATH  RecName: Full=Putative cysteine-rich rep...  85.9    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223972.1|  hypothetical protein PRUPE_ppa014621mg           88.6    7e-18   
gb|KHN25769.1|  Cysteine-rich repeat secretory protein 38             83.6    8e-18   
ref|XP_007227081.1|  hypothetical protein PRUPE_ppa015766mg           83.6    1e-17   
emb|CAN64566.1|  hypothetical protein VITISV_020515                   86.3    1e-17   Vitis vinifera
ref|XP_010103954.1|  Cysteine-rich receptor-like protein kinase 25    87.8    1e-17   
ref|XP_003622768.1|  Cysteine-rich repeat secretory protein           85.1    1e-17   
ref|XP_010463431.1|  PREDICTED: putative cysteine-rich repeat sec...  84.7    2e-17   
ref|XP_006449124.1|  hypothetical protein CICLE_v10018264mg           83.6    2e-17   
ref|XP_008372641.1|  PREDICTED: cysteine-rich repeat secretory pr...  84.7    2e-17   
ref|XP_007214583.1|  hypothetical protein PRUPE_ppa026781mg           87.4    2e-17   
dbj|BAD43562.1|  putative protein                                     84.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
sp|P0CJ49.1|CRR42_ARATH  RecName: Full=Cysteine-rich repeat secre...  84.3    2e-17   
ref|NP_193799.2|  uncharacterized protein                             84.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KFK45107.1|  hypothetical protein AALP_AA1G345400                  84.3    2e-17   
sp|Q9SVI0.1|CRR41_ARATH  RecName: Full=Cysteine-rich repeat secre...  84.3    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931306.1|  PREDICTED: putative receptor-like protein ki...  87.0    2e-17   
ref|XP_010468360.1|  PREDICTED: putative cysteine-rich repeat sec...  84.3    3e-17   
ref|XP_008776433.1|  PREDICTED: cysteine-rich receptor-like prote...  87.0    3e-17   
ref|XP_010466463.1|  PREDICTED: putative cysteine-rich repeat sec...  84.0    3e-17   
gb|KHN25768.1|  Cysteine-rich repeat secretory protein 38             80.9    3e-17   
ref|XP_006842323.1|  hypothetical protein AMTR_s00079p00148810        86.3    5e-17   
ref|XP_010241766.1|  PREDICTED: cysteine-rich repeat secretory pr...  83.6    5e-17   
ref|XP_006484824.1|  PREDICTED: cysteine-rich repeat secretory pr...  83.6    5e-17   
ref|XP_006437221.1|  hypothetical protein CICLE_v10032523mg           83.2    6e-17   
ref|XP_010908261.1|  PREDICTED: cysteine-rich repeat secretory pr...  83.2    6e-17   
gb|KDO60896.1|  hypothetical protein CISIN_1g036866mg                 83.2    6e-17   
ref|XP_009372187.1|  PREDICTED: cysteine-rich repeat secretory pr...  83.2    6e-17   
ref|XP_010056929.1|  PREDICTED: cysteine-rich receptor-like prote...  85.5    6e-17   
ref|XP_006299457.1|  hypothetical protein CARUB_v10015622mg           83.2    7e-17   
ref|NP_188832.1|  Receptor protein kinase-related protein             83.2    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089218.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  83.2    7e-17   
ref|NP_567605.2|  uncharacterized protein                             85.1    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25876.1|  hypothetical protein JCGZ_22906                       82.8    8e-17   
ref|XP_011037142.1|  PREDICTED: cysteine-rich repeat secretory pr...  82.0    1e-16   
ref|XP_010932101.1|  PREDICTED: cysteine-rich repeat secretory pr...  82.8    1e-16   
ref|NP_001154635.1|  receptor-like protein kinase-related family ...  84.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LRL2.2|CRR25_ARATH  RecName: Full=Putative cysteine-rich rep...  82.4    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AFK33693.1|  unknown                                               82.0    1e-16   
ref|XP_009359012.1|  PREDICTED: cysteine-rich repeat secretory pr...  82.0    2e-16   
ref|XP_003638011.1|  Cysteine-rich receptor-like protein kinase       84.3    2e-16   
ref|XP_010468358.1|  PREDICTED: LOW QUALITY PROTEIN: putative cys...  82.0    2e-16   
ref|XP_008244704.1|  PREDICTED: cysteine-rich repeat secretory pr...  82.0    2e-16   
gb|KEH43963.1|  cysteine-rich receptor-kinase-like protein            84.7    2e-16   
ref|XP_003637963.1|  Cysteine-rich receptor-like protein kinase       84.7    2e-16   
sp|Q9LRL4.1|CRR24_ARATH  RecName: Full=Putative cysteine-rich rep...  81.6    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                   84.7    2e-16   
ref|NP_188834.4|  receptor-like protein kinase-related family pro...  81.6    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334264.1|  PREDICTED: cysteine-rich repeat secretory pr...  81.6    2e-16   
gb|AGT15895.1|  hypothetical protein SHCRBa_258_I03_R_340             84.0    3e-16   
ref|XP_008382567.1|  PREDICTED: cysteine-rich repeat secretory pr...  81.3    3e-16   
ref|XP_010052402.1|  PREDICTED: putative receptor-like protein ki...  83.6    4e-16   
ref|XP_010100808.1|  hypothetical protein L484_015838                 80.9    4e-16   
ref|XP_006595455.1|  PREDICTED: cysteine-rich repeat secretory pr...  79.7    5e-16   
ref|NP_180720.1|  putative cysteine-rich repeat secretory protein 10  80.9    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290148.1|  PREDICTED: cysteine-rich repeat secretory pr...  80.5    6e-16   
ref|XP_010052449.1|  PREDICTED: putative receptor-like protein ki...  83.2    6e-16   
ref|XP_008804396.1|  PREDICTED: putative receptor-like protein ki...  83.2    6e-16   
dbj|BAB01379.1|  unnamed protein product                              80.5    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492208.1|  PREDICTED: cysteine-rich repeat secretory pr...  80.5    7e-16   
ref|XP_007025964.1|  Cysteine-rich RLK 29, putative                   83.2    7e-16   
gb|KDP20813.1|  hypothetical protein JCGZ_21284                       80.5    8e-16   
ref|NP_188835.1|  cysteine-rich repeat secretory protein 26           80.1    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007140710.1|  hypothetical protein PHAVU_008G135300g           80.1    9e-16   
ref|XP_006828415.1|  hypothetical protein AMTR_s00060p00079250        80.1    9e-16   
ref|XP_008363779.1|  PREDICTED: cysteine-rich receptor-like prote...  82.8    1e-15   
ref|XP_002269937.2|  PREDICTED: cysteine-rich repeat secretory pr...  79.7    1e-15   Vitis vinifera
ref|XP_010267898.1|  PREDICTED: uncharacterized protein LOC104605002  83.2    1e-15   
ref|XP_008776432.1|  PREDICTED: cysteine-rich repeat secretory pr...  79.7    1e-15   
ref|XP_006299656.1|  hypothetical protein CARUB_v10015844mg           79.7    1e-15   
ref|XP_010910126.1|  PREDICTED: putative receptor-like protein ki...  82.4    1e-15   
ref|XP_003551283.1|  PREDICTED: cysteine-rich repeat secretory pr...  79.7    1e-15   
ref|XP_006406032.1|  hypothetical protein EUTSA_v10021994mg           79.3    1e-15   
ref|XP_008788477.1|  PREDICTED: cysteine-rich repeat secretory pr...  79.3    2e-15   
ref|XP_004166549.1|  PREDICTED: cysteine-rich receptor-like prote...  82.4    2e-15   
ref|XP_004145167.1|  PREDICTED: cysteine-rich receptor-like prote...  82.4    2e-15   
ref|XP_004153194.1|  PREDICTED: cysteine-rich receptor-like prote...  82.4    2e-15   
ref|XP_010513156.1|  PREDICTED: putative cysteine-rich repeat sec...  79.0    2e-15   
ref|XP_010679273.1|  PREDICTED: cysteine-rich repeat secretory pr...  79.0    2e-15   
ref|XP_002883335.1|  hypothetical protein ARALYDRAFT_479716           79.0    2e-15   
ref|XP_010646639.1|  PREDICTED: putative receptor-like protein ki...  81.6    2e-15   
ref|XP_008224860.1|  PREDICTED: cysteine-rich receptor-like prote...  81.6    2e-15   
ref|XP_002533056.1|  DUF26 domain-containing protein 1 precursor,...  79.0    2e-15   Ricinus communis
ref|XP_003635322.2|  PREDICTED: cysteine-rich receptor-like prote...  82.0    3e-15   
gb|KDP45259.1|  hypothetical protein JCGZ_15124                       78.6    3e-15   
emb|CBI38478.3|  unnamed protein product                              80.9    3e-15   
ref|XP_003635466.1|  PREDICTED: putative receptor-like protein ki...  81.3    3e-15   
gb|KGN64567.1|  hypothetical protein Csa_1G065380                     80.9    3e-15   
ref|XP_004295243.1|  PREDICTED: cysteine-rich receptor-like prote...  79.7    3e-15   
emb|CBI18745.3|  unnamed protein product                              79.7    3e-15   
gb|KCW44163.1|  hypothetical protein EUGRSUZ_L02419                   78.6    3e-15   
ref|XP_010041695.1|  PREDICTED: cysteine-rich receptor-like prote...  78.6    3e-15   
gb|KHG01974.1|  Cysteine-rich receptor-like protein kinase 26         80.9    3e-15   
ref|XP_009419751.1|  PREDICTED: cysteine-rich repeat secretory pr...  78.2    3e-15   
ref|XP_006406225.1|  hypothetical protein EUTSA_v10022109mg           78.2    4e-15   
ref|XP_006365261.1|  PREDICTED: cysteine-rich repeat secretory pr...  78.2    4e-15   
ref|XP_003632027.1|  PREDICTED: cysteine-rich receptor-like prote...  80.9    4e-15   
emb|CBI23450.3|  unnamed protein product                              80.1    4e-15   
emb|CDP03947.1|  unnamed protein product                              78.2    4e-15   
emb|CAN65425.1|  hypothetical protein VITISV_005300                   81.3    4e-15   Vitis vinifera
ref|XP_009418903.1|  PREDICTED: cysteine-rich repeat secretory pr...  78.2    4e-15   
ref|XP_008224765.1|  PREDICTED: cysteine-rich receptor-like prote...  80.9    4e-15   
ref|XP_010501991.1|  PREDICTED: putative cysteine-rich repeat sec...  78.2    4e-15   
ref|XP_010036760.1|  PREDICTED: cysteine-rich repeat secretory pr...  78.2    4e-15   
ref|XP_008224863.1|  PREDICTED: uncharacterized protein LOC103324571  81.3    5e-15   
ref|XP_004247276.1|  PREDICTED: cysteine-rich repeat secretory pr...  77.8    5e-15   
ref|XP_010089691.1|  hypothetical protein L484_006313                 79.0    6e-15   
ref|XP_007207065.1|  hypothetical protein PRUPE_ppa026748mg           76.6    6e-15   
gb|KHN02663.1|  Cysteine-rich receptor-like protein kinase 29         80.1    6e-15   
ref|XP_010054502.1|  PREDICTED: cysteine-rich repeat secretory pr...  78.6    7e-15   
ref|XP_008340068.1|  PREDICTED: cysteine-rich receptor-like prote...  80.1    8e-15   
ref|XP_008224859.1|  PREDICTED: cysteine-rich receptor-like prote...  80.1    8e-15   
ref|XP_010267891.1|  PREDICTED: cysteine-rich receptor-like prote...  80.1    8e-15   
ref|XP_008232237.1|  PREDICTED: cysteine-rich receptor-like prote...  79.7    8e-15   
ref|XP_007211369.1|  hypothetical protein PRUPE_ppa002516mg           79.7    9e-15   
ref|XP_009357384.1|  PREDICTED: cysteine-rich receptor-like prote...  79.7    9e-15   
ref|XP_009340920.1|  PREDICTED: cysteine-rich receptor-like prote...  79.7    9e-15   
ref|XP_007025939.1|  Cysteine-rich RLK 29                             80.1    1e-14   
ref|XP_006590220.1|  PREDICTED: cysteine-rich receptor-like prote...  79.7    1e-14   
ref|XP_010932126.1|  PREDICTED: cysteine-rich receptor-like prote...  79.3    1e-14   
gb|KCW76447.1|  hypothetical protein EUGRSUZ_D00839                   77.0    1e-14   
ref|XP_006838101.1|  hypothetical protein AMTR_s00106p00037610        77.0    1e-14   
ref|XP_010468359.1|  PREDICTED: putative cysteine-rich repeat sec...  76.6    1e-14   
ref|XP_010510832.1|  PREDICTED: putative cysteine-rich repeat sec...  76.6    1e-14   
ref|XP_010911643.1|  PREDICTED: cysteine-rich repeat secretory pr...  76.6    1e-14   
ref|XP_010054430.1|  PREDICTED: cysteine-rich receptor-like prote...  77.0    1e-14   
gb|KDO75587.1|  hypothetical protein CISIN_1g040542mg                 76.3    2e-14   
ref|XP_006856952.1|  hypothetical protein AMTR_s01216p00000700        78.6    2e-14   
ref|XP_006373161.1|  hypothetical protein POPTR_0017s09240g           77.0    2e-14   
ref|XP_006468227.1|  PREDICTED: cysteine-rich repeat secretory pr...  76.3    2e-14   
ref|XP_010054433.1|  PREDICTED: cysteine-rich receptor-like prote...  79.0    2e-14   
ref|XP_003635677.2|  PREDICTED: putative receptor-like protein ki...  79.0    2e-14   
ref|XP_006449123.1|  hypothetical protein CICLE_v10018168mg           76.3    2e-14   
gb|EYU39171.1|  hypothetical protein MIMGU_mgv1a027159mg              76.3    2e-14   
ref|XP_008784711.1|  PREDICTED: cysteine-rich repeat secretory pr...  76.3    2e-14   
ref|XP_008439949.1|  PREDICTED: cysteine-rich receptor-like prote...  78.6    2e-14   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...  78.6    2e-14   
ref|XP_008439947.1|  PREDICTED: cysteine-rich receptor-like prote...  78.6    2e-14   
ref|XP_010920641.1|  PREDICTED: cysteine-rich repeat secretory pr...  75.9    2e-14   
ref|XP_010247617.1|  PREDICTED: cysteine-rich receptor-like prote...  78.6    2e-14   
gb|KFK33400.1|  hypothetical protein AALP_AA5G007900                  75.9    2e-14   
emb|CAB45831.1|  putative protein (fragment)                          77.4    2e-14   
gb|KDP20817.1|  hypothetical protein JCGZ_21288                       78.6    2e-14   
ref|XP_010644348.1|  PREDICTED: cysteine-rich receptor-like prote...  78.2    3e-14   
ref|XP_010524650.1|  PREDICTED: cysteine-rich repeat secretory pr...  75.9    3e-14   
gb|ACU20179.1|  unknown                                               75.5    3e-14   
ref|XP_007226138.1|  hypothetical protein PRUPE_ppa014741mg           78.2    3e-14   
gb|KEH43962.1|  cysteine-rich receptor-kinase-like protein            78.2    3e-14   
ref|XP_011010157.1|  PREDICTED: cysteine-rich repeat secretory pr...  75.9    3e-14   
ref|XP_006406224.1|  hypothetical protein EUTSA_v10021968mg           75.5    3e-14   
ref|XP_011010156.1|  PREDICTED: cysteine-rich repeat secretory pr...  75.9    4e-14   
ref|XP_002518555.1|  ATP binding protein, putative                    78.2    4e-14   
gb|KHG11982.1|  Cysteine-rich receptor-like protein kinase 26         77.8    4e-14   
ref|XP_010247622.1|  PREDICTED: cysteine-rich receptor-like prote...  77.8    4e-14   
ref|XP_008349286.1|  PREDICTED: cysteine-rich receptor-like prote...  77.8    4e-14   
gb|EYU40654.1|  hypothetical protein MIMGU_mgv1a012036mg              75.5    4e-14   
gb|KHN02664.1|  Cysteine-rich receptor-like protein kinase 29         75.1    4e-14   
gb|KHG13311.1|  Cysteine-rich receptor-like protein kinase 25         77.8    4e-14   
ref|XP_009412446.1|  PREDICTED: putative receptor-like protein ki...  77.8    5e-14   
ref|XP_002518554.1|  ATP binding protein, putative                    77.4    5e-14   
ref|NP_567603.1|  uncharacterized protein                             77.0    5e-14   
ref|XP_006838094.1|  hypothetical protein AMTR_s00106p00032870        75.1    5e-14   
gb|KDO48492.1|  hypothetical protein CISIN_1g0460102mg                75.1    6e-14   
ref|XP_006383959.1|  hypothetical protein POPTR_0004s02450g           75.1    6e-14   
ref|NP_193798.2|  receptor-like protein kinase-related protein        77.0    6e-14   
emb|CDP14580.1|  unnamed protein product                              74.7    6e-14   
gb|KCW76457.1|  hypothetical protein EUGRSUZ_D00850                   77.4    6e-14   
ref|XP_010052453.1|  PREDICTED: cysteine-rich receptor-like prote...  77.4    7e-14   
ref|XP_009412444.1|  PREDICTED: putative receptor-like protein ki...  77.0    7e-14   
sp|Q9LRL9.2|CRR20_ARATH  RecName: Full=Putative cysteine-rich rep...  74.7    8e-14   
gb|KGN49151.1|  hypothetical protein Csa_6G516590                     76.3    8e-14   
ref|XP_010910873.1|  PREDICTED: cysteine-rich repeat secretory pr...  74.3    9e-14   
ref|XP_011096160.1|  PREDICTED: cysteine-rich receptor-like prote...  77.4    9e-14   
ref|XP_008780260.1|  PREDICTED: cysteine-rich repeat secretory pr...  74.3    9e-14   
ref|XP_003637955.1|  Cysteine-rich receptor-like protein kinase       74.3    9e-14   
ref|NP_188838.1|  cysteine-rich repeat secretory protein 30           74.3    9e-14   
gb|ABK28568.1|  unknown                                               74.3    9e-14   
ref|XP_009357380.1|  PREDICTED: cysteine-rich receptor-like prote...  77.0    1e-13   
ref|XP_002883327.1|  hypothetical protein ARALYDRAFT_898651           73.9    1e-13   
ref|XP_008358736.1|  PREDICTED: cysteine-rich receptor-like prote...  76.6    1e-13   
gb|KFK40537.1|  hypothetical protein AALP_AA2G008600                  74.3    1e-13   
ref|XP_008778956.1|  PREDICTED: cysteine-rich repeat secretory pr...  74.3    1e-13   
ref|XP_010488217.1|  PREDICTED: putative cysteine-rich repeat sec...  73.9    1e-13   
gb|KDP20812.1|  hypothetical protein JCGZ_21283                       76.6    1e-13   
emb|CDY52062.1|  BnaCnng21720D                                        73.9    1e-13   
ref|XP_010911153.1|  PREDICTED: cysteine-rich repeat secretory pr...  74.3    1e-13   
emb|CDP04889.1|  unnamed protein product                              75.9    1e-13   
emb|CDP04312.1|  unnamed protein product                              73.6    1e-13   
gb|KHN15830.1|  Cysteine-rich receptor-like protein kinase 25         76.3    2e-13   
ref|XP_010646644.1|  PREDICTED: cysteine-rich repeat secretory pr...  75.1    2e-13   
emb|CDP22123.1|  unnamed protein product                              75.9    2e-13   
ref|XP_006406228.1|  hypothetical protein EUTSA_v10021912mg           72.8    2e-13   
ref|XP_010430872.1|  PREDICTED: putative cysteine-rich repeat sec...  73.2    2e-13   
ref|XP_010931318.1|  PREDICTED: putative receptor-like protein ki...  76.3    2e-13   
ref|XP_006303591.1|  hypothetical protein CARUB_v10011141mg           73.6    2e-13   
gb|KHG16271.1|  Cysteine-rich receptor-like protein kinase 25         75.9    2e-13   
ref|XP_004134965.1|  PREDICTED: cysteine-rich receptor-like prote...  75.5    2e-13   
ref|XP_010247618.1|  PREDICTED: putative receptor-like protein ki...  75.9    2e-13   
ref|XP_010247620.1|  PREDICTED: cysteine-rich receptor-like prote...  75.9    2e-13   
ref|XP_004155665.1|  PREDICTED: cysteine-rich receptor-like prote...  76.3    3e-13   
ref|XP_010490017.1|  PREDICTED: putative cysteine-rich repeat sec...  72.8    3e-13   
ref|XP_002518557.1|  DUF26 domain-containing protein 1 precursor,...  73.2    3e-13   
ref|XP_002526797.1|  DUF26 domain-containing protein 2 precursor,...  72.8    3e-13   
ref|XP_006828414.1|  hypothetical protein AMTR_s00060p00077910        72.0    3e-13   
ref|XP_009398950.1|  PREDICTED: uncharacterized protein LOC103983462  75.9    3e-13   
ref|XP_003556004.1|  PREDICTED: cysteine-rich receptor-like prote...  75.5    3e-13   
ref|XP_010247032.1|  PREDICTED: uncharacterized protein LOC104590182  75.9    3e-13   
ref|XP_009340921.1|  PREDICTED: cysteine-rich receptor-like prote...  75.1    3e-13   
ref|XP_009357385.1|  PREDICTED: cysteine-rich receptor-like prote...  75.1    3e-13   
ref|XP_009405651.1|  PREDICTED: putative receptor-like protein ki...  75.1    3e-13   
ref|XP_003635324.2|  PREDICTED: cysteine-rich repeat secretory pr...  73.2    4e-13   
ref|XP_009145438.1|  PREDICTED: putative cysteine-rich repeat sec...  72.4    4e-13   
emb|CAN74851.1|  hypothetical protein VITISV_019620                   75.5    4e-13   
ref|XP_009769622.1|  PREDICTED: cysteine-rich repeat secretory pr...  72.4    4e-13   
ref|NP_193800.1|  putative cysteine-rich repeat secretory protein 40  72.8    4e-13   
ref|XP_007143162.1|  hypothetical protein PHAVU_007G049100g           75.1    4e-13   
ref|XP_002875487.1|  predicted protein                                72.4    4e-13   
ref|XP_010920640.1|  PREDICTED: cysteine-rich repeat secretory pr...  72.4    4e-13   
ref|XP_010482102.1|  PREDICTED: cysteine-rich repeat secretory pr...  72.0    5e-13   
ref|XP_006299261.1|  hypothetical protein CARUB_v10015411mg           72.0    5e-13   
ref|XP_006299193.1|  hypothetical protein CARUB_v10015340mg           72.0    5e-13   
gb|KDO75584.1|  hypothetical protein CISIN_1g010329mg                 73.9    5e-13   
ref|XP_006395170.1|  hypothetical protein EUTSA_v10005717mg           72.0    5e-13   
ref|XP_010646645.1|  PREDICTED: cysteine-rich repeat secretory pr...  72.0    5e-13   
emb|CDX85345.1|  BnaC07g26560D                                        72.0    6e-13   
ref|XP_007143160.1|  hypothetical protein PHAVU_007G048900g           74.7    6e-13   
gb|EPS71622.1|  hypothetical protein M569_03138                       72.0    6e-13   
dbj|BAK01760.1|  predicted protein                                    72.0    6e-13   
gb|KHN01547.1|  Cysteine-rich receptor-like protein kinase 29         74.7    6e-13   
ref|XP_010442278.1|  PREDICTED: cysteine-rich repeat secretory pr...  72.0    6e-13   
ref|XP_010493678.1|  PREDICTED: cysteine-rich repeat secretory pr...  71.6    6e-13   
ref|XP_010052450.1|  PREDICTED: putative receptor-like protein ki...  74.3    7e-13   
ref|XP_008370580.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  74.3    7e-13   
ref|XP_006850463.1|  hypothetical protein AMTR_s00035p00086030        71.6    7e-13   
ref|XP_010931341.1|  PREDICTED: cysteine-rich receptor-like prote...  74.3    7e-13   
ref|XP_010493679.1|  PREDICTED: cysteine-rich repeat secretory pr...  71.2    7e-13   
ref|XP_009611212.1|  PREDICTED: cysteine-rich repeat secretory pr...  71.6    7e-13   
ref|XP_009151651.1|  PREDICTED: cysteine-rich repeat secretory pr...  71.6    7e-13   
gb|KDO75583.1|  hypothetical protein CISIN_1g010329mg                 73.9    7e-13   
ref|XP_006373153.1|  hypothetical protein POPTR_0017s09190g           71.6    8e-13   
gb|KCW76449.1|  hypothetical protein EUGRSUZ_D00841                   74.3    8e-13   
ref|XP_008784514.1|  PREDICTED: cysteine-rich repeat secretory pr...  71.6    9e-13   
ref|XP_009768670.1|  PREDICTED: putative receptor-like protein ki...  74.3    9e-13   
ref|XP_007025924.1|  Cysteine-rich RLK 29, putative isoform 3         73.6    9e-13   
ref|XP_006843860.1|  hypothetical protein AMTR_s00007p00264250        72.0    1e-12   
sp|Q9LRL6.2|CRR23_ARATH  RecName: Full=Putative cysteine-rich rep...  71.2    1e-12   
gb|EYU40655.1|  hypothetical protein MIMGU_mgv1a025334mg              70.9    1e-12   
ref|XP_002271125.3|  PREDICTED: cysteine-rich receptor-like prote...  73.6    1e-12   
ref|XP_008347602.1|  PREDICTED: cysteine-rich receptor-like prote...  70.9    1e-12   
ref|XP_006299022.1|  hypothetical protein CARUB_v10015159mg           71.2    1e-12   
ref|XP_002883330.1|  hypothetical protein ARALYDRAFT_479712           71.2    1e-12   
ref|XP_006468228.1|  PREDICTED: uncharacterized protein LOC102629057  73.9    1e-12   
ref|XP_006373157.1|  hypothetical protein POPTR_0017s09220g           70.5    1e-12   
emb|CDP04899.1|  unnamed protein product                              73.6    1e-12   
ref|XP_004499785.1|  PREDICTED: cysteine-rich receptor-like prote...  73.6    1e-12   
ref|XP_006655441.1|  PREDICTED: cysteine-rich receptor-like prote...  73.2    1e-12   
ref|XP_006449119.1|  hypothetical protein CICLE_v10014496mg           73.6    2e-12   
gb|KCW76445.1|  hypothetical protein EUGRSUZ_D00835                   70.9    2e-12   
ref|XP_007143203.1|  hypothetical protein PHAVU_007G052500g           73.2    2e-12   
ref|NP_188829.1|  putative cysteine-rich repeat secretory protein 17  70.9    2e-12   
ref|XP_006406220.1|  hypothetical protein EUTSA_v10022153mg           70.9    2e-12   
ref|XP_007025958.1|  Cysteine-rich RLK 29, putative                   73.2    2e-12   
ref|XP_002883326.1|  hypothetical protein ARALYDRAFT_479711           70.5    2e-12   
ref|XP_008348836.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  72.8    2e-12   
ref|XP_007025922.1|  Cysteine-rich RLK 29, putative isoform 1         73.2    2e-12   
ref|XP_006388145.1|  hypothetical protein POPTR_0314s00210g           71.2    2e-12   
ref|XP_010265354.1|  PREDICTED: cysteine-rich receptor-like prote...  73.2    2e-12   
ref|XP_010247616.1|  PREDICTED: cysteine-rich receptor-like prote...  73.2    2e-12   
ref|XP_010647173.1|  PREDICTED: putative receptor-like protein ki...  73.2    2e-12   
ref|NP_189547.2|  putative cysteine-rich repeat secretory protein 13  70.5    2e-12   
ref|XP_007025923.1|  Cysteine-rich RLK 29, putative isoform 2         72.8    2e-12   
gb|KDO75603.1|  hypothetical protein CISIN_1g017211mg                 71.6    2e-12   
ref|XP_006383950.1|  hypothetical protein POPTR_0004s02310g           72.8    2e-12   
ref|XP_010095198.1|  Dehydration-responsive element-binding prote...  72.0    2e-12   
ref|NP_188839.1|  putative cysteine-rich repeat secretory protein 31  70.1    2e-12   
ref|XP_007143165.1|  hypothetical protein PHAVU_007G0492000g          70.5    2e-12   
gb|KCW76450.1|  hypothetical protein EUGRSUZ_D00842                   72.8    3e-12   
ref|XP_003637378.1|  Cysteine-rich receptor-like protein kinase       72.4    3e-12   
ref|XP_010466470.1|  PREDICTED: putative cysteine-rich repeat sec...  70.1    3e-12   
gb|EMT26211.1|  hypothetical protein F775_06000                       70.1    3e-12   
ref|XP_010666948.1|  PREDICTED: cysteine-rich repeat secretory pr...  70.1    3e-12   
ref|XP_007214635.1|  hypothetical protein PRUPE_ppa001541mg           72.8    3e-12   
ref|XP_003637461.1|  Cysteine-rich receptor-like protein kinase       72.4    3e-12   
ref|XP_006449134.1|  hypothetical protein CICLE_v10017888mg           72.4    3e-12   
ref|XP_002865649.1|  hypothetical protein ARALYDRAFT_494916           70.1    3e-12   
ref|XP_010646958.1|  PREDICTED: uncharacterized protein LOC100265431  72.8    3e-12   
ref|XP_010054432.1|  PREDICTED: uncharacterized protein LOC104442733  72.8    3e-12   
ref|XP_006299855.1|  hypothetical protein CARUB_v10016058mg           69.7    3e-12   
gb|KFK35565.1|  hypothetical protein AALP_AA4G007300                  71.6    4e-12   
gb|KFK31328.1|  hypothetical protein AALP_AA6G098000                  69.7    4e-12   
ref|XP_009340953.1|  PREDICTED: cysteine-rich receptor-like prote...  71.6    4e-12   
gb|AGT15891.1|  hypothetical protein SHCRBa_258_I03_F_10              72.0    4e-12   
ref|XP_006298980.1|  hypothetical protein CARUB_v10015105mg           69.7    4e-12   
ref|XP_006468226.1|  PREDICTED: uncharacterized protein LOC102628483  72.4    5e-12   
emb|CBI23455.3|  unnamed protein product                              72.0    5e-12   
ref|XP_003635308.1|  PREDICTED: cysteine-rich receptor-like prote...  72.0    5e-12   
ref|XP_009364708.1|  PREDICTED: cysteine-rich receptor-like prote...  72.0    5e-12   
ref|XP_008384459.1|  PREDICTED: cysteine-rich receptor-like prote...  72.0    5e-12   
ref|XP_006280966.1|  hypothetical protein CARUB_v10026967mg           69.3    5e-12   
ref|XP_009372972.1|  PREDICTED: cysteine-rich receptor-like prote...  71.6    5e-12   
emb|CBI41018.3|  unnamed protein product                              71.6    6e-12   
ref|XP_008237550.1|  PREDICTED: cysteine-rich receptor-like prote...  71.6    6e-12   
ref|XP_003637462.1|  Cysteine-rich receptor-like protein kinase       69.3    6e-12   
ref|XP_006406219.1|  hypothetical protein EUTSA_v10022112mg           69.3    6e-12   
ref|XP_011007635.1|  PREDICTED: cysteine-rich receptor-like prote...  71.6    6e-12   
ref|XP_006295991.1|  hypothetical protein CARUB_v10025134mg           68.9    7e-12   
gb|KCW74999.1|  hypothetical protein EUGRSUZ_E03761                   68.2    7e-12   
emb|CBI23396.3|  unnamed protein product                              70.9    7e-12   
ref|XP_006299285.1|  hypothetical protein CARUB_v10015439mg           68.9    8e-12   
ref|XP_010466459.1|  PREDICTED: cysteine-rich repeat secretory pr...  68.9    8e-12   
ref|XP_010059504.1|  PREDICTED: cysteine-rich receptor-like prote...  68.9    8e-12   
ref|XP_006377265.1|  hypothetical protein POPTR_0011s03300g           68.6    9e-12   
ref|XP_003635446.2|  PREDICTED: cysteine-rich receptor-like prote...  70.9    1e-11   
ref|XP_010490015.1|  PREDICTED: cysteine-rich repeat secretory pr...  68.9    1e-11   
ref|XP_010660486.1|  PREDICTED: cysteine-rich receptor-like prote...  71.2    1e-11   
ref|XP_010646978.1|  PREDICTED: cysteine-rich repeat secretory pr...  68.6    1e-11   
gb|KCW74848.1|  hypothetical protein EUGRSUZ_E03585                   70.9    1e-11   
ref|XP_006433223.1|  hypothetical protein CICLE_v10003836mg           68.6    1e-11   
ref|XP_009347950.1|  PREDICTED: putative cysteine-rich receptor-l...  68.2    1e-11   
ref|XP_010647003.1|  PREDICTED: putative receptor-like protein ki...  70.9    1e-11   
ref|XP_010057675.1|  PREDICTED: putative receptor-like protein ki...  70.9    1e-11   
gb|KDP20809.1|  hypothetical protein JCGZ_21280                       70.1    1e-11   
ref|XP_006383961.1|  hypothetical protein POPTR_0004s02480g           68.2    1e-11   
ref|XP_010999534.1|  PREDICTED: cysteine-rich receptor-like prote...  70.9    1e-11   
gb|KDO38176.1|  hypothetical protein CISIN_1g0455682mg                68.6    1e-11   
ref|XP_003561775.1|  PREDICTED: cysteine-rich repeat secretory pr...  68.6    1e-11   
gb|KCW76451.1|  hypothetical protein EUGRSUZ_D00843                   70.5    1e-11   
ref|XP_006851147.1|  hypothetical protein AMTR_s00043p00100060        70.5    1e-11   
ref|XP_008779475.1|  PREDICTED: cysteine-rich receptor-like prote...  69.7    1e-11   
ref|XP_010092052.1|  Cysteine-rich receptor-like protein kinase 29    70.5    1e-11   
emb|CAN61842.1|  hypothetical protein VITISV_026923                   70.5    2e-11   
gb|EEE58797.1|  hypothetical protein OsJ_10340                        67.8    2e-11   
gb|KFK35564.1|  hypothetical protein AALP_AA4G007200                  67.8    2e-11   
ref|XP_009340926.1|  PREDICTED: cysteine-rich receptor-like prote...  70.5    2e-11   
ref|XP_010502957.1|  PREDICTED: putative cysteine-rich repeat sec...  67.8    2e-11   
ref|XP_002280482.1|  PREDICTED: putative receptor-like protein ki...  70.5    2e-11   
gb|KCW75386.1|  hypothetical protein EUGRSUZ_E04136                   68.2    2e-11   
gb|EMT14692.1|  Cysteine-rich receptor-like protein kinase 25         70.1    2e-11   
ref|XP_006377262.1|  hypothetical protein POPTR_0011s03240g           67.8    2e-11   
ref|XP_009417405.1|  PREDICTED: cysteine-rich receptor-like prote...  70.1    2e-11   
ref|XP_011010158.1|  PREDICTED: cysteine-rich receptor-like prote...  70.1    2e-11   
ref|XP_010059128.1|  PREDICTED: cysteine-rich receptor-like prote...  67.4    2e-11   
ref|NP_188840.4|  Receptor-like protein kinase-related family pro...  67.4    2e-11   



>ref|XP_007024474.1| Receptor-like protein kinase-related family protein [Theobroma 
cacao]
 gb|EOY27096.1| Receptor-like protein kinase-related family protein [Theobroma 
cacao]
Length=242

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+C+ +AGS +R RCP NKGAIIWYDNCL+KYS  +F G+IDN NKFYMWN+R+VS+P+
Sbjct  91   CKTCIVEAGSEIRKRCPSNKGAIIWYDNCLLKYSNTEFFGQIDNRNKFYMWNLRDVSDPQ  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS+LA +AY    LYA   T       ++KLYGL QCTRDLS
Sbjct  151  SFNQKTKELLSQLANEAYATPKLYA---TGETELYGSQKLYGLTQCTRDLS  198



>ref|XP_006380319.1| hypothetical protein POPTR_0007s02730g [Populus trichocarpa]
 gb|ERP58116.1| hypothetical protein POPTR_0007s02730g [Populus trichocarpa]
Length=242

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +AGS +R RCPYNK AIIWYDNCL+KYS + F G+IDNGNKFYMWNV  VS P 
Sbjct  91   CKTCVVEAGSEIRKRCPYNKAAIIWYDNCLLKYSNKGFFGQIDNGNKFYMWNVNAVSEPV  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KTKELL++LA KA     LYA   T       + KLYGLVQCTRDLS
Sbjct  151  PFNEKTKELLTQLANKAKATPKLYA---TGGMELGESTKLYGLVQCTRDLS  198



>ref|XP_006387991.1| receptor-like protein kinase [Populus trichocarpa]
 gb|ERP46905.1| receptor-like protein kinase [Populus trichocarpa]
Length=242

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +AGS +R RCPYN+ AIIWYDNCL+KYS + F G+IDNGNKFYMWNV  VS P 
Sbjct  91   CKTCVVEAGSEIRKRCPYNEAAIIWYDNCLLKYSNKGFFGQIDNGNKFYMWNVNAVSEPV  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KTKELL++LA KA     LYA   T       + KLYGLVQCTRDLS
Sbjct  151  PFNEKTKELLTQLANKAKATPKLYA---TGGMELGESTKLYGLVQCTRDLS  198



>ref|XP_006447470.1| hypothetical protein CICLE_v10017568mg, partial [Citrus clementina]
 gb|ESR60710.1| hypothetical protein CICLE_v10017568mg, partial [Citrus clementina]
Length=254

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+C+ DA   +R RCPYNK AIIWYDNCL+KY+  +F G+IDN NKFYMWNVR V+ P 
Sbjct  114  CKTCIVDASGEIRKRCPYNKAAIIWYDNCLLKYTNTEFFGQIDNKNKFYMWNVRVVTEPV  173

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQ+TKELL++LAEKAY    LYA           + KLYGL QCTRDLS
Sbjct  174  SFNQRTKELLTQLAEKAYVTPKLYA---VGEMELGKSNKLYGLTQCTRDLS  221



>ref|XP_006469729.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
 gb|KDO59871.1| hypothetical protein CISIN_1g025954mg [Citrus sinensis]
Length=245

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+C+ DA   +R RCPYNK AIIWYDNCL+KY+  +F G+IDN NKFYMWNVR V+ P 
Sbjct  94   CKTCIVDASGEIRKRCPYNKAAIIWYDNCLLKYTNTEFFGQIDNKNKFYMWNVRVVTEPV  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQ+TKELL++LAEKAY    LYA           + KLYGL QCTRDLS
Sbjct  154  SFNQRTKELLTQLAEKAYVTPKLYA---VGEMELGKSNKLYGLTQCTRDLS  201



>ref|XP_010051171.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89430.1| hypothetical protein EUGRSUZ_A01729 [Eucalyptus grandis]
Length=240

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CVADAG+ +R RCP+NKGAIIWYDNC+ KY + +F G+IDN NKFYMWNV  VS+PE
Sbjct  89   CKACVADAGAEIRRRCPHNKGAIIWYDNCMFKYLDTEFFGQIDNANKFYMWNVNNVSHPE  148

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            AFN + + LL+ L E+AY V  LYA   T   G     KLYGLVQCTRDLS
Sbjct  149  AFNGRVRGLLTGLVEEAYTVPKLYA---TGEMGLEDKTKLYGLVQCTRDLS  196



>ref|XP_010069655.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89428.1| hypothetical protein EUGRSUZ_A01727 [Eucalyptus grandis]
Length=240

 Score =   144 bits (362),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CVADAG+ +R RCP NKGAIIWYDNC++KY + DF G+IDN NKFYMWNV  VS PE
Sbjct  89   CKACVADAGAEIRRRCPRNKGAIIWYDNCMIKYLDTDFFGQIDNANKFYMWNVNNVSYPE  148

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            AFN + + LL+ L E+AY V  LYA   T   G     KLYGLVQCTRDLS
Sbjct  149  AFNGRVRGLLTGLVEEAYTVPKLYA---TGEMGLEDKTKLYGLVQCTRDLS  196



>ref|XP_006351952.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=244

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L  RCPY+K AIIWYDNCL+KYS++DFLGKIDN NKFYMWNVR V NP+
Sbjct  92   CKSCVLDASEELGKRCPYDKEAIIWYDNCLLKYSDKDFLGKIDNMNKFYMWNVRVVKNPK  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTKELL  LA  AY   +LYA   T        +KLYGLVQCTRDLS
Sbjct  152  YFNAKTKELLGNLAANAYKTSNLYA---TGEMEIEENKKLYGLVQCTRDLS  199



>ref|XP_004251507.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Solanum 
lycopersicum]
Length=240

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L  RCPY+K AIIWYDNCL+KYS++DFLG IDN  KFYMWNVR VSNPE
Sbjct  88   CKSCVLDASEELGKRCPYDKEAIIWYDNCLLKYSDKDFLGNIDNTYKFYMWNVRVVSNPE  147

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTKELL  L+E AY   +LYA            +KLYGLVQCTRDLS
Sbjct  148  YFNAKTKELLGSLSENAYKTTNLYA---IGEMEIEENKKLYGLVQCTRDLS  195



>ref|XP_006352035.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=244

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L  RCPY+K AIIWYDNCL+KYS++DFLGKIDN NKFYMWNVR V NP+
Sbjct  92   CKSCVLDASEELGKRCPYDKEAIIWYDNCLLKYSDKDFLGKIDNMNKFYMWNVRVVKNPK  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTKELL  LA  AY   +LYA   T        +KLYGLVQCTRDLS
Sbjct  152  YFNAKTKELLGNLAANAYKTSNLYA---TGEMEIEENKKLYGLVQCTRDLS  199



>ref|XP_009794300.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Nicotiana sylvestris]
Length=134

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L   CPY+K AIIWYDNCL+KYS  DFLGKIDN  KFYMWNVR VS PE
Sbjct  11   CKSCVVDASEELGKLCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYMWNVRVVSKPE  70

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN KTKELL  L EKAY  ++LYA        G   EKLYGLVQCTRDLS
Sbjct  71   SFNAKTKELLGSLVEKAYKKQNLYA-NGEMELIGDQYEKLYGLVQCTRDLS  120



>ref|XP_002309843.2| hypothetical protein POPTR_0007s02720g [Populus trichocarpa]
 ref|XP_006387148.1| receptor-like protein kinase [Populus trichocarpa]
 gb|ERP46062.1| receptor-like protein kinase [Populus trichocarpa]
 gb|EEE90293.2| hypothetical protein POPTR_0007s02720g [Populus trichocarpa]
Length=242

 Score =   142 bits (357),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +AG  +R RCPYNK AIIWYDNCLVKYS   F G+IDNGNKFYMWNV+ VS P 
Sbjct  91   CKTCVVEAGGEIRKRCPYNKAAIIWYDNCLVKYSNNGFFGQIDNGNKFYMWNVKVVSEPV  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTKELL++LA K      LY   ET       + KLYGLVQCTRDLS
Sbjct  151  TFNGKTKELLTQLANKVEATPKLY---ETGEMELGESTKLYGLVQCTRDLS  198



>ref|XP_006351953.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=240

 Score =   141 bits (355),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L  RCPY+K AIIWYDNCL+KYS +DFLG IDN  KFYMWNVR VSNPE
Sbjct  88   CKSCVLDASEELGKRCPYDKEAIIWYDNCLLKYSNKDFLGNIDNTYKFYMWNVRVVSNPE  147

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTKELL  L+E AY   +LYA            +KLYGLVQCTRD+S
Sbjct  148  YFNAKTKELLGSLSENAYKTSNLYA---IGEMEIEENKKLYGLVQCTRDIS  195



>ref|XP_011003220.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=242

 Score =   140 bits (354),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +AG  +R RCPYNK AIIWYDNCL+KYS   F G+IDNGNKFYMWNV+ VS P 
Sbjct  91   CKTCVVEAGGEIRKRCPYNKAAIIWYDNCLLKYSNNGFFGQIDNGNKFYMWNVKVVSEPV  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTKELL++LA K      LY   ET       + KLYGLVQCTRDLS
Sbjct  151  TFNGKTKELLTQLANKVQATPKLY---ETGEMELGESTKLYGLVQCTRDLS  198



>ref|XP_009787632.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Nicotiana sylvestris]
Length=164

 Score =   139 bits (349),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L   CPY+K AIIWYDNCL+KYS  DFLGKIDN  KFYMWNVR VS PE
Sbjct  10   CKSCVVDASEELGKLCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYMWNVRVVSKPE  69

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN KTKELL  L EKAY  ++LYA        G   EKLYGLVQCTRDLS
Sbjct  70   SFNAKTKELLGSLVEKAYKKQNLYA-NGEMELIGDQYEKLYGLVQCTRDLS  119



>gb|KDP25874.1| hypothetical protein JCGZ_22904 [Jatropha curcas]
Length=243

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A S +R RCPYNK AIIWYDNCL+KYS+++F G+IDN NKFYMWNVR VSNP 
Sbjct  91   CKTCVVEASSEIRKRCPYNKAAIIWYDNCLLKYSDKEFFGQIDNRNKFYMWNVRVVSNPV  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTKELLS+L + AY    LYA    EL    + +KLYGL QC+RDLS
Sbjct  151  EFNGKTKELLSQLVKDAYVSPKLYA--TGELKLEETYDKLYGLTQCSRDLS  199



>ref|XP_009787631.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
sylvestris]
Length=246

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L   CPY+K AIIWYDNCL+KYS  DFLGKIDN  KFYMWNVR VS PE
Sbjct  92   CKSCVVDASEELGKLCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYMWNVRVVSKPE  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN KTKELL  L EKAY  ++LYA        G   EKLYGLVQCTRDLS
Sbjct  152  SFNAKTKELLGSLVEKAYKKQNLYA-NGEMELIGDQYEKLYGLVQCTRDLS  201



>ref|XP_009793791.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
sylvestris]
Length=246

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L   CPY+K AIIWYDNCL+KYS  DFLGKIDN  KFYMWNVR VS PE
Sbjct  92   CKSCVVDASEELGKLCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYMWNVRVVSKPE  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN KTKELL  L EKAY  ++LYA        G   EKLYGLVQCTRDLS
Sbjct  152  SFNAKTKELLGSLVEKAYKKQNLYA-NGEMELIGDQYEKLYGLVQCTRDLS  201



>ref|XP_009605992.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
tomentosiformis]
Length=246

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L  RCPY+K AIIWYDNCL+KYS  DFLGKIDN  KFYMWNVR V+ PE
Sbjct  92   CKSCVVDASEELGKRCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYMWNVRVVNKPE  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN KTKELL  L E AY  ++LYA        G   EKLYGLVQCTRDLS
Sbjct  152  SFNAKTKELLGSLVETAYKKQNLYA-SGDMELIGDQYEKLYGLVQCTRDLS  201



>ref|XP_009591406.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
tomentosiformis]
Length=246

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV DA   L  RCPY+K AIIWYDNCL+KYS  DFLGKIDN  KFYMWNVR V+ PE
Sbjct  92   CKSCVVDASEELGKRCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYMWNVRVVNKPE  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN KTKELL  L E AY  ++LYA        G   EKLYGLVQCTRDLS
Sbjct  152  SFNAKTKELLGSLVETAYKKQNLYA-SGDMELIGDQYEKLYGLVQCTRDLS  201



>ref|XP_010051179.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89432.1| hypothetical protein EUGRSUZ_A01731 [Eucalyptus grandis]
Length=240

 Score =   139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+ VADAG+ +R RCP+NKGAIIWYD+C+ KY + DF G+IDN NKFYMWN++ VS+PE
Sbjct  89   CKAFVADAGAEIRRRCPHNKGAIIWYDDCMFKYLDTDFFGQIDNANKFYMWNLKNVSDPE  148

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN K + LL+ L E+AY V  LYA   T   G     KLYGLVQCTRDLS
Sbjct  149  PFNGKVRGLLTGLVEEAYTVPKLYA---TGEMGLEDKTKLYGLVQCTRDLS  196



>ref|XP_006372985.1| hypothetical protein POPTR_0017s06790g [Populus trichocarpa]
 gb|ERP50782.1| hypothetical protein POPTR_0017s06790g [Populus trichocarpa]
Length=242

 Score =   138 bits (348),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +  S +R RCPYNK AIIWYDNCL+KYS   F G+IDNGNKFYMWNV  VS P 
Sbjct  91   CKTCVVEVSSEIRKRCPYNKAAIIWYDNCLLKYSNNAFFGQIDNGNKFYMWNVHVVSEPA  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KTKELLS+LA +A     L+A   T       + KLYGLVQCT DLS
Sbjct  151  PFNEKTKELLSQLANEAQATPKLFA---TGERELGKSTKLYGLVQCTGDLS  198



>ref|XP_010051161.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89429.1| hypothetical protein EUGRSUZ_A01728 [Eucalyptus grandis]
Length=240

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++CVADA + +R  CP NKGAIIWYDNC+ KY + DF G+IDN NKFYMWN + VS+PE
Sbjct  89   CEACVADAVAEIRRHCPRNKGAIIWYDNCMFKYLDTDFFGQIDNANKFYMWNPKSVSDPE  148

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            AFN K + LL+ L E+AY V  LYA   T   G     KLYGLVQCTRDLS
Sbjct  149  AFNGKVRGLLTGLVEEAYSVPKLYA---TGEMGLEEKTKLYGLVQCTRDLS  196



>ref|XP_006372978.1| hypothetical protein POPTR_0017s06720g [Populus trichocarpa]
 gb|ERP50775.1| hypothetical protein POPTR_0017s06720g [Populus trichocarpa]
Length=242

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A S +R RCPYNK AIIWYDNCL+KYS   F G++D GNKFYMWNV  VS P 
Sbjct  91   CKTCVVEASSEIRKRCPYNKAAIIWYDNCLLKYSNTGFFGQVDTGNKFYMWNVHVVSKPA  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KTKELLS+LA +A     L+A   T       + KLYGLVQCT DLS
Sbjct  151  PFNKKTKELLSQLANEAQATPKLFA---TGERELGKSTKLYGLVQCTGDLS  198



>ref|XP_002515716.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF46663.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=240

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A S +R RCP NK AIIWYDNCL KYS++ + G+IDN NKFYMWNVR V++  
Sbjct  88   CKTCVVEASSEIRKRCPTNKAAIIWYDNCLYKYSDKKYFGQIDNRNKFYMWNVRVVNDSA  147

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQKTKELLSELA +AY    LYA    E      + KLYGLVQCTRDLS
Sbjct  148  EFNQKTKELLSELASQAYVTSKLYA--TGESDKLGKSNKLYGLVQCTRDLS  196



>ref|XP_006372979.1| hypothetical protein POPTR_0017s06730g [Populus trichocarpa]
 gb|ERP50776.1| hypothetical protein POPTR_0017s06730g [Populus trichocarpa]
Length=242

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A S +R RCPYNK AIIWYDNCL+KYS   F G++D GNKFYMWNV  VS P 
Sbjct  91   CKTCVVEASSEIRKRCPYNKAAIIWYDNCLLKYSNTGFFGQVDTGNKFYMWNVHVVSKPA  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KTKELLS+LA +A     L+A   T       + KLYGLVQCT DLS
Sbjct  151  PFNKKTKELLSQLANEAQATPKLFA---TGERELGKSTKLYGLVQCTGDLS  198



>ref|XP_007010459.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
 gb|EOY19269.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
Length=222

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++CV +AG+ +R  CP  KGAIIWYDNCL+KYS+ +F G+IDN N FY+WN R VS+P+
Sbjct  71   CQTCVVEAGNEIRKLCPSTKGAIIWYDNCLLKYSDTEFFGQIDNKNMFYLWNGRVVSDPQ  130

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS+LA +AY    LYA   T       + KLYGL QCTRDLS
Sbjct  131  SFNQKTKELLSQLANEAYATPKLYA---TRETELYGSPKLYGLTQCTRDLS  178



>ref|XP_007149948.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris]
 gb|ESW21942.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris]
Length=253

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A   + +RCPYNKGAIIWYD C+ KYS+ DF GKID  N+FYMWN++ VS+P 
Sbjct  102  CKTCVSEAPKEILNRCPYNKGAIIWYDYCMFKYSDTDFFGKIDYSNRFYMWNLKSVSDPS  161

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN KTKELLS+LAEKAY    LYA+GE  L    +   LYGL QCTRDLS
Sbjct  162  SFNYKTKELLSKLAEKAYVDNKLYASGEQYLENSVT---LYGLTQCTRDLS  209



>gb|KHN36561.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=244

 Score =   135 bits (341),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A   +  RCPYNKGAIIWYD C+ KY + DFLGKIDN NKFYMWN++ VS+P 
Sbjct  93   CKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKFYMWNLKNVSDPA  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KT+ELLS+LA+KAY    LYATGE +L    +   LYGL QCTRDLS
Sbjct  153  TFNYKTRELLSQLAQKAYVNNKLYATGEAKLENSET---LYGLTQCTRDLS  200



>gb|ACU16205.1| unknown [Glycine max]
Length=242

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A   +  RCPYNKGAIIWYD C+ KY + DFLGKIDN NKFYMWN++ VS+P 
Sbjct  93   CKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKFYMWNLKNVSDPA  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN  T++LLS+LA+KAY    LYATGE +L    +   LYGL QCTRDLS
Sbjct  153  TFNYNTRDLLSQLAQKAYVNNKLYATGEAKLENSET---LYGLTQCTRDLS  200



>ref|XP_003543377.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Glycine 
max]
Length=244

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A   +  RCPYNKGAIIWYD C+ KY + DFLGKIDN NKFYMWN++ VS+P 
Sbjct  93   CKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKFYMWNLKNVSDPA  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN  T++LLS+LA+KAY    LYATGE +L    +   LYGL QCTRDLS
Sbjct  153  TFNYNTRDLLSQLAQKAYVNNKLYATGEAKLENSET---LYGLTQCTRDLS  200



>ref|XP_006387993.1| hypothetical protein POPTR_0421s00220g [Populus trichocarpa]
 gb|ERP46907.1| hypothetical protein POPTR_0421s00220g [Populus trichocarpa]
Length=230

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +AG  +R RCPYNK AIIWYDNCL+KYS   F G+ID  NKFY+WNV+ V  P 
Sbjct  92   CKTCVVEAGGEIRKRCPYNKAAIIWYDNCLLKYSNNGFFGQIDYRNKFYLWNVKVVREPV  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTKELL++LA K      LYA   T +     + K+YGLVQCTRDLS
Sbjct  152  TFNGKTKELLTQLANKVQATPKLYA---TGVMELGESTKIYGLVQCTRDLS  199



>ref|XP_010051151.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89427.1| hypothetical protein EUGRSUZ_A01726 [Eucalyptus grandis]
Length=240

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CVADAG+ +R RCP NKGAIIWYD+C+ KY + DF G+ID  NKFYMWN+ +VS+P 
Sbjct  89   CKACVADAGAEIRRRCPRNKGAIIWYDDCMFKYLDADFFGQIDKTNKFYMWNLNDVSDPA  148

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN K + +L+ LA+ A  +  LYA       G  S  KLYGLVQCTRDLS
Sbjct  149  LFNGKVRAMLTRLAKAASSIPRLYA---AGEKGVDSKTKLYGLVQCTRDLS  196



>ref|XP_006372981.1| hypothetical protein POPTR_0017s06750g [Populus trichocarpa]
 gb|ERP50778.1| hypothetical protein POPTR_0017s06750g [Populus trichocarpa]
Length=236

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C ADA   +R RCPY+K AII YDNCL+KYS+ DF G+ID+ NKFYMWNV  VSNP 
Sbjct  83   CRTCAADATREIRKRCPYSKRAIIAYDNCLLKYSDSDFFGQIDDQNKFYMWNVNNVSNPV  142

Query  155  AFNQKTKELLSELAEKA-YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KT ELLS+LA+KA Y    LYA    E+     + KLYG+ QCTRDLS
Sbjct  143  LFNEKTSELLSQLADKASYNSSKLYA--AGEMDLLEGSMKLYGMAQCTRDLS  192



>emb|CAN73038.1| hypothetical protein VITISV_044348 [Vitis vinifera]
Length=243

 Score =   131 bits (329),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A   L +RCPYNKGAIIWYDNCL  YS   F G+IDN NKFY++NV+   +P 
Sbjct  90   CKTCVTEATKELHNRCPYNKGAIIWYDNCLFNYSNVKFFGEIDNKNKFYVYNVQSADDPT  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN KTKELLS L+ KAYG   L+A   T       + KLYGL QCTRDLS
Sbjct  150  SFNVKTKELLSSLSNKAYGSPMLFA---TGELVLEESMKLYGLAQCTRDLS  197



>ref|XP_010109547.1| hypothetical protein L484_018282 [Morus notabilis]
 gb|EXC23151.1| hypothetical protein L484_018282 [Morus notabilis]
Length=249

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            CK+C  +AG  L+ RCPYNKGA+IWYDNCL+KYS+++F G+ID+ N+FYMWNV++V  +P
Sbjct  92   CKTCTVEAGKELQSRCPYNKGAVIWYDNCLLKYSDKNFFGQIDSTNRFYMWNVKDVDQDP  151

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            ++F+ K KELLS L+EKA     LY+     + G     KLYGL QCTRDL
Sbjct  152  KSFDSKVKELLSSLSEKASATSKLYS-TGELVLGTGPDPKLYGLAQCTRDL  201



>ref|XP_006380320.1| hypothetical protein POPTR_0007s02740g [Populus trichocarpa]
 gb|ERP58117.1| hypothetical protein POPTR_0007s02740g [Populus trichocarpa]
Length=245

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CVADA   +R RCPY K   I YDNCL+KYS +DF G+ID+ NK Y++NVR VSNP 
Sbjct  94   CSACVADATREIRKRCPYGKSGFIAYDNCLLKYSNKDFFGQIDSQNKIYLYNVRNVSNPV  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQKTK+LLS+LA KAY  + +YA   T   G   ++KLYG+ QCTRDLS
Sbjct  154  VFNQKTKDLLSQLANKAYIARKMYA---TGELGLGGSKKLYGMAQCTRDLS  201



>ref|XP_011003221.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CVADA   +R RCPY K   I YDNCL+KYS +DF G+ID+ NK Y++NVR VSNP 
Sbjct  94   CSACVADATREIRKRCPYGKSGFIAYDNCLLKYSNKDFFGQIDSRNKIYLYNVRNVSNPV  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQKTK+LLS+LA KAY  + +YA       G   ++KLYG+ QCTRDLS
Sbjct  154  VFNQKTKDLLSQLANKAYIARKMYA---AGELGLGGSKKLYGMAQCTRDLS  201



>gb|AFK48353.1| unknown [Medicago truncatula]
Length=241

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A   ++ RCPYNKG IIWYD CL KYS+ DF GKI   N+FYMWN+  VS+P 
Sbjct  89   CKTCVSEATKEIQSRCPYNKGGIIWYDYCLFKYSDTDFFGKIAKTNRFYMWNLNNVSDPS  148

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTK+LLS+LA+KA     LYA   T       ++KLYGL QCTRDLS
Sbjct  149  TFNYKTKDLLSQLAQKASMNPKLYA---TGEVKLEESKKLYGLTQCTRDLS  196



>gb|KDO59869.1| hypothetical protein CISIN_1g041051mg, partial [Citrus sinensis]
Length=168

 Score =   127 bits (319),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK CVADA ST+R  CPY+K A I+YDNC+ KYS ++F G+IDNG K++MWNV  VSN  
Sbjct  15   CKRCVADAVSTIRKSCPYSKSAKIFYDNCMFKYSNDNFFGQIDNGTKYFMWNVNNVSNRV  74

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQK+KELLS LA +A G   LYA          S +K+YGL QCTRDLS
Sbjct  75   TFNQKSKELLSRLANEASGNPKLYA-AGELELNEESKKKIYGLAQCTRDLS  124



>ref|XP_006387992.1| hypothetical protein POPTR_0421s00210g [Populus trichocarpa]
 gb|ERP46906.1| hypothetical protein POPTR_0421s00210g [Populus trichocarpa]
Length=245

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CVADA   +R RCPY K   I YDNCL+KYS +DF G+ID+ NK Y++NVR VSNP 
Sbjct  94   CSACVADATREIRKRCPYGKSGFIAYDNCLLKYSNKDFFGQIDSQNKIYLYNVRNVSNPV  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQKTK+LL++LA KAY  + +YA       G   ++KLYG+ QCTRDLS
Sbjct  154  VFNQKTKDLLTQLANKAYIARKMYA---AGELGLGGSKKLYGMAQCTRDLS  201



>gb|AES67291.2| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=246

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A   ++ RCPYNKG IIWYD CL KYS+ DF GKI   N+FYMWN+  VS+P 
Sbjct  95   CKTCVSEATKEIQSRCPYNKGGIIWYDYCLFKYSDTDFFGKIAKTNRFYMWNLNNVSDPS  154

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTK+LLS+LA+KA     LYA   T       ++KLYGL QCTRDLS
Sbjct  155  TFNYKTKDLLSQLAQKASMNPKLYA---TGEVKLEESKKLYGLTQCTRDLS  202



>gb|AFK43074.1| unknown [Medicago truncatula]
Length=248

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A   ++ RCPYNKG IIWYD CL KYS+ DF GKI   N+FYMWN+  VS+P 
Sbjct  95   CKTCVSEATKEIQSRCPYNKGGIIWYDYCLFKYSDTDFFGKIAKTNRFYMWNLNNVSDPS  154

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTK+LLS+LA+KA     LYA   T       ++KLYGL QCTRDLS
Sbjct  155  TFNYKTKDLLSQLAQKASMNPKLYA---TGEVKLEESKKLYGLTQCTRDLS  202



>ref|XP_006469774.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=246

 Score =   128 bits (321),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK CVADA ST+R  CPY+K A I+YDNC+ KYS ++F G+IDNG K++MWNV  VSN  
Sbjct  93   CKRCVADAVSTIRKSCPYSKSAKIFYDNCMFKYSNDNFFGQIDNGTKYFMWNVNNVSNRV  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQK+KELLS LA +A G   LYA          S +K+YGL QCTRDLS
Sbjct  153  TFNQKSKELLSRLANEASGNPKLYA-AGELELNEESKKKIYGLAQCTRDLS  202



>ref|XP_010247023.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=240

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A + +  RCP +K  IIWYDNCL+KYS +DF G ID   KFYMWNV+ VSNP 
Sbjct  90   CKTCVSEAKTEILQRCPNDKEGIIWYDNCLLKYSNKDFFGNIDYKYKFYMWNVQNVSNPA  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS L  +AY    L+ATGE +LG   +   LYGLVQCTRDLS
Sbjct  150  SFNQKTKELLSHLTNEAYHSPKLFATGEQKLGEAQT---LYGLVQCTRDLS  197



>ref|XP_007216947.1| hypothetical protein PRUPE_ppa016345mg [Prunus persica]
 gb|EMJ18146.1| hypothetical protein PRUPE_ppa016345mg [Prunus persica]
Length=210

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A   L +RCP  KGAIIWYDNCL KYS  +F GKIDN N+FYMWNV+EV +P 
Sbjct  59   CKTCVVEASKKLGERCPSRKGAIIWYDNCLFKYSNVNFAGKIDNNNRFYMWNVQEVDDPT  118

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+K KELLS L+ KA      YATGE EL    +   LYGL QCTRDLS
Sbjct  119  PFNEKVKELLSGLSTKASSNPKFYATGELELSSSET---LYGLTQCTRDLS  166



>ref|XP_006447471.1| hypothetical protein CICLE_v10018332mg, partial [Citrus clementina]
 gb|ESR60711.1| hypothetical protein CICLE_v10018332mg, partial [Citrus clementina]
Length=219

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CVADA ST+R+ CPY+K A I+YDNC++KYS + F G+IDNG K++MWNV  V  P 
Sbjct  79   CKTCVADAISTIRENCPYSKSAKIFYDNCMLKYSNDKFFGQIDNGTKYFMWNVNNVGYPV  138

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQK+K+LL +LA++A G   LYA          S +K+YGL QCTRDLS
Sbjct  139  IFNQKSKDLLRQLADEASGKPKLYA-AGELELNEGSKKKIYGLAQCTRDLS  188



>ref|XP_010247024.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=238

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSCV  A S +R RCP +K AIIWYDNCL+KYS  DF GKID   +FYMWN + VS+P 
Sbjct  87   CKSCVIGANSEIRQRCPNDKEAIIWYDNCLLKYSNLDFSGKIDYKYRFYMWNTQNVSDPA  146

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FNQKT+ELLS LAE+AY    L+A   T          LYGLVQCTRDL
Sbjct  147  SFNQKTEELLSRLAEQAYRGAMLFA---TGEQQLDEAVTLYGLVQCTRDL  193



>ref|XP_003597040.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
Length=316

 Score =   128 bits (321),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV++A   ++ RCPYNKG IIWYD CL KYS+ DF GKI   N+FYMWN+  VS+P 
Sbjct  95   CKTCVSEATKEIQSRCPYNKGGIIWYDYCLFKYSDTDFFGKIAKTNRFYMWNLNNVSDPS  154

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN KTK+LLS+LA+KA     LYA   T       ++KLYGL QCTRDLS
Sbjct  155  TFNYKTKDLLSQLAQKASMNPKLYA---TGEVKLEESKKLYGLTQCTRDLS  202



>ref|XP_006372983.1| hypothetical protein POPTR_0017s06770g [Populus trichocarpa]
 gb|ERP50780.1| hypothetical protein POPTR_0017s06770g [Populus trichocarpa]
Length=245

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C A+A   +R RCP  K AII YDNCL+KYS+ DF G+ID+ NKFYMWNV  VSNP 
Sbjct  92   CRTCAANATREIRKRCPNGKRAIIAYDNCLLKYSDSDFFGQIDDQNKFYMWNVNNVSNPV  151

Query  155  AFNQKTKELLSELAEKA-YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KT ELLS+LA+KA Y    LYA    E+     + KLYG+ QCTRDLS
Sbjct  152  LFNEKTTELLSQLADKASYNSSKLYA--AGEMDLLEGSMKLYGMAQCTRDLS  201



>gb|KDO59870.1| hypothetical protein CISIN_1g046481mg [Citrus sinensis]
Length=247

 Score =   126 bits (316),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CVADA ST+R  CPY+K A I+YDNC++KYS + F G+IDNG K++MWNV  V  P 
Sbjct  94   CKTCVADAISTIRKNCPYSKSAKIFYDNCMLKYSNDKFFGQIDNGTKYFMWNVNNVGYPV  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQK+K+LL +LA++A G   LYA          S +K+YGL QCTRDLS
Sbjct  154  IFNQKSKDLLRQLADEASGKPKLYA-AGELELNEGSKKKIYGLAQCTRDLS  203



>ref|XP_002274668.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=242

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+C+ ++ S +R RCP NK AIIWYD CL+KYS  +F G++D+ N FYMWN+  VS+P+
Sbjct  91   CKACITESSSEIRKRCPDNKAAIIWYDYCLLKYSNVNFFGQVDHQNMFYMWNLNNVSDPD  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS LA++A+    +YA   T       +EKLYGL QCTRDLS
Sbjct  151  SFNQKTKELLSNLAQQAFNAMKMYA---TGELELEESEKLYGLTQCTRDLS  198



>ref|XP_007216907.1| hypothetical protein PRUPE_ppa019252mg [Prunus persica]
 gb|EMJ18106.1| hypothetical protein PRUPE_ppa019252mg [Prunus persica]
Length=215

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A   L +RCP  KGAIIWYDNCL KYS  +F GKIDN N+FYMWNV+EV +P+
Sbjct  64   CKTCVVEASKELGERCPSRKGAIIWYDNCLFKYSNVNFAGKIDNNNRFYMWNVQEVDDPK  123

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN K +ELLS L+ KA      YATGE EL    +   LYGL QCTRDLS
Sbjct  124  PFNAKVEELLSGLSTKASSNPKFYATGELELSSSET---LYGLTQCTRDLS  171



>ref|XP_011037143.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C A+A   +R RCP +K AII YDNCL+KYS+ DF G+ID+ NKFYMWNV  VSNP 
Sbjct  92   CRTCAANATREIRKRCPNSKRAIIAYDNCLLKYSDSDFFGQIDDQNKFYMWNVNNVSNPV  151

Query  155  AFNQKTKELLSELAEKA-YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KT ELLS+LA+KA Y    LYA    E+     + KLYG+ QC+RDLS
Sbjct  152  LFNEKTTELLSQLADKASYNSSKLYA--AGEMDLLEGSMKLYGMAQCSRDLS  201



>ref|XP_002533571.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF28806.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=243

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CVA+A + +R RCPY K AIIWYDNCL+KYS +DF G+IDN NK Y+ N+R VS+P 
Sbjct  90   CITCVAEASTEIRRRCPYKKEAIIWYDNCLLKYSNKDFFGQIDNKNKVYLLNLRNVSDPV  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQKTKELL++LA  A     +YA       G    +K+YG+ QCTRDLS
Sbjct  150  TFNQKTKELLTQLAVDASVTPRMYA-AGDLEFGDQGLKKIYGMAQCTRDLS  199



>ref|XP_006372982.1| hypothetical protein POPTR_0017s06760g [Populus trichocarpa]
 gb|ERP50779.1| hypothetical protein POPTR_0017s06760g [Populus trichocarpa]
Length=245

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C A+A   +R RCP  K AII YDNCL+KYS+ DF G+ID+ NKFYMWNV  VSNP 
Sbjct  92   CRTCAANATREIRKRCPNGKRAIIAYDNCLLKYSDSDFFGQIDDQNKFYMWNVNNVSNPV  151

Query  155  AFNQKTKELLSELAEKA-YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KT ELLS+LA+KA Y    LYA    E+     + KLYG+  CTRDLS
Sbjct  152  LFNEKTTELLSQLADKASYNSSKLYA--AGEMDLLEGSMKLYGMAHCTRDLS  201



>ref|XP_011037144.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C A+A   +R RCP +K AII YDNCL+KYS+ DF G+ID  NKFYMWNV  VSNP 
Sbjct  92   CRTCAANATREIRKRCPNSKRAIIAYDNCLLKYSDSDFFGQIDEQNKFYMWNVNNVSNPV  151

Query  155  AFNQKTKELLSELAEKA-YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+KT ELLS+LA+KA Y    LYA    E+     + KLYG+ +CTRDLS
Sbjct  152  LFNEKTTELLSQLADKASYNSSKLYA--AGEMDLLEGSMKLYGMAECTRDLS  201



>emb|CAN73036.1| hypothetical protein VITISV_044346 [Vitis vinifera]
Length=229

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK C+ +A + +R  CP NK AI+WYD+CL+KYS  +F G++D  N+FYMWN+  VS+P 
Sbjct  77   CKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFYMWNLNNVSDPT  136

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS LA++ +  + +YA           ++KLYGL QCTRDLS
Sbjct  137  SFNQKTKELLSHLAQQXFVNQKMYA---VGELELEESKKLYGLTQCTRDLS  184



>ref|XP_008228882.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=241

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A   L +RCP  KGAIIWYDNCL KYS  +F GKID  N+FYMWNV+EV +P 
Sbjct  90   CKTCVVEASKELGERCPSRKGAIIWYDNCLFKYSNVNFAGKIDKNNRFYMWNVQEVDDPT  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN K KELLS L+ KA      YATGE EL    +   LYGL QCTRDLS
Sbjct  150  PFNAKVKELLSGLSTKASSNPKFYATGELELSSSET---LYGLTQCTRDLS  197



>gb|KHN36560.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=227

 Score =   123 bits (308),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV+DA   +  RCPYNKG IIWYDNC++KY + DF GKIDN NKF + NVR VS+P 
Sbjct  93   CKTCVSDATKEILSRCPYNKGGIIWYDNCMLKYLDTDFFGKIDNTNKFSLLNVRNVSDPA  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN  TKELLS LA +A     +YA    EL  G  ++ +YGL QCTRDLS
Sbjct  153  MFNYMTKELLSLLAYRASLSPKMYA--SGELKIGGESKDIYGLTQCTRDLS  201



>emb|CAN73040.1| hypothetical protein VITISV_044350 [Vitis vinifera]
Length=190

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 4/111 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A + +  RCP  K AIIWYDNCL+KYS  DF G++D+  KFY +N + VSNP 
Sbjct  40   CKACVTEASTEILKRCPDYKAAIIWYDNCLLKYSNMDFFGQVDH-QKFYSFNEKNVSNPA  98

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKT+ELLS LAE+A+   ++YA   T       ++KLYGLVQCTRDLS
Sbjct  99   SFNQKTRELLSRLAEEAFVAPNMYA---TGEVDLEDSKKLYGLVQCTRDLS  146



>ref|XP_002274745.2| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=243

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK C+ +A + +R  CP NK AI+WYD+CL+KYS  +F G++D  N+FYMWN+  VS P 
Sbjct  91   CKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFYMWNLNNVSYPT  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS LA++ +  + +YA           ++KLYGL QCTRDLS
Sbjct  151  SFNQKTKELLSHLAQQGFVNQKMYA---VGELELEESKKLYGLTQCTRDLS  198



>emb|CBI28973.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK C+ +A + +R  CP NK AI+WYD+CL+KYS  +F G++D  N+FYMWN+  VS P 
Sbjct  114  CKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFYMWNLNNVSYPT  173

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS LA++ +  + +YA           ++KLYGL QCTRDLS
Sbjct  174  SFNQKTKELLSHLAQQGFVNQKMYA---VGELELEESKKLYGLTQCTRDLS  221



>ref|XP_003541936.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine 
max]
Length=245

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV+DA   +  RCPYNKG IIWYDNC++KY + DF GKIDN NKF + NVR VS+P 
Sbjct  93   CKTCVSDATKEILSRCPYNKGGIIWYDNCMLKYLDTDFFGKIDNTNKFSLLNVRNVSDPA  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN  TKELLS LA +A     +YA    EL  G  ++ +YGL QCTRDLS
Sbjct  153  MFNYMTKELLSLLAYRASLSPKMYA--SGELKIGGESKDIYGLTQCTRDLS  201



>emb|CDY68211.1| BnaCnng58060D [Brassica napus]
 emb|CDY52060.1| BnaCnng21700D [Brassica napus]
Length=255

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C+A A   LR RCP NK  IIWYDNCLVKYS  +F GKID  N+FY++NV  VSNP 
Sbjct  102  CRTCLATAIPELRKRCPNNKAGIIWYDNCLVKYSSTNFFGKIDYENRFYLYNVNNVSNPA  161

Query  155  AFNQKTKELLSELAEKAY--GVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN +TK LL+EL +KA   G + L+A            +KLYGLVQCTRDL
Sbjct  162  SFNTQTKALLTELTKKATAGGNQKLFA----TGEKSLGEKKLYGLVQCTRDL  209



>gb|KDP25619.1| hypothetical protein JCGZ_20775 [Jatropha curcas]
Length=231

 Score =   120 bits (302),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS--N  162
            CK+CVA+AG  L DRC  NKGAIIWYD+CL+KYS  +F G ID  NKFY++N ++V   N
Sbjct  72   CKTCVANAGDALIDRCSNNKGAIIWYDDCLLKYSNFNFFGDIDEQNKFYLYNYQDVEKMN  131

Query  161  PEAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            P  FN+K KELLS L+ KAYG K  YA        G   +K+YG+ QCTRDLS
Sbjct  132  PALFNKKVKELLSGLSGKAYGNKKFYA-TGELKLFGGKYKKIYGMAQCTRDLS  183



>ref|XP_008342465.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=242

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CV DA   +R+RCPY KGAIIWYD+CL+KYS+  F G+ID+ N+FYMWNV+EV N  
Sbjct  90   CNTCVVDASKEIRERCPYRKGAIIWYDHCLLKYSDVSFFGQIDSRNRFYMWNVQEVENGT  149

Query  155  AFNQKTKELLSELA-EKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+K KELLS L+ E +   + LYA   T      +   LYG+ QCTRDLS
Sbjct  150  LFNEKVKELLSGLSNEASEANQKLYA---TGEVQLDTFTTLYGIAQCTRDLS  198



>ref|XP_011079182.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Sesamum 
indicum]
Length=245

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C +CV DA   +  RCP ++GAIIWYDNCL+KY++ DFLGKID  N+FYMWN++ V+ +P
Sbjct  93   CGACVVDASDEIIKRCPNDRGAIIWYDNCLLKYADSDFLGKIDGQNRFYMWNLQNVTIDP  152

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            + FNQ+T+ LLSEL+E A     +YA         +  EK+YG+ QC+RDLS
Sbjct  153  QEFNQRTRGLLSELSEHASKTGKMYA---KGEVEVTGYEKIYGMAQCSRDLS  201



>ref|XP_004144581.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43545.1| hypothetical protein Csa_7G044850 [Cucumis sativus]
Length=256

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN-P  159
            CK+CVA A   +++RCP  KGA IWYD CL+KYS   F GKIDN NKFYMWN++E  + P
Sbjct  100  CKNCVATASQEIQERCPNRKGAAIWYDFCLLKYSNTKFFGKIDNRNKFYMWNLQERDDEP  159

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            E FN++ K LL  L+EK  G K+LY             EKLYGLVQC+RDLS
Sbjct  160  EVFNKQVKRLLISLSEKVEGTKNLYV-IGEVEMRTKGMEKLYGLVQCSRDLS  210



>ref|XP_003633310.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Vitis vinifera]
 emb|CBI28970.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A + +  RCP  K AIIWYDNCL+KYS  DF G++D+  KFY +N + VSNP 
Sbjct  91   CKACVTEASTEILKRCPDYKAAIIWYDNCLLKYSNMDFFGQVDH-QKFYSFNEKNVSNPA  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKT+ELLS L E+A+   ++YA   T       ++KLYGLVQCTRDLS
Sbjct  150  SFNQKTRELLSRLVEEAFVAPNMYA---TGEVDLEESKKLYGLVQCTRDLS  197



>emb|CAN73039.1| hypothetical protein VITISV_044349 [Vitis vinifera]
Length=231

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+C+ ++   +R RCP NK AIIWYD CL+KYS  +F G++   N+FYMWN+  VS+P 
Sbjct  91   CKACITESSGEIRKRCPDNKAAIIWYDYCLLKYSNVNFFGQVAYQNRFYMWNLNNVSDPA  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS LA+KA+    +YA   T       +EKLYGL QCTRDLS
Sbjct  151  SFNQKTKELLSNLAQKAFINSKMYA---TGELELEESEKLYGLTQCTRDLS  198



>ref|XP_010532487.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Tarenaya 
hassleriana]
Length=251

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A   LR RCP NKG  IWYD CLVK+S  +F GKID  NKFY++NV  V++P 
Sbjct  94   CRSCITAATPELRKRCPNNKGGAIWYDFCLVKHSTINFFGKIDYDNKFYLYNVNNVTDPT  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgete--lgggsstEKLYGLVQCTRDLS  3
            +FN +TK LLS L+++A  VK LYA GE     G GS  +KLYGLVQCTRDL+
Sbjct  154  SFNAQTKNLLSRLSKEAAAVKKLYAAGEDNLYGGAGSGKKKLYGLVQCTRDLT  206



>ref|XP_009145437.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Brassica 
rapa]
Length=274

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C+A A   LR RCP NK  IIWYDNCLVKYS  +F GKID  N+FY++NV  VSNP 
Sbjct  121  CRTCLATAIPELRKRCPNNKAGIIWYDNCLVKYSSTNFFGKIDYENRFYLYNVNNVSNPA  180

Query  155  AFNQKTKELLSELAEKAY--GVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN +TK +L++L +KA   G + L+A            +KLYGLVQCTRDL
Sbjct  181  SFNTQTKAILTDLTKKATAGGHQKLFA----TGEKSLGEKKLYGLVQCTRDL  228



>gb|AAN46194.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46196.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46198.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46199.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46200.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46201.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46202.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46203.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46204.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A   LR RCP NK  I+WYDNCLVKYS  +F GKID  N+FY++NV+ VS+P 
Sbjct  84   CRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFGKIDFENRFYLYNVKNVSDPS  143

Query  155  AFNQKTKELLSELAEKAYGV--KSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN +TK LL+EL +KA     + L+A             KLYGLVQCTRDL
Sbjct  144  TFNSQTKALLTELTKKATTRDNQKLFA----TGEKNIGKNKLYGLVQCTRDL  191



>gb|AAN46205.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A   LR RCP NK  I+WYDNCLVKYS  +F GKID  N+FY++NV+ VS+P 
Sbjct  84   CRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFGKIDFENRFYLYNVKNVSDPS  143

Query  155  AFNQKTKELLSELAEKAYGV--KSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN +TK LL+EL +KA     + L+A             KLYGLVQCTRDL
Sbjct  144  TFNSQTKALLTELTKKATTRDNQKLFA----TGEKIIGKNKLYGLVQCTRDL  191



>ref|XP_010069666.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89431.1| hypothetical protein EUGRSUZ_A01730 [Eucalyptus grandis]
Length=239

 Score =   118 bits (296),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CVADAG+ ++  CP NKGAI+WYD+C+ KY++ +F  +ID  N FY++N  +VS+P 
Sbjct  88   CKACVADAGAEIQRLCPRNKGAIMWYDDCMFKYNDTNFFRQIDKANNFYLYNGNKVSDPA  147

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN +  E+L+ LA+KAY +  LYA G+  + G ++   LYGLVQCTRDLS
Sbjct  148  LFNLRVTEMLTRLAKKAYSIPKLYAAGKKRVDGKTT---LYGLVQCTRDLS  195



>ref|XP_002274604.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=242

 Score =   118 bits (296),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+C+ ++   +R RCP NK AIIWYD CL+KYS  +F G++   N+FYMWN+  VS+P 
Sbjct  91   CKACITESSGEIRKRCPDNKAAIIWYDYCLLKYSNVNFFGQVAYQNRFYMWNLNNVSDPA  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQKTKELLS LA+KA+    +YA   T       +EKLYGL QCTRDLS
Sbjct  151  SFNQKTKELLSNLAQKAFINSKMYA---TGELELEESEKLYGLTQCTRDLS  198



>emb|CAN73037.1| hypothetical protein VITISV_044347 [Vitis vinifera]
Length=337

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = -1

Query  332  KSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEA  153
            K+CV +A   L +RCP+N+GAIIWY NCL KYS  +F G+IDN NKFYM+NV+   +P +
Sbjct  187  KTCVTEATKELCNRCPHNRGAIIWYYNCLFKYSNVEFFGEIDNKNKFYMYNVQSADDPTS  246

Query  152  FNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            FN KTKEL S L+ KAYG   L+A   T       + KLYGL QCTR+LS
Sbjct  247  FNVKTKELSSSLSNKAYGSPVLFA---TGELVLEESMKLYGLAQCTRNLS  293


 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNV  177
            CK+C+ ++ S +R RCP NK AIIWYD  L+KYS  +F G++D+ N FYMWN+
Sbjct  91   CKACITESSSEIRKRCPDNKAAIIWYDYXLLKYSNVNFFGQVDHQNMFYMWNL  143



>ref|XP_010684085.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=243

 Score =   118 bits (295),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 74/112 (66%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN-P  159
            C +CV DA + +R RCPYNKG IIWYDNC +KY +++F G+IDN N+F + NV  +SN P
Sbjct  91   CTTCVYDARTEIRKRCPYNKGGIIWYDNCFLKYIDQNFFGQIDNKNEFQLSNVANISNAP  150

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              FNQK K LLS+LA ++   + LYA          +   LYGL QCTRDLS
Sbjct  151  SLFNQKVKGLLSQLANESASARKLYA---AGEMKLDTFTNLYGLAQCTRDLS  199



>ref|XP_004292427.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Fragaria 
vesca subsp. vesca]
Length=244

 Score =   117 bits (294),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CV DA   +R+ CP +KGAIIWYD+CL+KYS  DF GKIDN NKFYMWNV+EV NP 
Sbjct  90   CTTCVVDASKDIREFCPNSKGAIIWYDHCLLKYSNVDFFGKIDNKNKFYMWNVQEVQNPT  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+  K+LLS LA +A    +      T      +   LYGL  CTRDLS
Sbjct  150  LFNKSVKDLLSGLAVEASEAAAAPKFYATGELQLDTFTTLYGLATCTRDLS  200



>gb|AAN46195.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46197.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score =   116 bits (291),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A   LR RCP NK  I+WYDNCLVKYS  +F GKID  N+F ++NV+ VS+P 
Sbjct  84   CRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFGKIDFENRFSLYNVKNVSDPS  143

Query  155  AFNQKTKELLSELAEKAYGV--KSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN +TK LL+ELA+KA     + L+A             KLYGLVQCTRDL
Sbjct  144  TFNSQTKALLTELAKKATTRDNQKLFA----TGEKNLGKNKLYGLVQCTRDL  191



>emb|CDY57408.1| BnaA05g36230D [Brassica napus]
Length=255

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C+A A   LR RCP NK  IIWYDNCLVKYS  +F GKID  N+FY++NV  VS+P 
Sbjct  102  CRTCLATAIPELRKRCPNNKAGIIWYDNCLVKYSSTNFFGKIDYENRFYLYNVNNVSSPA  161

Query  155  AFNQKTKELLSELAEKAY--GVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN +TK +L++L +KA   G + L+A            +KLYGLVQCTRDL
Sbjct  162  SFNTQTKAILTDLTKKATAGGHQKLFA----TGEKSLGEKKLYGLVQCTRDL  209



>ref|XP_006406217.1| hypothetical protein EUTSA_v10021371mg [Eutrema salsugineum]
 dbj|BAJ34612.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47670.1| hypothetical protein EUTSA_v10021371mg [Eutrema salsugineum]
Length=255

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+A A   LR RCP NK  IIWYDNCLVKYS  +F GKID  N+FY++NV  VS+P 
Sbjct  102  CGSCLATAIPELRQRCPNNKAGIIWYDNCLVKYSSTNFFGKIDYENRFYLYNVNNVSDPA  161

Query  155  AFNQKTKELLSELAEKAYGV--KSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN +TK LL+EL +KA     + L+A            +KLYGLVQCTRDL
Sbjct  162  SFNTQTKALLTELTQKATTGDNQKLFA----TGEKNLEKKKLYGLVQCTRDL  209



>ref|NP_566697.1| Receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
 sp|Q9LRJ9.1|CRR38_ARATH RecName: Full=Cysteine-rich repeat secretory protein 38; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB01391.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59407.1| unknown protein [Arabidopsis thaliana]
 gb|ABD91491.1| At3g22060 [Arabidopsis thaliana]
 gb|AEE76585.1| Receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
Length=252

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A   LR RCP NK  I+WYDNCLVKYS  +F GKID  N+FY++NV+ VS+P 
Sbjct  99   CRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFGKIDFENRFYLYNVKNVSDPS  158

Query  155  AFNQKTKELLSELAEKAYGV--KSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN +TK LL+EL +KA     + L+A             KLYGLVQCTRDL
Sbjct  159  TFNSQTKALLTELTKKATTRDNQKLFA----TGEKNIGKNKLYGLVQCTRDL  206



>ref|XP_008455405.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=258

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            CK+C+A A   +++RC   KGA IWYD CL+KYS   F GKIDN NKFYMWN++E   +P
Sbjct  100  CKNCIAMASQEIQERCTNRKGAAIWYDFCLLKYSNTKFFGKIDNRNKFYMWNLQERDEDP  159

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAt-getelgggsstEKLYGLVQCTRDLS  3
            E FN++ K LL  L+EK  G K+LY       +      EKLYGLVQC+RDLS
Sbjct  160  EVFNKQVKRLLISLSEKVEGTKNLYVIGEVEMMIRTKGMEKLYGLVQCSRDLS  212



>gb|EYU43106.1| hypothetical protein MIMGU_mgv1a021349mg, partial [Erythranthe 
guttata]
Length=220

 Score =   115 bits (287),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            CK+CV +A S +   CP  KGA++WYDNC +KYS+ DF GKIDN NKFYMWN+  VS N 
Sbjct  69   CKTCVVEASSQVTKICPNLKGAVVWYDNCYLKYSDVDFHGKIDNRNKFYMWNLNNVSTNA  128

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            E FNQKT+EL+  L+  A     +YA             K+YG+VQC+RDLS
Sbjct  129  ELFNQKTRELIENLSTNASRTSKMYA---NGETDIGIESKIYGMVQCSRDLS  177



>gb|KDP32106.1| hypothetical protein JCGZ_12567 [Jatropha curcas]
Length=241

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+A+A + +R RCP NK A IWYDNCL+KYS  +F G+ID  NKFY+ NV+ VS+P 
Sbjct  90   CLTCIAEASNEIRTRCPNNKQATIWYDNCLIKYSNINFFGQIDEQNKFYLLNVQNVSDPA  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN   K+LLS+LAE A     ++A           ++K+YGL QC+RDLS
Sbjct  150  SFNANVKDLLSKLAENASVSPRMFA---AGDMEIEGSKKVYGLAQCSRDLS  197



>ref|XP_008237024.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 5/113 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C +CV  A   LR+RCPY+KGAIIWYD+CL+KYS+ +F GKIDN NKF M NV+ V +NP
Sbjct  90   CSTCVIGASKELRERCPYSKGAIIWYDHCLLKYSDVNFFGKIDNKNKFSMTNVQAVENNP  149

Query  158  EAFNQKTKELLSELAEKAYGV-KSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              FN+K KELLS L+ +A    +  YA   T      +   LYG+ QCTRDLS
Sbjct  150  TLFNEKVKELLSGLSNEASDANQKFYA---TGEVQLDTFTTLYGIAQCTRDLS  199



>gb|EYU43108.1| hypothetical protein MIMGU_mgv1a018557mg, partial [Erythranthe 
guttata]
Length=220

 Score =   112 bits (280),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            CK+CV +A S +   CP  KGA+IWYDNC +KYS+ +F G IDN NKFYMWN+  VS N 
Sbjct  69   CKTCVVEASSQVTKICPNLKGAVIWYDNCYLKYSDVNFHGTIDNRNKFYMWNLNNVSTNA  128

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            E FNQKT+EL+  L+  A     +YA             K+YG+VQC+RDLS
Sbjct  129  ELFNQKTRELIGNLSTNASRTSKMYA---HGETDIGIESKIYGMVQCSRDLS  177



>ref|XP_008455543.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=277

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+C+  A + ++ RCP  KG  IWYD CL+KYS   F GKIDNG + YMWNV+E  NP 
Sbjct  124  CKTCIETASNEIQQRCPDKKGGSIWYDFCLLKYSNIKFFGKIDNGFRLYMWNVQEAENPT  183

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++ K LL+ L E+      LY            ++KLYGLVQCTRDLS
Sbjct  184  LFNEQVKNLLTSLVEQVEVTPKLYV---IGEKEIEGSKKLYGLVQCTRDLS  231



>ref|XP_003597035.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
 gb|AES67286.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=246

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV+ A   + + CPY KGAIIWYDNC+ KY + DF GKIDN NKF + NV+ VS+P 
Sbjct  95   CKTCVSQATKEILNVCPYKKGAIIWYDNCMFKYLDNDFFGKIDNTNKFALLNVQNVSDPI  154

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN  T +LLS LA +A     LYA   T       +E++YGL QCTRD+S
Sbjct  155  KFNNMTNDLLSFLANEASMNHKLYA---TGELKIGESERVYGLTQCTRDIS  202



>ref|XP_004144580.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
Length=208

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 73/111 (66%), Gaps = 4/111 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGN-KFYMWNVREVSNP  159
            CK+CV  AG  ++ RCPY KGA IWYD+CL+KYS   F GK  NG  +FY+ NVRE  +P
Sbjct  54   CKTCVTSAGQDIQQRCPYKKGAAIWYDSCLLKYSNAKFFGKNQNGGFRFYLVNVREADDP  113

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             +F ++ K LL+ L+E A   ++LYA          S+ KLYGLVQCTRDL
Sbjct  114  TSFKEQVKNLLNGLSETAKTSRNLYA---IGDLEIGSSRKLYGLVQCTRDL  161



>ref|XP_004168058.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
Length=208

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 73/111 (66%), Gaps = 4/111 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGN-KFYMWNVREVSNP  159
            CK+CV  AG  ++ RCPY KGA IWYD+CL+KYS   F GK  NG  +FY+ NVRE  +P
Sbjct  54   CKTCVTSAGQDIQQRCPYKKGAAIWYDSCLLKYSNAKFFGKNQNGGFRFYLVNVREADDP  113

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             +F ++ K LL+ L+E A   ++LYA          S+ KLYGLVQCTRDL
Sbjct  114  TSFKEQVKNLLNGLSETAKTSRNLYA---IGDLEIGSSRKLYGLVQCTRDL  161



>ref|XP_008391617.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=242

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CV DA   LR+ CP  KGAIIWYD+CL+KYS+  F G+ID  N+FY++NV+EV N  
Sbjct  90   CNTCVVDASKDLRELCPSRKGAIIWYDHCLLKYSDVGFFGQIDTNNRFYLYNVQEVENGT  149

Query  155  AFNQKTKELLSELA-EKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+K KELLS L+ E +   +  YA   T      +   LYGL QCTRDLS
Sbjct  150  VFNEKVKELLSGLSNEASEDNQKFYA---TGEVQLDTFTTLYGLAQCTRDLS  198



>gb|KGN43546.1| hypothetical protein Csa_7G044860 [Cucumis sativus]
Length=250

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 73/111 (66%), Gaps = 4/111 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGN-KFYMWNVREVSNP  159
            CK+CV  AG  ++ RCPY KGA IWYD+CL+KYS   F GK  NG  +FY+ NVRE  +P
Sbjct  96   CKTCVTSAGQDIQQRCPYKKGAAIWYDSCLLKYSNAKFFGKNQNGGFRFYLVNVREADDP  155

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             +F ++ K LL+ L+E A   ++LYA          S+ KLYGLVQCTRDL
Sbjct  156  TSFKEQVKNLLNGLSETAKTSRNLYA---IGDLEIGSSRKLYGLVQCTRDL  203



>gb|EYU43107.1| hypothetical protein MIMGU_mgv1a022379mg [Erythranthe guttata]
Length=242

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            CK+CV +A S +   CP  KGA+IWYDNC +KYS+ +F G IDN NKFYMWN+  VS N 
Sbjct  91   CKTCVVEASSHVTKICPNIKGAVIWYDNCYLKYSDVNFHGTIDNRNKFYMWNLNNVSTNA  150

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            E FNQKT+EL+  L+  A     +YA             K+YG+ QC+RDLS
Sbjct  151  ELFNQKTRELIGNLSTNASRTSKMYA---NGETDIGIESKIYGMAQCSRDLS  199



>ref|XP_006850462.1| hypothetical protein AMTR_s00035p00084590 [Amborella trichopoda]
 gb|ERN12043.1| hypothetical protein AMTR_s00035p00084590 [Amborella trichopoda]
Length=161

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A   +   CP  + AI+W+DNCL++YS++DF+G++D  NKFYMWN+  +S  +
Sbjct  5    CKACVENATIEISHLCPGKEEAIVWFDNCLLRYSDKDFIGEVDESNKFYMWNIYNISQRQ  64

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+   EL+ EL+ KA      +ATGE E+      EK+YGLVQC+R+LS
Sbjct  65   VFNRHLGELMYELSSKASSSHFFFATGEVEVSEKKIEEKIYGLVQCSRELS  115



>ref|XP_008342466.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=243

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 73/113 (65%), Gaps = 5/113 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C +CV DAG  LR RC Y+KGA+IWYD+CL+KYS+  F G+ID   +F M NVREV  N 
Sbjct  90   CNTCVXDAGKELRQRCAYSKGAVIWYDHCLLKYSDVSFFGQIDYATRFSMSNVREVDQNG  149

Query  158  EAFNQKTKELLSELAEKAYGVKS-LYAtgetelgggsstEKLYGLVQCTRDLS  3
              FN+K KELLSEL+ +A      LYA   T      +   LYG+ QCTRDLS
Sbjct  150  TLFNEKVKELLSELSNEASDANPKLYA---TGELQLDTVTTLYGIAQCTRDLS  199



>gb|KFK39506.1| hypothetical protein AALP_AA3G252600 [Arabis alpina]
Length=255

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 6/112 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+A A   +  RCP NK  IIWYDNCLVKY+  +F GKID  N+FY++NV  VS+P 
Sbjct  102  CGSCLAIAIPEISRRCPDNKAGIIWYDNCLVKYASTNFFGKIDFENRFYLYNVNNVSDPA  161

Query  155  AFNQKTKELLSELAEKAY-GVKS-LYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN +TK LL+ELA+K   G+ + L+A GE  +G       LYGLVQCTRDL
Sbjct  162  SFNMQTKTLLTELAKKVTAGINNKLFAAGEKNIGKQM----LYGLVQCTRDL  209



>gb|AAN46207.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46208.1| unknown protein [Arabidopsis lyrata]
Length=200

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = -1

Query  323  VADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQ  144
            +A A   +R RCP NK  IIWYDNCLVKYS  +F GKID  N+FY++NV  VS+P  FN 
Sbjct  88   LATAIPEIRQRCPSNKAGIIWYDNCLVKYSSTNFFGKIDFENRFYLYNVNNVSDPSTFNT  147

Query  143  KTKELLSELAEKAYG--VKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +TK LL++L +KA     + L+A            +KLYGLVQCTRDL
Sbjct  148  QTKALLTKLTKKATTGDNQKLFA----TGEKNIGKKKLYGLVQCTRDL  191



>ref|XP_004487372.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cicer 
arietinum]
Length=248

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            CK+CV++A   + + CPYNKGAIIWYDNC+ KYS+ DF GKIDN NKF + NV+ VS + 
Sbjct  96   CKTCVSNASKEILNLCPYNKGAIIWYDNCMFKYSDIDFFGKIDNTNKFSLLNVQNVSGDS  155

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              FN  TK+LLS LA +A   K LYA   +        E++YGL +CTRDL+
Sbjct  156  MKFNNMTKDLLSLLAYEASLDKKLYA---SGELKIGELERVYGLSECTRDLT  204



>ref|XP_008228908.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=240

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 71/110 (65%), Gaps = 3/110 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+CV +A   L +RCP  KGAIIW+DNCL KYS   F GK+D  NKF +WN  +V +P 
Sbjct  89   CKTCVVEASKELGERCPSGKGAIIWHDNCLFKYSNVKFAGKVDYKNKFSLWNGYKVDDPT  148

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN K KELLS L+ KA      YATGE EL    +   LYGL QCTRDL
Sbjct  149  PFNAKVKELLSGLSTKASSNPKFYATGELELSSSET---LYGLTQCTRDL  195



>ref|XP_010051188.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89433.1| hypothetical protein EUGRSUZ_A01732 [Eucalyptus grandis]
Length=242

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            CKSCV+DAG  L  RCP  KGAIIWYDNCL+KYS  +F GKID  NKFY+ NV++V  + 
Sbjct  90   CKSCVSDAGPELLQRCPEQKGAIIWYDNCLLKYSNVEFFGKIDTKNKFYLLNVQDVDMDF  149

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              F +K K+LLS L ++A     LYA       G    + L+GL QCTRDLS
Sbjct  150  MEFYRKIKQLLSNLTDEAVAGPKLYA---YGELGLGGYKTLFGLAQCTRDLS  198



>ref|XP_002878210.1| hypothetical protein ARALYDRAFT_348900 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54469.1| hypothetical protein ARALYDRAFT_348900 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+  A S LR RCP NK  I+W+D CL+K+S   F  KID+ NKFYM++ ++VS+P 
Sbjct  103  CGSCLTTASSELRRRCPMNKAGIVWFDKCLLKFSPTAFFEKIDDKNKFYMYSTKKVSDPA  162

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN KTK LL+EL  KA   +S                KLYG+VQCTRDL
Sbjct  163  SFNAKTKALLTELTTKA-TRRSDKLLLYETGEMKLGKMKLYGMVQCTRDL  211



>gb|AAN46206.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46209.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46210.1| unknown protein [Arabidopsis lyrata]
Length=200

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 6/101 (6%)
 Frame = -1

Query  302  LRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQKTKELLS  123
            +R RCP NK  IIWYDNCLVKYS  +F GKID  N+FY++NV  VS+P  FN +TK LL+
Sbjct  95   IRQRCPSNKAGIIWYDNCLVKYSSTNFFGKIDFENRFYLYNVNNVSDPSTFNTQTKALLT  154

Query  122  ELAEKAYGV--KSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +L +KA     + L+A            +KLYGLVQCTRDL
Sbjct  155  KLTKKATTGDNQKLFA----TGEKNIGKKKLYGLVQCTRDL  191



>ref|XP_008455404.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=249

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 4/111 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGN-KFYMWNVREVSNP  159
            CK+CV  A   ++ RCPY KGA IWYD+CL+KYS   F GK  NG  +FY+ NVRE  +P
Sbjct  95   CKTCVITAAQDIQQRCPYKKGAAIWYDSCLLKYSNAKFFGKNQNGGFRFYLVNVREADDP  154

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             +F ++ K LL+ L+E A   ++LYA          S++KLYGLVQCTRDL
Sbjct  155  TSFKEQVKNLLNGLSEMAKTSRNLYA---IGDLEIGSSKKLYGLVQCTRDL  202



>ref|XP_010496825.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Camelina 
sativa]
Length=255

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = -1

Query  302  LRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQKTKELLS  123
            +R RCP NK  IIWYDNCL+KYS   F GKID  N+FY++NV  VS+P +FN +T+ LL+
Sbjct  113  IRQRCPNNKAGIIWYDNCLLKYSSTKFFGKIDYENRFYLYNVNNVSDPTSFNTQTRALLT  172

Query  122  ELAEKAY--GVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            EL +KA   G + L+A            +KLYGLVQCTRDL
Sbjct  173  ELTKKATTGGNQKLFA----TGEKNIGKKKLYGLVQCTRDL  209



>ref|XP_008236988.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C +CV  A   LR+RCPY+KGA+IWYD+CL+KYS+ +F G+IDN NKF M NV+ V +N 
Sbjct  90   CNTCVIGASKELRERCPYSKGAVIWYDHCLLKYSDVNFFGQIDNRNKFSMANVQAVENNT  149

Query  158  EAFNQKTKELLSELAEKAYGVKS-LYAtgetelgggsstEKLYGLVQCTRDLS  3
              FN+K KELLS L+ +A       YA   T      +   LYG+ QCTRDLS
Sbjct  150  TLFNEKVKELLSGLSNEASDANPKFYA---TGEVQLDTFTTLYGIAQCTRDLS  199



>ref|XP_008237025.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C +CV  A   LR+RCPY+KGA+IWYD+CL+KYS+ +F G+IDN NKF M NV+ V +N 
Sbjct  90   CNTCVIGASKELRERCPYSKGAVIWYDHCLLKYSDVNFFGQIDNRNKFSMANVQAVENNT  149

Query  158  EAFNQKTKELLSELAEKAYGVKS-LYAtgetelgggsstEKLYGLVQCTRDLS  3
              FN+K KELLS L+ +A       YA   T      +   LYG+ QCTRDLS
Sbjct  150  TLFNEKVKELLSGLSNEASDANPKFYA---TGEVQLDTFTTLYGIAQCTRDLS  199



>ref|XP_007149947.1| hypothetical protein PHAVU_005G112700g [Phaseolus vulgaris]
 gb|ESW21941.1| hypothetical protein PHAVU_005G112700g [Phaseolus vulgaris]
Length=249

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SCV DA   L++RCP  KGAI+WYD CL+KYS E F G+ D  NKFYM N+ +V +P 
Sbjct  98   CMSCVDDATKKLQERCPKKKGAIVWYDYCLLKYSNEYFFGESDEKNKFYMVNIYDVDDPA  157

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN K  ELLS L+  A     LYA GE +L    +   LYGL QCTRDL
Sbjct  158  TFNAKVNELLSALSYNASQTPMLYAVGELQLEEAKT---LYGLAQCTRDL  204



>ref|XP_002883339.1| hypothetical protein ARALYDRAFT_479720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59598.1| hypothetical protein ARALYDRAFT_479720 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 6/101 (6%)
 Frame = -1

Query  302  LRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQKTKELLS  123
            +R RCP NK  IIWYDNCLVKYS  +F GKID  N+FY++NV  VS+P  FN +TK LL+
Sbjct  110  IRQRCPSNKAGIIWYDNCLVKYSSTNFFGKIDFENRFYLYNVNNVSDPSTFNTQTKALLT  169

Query  122  ELAEKAYGV--KSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +L +KA     + L+A            +KLYGLVQCTRDL
Sbjct  170  KLTKKATTGDNQKLFA----TGEKNIGMKKLYGLVQCTRDL  206



>ref|XP_010431451.1| PREDICTED: putative cysteine-rich repeat secretory protein 61 
[Camelina sativa]
Length=258

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+  A S LR RCP NK  I+W+D CL+K S   F  KID+ NKFYM++ ++VS+P 
Sbjct  103  CGSCLTTATSELRRRCPMNKAGIVWFDKCLLKISPTAFFEKIDDKNKFYMYSTKKVSDPV  162

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN KTK LL+EL  KA   +S       +        KLYG+VQCTRDL
Sbjct  163  SFNAKTKALLTELTTKA-TRRSDKLLLYEKGEMNLGKMKLYGMVQCTRDL  211



>ref|XP_010516475.1| PREDICTED: putative cysteine-rich repeat secretory protein 61 
[Camelina sativa]
Length=258

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+  A S LR RCP NK  I+W+D CL+K S   F  KID+ NKFYM+  ++VS+P 
Sbjct  103  CGSCLTTATSELRRRCPMNKAGIVWFDKCLLKISPTAFFEKIDDKNKFYMYRTKKVSDPV  162

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN KTK LL+EL  KA   +S       +        KLYG+VQCTRDL
Sbjct  163  SFNAKTKALLTELTTKA-TRRSDKLLLYEKGEMNLGKMKLYGMVQCTRDL  211



>ref|XP_004144485.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 ref|XP_004159198.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43543.1| hypothetical protein Csa_7G044830 [Cucumis sativus]
Length=253

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK+C+  A + ++ +C   KG  IWYD C +KYS   F GKIDNG + YMWNV+E  NP 
Sbjct  100  CKTCIQVASNEIQQQCLNKKGGSIWYDFCFLKYSNIKFFGKIDNGFRLYMWNVQEAENPT  159

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++ K LL+ L E+      LY            ++KLYGLVQCTRDLS
Sbjct  160  VFNEQVKNLLTSLVEQVEVTPKLYV---IGEKENEGSKKLYGLVQCTRDLS  207



>ref|XP_010510855.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Camelina 
sativa]
Length=255

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 6/101 (6%)
 Frame = -1

Query  302  LRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQKTKELLS  123
            +R RCP NK  IIWYDNCL+KYS   F GKID  N+FY++NV  VS+P +FN +T+ LL 
Sbjct  113  IRQRCPNNKAGIIWYDNCLLKYSSTKFFGKIDYENRFYLYNVNNVSDPTSFNTQTRALLI  172

Query  122  ELAEKAY--GVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            EL + A   G + L+A            +KLYGLVQCTRDL
Sbjct  173  ELTKNATTRGNQKLFA----TGEKNIGKKKLYGLVQCTRDL  209



>ref|NP_191390.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9M2I5.1|CRR61_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
61; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB68169.1| putative protein [Arabidopsis thaliana]
 gb|AEE79768.1| uncharacterized protein AT3G58310 [Arabidopsis thaliana]
Length=258

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 67/110 (61%), Gaps = 1/110 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC++ A S LR RCP NK  I+W+D CL+K S   F  KID+ NKFYM++ ++VS+P 
Sbjct  103  CGSCLSTATSELRRRCPMNKAGIVWFDKCLLKISPTAFFEKIDDKNKFYMYSTKKVSDPA  162

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN KTK LL+EL  KA   +S                KLYG+VQC RDL
Sbjct  163  LFNVKTKALLTELTAKA-TRRSDKLLLYETGEMKLGKMKLYGMVQCRRDL  211



>ref|XP_009398186.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Musa 
acuminata subsp. malaccensis]
Length=247

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CV  AG+ +RD CP NK  IIW+D C+++YS+ +F G+ID  ++FYMWN   VS+  
Sbjct  96   CTTCVRTAGARVRDLCPNNKDGIIWFDECMLRYSDVEFFGEIDFDHRFYMWNRENVSDAV  155

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F+ K + L++ L +KAY    L+A   T       +++LYGLVQCT+DLS
Sbjct  156  MFDGKVENLMNRLKQKAYISPLLFA---TGEMEIGESQELYGLVQCTKDLS  203



>ref|XP_006592824.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine 
max]
 gb|KHN25767.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=171

 Score =   100 bits (250),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CV +A   L++RC   KGAI+WYD CL+KYS E F G+ID  NKFYM N+ +V +P 
Sbjct  19   CMACVNEATKKLQERCSKKKGAIVWYDYCLLKYSNEYFFGEIDEKNKFYMVNIYDVDDPS  78

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             F+ K  ELLS L+  A     LYA GE +L    +   LYGL QCTRDL
Sbjct  79   TFSDKVNELLSGLSYNASQTPMLYAVGELQLQESKT---LYGLAQCTRDL  125



>ref|XP_006298384.1| hypothetical protein CARUB_v10014454mg [Capsella rubella]
 gb|EOA31282.1| hypothetical protein CARUB_v10014454mg [Capsella rubella]
Length=254

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = -1

Query  302  LRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQKTKELLS  123
            +  RCP NK  IIWYDNCLVKYS  +F G+ID  N+F ++NV  VS+P +FN +T++LL+
Sbjct  113  ISKRCPNNKAGIIWYDNCLVKYSSTNFFGRIDYENRFALYNVNNVSDPTSFNTQTRDLLT  172

Query  122  ELAEKAY--GVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            EL + A   G + L+A      G  +  +KLYGLVQCTRDL
Sbjct  173  ELTKTATTGGNQKLFA-----TGEKNIGKKLYGLVQCTRDL  208



>ref|XP_006292774.1| hypothetical protein CARUB_v10019024mg [Capsella rubella]
 gb|EOA25672.1| hypothetical protein CARUB_v10019024mg [Capsella rubella]
Length=258

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+  A S LR RCP +K  I+W+D CL+K S   F  KID  NKFYM++ ++VS+P 
Sbjct  103  CGSCLTTATSELRRRCPMSKAGIVWFDKCLLKISPTAFFEKIDYKNKFYMYSTKKVSDPG  162

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN KTK LL+ELA KA   +S       +        KLYG+VQCTR+L
Sbjct  163  SFNAKTKALLTELAAKA-TRRSDKLLLYEKGEMNLGKMKLYGMVQCTRNL  211



>ref|XP_010466466.1| PREDICTED: putative cysteine-rich repeat secretory protein 21 
[Camelina sativa]
Length=262

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNP-  159
            C SC+A A S LR RCP NKG IIWYDNCL++ S  D LGKID  N FYM+N +EVS+  
Sbjct  104  CHSCLATAISGLRKRCPNNKGGIIWYDNCLLEISSIDTLGKIDYKNNFYMYNAKEVSSDI  163

Query  158  EAFNQKTKELLSELAEKAYGVK-------SLYAtgetelgggsstEKLYGLVQCTRDLS  3
            E+FN+  + LL++L EKA   +       ++YA             KLY +VQCT+DLS
Sbjct  164  ESFNKNVRILLNKLKEKATSNETNAGRDYTVYA----AGDNKLGPMKLYAMVQCTQDLS  218



>ref|XP_010504787.1| PREDICTED: putative cysteine-rich repeat secretory protein 61 
[Camelina sativa]
Length=258

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 67/110 (61%), Gaps = 1/110 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C S +  A S LR RCP NK  I+W+D CL+K S   F  KID+ NKFYM++ ++V++P 
Sbjct  103  CGSFLTTATSELRRRCPMNKAGIVWFDKCLLKISPTAFFEKIDDKNKFYMYSTKKVNDPV  162

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN KTK L +EL  KA   +S       +        KLYG+VQCTRDL
Sbjct  163  SFNAKTKALFTELTTKA-TRRSDKLLLYEKGEMNLGKMKLYGMVQCTRDL  211



>ref|XP_004144484.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43544.1| hypothetical protein Csa_7G044840 [Cucumis sativus]
Length=255

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN--  162
            C++CVA     ++ RCP +KGAIIWYD CL+KYS   F GKIDN NKF + NV+ V +  
Sbjct  96   CRNCVATGSQEIQVRCPLSKGAIIWYDYCLLKYSNTQFFGKIDNRNKFSLINVQSVDDNV  155

Query  161  PEAFNQKTKELLSELAEKAY---GVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
               FN++ K LL++LA+K      +   Y     E       +KLYGLVQC+RDLS
Sbjct  156  TTVFNEEVKSLLTDLAKKVELPNNIPKFYV--IGEREIEVLKKKLYGLVQCSRDLS  209



>sp|Q9LRL8.2|CRR21_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
21; Flags: Precursor [Arabidopsis thaliana]
Length=256

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+A A S +R RCP NK  IIWYDNC+++ S  D   KID  N F+M+N ++VS + 
Sbjct  102  CRSCLATANSEIRRRCPKNKEKIIWYDNCVLEISSIDTFNKIDYQNNFFMYNAKDVSGDI  161

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            E FN+ T++LL EL EKA  +KS           G   +KLY +VQCT+DL+
Sbjct  162  ELFNKNTRDLLHELKEKA-NIKSKKDFMYAAGEKGLGEKKLYAMVQCTKDLT  212



>ref|XP_006850460.1| hypothetical protein AMTR_s00035p00082360 [Amborella trichopoda]
 gb|ERN12041.1| hypothetical protein AMTR_s00035p00082360 [Amborella trichopoda]
Length=244

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK C+ DA + +R  CP  + AI+W+D CLV YS + F GKID  NK YMWN   VS P 
Sbjct  90   CKVCMEDATAEIRHLCPNKEEAIVWFDYCLVHYSNKSFFGKIDEKNKIYMWNTLNVSAPH  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+   EL+ + + +A    S +ATGE +L        +YGL QC+ DLS
Sbjct  150  LFNRYLGELMYQFSSQASLSLSFFATGEIQLSEVGDKTTIYGLAQCSYDLS  200



>ref|XP_004168056.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
Length=261

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 70/116 (60%), Gaps = 7/116 (6%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN--  162
            C++CVA     ++ RCP +KGAIIWYD CL+KYS   F GKIDN NKF + NV+ V +  
Sbjct  96   CRNCVATGSQEIQVRCPLSKGAIIWYDYCLLKYSNTQFFGKIDNRNKFSLINVQSVDDNV  155

Query  161  PEAFNQKTKELLSELAEKAY---GVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
               FN++ K LL +LA+K      +   Y     E       +KLYGLVQC+RDLS
Sbjct  156  TTVFNEEVKSLLMDLAKKVELPNNIPKFYV--IGEREIEVLKKKLYGLVQCSRDLS  209



>ref|XP_009150860.1| PREDICTED: putative cysteine-rich repeat secretory protein 61 
[Brassica rapa]
Length=259

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C++ A S LR RCP NKGAI+W+D CL++ S   F+ ++D  NKFYM+N+++V +P 
Sbjct  99   CDTCLSTAYSELRKRCPMNKGAIVWFDQCLLRISPTTFINEMDLKNKFYMYNMKKVRDPA  158

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtget----elgggsstEKLYGLVQCTR  12
            +FN KTK LL++L ++A    S  +  +              KLYG+VQCTR
Sbjct  159  SFNAKTKALLTKLTKEATRKGSERSPAQEYYEPGDMKLDGKMKLYGMVQCTR  210



>dbj|BAB01372.1| unnamed protein product [Arabidopsis thaliana]
Length=262

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+A A S +R RCP NK  IIWYDNC+++ S  D   KID  N F+M+N ++VS + 
Sbjct  108  CRSCLATANSEIRRRCPKNKEKIIWYDNCVLEISSIDTFNKIDYQNNFFMYNAKDVSGDI  167

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            E FN+ T++LL EL EKA  +KS           G   +KLY +VQCT+DL+
Sbjct  168  ELFNKNTRDLLHELKEKA-NIKSKKDFMYAAGEKGLGEKKLYAMVQCTKDLT  218



>emb|CDX88009.1| BnaA06g26000D [Brassica napus]
Length=259

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C++ A S LR RCP NKGAI+W+D CL++ S   F+ ++D  NKFYM+N+++V +P 
Sbjct  99   CDTCLSTAYSELRKRCPMNKGAIVWFDRCLLRISPTTFINEMDLKNKFYMYNMKKVRDPA  158

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtget----elgggsstEKLYGLVQCTR  12
            +FN KTK LL++L ++A    S  +  +              KLYG+VQCTR
Sbjct  159  SFNAKTKALLTKLTKEATRKGSERSPAQEYYEPGDMKLDGKMKLYGMVQCTR  210



>ref|XP_007201324.1| hypothetical protein PRUPE_ppa009992mg [Prunus persica]
 gb|EMJ02523.1| hypothetical protein PRUPE_ppa009992mg [Prunus persica]
Length=268

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C +CV  A   L +RCPY+KGAIIWYD+CL+KYS+ +F G+IDN NKF M NV+ V +NP
Sbjct  90   CNTCVIGASKELLERCPYSKGAIIWYDHCLLKYSDVNFFGQIDNKNKFSMTNVQAVENNP  149

Query  158  EAFNQKTKELLSELAEKA  105
              FN+K  ELLS L+ +A
Sbjct  150  TLFNEKVHELLSGLSNEA  167



>ref|XP_006299328.1| hypothetical protein CARUB_v10015485mg [Capsella rubella]
 gb|EOA32226.1| hypothetical protein CARUB_v10015485mg [Capsella rubella]
Length=259

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 71/119 (60%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C+SC+  A S LR +CP NKG IIWYDNCL+  S    LG+ID    FYM+N ++V SN 
Sbjct  101  CRSCINTALSDLRRKCPNNKGRIIWYDNCLLDISSIFSLGEIDYRYIFYMYNAKDVSSNK  160

Query  158  EAFNQKTKELLSELAEKAYGVKS-------LYAtgetelgggsstEKLYGLVQCTRDLS  3
             AFN+ TKELL EL EKA   K        LYA           T KLY +VQCT+DLS
Sbjct  161  IAFNKNTKELLCELKEKAINKKELPYRRDYLYA----AGAENLGTTKLYAMVQCTKDLS  215



>ref|XP_008455406.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=262

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 69/116 (59%), Gaps = 7/116 (6%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN--  162
            C++CVA     ++ RCP +KGAIIWYD CL+KYS   F GKIDN N F + NV+ V +  
Sbjct  97   CRNCVATGSQEIQVRCPLSKGAIIWYDYCLLKYSNTQFFGKIDNRNTFSLINVQSVDDKA  156

Query  161  PEAFNQKTKELLSELAEKAY---GVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
               FN++ K LL +LA+K      +   Y     E       +KLYGLVQC+RDLS
Sbjct  157  TTVFNEEVKSLLMDLAKKVELPNNIPKFYV--IGEREIEVLKKKLYGLVQCSRDLS  210



>emb|CDY07878.1| BnaC03g47440D [Brassica napus]
Length=259

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C++ A S LR RCP NKGAI+W+D CL++ S   F+ ++D  NKFYM+N+++V +P 
Sbjct  99   CNTCLSTAYSELRKRCPMNKGAIVWFDRCLLRISPTTFINEMDLKNKFYMYNMKKVRDPV  158

Query  155  AFNQKTKELLSELAEKAY--GVKSLYAtgetelgggsstEK--LYGLVQCTR  12
            +F  KTK LL++LA++A   G +   A    E G      K  LYG+VQCTR
Sbjct  159  SFKAKTKALLTKLAKEATRKGSERSPAQEYYEPGDMKLDGKMTLYGMVQCTR  210



>sp|Q9LRL7.2|CRR22_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
22; Flags: Precursor [Arabidopsis thaliana]
Length=279

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 73/131 (56%), Gaps = 24/131 (18%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S LR RCP NKG IIWYDNCL++ S  + LGKID    FYM+N ++V+ + 
Sbjct  109  CRSCLTTAFSELRGRCPKNKGRIIWYDNCLLEISPINSLGKIDYEYNFYMYNEKDVNGDT  168

Query  158  EAFNQKTKELLSELAEKA-------------------YGVKSLYAtgetelgggsstEKL  36
              FN+ T+ LL  L EKA                    G+K LYA           T KL
Sbjct  169  NLFNKNTRALLYRLKEKATSKENNNGKQDLPEIGGKRLGMKMLYA----TGEKSLRTMKL  224

Query  35   YGLVQCTRDLS  3
            YG+VQCT+DLS
Sbjct  225  YGMVQCTKDLS  235



>ref|XP_010466465.1| PREDICTED: putative cysteine-rich repeat secretory protein 25 
[Camelina sativa]
Length=258

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 69/119 (58%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C+SC+  A   +R +CP NKG IIWYDNCL+  S    LGKID    FYM+N ++V SN 
Sbjct  100  CRSCITTALPEIRRKCPNNKGRIIWYDNCLLDISSIYTLGKIDYRYIFYMYNSKDVSSNK  159

Query  158  EAFNQKTKELLSELAEKAYGVKS-------LYAtgetelgggsstEKLYGLVQCTRDLS  3
             AFN+ TK LL EL EKA   K        LYA           T K+Y +VQCT+DLS
Sbjct  160  MAFNKNTKALLYELKEKATSKKEIPYRRDYLYA----AGEESLGTTKVYAMVQCTKDLS  214



>ref|XP_010908140.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Elaeis 
guineensis]
Length=366

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A     + CPY KG IIWYD+CL+ YS + FL  ID  N+ +M+N+ ++++P 
Sbjct  98   CRSCLDTAIQDAPNLCPYAKGTIIWYDHCLLHYSNQLFLSTIDTSNEIFMYNIYKITDPS  157

Query  155  AFNQKTKELLSELAE-KAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++    L+  +A+  AY    ++ATGE           +YGL QCTRDLS
Sbjct  158  RFDKLLDVLMGRIADWAAYNSTKMFATGEMMNSTNPPFPTIYGLAQCTRDLS  209



>ref|XP_006406223.1| hypothetical protein EUTSA_v10021973mg [Eutrema salsugineum]
 gb|ESQ47676.1| hypothetical protein EUTSA_v10021973mg [Eutrema salsugineum]
Length=257

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 67/117 (57%), Gaps = 10/117 (9%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S LR RCP NKGAIIWYD C  K S +D   KID  N FYM N   VS NP
Sbjct  99   CRSCLTTAVSELRKRCPGNKGAIIWYDQCFFKLSTKDSHNKIDYENDFYMSNANNVSGNP  158

Query  158  EAFNQKTKELLSELAEKAY------GVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            E FN++  +LL +L  KA       G K L+            T+K+Y +VQCT+DL
Sbjct  159  ELFNREISDLLKKLTIKATNENIVEGSKGLF---YGAGETTIGTKKIYAMVQCTQDL  212



>ref|XP_010910400.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Elaeis 
guineensis]
Length=322

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 66/112 (59%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+  A       CPY KGAIIWYD CL+ YS E FL  +D  ++  M+NV  +++P 
Sbjct  97   CHSCLNTAIQDAPKLCPYTKGAIIWYDYCLLHYSNEHFLSTVDISDEIMMYNVNNITDPS  156

Query  155  AFNQKTKELLSELAEK-AYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++    L++++A+  AY    L+ATGE        +  +YGL QCTRDLS
Sbjct  157  RFDKLVDVLMNKIADSAAYNSTKLFATGEMMNSTNPPSPTIYGLAQCTRDLS  208



>ref|XP_006467960.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=320

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+A A   L  RCP  K AIIWYDNC+++YS   F G ++ G +F M+N++  S+  
Sbjct  96   CRSCIATATLALPTRCPNQKEAIIWYDNCMLRYSNRFFFGNMEFGPRFSMYNLKNASDAS  155

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ  K LL  L  KA      +ATG      G+ ++ +Y LVQCT DLS
Sbjct  156  TFNQAVKSLLDSLKIKA-APGDKFATGNANTSAGAGSQTIYALVQCTPDLS  205



>gb|KDO75586.1| hypothetical protein CISIN_1g021048mg [Citrus sinensis]
Length=318

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+A A   L  RCP  K AIIWYDNC+++YS   F G ++ G +F M+N++  S+  
Sbjct  96   CRSCIATATLALPTRCPNQKEAIIWYDNCMLRYSNRFFFGNMEFGPRFSMYNLKNASDAS  155

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ  K LL  L  KA      +ATG      G+ ++ +Y LVQCT DLS
Sbjct  156  TFNQAVKSLLDSLKIKA-APGDKFATGNANTSAGAGSQTIYALVQCTPDLS  205



>sp|Q9LRK9.2|CRR28_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
28; Flags: Precursor [Arabidopsis thaliana]
Length=257

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 68/114 (60%), Gaps = 4/114 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++CV  A S LR RCP NKGAIIWYD CL + S  D   KID  N FY+ N + VSN E
Sbjct  99   CRTCVTTALSGLRKRCPGNKGAIIWYDQCLFEISTVDSYHKIDYENDFYLSNPKNVSNRE  158

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelggg----sstEKLYGLVQCTRDL  6
             FN++T  LL +L  KA   K++    +  L         T+K+Y +VQCT+DL
Sbjct  159  LFNRETSALLEKLTTKATDKKNIDGANQLVLYAAGEKRIGTKKVYAMVQCTKDL  212



>ref|XP_008800494.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix 
dactylifera]
Length=686

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 48/112 (43%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A     + CPY+KGAIIWYD CL+ YS + FL  IDN N  YM+N + +++P 
Sbjct  98   CRSCLDTAVVDAPNLCPYDKGAIIWYDYCLLHYSNQRFLSTIDNSNVVYMYNTQNITDPS  157

Query  155  AFNQKTKELLSELAE-KAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++    L+  LA+  A     ++ATGE        +  +YGL QCTRDLS
Sbjct  158  RFDKLVNVLMGRLADWAADNSTEMFATGEMMNSTNPPSPTIYGLAQCTRDLS  209



>ref|XP_006406033.1| hypothetical protein EUTSA_v10022150mg [Eutrema salsugineum]
 gb|ESQ47486.1| hypothetical protein EUTSA_v10022150mg [Eutrema salsugineum]
Length=256

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 69/118 (58%), Gaps = 12/118 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C++C+A A + LR RCP NKGAIIWYD CL++ S     GKID  NKFY+ N  +V+ NP
Sbjct  98   CRTCLATAIAGLRRRCPRNKGAIIWYDQCLLRISTIRVSGKIDYENKFYLSNPNKVNGNP  157

Query  158  EAFNQKTKELLSELAEKAYGVKS-------LYAtgetelgggsstEKLYGLVQCTRDL  6
             +FN++T   L  LA KA   K+       LYA           T  LY +VQCT+DL
Sbjct  158  VSFNKETSAFLENLAYKATDTKNVDGIALVLYA----SGEKTIGTTNLYAMVQCTKDL  211



>ref|XP_007049618.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
 gb|EOX93775.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
Length=254

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA + +R RCP    A IWYD C ++YS+E+F+G++D     + +NV  V++PE
Sbjct  84   CSSCIQDAATQIRQRCPNQSDARIWYDYCFLRYSKENFIGEVDTSFGIFYYNVENVTDPE  143

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FNQ+   L +++  +A   K+            S    LY LVQCTRDLS
Sbjct  144  SFNQELGALTNKIRSEAVMPKN--EGLGKGKTKLSPFVTLYALVQCTRDLS  192



>ref|XP_010466464.1| PREDICTED: putative cysteine-rich repeat secretory protein 22 
[Camelina sativa]
Length=277

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 71/131 (54%), Gaps = 24/131 (18%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S +R +CP NKG IIWYDNCL++ S  + LGKID  N FYM+N + V+ + 
Sbjct  107  CRSCLNTAFSEIRRKCPNNKGGIIWYDNCLLEISPINSLGKIDYENNFYMYNEKAVNGDT  166

Query  158  EAFNQKTKELLSELAEKAYG-------------------VKSLYAtgetelgggsstEKL  36
             +FN+ T+ LL  L EKA                     +K LYA             KL
Sbjct  167  NSFNKNTRALLYRLKEKATSKENNNGKQDLPETKEERLKMKKLYA----TGEESLGKMKL  222

Query  35   YGLVQCTRDLS  3
            Y +VQCT+DLS
Sbjct  223  YAMVQCTKDLS  233



>ref|XP_010910239.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=686

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 43/111 (39%), Positives = 62/111 (56%), Gaps = 0/111 (0%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A     + CPY K AIIWYD CL+ YS E FL  +DN +K YM+NV  +++P 
Sbjct  99   CRSCLDTAIQDAPNLCPYAKSAIIWYDYCLLHYSNERFLSTVDNSDKVYMYNVNNITDPS  158

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F+     L++++ ++A    +            S    +YGL QCTRDLS
Sbjct  159  QFDNLVGVLMNKIVDRAASNSTEMFATGEMNSTNSPFPTIYGLAQCTRDLS  209



>ref|XP_006449122.1| hypothetical protein CICLE_v10015972mg [Citrus clementina]
 gb|ESR62362.1| hypothetical protein CICLE_v10015972mg [Citrus clementina]
Length=317

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+A A   L  RCP  K AIIWYDNC+++YS   F G ++ G  F M+N++  S+  
Sbjct  96   CRSCIATATVELPKRCPNEKEAIIWYDNCMLRYSNRFFFGNMEFGPWFSMYNLKNASDAS  155

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ  K LL  L  KA      +ATG      G+ ++ +Y LVQCT DLS
Sbjct  156  TFNQAVKSLLDSLKIKA-APGDKFATGNANTSAGAGSQTIYALVQCTPDLS  205



>ref|XP_006299311.1| hypothetical protein CARUB_v10015466mg [Capsella rubella]
 gb|EOA32209.1| hypothetical protein CARUB_v10015466mg [Capsella rubella]
Length=278

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 72/132 (55%), Gaps = 25/132 (19%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S +R +CP NKG IIWYDNCL++ S  + LGKID  N FYM+N  +V+ + 
Sbjct  107  CRSCLDTAFSEIRSKCPNNKGGIIWYDNCLLEISPINSLGKIDYQNTFYMYNENDVNGDT  166

Query  158  EAFNQKTKELLSELAEKAYG--------------------VKSLYAtgetelgggsstEK  39
             +FN+ ++ LL  L EKA                      +K LYA       G     K
Sbjct  167  NSFNKNSRALLYRLKEKATSKENNNGKQDLPQNGENRLIRMKKLYA----AGEGSLGKMK  222

Query  38   LYGLVQCTRDLS  3
            LY +VQCT+DLS
Sbjct  223  LYAMVQCTKDLS  234



>ref|XP_006406226.1| hypothetical protein EUTSA_v10022184mg [Eutrema salsugineum]
 gb|ESQ47679.1| hypothetical protein EUTSA_v10022184mg [Eutrema salsugineum]
Length=318

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C SC+  A + +R RCP NKG IIWY+NC+++ S      +ID  N F+++N ++ S + 
Sbjct  156  CHSCLTTAFAGIRKRCPKNKGRIIWYENCVLEISSVYRWSQIDYQNNFFLYNAKDASGDK  215

Query  158  EAFNQKTKELLSELAEKA-------YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            E+FN+KTK LL  L EKA       YG   +YA     +     T KLYG+VQC +DLS
Sbjct  216  ESFNKKTKALLYNLKEKASSKENDPYGKNYMYA----TMEESLGTMKLYGMVQCMKDLS  270



>ref|XP_010646646.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=299

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SCV  AG  ++++C Y+K AIIWYD C+++YS EDF+G ++    F MWNV   ++P+
Sbjct  87   CQSCVKTAGQEIQEQCQYHKTAIIWYDQCMLRYSNEDFIGTMNTSPGFLMWNVNNRTDPD  146

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              +     L+ +L  +A   + + +         +S   LYGL QCTRD+S
Sbjct  147  DKDVGALSLMYKLVSEAPDSEDMVSIKNETSVNNASLM-LYGLAQCTRDIS  196



>ref|XP_002264674.2| PREDICTED: cysteine-rich repeat secretory protein 55 [Vitis vinifera]
 emb|CBI18746.3| unnamed protein product [Vitis vinifera]
Length=262

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP    A IW+D C ++YS +DF+G++D G   Y +NV  V+  E
Sbjct  93   CSTCIQDAAKQIRTRCPNEADARIWFDYCFLRYSNKDFIGEVDTGFGIYYYNVDNVTETE  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++  +L+ ++  +A  V+   A         +    LY LVQCTRDLS
Sbjct  153  RFNEELSKLMEKIRSQA--VEPQNAGLGKGQTELTPFITLYALVQCTRDLS  201



>ref|XP_006828418.1| hypothetical protein AMTR_s00060p00084230 [Amborella trichopoda]
 gb|ERM95834.1| hypothetical protein AMTR_s00060p00084230 [Amborella trichopoda]
Length=261

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 2/110 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC +DA   +R  CP    A IW+DNC ++Y  +DF+G++D G   + WNV+ V+ PE
Sbjct  86   CSSCTSDATKQIRQLCPDEADARIWFDNCFLRYDTDDFMGELDTGYGIFYWNVQNVTEPE  145

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             F ++  +L+ ++  KA  V+       +     +    +YGLVQCT+DL
Sbjct  146  RFAKELGDLMDKITAKA--VEPGNKGFGSGKTKFAPFVTIYGLVQCTQDL  193



>ref|XP_006838099.1| hypothetical protein AMTR_s00106p00036910 [Amborella trichopoda]
 gb|ERN00668.1| hypothetical protein AMTR_s00106p00036910 [Amborella trichopoda]
Length=284

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 4/110 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+ C+  + +  +  CP  K AI WYD+CL++YS+ DF+G I   N+ Y+WN+   ++PE
Sbjct  92   CRDCMYTSTTDAQQLCPNRKEAIFWYDDCLLRYSDSDFIGSITQ-NRLYLWNIYNATDPE  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +FN++   L+  L+ +A     LYA   +      +   ++GL+QCTRDL
Sbjct  151  SFNKELAGLMRNLSSRAISDALLYA---SGNTVYDNFVTIHGLLQCTRDL  197



>ref|NP_188837.1| cysteine-rich repeat secretory protein 29 [Arabidopsis thaliana]
 sp|Q9LRK8.1|CRR29_ARATH RecName: Full=Cysteine-rich repeat secretory protein 29; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB01382.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76575.1| cysteine-rich repeat secretory protein 29 [Arabidopsis thaliana]
Length=256

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C++ A S LR RCP NKGAIIWYD CL+K S      KID  N FY+ N + +S+ E
Sbjct  99   CPPCISTAVSGLRRRCPRNKGAIIWYDQCLLKISSVASFNKIDYENDFYLSNPKNMSDRE  158

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtge---telgggsstEKLYGLVQCTRDL  6
             FN++T  LL +LA KA    +L                T+K+  +VQCT+DL
Sbjct  159  LFNKETSALLEKLANKASDRNNLDGKQLVLYAAGEKRIGTKKVSAMVQCTKDL  211



>ref|XP_010481161.1| PREDICTED: putative cysteine-rich repeat secretory protein 10 
[Camelina sativa]
Length=264

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 70/119 (59%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S +R  CP+NKG IIWYDNC++  S     G+IDN + FY++N ++V+ + 
Sbjct  102  CRSCLTTAFSGIRRLCPHNKGRIIWYDNCILDLSSIYTYGEIDNKHIFYLYNAKDVNGDT  161

Query  158  EAFNQKTKELLSELAEKA-------YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            + FN+ T+ LL +L EKA       Y    +YA             KLY +VQCT+DLS
Sbjct  162  KLFNKNTRALLYKLKEKASRKEQKPYRKDYMYA----AGEESLGKMKLYAMVQCTQDLS  216



>ref|XP_010646957.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=664

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 66/111 (59%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SCV  AG  ++++C YNK AIIWYD C+++YS EDF+G ++    F MWNV   ++P+
Sbjct  88   CQSCVKTAGQEIQEQCQYNKTAIIWYDQCMLRYSNEDFIGTMNTSPGFLMWNVNNRTDPD  147

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              +     L+ +L  +A   + + +         +S   LYGL QCTRD+S
Sbjct  148  DKDVGALSLMYKLVSEAPYSEDMVSIKNETSVNNASLM-LYGLAQCTRDIS  197



>ref|XP_002894412.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70671.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=269

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 69/119 (58%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S +R RCP NKG IIWYDNC++  S      K+D  + FY++N ++VS N 
Sbjct  94   CRSCLTTAFSAIRRRCPNNKGRIIWYDNCVLDLSSIYTYDKVDYKHSFYVYNAKDVSGNT  153

Query  158  EAFNQKTKELLSELAEKA-------YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            ++FN+ T  LL +L EKA       Y    +YA           T KLY +VQCT+DLS
Sbjct  154  KSFNKNTNTLLYKLKEKATRKEQEQYTKDYMYA----TGEESLGTMKLYAMVQCTQDLS  208



>sp|Q9LRL0.2|CRR27_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
27; Flags: Precursor [Arabidopsis thaliana]
Length=255

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSC++ A S LR RCP +KGA+IWYD CL + S  +   KID  N FY+ N  +V++ E
Sbjct  98   CKSCISAAISGLRRRCPKSKGAVIWYDQCLFEISTINSFNKIDYENDFYLSNPNDVNDKE  157

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgg---gsstEKLYGLVQCTRDL  6
             FN++T  LL EL  KA    ++                T+ +Y +VQCT+DL
Sbjct  158  LFNKETSALLEELTNKATDKNNMIGNKFVLYAAGDKRIGTKNVYAMVQCTKDL  210



>ref|XP_007223972.1| hypothetical protein PRUPE_ppa014621mg [Prunus persica]
 gb|EMJ25171.1| hypothetical protein PRUPE_ppa014621mg [Prunus persica]
Length=664

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 2/113 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNP-  159
            C  C++DA   L + CP  K AI WYDNC+++YS     G ++    +YMWNV+ VS+  
Sbjct  91   CGKCLSDATYVLTESCPNQKEAIGWYDNCMLRYSNRSLYGLMETIPAYYMWNVQNVSSTI  150

Query  158  -EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             +AFNQK   LL+ L  +A GV  L         G SS   +YGL QCT DLS
Sbjct  151  LDAFNQKLAALLNGLTSEAAGVDDLKFAVGNASVGASSNVTIYGLAQCTPDLS  203



>gb|KHN25769.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=124

 Score = 83.6 bits (205),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = -1

Query  248  LVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQKTKELLSELAEKAYGVKS-LYAtge  72
            + +Y + D LGKIDN NKFYMWN++ VS+P  FN KT+ELLS+LA+K Y + + LYATGE
Sbjct  1    MFRYLDTDILGKIDNTNKFYMWNLKNVSDPATFNYKTRELLSQLAQKTYVMNNKLYATGE  60

Query  71   telgggsstEKLYGLVQCTRDLS  3
             +L    +   LYGL QCTRDLS
Sbjct  61   VKLENSET---LYGLSQCTRDLS  80



>ref|XP_007227081.1| hypothetical protein PRUPE_ppa015766mg, partial [Prunus persica]
 gb|EMJ28280.1| hypothetical protein PRUPE_ppa015766mg, partial [Prunus persica]
Length=155

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  CV+ AG  LR  CPY +GAIIWY+NCL+KYS+  F+G  D  N   + N+R +  P 
Sbjct  67   CGRCVSAAGQELRVLCPYIRGAIIWYENCLLKYSDTHFIGISDTDNVVRLTNIRFIGTPL  126

Query  155  AFNQKTKELLSELAEKA  105
             F +K  ELL+ L  KA
Sbjct  127  LFGKKVHELLTHLCSKA  143



>emb|CAN64566.1| hypothetical protein VITISV_020515 [Vitis vinifera]
Length=399

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP    A IW+D C ++YS +DF+G+ D G   Y +NV  V+  E
Sbjct  93   CSTCIQDAAKQIRTRCPNEADARIWFDYCFLRYSNKDFIGEXDTGFGIYYYNVDNVTETE  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++  +L+ ++  +A  V+   A         +    LY LVQCTRDLS
Sbjct  153  RFNEELSKLMEKIRSQA--VEPQNAGLGKGQTELTPFITLYALVQCTRDLS  201



>ref|XP_010103954.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
 gb|EXB97657.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
Length=590

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+ CV  A   +R+RCP  K AIIWY+ C ++YS   F G +D     Y+WN  +++  E
Sbjct  89   CRECVQSAVEDVRNRCPVEKDAIIWYEQCQLRYSNLSFFGALDETPTIYLWNTADITEKE  148

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ  ++ L+E   +A   +             S  +KLYGLVQC+ DLS
Sbjct  149  RFNQLVEDTLNEATAEAAKGRPGGEKFAMRTANFSRFQKLYGLVQCSPDLS  199



>ref|XP_003622768.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
 gb|AES78986.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=257

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP    A IWYD C ++YS + F+G++D     + +NV  V++ E
Sbjct  87   CSNCIQDATKQIRQRCPNQADARIWYDYCFIRYSNKSFIGEVDTSFGIFYFNVENVTDSE  146

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN+K   L+ ++  +A  VK+            S    LYGLVQCTRDL
Sbjct  147  VFNKKLGNLMDQIRGEAVMVKN--KGLGKGKTVLSPFVTLYGLVQCTRDL  194



>ref|XP_010463431.1| PREDICTED: putative cysteine-rich repeat secretory protein 25 
[Camelina sativa]
Length=264

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 70/119 (59%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S +R  CP NKG IIWYDNC++  S     G+IDN + F+++N ++V+ + 
Sbjct  102  CRSCLTTAFSRIRRLCPNNKGRIIWYDNCILDLSSIYTYGEIDNKHIFFLYNAKDVNGDT  161

Query  158  EAFNQKTKELLSELAEKA-------YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            ++FN+ TK LL +L EKA       Y    +YA             KLY +VQCT+DLS
Sbjct  162  KSFNKNTKALLYKLKEKASRKEQKPYRKDYMYA----AGEESLGKMKLYAMVQCTQDLS  216



>ref|XP_006449124.1| hypothetical protein CICLE_v10018264mg, partial [Citrus clementina]
 gb|ESR62364.1| hypothetical protein CICLE_v10018264mg, partial [Citrus clementina]
Length=183

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+ C+  +   L+ RCP  K A+IWYDNC+++YS   F G ++ G  F+M+N+++V NP 
Sbjct  32   CRQCIYRSTFVLQKRCPNQKEAVIWYDNCMLRYSNRYFFGNMEFGPWFWMYNLKKVPNPG  91

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            AF +  + LL+ L  KA    S             S+  +Y LVQC+ DLS
Sbjct  92   AFTRAVRSLLNTLILKAASGSS--RLKYATGFTTRSSPNIYALVQCSPDLS  140



>ref|XP_008372641.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Malus domestica]
Length=263

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +R RCP    A IWYD C ++YS++ F+G++D     + +NV  V++PE
Sbjct  90   CSSCIQDAAKQIRQRCPNQADARIWYDYCFLRYSDKSFIGEVDTSYGIFYYNVYNVTDPE  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++   L  ++ ++A   +S            S    LY LVQCTRDLS
Sbjct  150  KFNEELGALTDKIRKQAVVPES--GGLGKGETKLSPFVTLYALVQCTRDLS  198



>ref|XP_007214583.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica]
 gb|EMJ15782.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica]
Length=659

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAG-STLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNP  159
            CK CVA A   T+++ CP+ K  IIWYD+C+++YS   F G +D   + Y+WNV  +++P
Sbjct  85   CKDCVATAARETVKEYCPFRKVTIIWYDDCMLRYSNVSFFGNMDEAPRVYLWNVGNITDP  144

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              FN+   E ++ L   A    S       +    ++ ++LY LVQCT DLS
Sbjct  145  NRFNKVLGETINGLVPVAANAASGTKKFAAKKTNFTAFQELYSLVQCTPDLS  196



>dbj|BAD43562.1| putative protein [Arabidopsis thaliana]
Length=270

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C++ A S LR RCP NKGAIIWYD CL+K S      KID  N FY+ N   +S+  
Sbjct  113  CPPCISTAVSGLRRRCPRNKGAIIWYDQCLLKISSVASFNKIDYENDFYLSNPNNMSDRG  172

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtge---telgggsstEKLYGLVQCTRDL  6
             FN++T  LL +LA KA    +L                T+K+Y +VQCT+DL
Sbjct  173  LFNKETSALLEKLAYKASDRNNLDGKQLVLYAAGEKRIGTKKVYAMVQCTKDL  225



>sp|P0CJ49.1|CRR42_ARATH RecName: Full=Cysteine-rich repeat secretory protein 42; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ50.1|CRR43_ARATH RecName: Full=Cysteine-rich repeat secretory protein 43; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ51.1|CRR44_ARATH RecName: Full=Cysteine-rich repeat secretory protein 44; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ52.1|CRR45_ARATH RecName: Full=Cysteine-rich repeat secretory protein 45; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ53.1|CRR46_ARATH RecName: Full=Cysteine-rich repeat secretory protein 46; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ54.1|CRR47_ARATH RecName: Full=Cysteine-rich repeat secretory protein 47; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ55.1|CRR48_ARATH RecName: Full=Cysteine-rich repeat secretory protein 48; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ56.1|CRR49_ARATH RecName: Full=Cysteine-rich repeat secretory protein 49; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ57.1|CRR50_ARATH RecName: Full=Cysteine-rich repeat secretory protein 50; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ58.1|CRR51_ARATH RecName: Full=Cysteine-rich repeat secretory protein 51; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ59.1|CRR52_ARATH RecName: Full=Cysteine-rich repeat secretory protein 52; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ60.1|CRR53_ARATH RecName: Full=Cysteine-rich repeat secretory protein 53; Flags: 
Precursor [Arabidopsis thaliana]
 sp|P0CJ61.1|CRR54_ARATH RecName: Full=Cysteine-rich repeat secretory protein 54; Flags: 
Precursor [Arabidopsis thaliana]
Length=256

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C++ A S LR RCP NKGAIIWYD CL+K S      KID  N FY+ N   +S+  
Sbjct  99   CPPCISTAVSGLRRRCPRNKGAIIWYDQCLLKISSVASFNKIDYENDFYLSNPNNMSDRG  158

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtge---telgggsstEKLYGLVQCTRDL  6
             FN++T  LL +LA KA    +L                T+K+Y +VQCT+DL
Sbjct  159  LFNKETSALLEKLAYKASDRNNLDGKQLVLYAAGEKRIGTKKVYAMVQCTKDL  211



>ref|NP_193799.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84352.1| uncharacterized protein AT4G20670 [Arabidopsis thaliana]
Length=280

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C++ A S LR RCP NKGAIIWYD CL+K S      KID  N FY+ N   +S+  
Sbjct  113  CPPCISTAVSGLRRRCPRNKGAIIWYDQCLLKISSVASFNKIDYENDFYLSNPNNMSDRG  172

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtge---telgggsstEKLYGLVQCTRDL  6
             FN++T  LL +LA KA    +L                T+K+Y +VQCT+DL
Sbjct  173  LFNKETSALLEKLAYKASDRNNLDGKQLVLYAAGEKRIGTKKVYAMVQCTKDL  225



>gb|KFK45107.1| hypothetical protein AALP_AA1G345400 [Arabis alpina]
Length=257

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 65/112 (58%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC   A S LR +CP NKG IIWYD CL+K S     GKID  N   M N + VS+P+
Sbjct  104  CRSCYTTALSMLRRKCPRNKGKIIWYDQCLIKISSIGSDGKIDYANNICMTNAKNVSDPD  163

Query  155  AFNQKTKELLSELAEKAYG-VKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            A+       +S+L  KA G   +L     T   G   TEK+YG+VQCT+DL+
Sbjct  164  AYWNSFIRFISKLNTKATGYYGNLSNGMYTTGEGMFGTEKVYGMVQCTKDLN  215



>sp|Q9SVI0.1|CRR41_ARATH RecName: Full=Cysteine-rich repeat secretory protein 41; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45833.1| putative protein [Arabidopsis thaliana]
 emb|CAB79067.1| putative protein [Arabidopsis thaliana]
Length=266

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C++ A S LR RCP NKGAIIWYD CL+K S      KID  N FY+ N   +S+  
Sbjct  99   CPPCISTAVSGLRRRCPRNKGAIIWYDQCLLKISSVASFNKIDYENDFYLSNPNNMSDRG  158

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtge---telgggsstEKLYGLVQCTRDL  6
             FN++T  LL +LA KA    +L                T+K+Y +VQCT+DL
Sbjct  159  LFNKETSALLEKLAYKASDRNNLDGKQLVLYAAGEKRIGTKKVYAMVQCTKDL  211



>ref|XP_010931306.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=681

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/111 (40%), Positives = 66/111 (59%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A   +   CPYNKGAIIWYD C+++YS + FL   +N  + +MWN + V++ +
Sbjct  95   CQSCLNTASKDVLQLCPYNKGAIIWYDPCMLRYSNQSFLSSYNNSGQVFMWNTQNVTDRD  154

Query  155  AFNQKTKELLSELAE-KAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             F++   EL+  +A+  AY     +ATGE        T  +YGL QCT D+
Sbjct  155  KFDKLLTELIDAIADYAAYNSTRRFATGEVNFTKAFPT--IYGLAQCTPDM  203



>ref|XP_010468360.1| PREDICTED: putative cysteine-rich repeat secretory protein 23 
[Camelina sativa]
Length=260

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C++C+  A S +R RCP N+G IIWYDNC++         +ID  N FY+ N ++VS + 
Sbjct  99   CRTCLDTAFSEIRRRCPNNRGRIIWYDNCVLTILTFYTYAEIDYQNHFYISNAKDVSGDT  158

Query  158  EAFNQKTKELLSELAEKAYG---VKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            ++FN+KT+ LL  L EKA     V S                +LYG+VQCT+DLS
Sbjct  159  KSFNEKTRALLHRLMEKASSKENVPSKKNYLYATGEESLGKMRLYGMVQCTQDLS  213



>ref|XP_008776433.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Phoenix 
dactylifera]
Length=680

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 66/112 (59%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+ C++DA       CPYN+GAI++YD+CL++YS   F   +D   +   WNV  V++P 
Sbjct  94   CRFCLSDAIQDAPQLCPYNQGAIVYYDDCLLRYSNLRFFSTVDTSVRDIQWNVNNVTDPS  153

Query  155  AFNQKTKELLSELAEKAYGVKS-LYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++   EL+S + + A    +  +ATG       +   ++YGLVQCTRDLS
Sbjct  154  RFDKIVDELMSAITDWAVSNSTRRFATGLMVNSTKAPFPEIYGLVQCTRDLS  205



>ref|XP_010466463.1| PREDICTED: putative cysteine-rich repeat secretory protein 21 
[Camelina sativa]
Length=230

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (57%), Gaps = 24/123 (20%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C+SC+  A S +  RCP NKG IIWYD+C+++ S  +   KID  N F M+N R+V S+ 
Sbjct  104  CRSCLTTANSKISRRCPKNKGKIIWYDSCVLEISSINTFDKIDYQNYFDMYNARDVRSDI  163

Query  158  EAFNQKTKELLSELAEK-----------AYGVKSLYAtgetelgggsstEKLYGLVQCTR  12
            E+FN+ T++ L EL EK           A G K+L              +KLY +VQCT+
Sbjct  164  ESFNKNTRDFLQELKEKANKKSKKDFMFAAGEKTLMT------------KKLYAMVQCTK  211

Query  11   DLS  3
            DLS
Sbjct  212  DLS  214



>gb|KHN25768.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=80

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN-P  159
            CK+CV++A   +   CPY+KGAIIWYDNC+ KY + DF G  DN NKFY+W    V+N P
Sbjct  16   CKTCVSEATKEILSLCPYHKGAIIWYDNCIFKYLDTDFFGMTDNTNKFYLWKGNRVNNDP  75

Query  158  EAFN  147
              FN
Sbjct  76   ATFN  79



>ref|XP_006842323.1| hypothetical protein AMTR_s00079p00148810 [Amborella trichopoda]
 gb|ERN03998.1| hypothetical protein AMTR_s00079p00148810 [Amborella trichopoda]
Length=665

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+ C+ DA + +R RCP  K A +WY+ C ++YS E+F  +  NG  +++  V   ++P+
Sbjct  87   CQQCITDATAVIRQRCPNQKVAQVWYELCTLRYSHENFTSQPLNGVVYFVVTVANTTDPD  146

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN     LL EL++KA    S +A         S  + +YGLVQCTRDLS
Sbjct  147  SFNSVLGHLLGELSDKASEGGSRFA---AGSSTVSDFQSVYGLVQCTRDLS  194



>ref|XP_010241766.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Nelumbo 
nucifera]
Length=258

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +R  CP    A IW+D C ++Y  ++F+G++D     + WNV  V++PE
Sbjct  86   CSSCIQDAAKQIRQLCPNQADARIWFDYCFLRYDIQNFIGEVDTAFGIFYWNVENVTDPE  145

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++    L+ ++ E+A   K+            +    LY LVQCTRDLS
Sbjct  146  TFDKDLGALMDQVREQALVPKN--GGLGKGKTKLTPFVTLYALVQCTRDLS  194



>ref|XP_006484824.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Citrus 
sinensis]
Length=254

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +R RC     A IWYD C ++Y+ E+F+GK+D     + +NV  V++P+
Sbjct  84   CASCIQDAAKQIRQRCVNQADARIWYDYCFLRYNTENFVGKVDTSFGIFYYNVENVTDPK  143

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN++   L+ E+  +A   K+            S    LY LVQCTRDLS
Sbjct  144  SFNKELGALMDEIRSQAVVPKN--EGLGKGETTLSPFVTLYALVQCTRDLS  192



>ref|XP_006437221.1| hypothetical protein CICLE_v10032523mg [Citrus clementina]
 gb|ESR50461.1| hypothetical protein CICLE_v10032523mg [Citrus clementina]
Length=254

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +R RC     A IWYD C ++Y+ E+F+GK+D     + +NV  V++P+
Sbjct  84   CASCIQDAAKQIRQRCVNQADARIWYDYCFLRYNTENFVGKVDTSFGIFYYNVENVTDPK  143

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN++   L+ E+  +A   K+            S    LY LVQCTRDLS
Sbjct  144  SFNKELGALMDEIRSQAVVPKN--EGLGKGETTLSPFVTLYALVQCTRDLS  192



>ref|XP_010908261.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Elaeis 
guineensis]
Length=262

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSC+ADA   L   CP    A IW+D C ++Y  +DF G++D+G   + WNV  V+ PE
Sbjct  92   CKSCLADAAERLPTLCPKQADARIWFDYCFLRYDTQDFFGEVDSGFGIFYWNVENVTEPE  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F+ +  +L+  + ++A    S            S    +YGLVQCT DLS
Sbjct  152  RFDAELGKLMDGVRKQAVAPGS--RGLGKGESKFSDFVTIYGLVQCTEDLS  200



>gb|KDO60896.1| hypothetical protein CISIN_1g036866mg [Citrus sinensis]
Length=254

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +R RC     A IWYD C ++Y+ E+F+GK+D     + +NV  V++P+
Sbjct  84   CASCIQDAAKQIRQRCVNQADARIWYDYCFLRYNTENFVGKVDTSFGIFYYNVENVTDPK  143

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN++   L+ E+  +A   K+            S    LY LVQCTRDLS
Sbjct  144  SFNKELGALMDEIRSQAVVPKN--EGLGKGETTLSPFVTLYALVQCTRDLS  192



>ref|XP_009372187.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Pyrus 
x bretschneideri]
Length=266

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP    A IWYD C ++YS++ F+G++D     + +NV  V++PE
Sbjct  93   CSTCIQDAAKQIRQRCPNQADARIWYDYCFLRYSDKSFIGEVDTSYGIFYYNVNNVTDPE  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN++   L  ++  +A   KS            S    LY LVQCTRDL
Sbjct  153  NFNKELGALADKIRAQAVVPKS--GGLGKGQTKLSPFVTLYALVQCTRDL  200



>ref|XP_010056929.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=527

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/111 (40%), Positives = 60/111 (54%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A   + + CP  K AIIWYD CLV+YS   F   +++    YMWNV  V++P 
Sbjct  97   CQSCIDSATRKILENCPEEKEAIIWYDECLVRYSNRSFFTIMESTPALYMWNVNNVTDPN  156

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F Q  +E    + + A   K LYAT +       +   L+ LVQCT DLS
Sbjct  157  RFLQILRETFKNVTDSAISSKRLYATIKFNFSSLVT---LHELVQCTPDLS  204



>ref|XP_006299457.1| hypothetical protein CARUB_v10015622mg [Capsella rubella]
 gb|EOA32355.1| hypothetical protein CARUB_v10015622mg [Capsella rubella]
Length=257

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C++ A S LR RCP NKGAIIWYD CL+K S      KID  N  Y+ N + V + E
Sbjct  100  CPPCISTAVSGLRKRCPRNKGAIIWYDQCLLKISSVGSFNKIDYENDIYLSNPKNVKDRE  159

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtge---telgggsstEKLYGLVQCTRDL  6
             FN++T  LL +LA KA    +L                T+K+Y + QCT+DL
Sbjct  160  MFNKETLALLKKLAYKASDRNNLDGKQLVLYAAGEKRIGTKKVYAMAQCTKDL  212



>ref|NP_188832.1| Receptor protein kinase-related protein [Arabidopsis thaliana]
 dbj|BAB01373.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76568.1| Receptor protein kinase-related protein [Arabidopsis thaliana]
Length=275

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 67/126 (53%), Gaps = 24/126 (19%)
 Frame = -1

Query  320  ADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NPEAFNQ  144
            A A   L  RCP NKG IIWYDNCL++ S  + LGKID    FYM+N ++V+ +   FN+
Sbjct  110  ALASPPLSPRCPKNKGRIIWYDNCLLEISPINSLGKIDYEYNFYMYNEKDVNGDTNLFNK  169

Query  143  KTKELLSELAEKA-------------------YGVKSLYAtgetelgggsstEKLYGLVQ  21
             T+ LL  L EKA                    G+K LYA           T KLYG+VQ
Sbjct  170  NTRALLYRLKEKATSKENNNGKQDLPEIGGKRLGMKMLYA----TGEKSLRTMKLYGMVQ  225

Query  20   CTRDLS  3
            CT+DLS
Sbjct  226  CTKDLS  231



>ref|XP_011089218.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich repeat secretory 
protein 55-like [Sesamum indicum]
Length=260

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 61/111 (55%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C+ DA   +RD C     A IWYD C ++YS   F G +D     Y++NV  V++P+
Sbjct  87   CSVCIQDALENIRDHCANRADARIWYDYCFLRYSTVKFFGHVDTSG-LYLYNVENVTDPD  145

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQK  +L+ +++ +A  VK             SS  +LY LVQCTRDLS
Sbjct  146  VFNQKLGDLMDQISSEA--VKPGSKGLGKGKTDISSFVRLYALVQCTRDLS  194



>ref|NP_567605.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_567606.2| cysteine-rich repeat secretory protein 51 [Arabidopsis thaliana]
 ref|NP_567607.2| cysteine-rich repeat secretory protein 50 [Arabidopsis thaliana]
 ref|NP_567608.2| cysteine-rich repeat secretory protein 49 [Arabidopsis thaliana]
 ref|NP_567609.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_567610.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_567611.2| cysteine-rich repeat secretory protein 46 [Arabidopsis thaliana]
 ref|NP_567612.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_567614.2| cysteine-rich repeat secretory protein 43 [Arabidopsis thaliana]
 gb|AEE84341.1| uncharacterized protein AT4G20550 [Arabidopsis thaliana]
 gb|AEE84342.1| cysteine-rich repeat secretory protein 51 [Arabidopsis thaliana]
 gb|AEE84343.1| cysteine-rich repeat secretory protein 50 [Arabidopsis thaliana]
 gb|AEE84344.1| cysteine-rich repeat secretory protein 49 [Arabidopsis thaliana]
 gb|AEE84345.1| uncharacterized protein AT4G20590 [Arabidopsis thaliana]
 gb|AEE84346.1| uncharacterized protein AT4G20600 [Arabidopsis thaliana]
 gb|AEE84347.1| cysteine-rich repeat secretory protein 46 [Arabidopsis thaliana]
 gb|AEE84348.1| uncharacterized protein AT4G20620 [Arabidopsis thaliana]
 gb|AEE84350.1| cysteine-rich repeat secretory protein 43 [Arabidopsis thaliana]
Length=483

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C++ A S LR RCP NKGAIIWYD CL+K S      KID  N FY+ N   +S+  
Sbjct  99   CPPCISTAVSGLRRRCPRNKGAIIWYDQCLLKISSVASFNKIDYENDFYLSNPNNMSDRG  158

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtge---telgggsstEKLYGLVQCTRDL  6
             FN++T  LL +LA KA    +L                T+K+Y +VQCT+DL
Sbjct  159  LFNKETSALLEKLAYKASDRNNLDGKQLVLYAAGEKRIGTKKVYAMVQCTKDL  211



>gb|KDP25876.1| hypothetical protein JCGZ_22906 [Jatropha curcas]
Length=226

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +CV++A   + D C  +K  IIWYD+C ++YS E F GKID   +F+ +N    SN +
Sbjct  73   CSACVSEASKKILDVCTGSKAGIIWYDHCFLRYSHEYFFGKIDYQEEFFTYNPVFASNTK  132

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
                K KELL+ L+ +A   ++ +A    EL    S+ KLYG+ QCT DLS
Sbjct  133  LLEDKMKELLNGLSVQASQKRTFFA--TGELVYDDSSHKLYGMAQCTIDLS  181



>ref|XP_011037142.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=196

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -1

Query  269  IIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQKTKELLSELAEKAYGVKS  90
              W DNC+VKYS   F G IDN  K YM+N + V +P +FN K K LLS L+ KAY    
Sbjct  61   TFWNDNCMVKYSSTKFFGDIDNQTKLYMYNAQAVDHPTSFNMKVKALLSSLSGKAYADTK  120

Query  89   LYAtgetelgggsstEKLYGLVQCTRDLS  3
             YATGE +LG       L GL QCTRDLS
Sbjct  121  FYATGELDLGASKI---LLGLAQCTRDLS  146



>ref|XP_010932101.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Elaeis 
guineensis]
Length=305

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC++DA       C YNKGA + YD+CL++YS + F   ID   + +MWN   V++  
Sbjct  95   CRSCLSDAIQDAPQLCSYNKGATVEYDDCLLRYSNQRFFSTIDTSMRVFMWNAYNVTDRS  154

Query  155  AFNQKTKELLSELAEKAYGVKS-LYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++   EL+S++ + A    +  +ATG+      +   ++YGLVQCT+DLS
Sbjct  155  RFDKIVDELMSKITDWAVSNSTRRFATGQMVNSTKAPFPEIYGLVQCTQDLS  206



>ref|NP_001154635.1| receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
 gb|AEE76572.1| receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
Length=441

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 63/119 (53%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV----  168
            C+SC+A A S +R +CP NKG IIWYDNC +  S     G+ID  N FYM+N ++V    
Sbjct  104  CRSCLATAFSEIRSKCPNNKGRIIWYDNCHLDLSSIYTYGQIDYKNNFYMYNAKDVRGDK  163

Query  167  ----SNPEAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
                 N +AF  K K   S    K Y    +YA           T KLY +VQCT+DLS
Sbjct  164  KSFYKNMKAFLHKLKAKASSKENKPYVKDYMYA----AGRESLGTVKLYAMVQCTQDLS  218



>sp|Q9LRL2.2|CRR25_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
25; Flags: Precursor [Arabidopsis thaliana]
Length=259

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 67/115 (58%), Gaps = 4/115 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV-SNP  159
            C+SC+A A S +R +CP  KG IIWYDNCL+  S    L +ID  + F M+N ++V S+ 
Sbjct  101  CRSCLATAFSEIRKKCPNYKGRIIWYDNCLLDISSIYTLAEIDYRHIFNMYNAKDVSSDT  160

Query  158  EAFNQKTKELLSELAEKAYGVKSL---YAtgetelgggsstEKLYGLVQCTRDLS  3
             AFN+ T+ LL  L EKA   K L        +        +K+Y +VQCT+DLS
Sbjct  161  MAFNKNTRALLYALKEKAISKKELPYRRDYLYSAGEESLGKKKVYAMVQCTKDLS  215



>gb|AFK33693.1| unknown [Lotus japonicus]
Length=261

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R +CP    A IWYD C ++Y+ + F+G +D     + +NV+ V++PE
Sbjct  90   CSNCIQDAAKQIRQKCPNQVDARIWYDYCFLRYNNKSFIGDVDTSFGIFYFNVKNVTDPE  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++   L+ ++  +A  VK             S    LY LVQCTRDLS
Sbjct  150  GFNKELGSLMGKIRGQA--VKPKAQGLGKGKTNLSPFLTLYALVQCTRDLS  198



>ref|XP_009359012.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Pyrus 
x bretschneideri]
Length=263

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 58/111 (52%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +R RCP    A IWYD C ++YS++ F+G++D     + +NV  V++PE
Sbjct  90   CSSCIQDAAKQIRQRCPNQADARIWYDYCFLRYSDKSFIGEVDTSYGIFYYNVDNVTDPE  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++   L   +  +A  V              S    LY L QCTRDLS
Sbjct  150  KFNEELGALTDNI--RAQAVLPESGGLGKGETKLSPFVTLYALAQCTRDLS  198



>ref|XP_003638011.1| Cysteine-rich receptor-like protein kinase, partial [Medicago 
truncatula]
Length=552

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+ D+   L   CP  K AI WYDNC+++YS     G ++   KFYMWN+  V+  +
Sbjct  97   CRSCLNDSRVLLTKLCPNQKEAIGWYDNCMLRYSNRSIFGVMEGSPKFYMWNIYNVTEVD  156

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEK-LYGLVQCTRDLS  3
             FNQ    L+ +L EKA    S            +   + +YGLVQCT DLS
Sbjct  157  QFNQVLGNLMRKLKEKAASSDSRRKFATDNATDVNLNFQTIYGLVQCTPDLS  208



>ref|XP_010468358.1| PREDICTED: LOW QUALITY PROTEIN: putative cysteine-rich repeat 
secretory protein 16 [Camelina sativa]
Length=268

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC A A + LR RCP NKGAIIWYD C ++ S  D  GKI+  N F M N +++ N +
Sbjct  110  CRSCFATAIAGLRRRCPRNKGAIIWYDQCTLEISSFDTQGKIEKDNDFCMSNAKKM-NVD  168

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            +F +K    L  L  KA   K LY            T+KLYG+VQC  DL
Sbjct  169  SFGEKWLSFLENLVGKANNDKYLYG----AGDTSFGTKKLYGMVQCRSDL  214



>ref|XP_008244704.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Prunus 
mume]
Length=268

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +R RCP    A IWYD C ++Y+ + F+GK+D        NV  V++PE
Sbjct  95   CSSCIQDAAKQIRKRCPDQADARIWYDYCFLRYNNKSFIGKVDTSYGILYGNVDNVTDPE  154

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            +FN++  +L+ ++  +A   K+            S    LY LVQCTRDLS
Sbjct  155  SFNKELGDLVDKIEAQAVVPKN--GGLGKGETKLSPFLTLYALVQCTRDLS  203



>gb|KEH43963.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=671

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+ D+   L   CP  K AI WYDNC+++YS     G ++   KFYMWN+  V+  +
Sbjct  97   CRSCLNDSRVLLTKLCPNQKEAIGWYDNCMLRYSNRSIFGVMEGSPKFYMWNIYNVTEVD  156

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEK-LYGLVQCTRDLS  3
             FNQ    L+ +L EKA    S            +   + +YGLVQCT DLS
Sbjct  157  QFNQVLGNLMRKLKEKAASSDSRRKFATDNATDVNLNFQTIYGLVQCTPDLS  208



>ref|XP_003637963.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=671

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+ D+   L   CP  K AI WYDNC+++YS     G ++   KFYMWN+  V+  +
Sbjct  97   CRSCLNDSRVLLTKLCPNQKEAIGWYDNCMLRYSNRSIFGVMEGSPKFYMWNIYNVTEVD  156

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEK-LYGLVQCTRDLS  3
             FNQ    L+ +L EKA    S            +   + +YGLVQCT DLS
Sbjct  157  QFNQVLGNLMRKLKEKAASSDSRRKFATDNATDVNLNFQTIYGLVQCTPDLS  208



>sp|Q9LRL4.1|CRR24_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
24; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01376.1| unnamed protein product [Arabidopsis thaliana]
Length=262

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 63/119 (53%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV----  168
            C+SC+A A S +R +CP NKG IIWYDNC +  S     G+ID  N FYM+N ++V    
Sbjct  104  CRSCLATAFSEIRSKCPNNKGRIIWYDNCHLDLSSIYTYGQIDYKNNFYMYNAKDVRGDK  163

Query  167  ----SNPEAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
                 N +AF  K K   S    K Y    +YA           T KLY +VQCT+DLS
Sbjct  164  KSFYKNMKAFLHKLKAKASSKENKPYVKDYMYA----AGRESLGTVKLYAMVQCTQDLS  218



>ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28559.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=680

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C+ +A   LR+RCP  K AIIWYD C+++Y+     G ++    FYMWN+  V++ +
Sbjct  93   CLHCINNATPELRNRCPNQKEAIIWYDFCMLRYTNRSIFGIMETEPSFYMWNLNNVTDVD  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            AFNQ    L++ L   A    SL     T     ++ + +Y LVQCT DL+
Sbjct  153  AFNQALSALMNNLRTNASSGTSL-GNFATGSRQVTAFQTIYALVQCTPDLT  202



>ref|NP_188834.4| receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
 gb|AEE76571.1| receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
Length=276

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 63/119 (53%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREV----  168
            C+SC+A A S +R +CP NKG IIWYDNC +  S     G+ID  N FYM+N ++V    
Sbjct  104  CRSCLATAFSEIRSKCPNNKGRIIWYDNCHLDLSSIYTYGQIDYKNNFYMYNAKDVRGDK  163

Query  167  ----SNPEAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
                 N +AF  K K   S    K Y    +YA           T KLY +VQCT+DLS
Sbjct  164  KSFYKNMKAFLHKLKAKASSKENKPYVKDYMYA----AGRESLGTVKLYAMVQCTQDLS  218



>ref|XP_009334264.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Pyrus 
x bretschneideri]
Length=266

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP      IWYD C ++YS++ F+G++D     + +NV  V++PE
Sbjct  93   CSTCIQDAAKQIRQRCPNQADVRIWYDYCFLRYSDKSFIGEVDTSYGIFYYNVNNVTDPE  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN++   L  ++  +A   KS            S    LY LVQCTRDL
Sbjct  153  NFNKELGALADKIRAQAVVPKS--GGLGKGQTKLSPFVTLYALVQCTRDL  200



>gb|AGT15895.1| hypothetical protein SHCRBa_258_I03_R_340 [Saccharum hybrid cultivar 
R570]
Length=587

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 4/110 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C++C+ ++   +  RCP  K A++ Y+ CL++YS+  F G+ D  N  YM ++   + P+
Sbjct  98   CRACLVNSAREMASRCPGRKSAVLIYEGCLLRYSDASFFGEADMSNPLYMCDLDNATQPQ  157

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             F      L+  LAEKAYG   L+A         +  EK+YG+VQCTRDL
Sbjct  158  -FVSSLDALMRSLAEKAYGSPRLFA---ASSVDLADYEKIYGMVQCTRDL  203



>ref|XP_008382567.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Malus 
domestica]
Length=266

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP    A IWYD C ++YS++ F+G++D     + +NV  V++PE
Sbjct  93   CSTCIQDAAKQIRXRCPNQADARIWYDYCFLRYSDKSFIGEVDTSYGIFYYNVNNVTDPE  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             FN++   L  ++  +A   +S            S    LY LVQCTRDL
Sbjct  153  NFNKELGALADKIRAQAVVPES--GGLGKGETKLSPFVTLYALVQCTRDL  200



>ref|XP_010052402.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=664

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNP-  159
            C+SC+ D+   +  RCP  K AIIWYDNC+++YS        D+    YMWN   V+N  
Sbjct  93   CRSCLNDSAPEITRRCPVQKEAIIWYDNCMLRYSNRSIFRTTDDSPSLYMWNRNNVTNNV  152

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            + FNQ  + L+  L E A    S             +   L+GLVQCT DLS
Sbjct  153  DQFNQVLRNLIDSLREGAASGNST-RKFAVGNATTPNFLSLFGLVQCTPDLS  203



>ref|XP_010100808.1| hypothetical protein L484_015838 [Morus notabilis]
 gb|EXB84506.1| hypothetical protein L484_015838 [Morus notabilis]
Length=260

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 62/112 (55%), Gaps = 2/112 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEED-FLGKIDNGNKFYMWNVREVSNP  159
            C  CV DA   +R RCP    A IWYD C ++Y+ +  F+G++D     Y +NV  V++P
Sbjct  87   CSRCVRDAAEQIRKRCPGESDARIWYDYCFLRYNNKSRFIGQVDTSFGIYYFNVESVNDP  146

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            + FN++   L+ ++ ++A   K+ Y          S    LY LVQCTRDLS
Sbjct  147  DTFNEQLGALMDQIKKEAVEAKN-YDGLGKGETRLSPFSTLYALVQCTRDLS  197



>ref|XP_006595455.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine 
max]
Length=163

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -1

Query  320  ADAGSTLRDRCPYNK-GAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPEAFNQ  144
              A   L++RCP  K G I+WYD CL+KYS E F G+ID  NKFY+ N+ +V +P  F  
Sbjct  49   GHATKKLQERCPPKKKGTIVWYDYCLIKYSNEYFFGEIDEKNKFYIVNIYDVDDPATFGD  108

Query  143  KTKELLSELAEKAYGVKSLYA  81
            K  ELLS L+  A  +  LYA
Sbjct  109  KVNELLSGLSYTASQIPMLYA  129



>ref|NP_180720.1| putative cysteine-rich repeat secretory protein 10 [Arabidopsis 
thaliana]
 sp|Q9SIP6.1|CRR10_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD24839.1| receptor kinase, putative [Arabidopsis thaliana]
 gb|AEC08568.1| putative cysteine-rich repeat secretory protein 10 [Arabidopsis 
thaliana]
Length=255

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 67/119 (56%), Gaps = 12/119 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S +  RCP N+G IIWYDNC +  SE     KID  +  Y+ N ++VS N 
Sbjct  97   CRSCLFTAFSGILRRCPNNRGRIIWYDNCFLYISEIYTYEKIDFKHYLYLHNAKDVSGNK  156

Query  158  EAFNQKTKELLSELAEKA-------YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            + FN+ TK LL +L EKA       Y    +YA           T KLYG++QCT+DLS
Sbjct  157  KLFNKNTKALLDKLKEKAIRKEQEPYTRDYMYA----AGEESLGTTKLYGMMQCTQDLS  211



>ref|XP_004290148.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=263

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 58/111 (52%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +R RCP    A IWYD C +KYS + F G++D       +NV+ V++PE
Sbjct  90   CSSCIQDAAKEIRQRCPDQAAATIWYDFCFLKYSNKSFTGEVDTSYGIIFYNVQNVTDPE  149

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F +K   L+ ++  +A   K+L           S    LY   QCTRDL+
Sbjct  150  KFVKKLGALVDDIKAQAVVPKNL--GFGKGETKLSPLSTLYAFGQCTRDLA  198



>ref|XP_010052449.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
 gb|KCW76443.1| hypothetical protein EUGRSUZ_D00833 [Eucalyptus grandis]
Length=671

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 41/112 (37%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNP-  159
            C+SC+ D+ + +  RCP  K AIIWYDNC+++YS        ++   +YMWN+  V+N  
Sbjct  94   CRSCLNDSAAEIAGRCPVQKEAIIWYDNCMLRYSNRSIFRTKEDLPGYYMWNLNNVTNNV  153

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            + FNQ  + L+ +L ++A    S             + + L+GLVQCT DLS
Sbjct  154  DQFNQVLRNLMDDLRDRAANGNST-RKFAVGNATAPNFQTLFGLVQCTPDLS  204



>ref|XP_008804396.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix 
dactylifera]
Length=683

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 65/111 (59%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A   +   CPYNK AI+WYD C+++YS++DFL   +N  + +MWN + V++ +
Sbjct  97   CQSCLNTASKDVLQLCPYNKTAIVWYDPCMLRYSDQDFLSSYNNSRQVFMWNTQNVTDRD  156

Query  155  AFNQKTKELLSELAE-KAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             F++   EL+  +A+  AY     +A    E+        +YGL QCT D+
Sbjct  157  KFDKLLTELIDAVADYAAYNSTRRFA--TGEVNFTKPFPTIYGLAQCTPDM  205



>dbj|BAB01379.1| unnamed protein product [Arabidopsis thaliana]
Length=275

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 64/118 (54%), Gaps = 12/118 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN-P  159
            C SC++ A S LR+RCP N+GA IWYD CL++ S  D  G+I     FYM N   V+N P
Sbjct  105  CHSCLSTAVSGLRERCPGNRGATIWYDQCLLEISSVDSEGRIHYKRMFYMQNPTNVTNDP  164

Query  158  EAFNQKTKELLSELA------EKAYGVKS-LYAtgetelgggsstEKLYGLVQCTRDL  6
            + F  K ++LL +L        K  G K  LYA             K+Y +VQCT+DL
Sbjct  165  KRFEDKRRDLLHKLMLEATKDSKENGAKGLLYA----VGEMRIGRNKMYAMVQCTQDL  218



>ref|XP_004492208.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Cicer 
arietinum]
Length=257

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 58/111 (52%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP    A IWYD C ++YS + F+  +D     + +NV  V++PE
Sbjct  87   CSNCIQDATRQIRQRCPNQADARIWYDYCFLRYSNKSFIADVDTSFGIFYFNVENVTDPE  146

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+K   L+ ++  +A   K             S    LY LVQCTRDLS
Sbjct  147  DFNKKLGALMDQIRGEAVMHKE--KGIGKGKSMLSPFVTLYALVQCTRDLS  195



>ref|XP_007025964.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28586.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=700

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C  C+ +A + LR+ C   K AIIWY+NCL++Y+     G  +    FYMWNV  V++ +
Sbjct  93   CLDCINNAATDLRNLCSNEKEAIIWYENCLLRYTNRSIFGVAETNPSFYMWNVNNVTDLD  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            AFNQ    L+  L+  A    SL     T     ++ + +Y LVQCT DL+
Sbjct  153  AFNQALIALMDNLSTNASSGTSL-RKFATGSAEVTAAQTIYALVQCTPDLT  202



>gb|KDP20813.1| hypothetical protein JCGZ_21284 [Jatropha curcas]
Length=315

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+ ++   L+  CP  K AI WYDNC+++YS     G ++    F MWNV  VS   
Sbjct  93   CRSCIGNSSLALKQLCPNQKEAITWYDNCMLRYSNRSLFGSMEINPSFVMWNVNNVSQVT  152

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN+  K LL  L  +     SL     T     +S + +Y L QCT DLS
Sbjct  153  QFNRVLKTLLDSLVTQVASGDSLR-KFATGNARTTSNQTIYALAQCTPDLS  202



>ref|NP_188835.1| cysteine-rich repeat secretory protein 26 [Arabidopsis thaliana]
 sp|Q9LRL1.2|CRR26_ARATH RecName: Full=Cysteine-rich repeat secretory protein 26; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE76573.1| cysteine-rich repeat secretory protein 26 [Arabidopsis thaliana]
Length=264

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 64/118 (54%), Gaps = 12/118 (10%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN-P  159
            C SC++ A S LR+RCP N+GA IWYD CL++ S  D  G+I     FYM N   V+N P
Sbjct  105  CHSCLSTAVSGLRERCPGNRGATIWYDQCLLEISSVDSEGRIHYKRMFYMQNPTNVTNDP  164

Query  158  EAFNQKTKELLSELA------EKAYGVKS-LYAtgetelgggsstEKLYGLVQCTRDL  6
            + F  K ++LL +L        K  G K  LYA             K+Y +VQCT+DL
Sbjct  165  KRFEDKRRDLLHKLMLEATKDSKENGAKGLLYA----VGEMRIGRNKMYAMVQCTQDL  218



>ref|XP_007140710.1| hypothetical protein PHAVU_008G135300g [Phaseolus vulgaris]
 gb|ESW12704.1| hypothetical protein PHAVU_008G135300g [Phaseolus vulgaris]
Length=257

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ DA   +  RCP    A IWYD C ++++ + F G++D     + +NV  V++PE
Sbjct  87   CSSCIQDATKQILQRCPNQADARIWYDYCFLRFNNKSFFGEVDTSFGIFYFNVENVTDPE  146

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            AFN++   L++ +  +A  V              S    LY LVQCTRDLS
Sbjct  147  AFNEELGALMNHI--RAQAVVPKEEGLGKGKSVLSPFVTLYALVQCTRDLS  195



>ref|XP_006828415.1| hypothetical protein AMTR_s00060p00079250 [Amborella trichopoda]
 gb|ERM95831.1| hypothetical protein AMTR_s00060p00079250 [Amborella trichopoda]
Length=262

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 62/110 (56%), Gaps = 2/110 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC +DA   +R  CP    A IW+D+C ++Y+ +DF+G++D     + WNV  V+ PE
Sbjct  87   CSSCTSDAAKHVRHLCPDEADARIWFDSCFLRYNTDDFIGELDTRYGIFYWNVENVTEPE  146

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
             F ++  +L++ +  KA  V+       +     +    +YGLVQCT+DL
Sbjct  147  RFAKELGDLMNNVKAKA--VQPGNKGFGSGKIKFTQFVTIYGLVQCTQDL  194



>ref|XP_008363779.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=678

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CK CVA+A +  R RCP  K  +IWYD+C+++YS E F   + +   FYM N    ++P 
Sbjct  103  CKICVANATALARQRCPVEKQVVIWYDDCMLRYSNESFFSTVTDSPSFYMRNTVNATDPI  162

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ     +++ A +A G    +    T     +    +Y L QCT+DLS
Sbjct  163  QFNQVVAASVNQAAREAVGDADKFG---TNRANVNGLISVYSLAQCTQDLS  210



>ref|XP_002269937.2| PREDICTED: cysteine-rich repeat secretory protein 55 [Vitis vinifera]
Length=255

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP    A I +D C ++YS++DF+GK+D G   ++ +  +V+  E
Sbjct  88   CSTCIQDAAKQIRTRCPNKADARILFDYCFLRYSDKDFIGKVDTGFGIFLRHGAKVTETE  147

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++  +L+ ++  +A  V+   A         +    LY LVQCTRDLS
Sbjct  148  RFNEELGKLMEKIRSQA--VEPQNAGLGKGQTKLTPFVTLYALVQCTRDLS  196



>ref|XP_010267898.1| PREDICTED: uncharacterized protein LOC104605002 [Nelumbo nucifera]
Length=1359

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 58/111 (52%), Gaps = 3/111 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+ CV  A  T+  RCP  K AI WYD CL++YS + F   +D    F M+N +  S+P 
Sbjct  103  CRECVKSAAQTITQRCPNGKVAITWYDECLLRYSNQSFFSIMDETPSFSMYNTQNNSDPR  162

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ   + L ELA       S YA   T     +S + LY L QCT DLS
Sbjct  163  QFNQLVGDKLGELATTVASSASKYA---TLEANYTSFQSLYCLAQCTPDLS  210


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+ C+  A   +  RCP  + A IWYD C+++YS +     I+    F   N  +V NP 
Sbjct  794  CRECIETASREIIRRCPNGRVAYIWYDECMLRYSNQLIFSTINEVPGFSFPNSSDVPNPG  853

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++  ++++  L  +     SL     TE+   +S++ LY L QCT DLS
Sbjct  854  EFSKLLRQVVDRLRNRVAFDPSL-GKFSTEVDNFTSSQTLYSLAQCTPDLS  903



>ref|XP_008776432.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Phoenix 
dactylifera]
Length=282

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 66/112 (59%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC++DA       CPYN+GAI++YD+CL++YS   F   +D   +    NV  +++P 
Sbjct  94   CRSCLSDAIQDAPQLCPYNQGAIVYYDDCLLRYSNLRFFSTVDTSVRDIQANVDNMTDPS  153

Query  155  AFNQKTKELLSELAEKAYGVKS-LYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++   EL+S + + A    +  +ATG       +   ++YG+VQCT+DLS
Sbjct  154  RFDKIVDELMSAITDWAVSNSTRRFATGLMVNSTKAPFPEIYGMVQCTQDLS  205



>ref|XP_006299656.1| hypothetical protein CARUB_v10015844mg [Capsella rubella]
 gb|EOA32554.1| hypothetical protein CARUB_v10015844mg [Capsella rubella]
Length=260

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 4/115 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NP  159
            C+SC+  A S +  RCP N+G IIWYDNC++        G+ID  N FY+ N ++VS + 
Sbjct  99   CRSCLDTAFSGISRRCPKNRGKIIWYDNCVLTILTSRTYGEIDYQNNFYISNSKDVSGDT  158

Query  158  EAFNQKTKELLSELAEKAYG---VKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            ++FN+K + LL  L +KA     V +                KLYG++QCT+DLS
Sbjct  159  KSFNEKRRALLYTLKDKASSKENVPNTKNYLYATGEESFGKMKLYGMMQCTQDLS  213



>ref|XP_010910126.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=683

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/112 (37%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+  A     + CPY K AI WYD+CL+ YS + F   ID  ++ +M+N   +++P 
Sbjct  98   CRSCLDIATQNAPNLCPYAKSAIFWYDDCLLHYSNQRFFSTIDTSDEIWMYNTNNITDPS  157

Query  155  AFNQKTKELLSELAE-KAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F+     L++ + +  A     ++ATGE      S    +YGL QCTRDLS
Sbjct  158  QFDNLVGVLMNRIVDWAASNSTKMFATGEMLNSTNSPLPTIYGLAQCTRDLS  209



>ref|XP_003551283.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Glycine 
max]
 gb|KHN31799.1| Cysteine-rich repeat secretory protein 55 [Glycine soja]
Length=257

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 57/111 (51%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP      IWYD C ++YS + F G++D     + +NV  V++PE
Sbjct  87   CSNCIQDATKQIRQRCPNQVDGRIWYDYCFLRYSNKSFFGEVDTSFGIFYFNVENVTDPE  146

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++   L+  +  +A  V              S    LY LVQCTRDLS
Sbjct  147  DFNKELGALMDHI--RAQAVVPREEGLGKGKSVLSPFVTLYALVQCTRDLS  195



>ref|XP_006406032.1| hypothetical protein EUTSA_v10021994mg [Eutrema salsugineum]
 gb|ESQ47485.1| hypothetical protein EUTSA_v10021994mg [Eutrema salsugineum]
Length=233

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = -1

Query  302  LRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS-NPEAFNQKTKELL  126
            LR RCP NKGAIIWYD CL++ S     GK+D  +KFY+ N  +VS NP +FN++T   L
Sbjct  86   LRRRCPGNKGAIIWYDQCLLRISTIHGYGKVDYDHKFYLSNPNKVSGNPLSFNKETSAFL  145

Query  125  SELAEKAYGVK---SLYAtgetelgggsstEKLYGLVQCTRDLS  3
             +L  KA   K   +L             T+ LY +VQCT+DL+
Sbjct  146  EKLTYKASDTKNVDNLSMVLYAAGEKKLGTKNLYAMVQCTKDLA  189



>ref|XP_008788477.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Phoenix 
dactylifera]
Length=262

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 58/111 (52%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            CKSC+ADA   L   CP    A IW+D C ++Y  +DF G++D G   + WNV  V+ PE
Sbjct  92   CKSCLADAAERLPKLCPKQADARIWFDYCFLRYDTKDFFGELDTGFGIFYWNVENVTEPE  151

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F+ +  +L+  + ++A    S            S    +Y LVQCT DLS
Sbjct  152  RFDAELGKLMDGVRKQAVAPGS--RGLGKGESQFSDFVTIYALVQCTDDLS  200



>ref|XP_004166549.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Cucumis sativus]
Length=1251

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC  D+   L  RCP  K A+IWY NC+ +YS     G + +   F++WN+ +  + +
Sbjct  709  CRSCFGDSVLELPTRCPNEKEAVIWYPNCMFRYSNRWIFGVVQDAPSFWIWNIEDAQDLQ  768

Query  155  AFNQKTKELLSELAEK-AYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++  + LL+++AE+ A G   L                +YGLVQCT D+S
Sbjct  769  GFSKAVQGLLTQVAEEAALGDSKLKFAAGNVSIENEDYSSVYGLVQCTPDIS  820


 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 3/112 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ ++ + L   CP +  AI WYD C+++YS       ++    F  WN    S+P 
Sbjct  89   CTTCLNNSRTLLPLLCPNHTEAIGWYDECMLRYSNRSIFASMETSPAFRAWNPNNASDPH  148

Query  155  AFNQKTKELLSELA-EKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F Q    LL +L  E A+G   L     T +    S   +YG VQCT DLS
Sbjct  149  RFFQFATTLLQQLTQEAAFGDSRL--KFATGVTSIPSFPTIYGAVQCTPDLS  198



>ref|XP_004145167.1| PREDICTED: cysteine-rich receptor-like protein kinase 8-like, 
partial [Cucumis sativus]
Length=1041

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC  D+   L  RCP  K A+IWY NC+ +YS     G + +   F++WN+ +  + +
Sbjct  76   CRSCFGDSVLELPTRCPNEKEAVIWYPNCMFRYSNRWIFGVVQDAPSFWIWNIEDAQDLQ  135

Query  155  AFNQKTKELLSELAEK-AYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++  + LL+++AE+ A G   L                +YGLVQCT D+S
Sbjct  136  GFSKAVQGLLTQVAEEAALGDSKLKFAAGNVSIENEDYSSVYGLVQCTPDIS  187



>ref|XP_004153194.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Cucumis sativus]
Length=1274

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC  D+   L  RCP  K A+IWY NC+ +YS     G + +   F++WN+ +  + +
Sbjct  709  CRSCFGDSVLELPTRCPNEKEAVIWYPNCMFRYSNRWIFGVVQDAPSFWIWNIEDAQDLQ  768

Query  155  AFNQKTKELLSELAEK-AYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++  + LL+++AE+ A G   L                +YGLVQCT D+S
Sbjct  769  GFSKAVQGLLTQVAEEAALGDSKLKFAAGNVSIENEDYSSVYGLVQCTPDIS  820


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 3/112 (3%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ ++ + L   CP +  AI WYD C+++YS       ++    F  WN    S+P 
Sbjct  89   CTTCLNNSRTLLPLLCPNHTEAIGWYDECMLRYSNRSIFASMETSPAFRAWNPNNASDPH  148

Query  155  AFNQKTKELLSELA-EKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F Q    LL +L  E A+G   L     T +    S   +YG VQCT DLS
Sbjct  149  RFFQFATTLLQQLTQEAAFGDSRL--KFATGVTSIPSFPTIYGAVQCTPDLS  198



>ref|XP_010513156.1| PREDICTED: putative cysteine-rich repeat secretory protein 10 
[Camelina sativa]
Length=268

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 66/120 (55%), Gaps = 13/120 (11%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS--N  162
            C+SC+  A S +  +CP NKG IIWYDNC +  S      KID  +  Y+ N ++VS  N
Sbjct  109  CRSCLVTAFSGILRKCPNNKGRIIWYDNCFLYISTVYTYQKIDYKHYLYLHNAKDVSGGN  168

Query  161  PEAFNQKTKELLSELAEKA-------YGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             + FN+ T+ LL +L EKA       Y    LYA           T KLYG++QCT+DLS
Sbjct  169  TKLFNKNTRALLYKLKEKAIRKEQKPYTRDYLYA----TAEESLGTMKLYGMMQCTQDLS  224



>ref|XP_010679273.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=238

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 66/112 (59%), Gaps = 4/112 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+++AG   R  CP NKGA+IWYD+C+ KY +++F G+ID      + NV  V+N +
Sbjct  85   CLSCISEAGIQARKLCPGNKGAVIWYDHCMFKYLDQNFFGQIDQSVAVSLLNVNNVTNNQ  144

Query  155  A-FNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              F QK  ELL +L+E+A      YA   +          +YGL QCTRDLS
Sbjct  145  MLFIQKNSELLGKLSEEASVDTKRYA---SGEIIVDGNTTIYGLAQCTRDLS  193



>ref|XP_002883335.1| hypothetical protein ARALYDRAFT_479716 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59594.1| hypothetical protein ARALYDRAFT_479716 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 62/114 (54%), Gaps = 4/114 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN-P  159
            C SC+  A S LR+RCP N+GA IWYD CL++ S  D  G+I   + FYM N + V+N P
Sbjct  105  CHSCLRTAVSGLRERCPGNRGATIWYDQCLLEISSVDSEGRIHYKSMFYMQNPKNVTNDP  164

Query  158  EAFNQKTKELLSEL---AEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            + F  K ++LL +L   A K     +                K+Y +VQCT+DL
Sbjct  165  KRFEDKRRDLLHKLMLEATKDSKENAAKGLLYAVGEMRIGRNKMYAVVQCTQDL  218



>ref|XP_010646639.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Vitis vinifera]
Length=681

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 56/111 (50%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SCV D+   L   CP  K AI WYD C+++YS     G       FYMWN    SN E
Sbjct  102  CRSCVNDSRIQLTQLCPNQKEAIGWYDKCMLRYSNNSIFGTAQTSLSFYMWNPENASNVE  161

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ    L++ L  KA    S +    T     +S   +YGL+QCT DLS
Sbjct  162  DFNQVLGNLMASLRSKAASGDSRH-KFATGEANVTSFVTIYGLMQCTPDLS  211



>ref|XP_008224860.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=679

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 62/115 (54%), Gaps = 7/115 (6%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVRE----V  168
            CKSCV+ A S +  RCP  K  +IWYD+C+++YS E F   +      +MWN R+    V
Sbjct  110  CKSCVSTATSDVFQRCPTEKQVVIWYDDCMLRYSNESFFSTMAESPSLFMWNTRKVIGNV  169

Query  167  SNPEAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            S+   FNQ     +SE+A +A      +A   T+    S    LY L QCT+DLS
Sbjct  170  SDQNRFNQVLATGVSEIAAEASNKDRKFA---TKEAKVSEFTSLYMLGQCTQDLS  221



>ref|XP_002533056.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF29326.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus 
communis]
Length=281

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSN--  162
            C SC+ DA + +R RCP    A IWYD C ++Y+ E+F+GK+D     + +NV  V++  
Sbjct  106  CSSCLKDAVNEIRQRCPDQADARIWYDFCFLRYNTEEFIGKLDTSFAIFYYNVENVTDPR  165

Query  161  PEAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            PE FN+K   L+  +  +A   K+       +    S    LY LVQCTRDL+
Sbjct  166  PEDFNKKLGALMDNIRSEAVVPKN--QGLGKDETKLSPFSTLYALVQCTRDLA  216



>ref|XP_003635322.2| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=1243

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+ D+   L   CP  K AI WYD C+++YS +   GK      F MWN++ VSN E
Sbjct  94   CRSCINDSRIQLTRLCPNQKEAIGWYDGCMLRYSNDSIFGKAQTSPSFTMWNLQNVSNVE  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ    L++ L  KA           TE    +S + +YGL+QCT DLS
Sbjct  154  DFNQVLGNLMASLRSKA-ASGDWRRKFATEEANVTSFQSIYGLMQCTPDLS  203


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/111 (38%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C SC+ D+   L  RCPY   AI  YD C+++YS       ++    FY+ N   VSN +
Sbjct  777  CHSCLNDSRLQLPQRCPYQNEAIGGYDECMLRYSNRSIFRTLEILPSFYVPNPNNVSNED  836

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ  K LL  L  KA    SL     T    G+  +++YG +QCT DL+
Sbjct  837  VFNQALKTLLDSLRSKAASGNSLL-KFATGEATGTGDKRIYGFMQCTPDLN  886



>gb|KDP45259.1| hypothetical protein JCGZ_15124 [Jatropha curcas]
Length=258

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVS--N  162
            C  C+ DA   +  RCP    A IWYD C ++YS +DF+GK+D     +  NV  V+  +
Sbjct  85   CSGCLLDAAKEIGQRCPNQVDARIWYDYCFLRYSNKDFIGKLDTSYALFYINVENVTVID  144

Query  161  PEAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
            PEAFN+K   L+ E+  +A   KS            +    LY L QCTRDL+
Sbjct  145  PEAFNRKLGNLIDEIRSEAVMEKS--KGIGKGETKLTPLVTLYALAQCTRDLA  195



>emb|CBI38478.3| unnamed protein product [Vitis vinifera]
Length=519

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+ D+   L   CP  K AI WYD C+++YS +   GK      F MWN++ VSN E
Sbjct  94   CRSCINDSRIQLTRLCPNQKEAIGWYDGCMLRYSNDSIFGKAQTSPTFTMWNLQNVSNVE  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ    L++ L  KA           TE    +S + +YGL+QCT DLS
Sbjct  154  DFNQVLGNLMASLRSKA-ASGDWRRKFATEEANVTSFQSIYGLMQCTPDLS  203



>ref|XP_003635466.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=675

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC+ D+   L   CP  K AI WYD C+++YS +   GK      F MWN++ VSN E
Sbjct  94   CRSCINDSRIQLTRLCPNQKEAIGWYDGCMLRYSNDSIFGKAQTSPTFTMWNLQNVSNVE  153

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FNQ    L++ L  KA           TE    +S + +YGL+QCT DLS
Sbjct  154  DFNQVLGNLMASLRSKA-ASGDWRRKFATEEANVTSFQSIYGLMQCTPDLS  203



>gb|KGN64567.1| hypothetical protein Csa_1G065380 [Cucumis sativus]
Length=553

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SC  D+   L  RCP  K A+IWY NC+ +YS     G + +   F++WN+ +  + +
Sbjct  92   CRSCFGDSVLELPTRCPNEKEAVIWYPNCMFRYSNRWIFGVVQDAPSFWIWNIEDAQDLQ  151

Query  155  AFNQKTKELLSELAEK-AYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             F++  + LL+++AE+ A G   L                +YGLVQCT D+S
Sbjct  152  GFSKAVQGLLTQVAEEAALGDSKLKFAAGNVSIENEDYSSVYGLVQCTPDIS  203



>ref|XP_004295243.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Fragaria vesca subsp. vesca]
Length=367

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  335  CKSCVAD-AGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNP  159
            C+ CVA  A   ++  CP  K AIIWYD C+++Y+ + FL ++D   +  MWN+  +S+P
Sbjct  96   CQECVATIAKDGVQTFCPLGKIAIIWYDECMLRYTNQSFLNRMDEAPRVSMWNIGNISDP  155

Query  158  EAFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
              F Q   E ++ L   A    S       +    +  ++LY LVQCT DLS
Sbjct  156  TRFTQLLAETINGLVAPASNAPSGAKKYAKKEENFTDFQQLYSLVQCTPDLS  207



>emb|CBI18745.3| unnamed protein product [Vitis vinifera]
Length=385

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+ DA   +R RCP    A I +D C ++YS++DF+GK+D G   ++ +  +V+  E
Sbjct  88   CSTCIQDAAKQIRTRCPNKADARILFDYCFLRYSDKDFIGKVDTGFGIFLRHGAKVTETE  147

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDLS  3
             FN++  +L+ ++  +A  V+   A         +    LY LVQCTRDLS
Sbjct  148  RFNEELGKLMEKIRSQA--VEPQNAGLGKGQTKLTPFVTLYALVQCTRDLS  196



>gb|KCW44163.1| hypothetical protein EUGRSUZ_L02419, partial [Eucalyptus grandis]
Length=255

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 2/110 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SCV  A   LR+RCP ++ AIIWYD C+++YS  DF G +    + +MWNV   ++P+
Sbjct  84   CQSCVEIAAQALRNRCPSSQEAIIWYDMCMLRYSNTDFFGVMATSPRVFMWNVENNTSPD  143

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
              +     L+  L         +Y     E  GG  +++ YGLVQC+RD+
Sbjct  144  DPDINALALIYNLVADVPYTALMYG--VRESNGGDGSQQRYGLVQCSRDI  191



>ref|XP_010041695.1| PREDICTED: cysteine-rich receptor-like protein kinase 25, partial 
[Eucalyptus grandis]
Length=262

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 2/110 (2%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C+SCV  A   LR+RCP ++ AIIWYD C+++YS  DF G +    + +MWNV   ++P+
Sbjct  91   CQSCVEIAAQALRNRCPSSQEAIIWYDMCMLRYSNTDFFGVMATSPRVFMWNVENNTSPD  150

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
              +     L+  L         +Y     E  GG  +++ YGLVQC+RD+
Sbjct  151  DPDINALALIYNLVADVPYTALMYG--VRESNGGDGSQQRYGLVQCSRDI  198



>gb|KHG01974.1| Cysteine-rich receptor-like protein kinase 26 [Gossypium arboreum]
Length=559

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 1/110 (1%)
 Frame = -1

Query  335  CKSCVADAGSTLRDRCPYNKGAIIWYDNCLVKYSEEDFLGKIDNGNKFYMWNVREVSNPE  156
            C +C+  A + LRDRCP  + AIIWYD C+ +Y+    LG ++    FYMWN   V N  
Sbjct  97   CFNCINSANAELRDRCPNQREAIIWYDYCMFRYTNHSILGNMEINPIFYMWNENNVRNVA  156

Query  155  AFNQKTKELLSELAEKAYGVKSLYAtgetelgggsstEKLYGLVQCTRDL  6
            AF+Q    LL+ L   A    SL     T       ++ +Y L+QCT D+
Sbjct  157  AFSQALGSLLNNLTNTASSGTSL-GKFATGNTRVGPSQTIYALLQCTPDV  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517432785088