BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6563_g1_i1 len=317 path=[295:0-316]

Length=317
                                                                      Score     E

ref|XP_009591406.1|  PREDICTED: cysteine-rich repeat secretory pr...  95.1    2e-21   
ref|XP_009793791.1|  PREDICTED: cysteine-rich repeat secretory pr...  95.1    3e-21   
ref|XP_009605992.1|  PREDICTED: cysteine-rich repeat secretory pr...  94.7    3e-21   
gb|ACU16205.1|  unknown                                               92.0    4e-20   Glycine max [soybeans]
ref|XP_006351952.1|  PREDICTED: cysteine-rich repeat secretory pr...  91.3    5e-20   
gb|KHN36561.1|  Cysteine-rich repeat secretory protein 38             90.9    8e-20   
ref|XP_003543377.1|  PREDICTED: cysteine-rich repeat secretory pr...  90.9    8e-20   
ref|XP_009787631.1|  PREDICTED: cysteine-rich repeat secretory pr...  90.5    1e-19   
ref|XP_006352035.1|  PREDICTED: cysteine-rich repeat secretory pr...  90.1    2e-19   
gb|AES67291.2|  cysteine-rich RLK (receptor-like kinase) protein      89.4    3e-19   
gb|AFK43074.1|  unknown                                               89.4    3e-19   
ref|XP_007149948.1|  hypothetical protein PHAVU_005G112800g           88.6    7e-19   
ref|XP_003597040.1|  Cysteine-rich repeat secretory protein           89.0    7e-19   
gb|KDP25874.1|  hypothetical protein JCGZ_22904                       87.4    1e-18   
ref|XP_007024474.1|  Receptor-like protein kinase-related family ...  87.4    1e-18   
ref|XP_010051179.1|  PREDICTED: cysteine-rich repeat secretory pr...  85.5    8e-18   
gb|EYU43107.1|  hypothetical protein MIMGU_mgv1a022379mg              85.1    1e-17   
ref|XP_003597035.1|  Cysteine-rich repeat secretory protein           85.1    1e-17   
ref|XP_006351953.1|  PREDICTED: cysteine-rich repeat secretory pr...  84.0    2e-17   
ref|XP_004251507.1|  PREDICTED: cysteine-rich repeat secretory pr...  83.6    4e-17   
gb|AFK48353.1|  unknown                                               83.2    5e-17   
ref|XP_002515716.1|  DUF26 domain-containing protein 2 precursor,...  82.4    8e-17   Ricinus communis
ref|XP_010051171.1|  PREDICTED: cysteine-rich repeat secretory pr...  82.0    1e-16   
ref|XP_006447470.1|  hypothetical protein CICLE_v10017568mg           82.0    1e-16   
ref|XP_006469729.1|  PREDICTED: cysteine-rich repeat secretory pr...  81.6    2e-16   
gb|KHN36560.1|  Cysteine-rich repeat secretory protein 38             80.9    3e-16   
ref|XP_003541936.1|  PREDICTED: cysteine-rich repeat secretory pr...  80.5    4e-16   
ref|XP_002309843.2|  hypothetical protein POPTR_0007s02720g           79.3    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011003220.1|  PREDICTED: cysteine-rich repeat secretory pr...  78.6    3e-15   
ref|XP_004487372.1|  PREDICTED: cysteine-rich repeat secretory pr...  78.2    3e-15   
ref|XP_011079182.1|  PREDICTED: cysteine-rich repeat secretory pr...  78.2    3e-15   
ref|XP_010069655.1|  PREDICTED: cysteine-rich repeat secretory pr...  76.6    1e-14   
ref|XP_006372985.1|  hypothetical protein POPTR_0017s06790g           75.9    2e-14   
ref|XP_006372978.1|  hypothetical protein POPTR_0017s06720g           75.9    2e-14   
ref|XP_006372979.1|  hypothetical protein POPTR_0017s06730g           75.5    2e-14   
ref|XP_006387991.1|  receptor-like protein kinase                     75.1    3e-14   
ref|XP_010051188.1|  PREDICTED: cysteine-rich repeat secretory pr...  75.1    4e-14   
ref|XP_006380319.1|  hypothetical protein POPTR_0007s02730g           75.1    4e-14   
ref|XP_010051151.1|  PREDICTED: cysteine-rich repeat secretory pr...  74.7    4e-14   
ref|XP_010247023.1|  PREDICTED: cysteine-rich repeat secretory pr...  74.7    5e-14   
gb|EYU43106.1|  hypothetical protein MIMGU_mgv1a021349mg              74.3    7e-14   
ref|XP_010051161.1|  PREDICTED: cysteine-rich repeat secretory pr...  73.9    1e-13   
ref|XP_006387993.1|  hypothetical protein POPTR_0421s00220g           73.6    1e-13   
emb|CAN73039.1|  hypothetical protein VITISV_044349                   73.2    2e-13   Vitis vinifera
ref|XP_002274604.1|  PREDICTED: cysteine-rich repeat secretory pr...  73.2    2e-13   Vitis vinifera
gb|EYU43108.1|  hypothetical protein MIMGU_mgv1a018557mg              72.8    2e-13   
emb|CAN73037.1|  hypothetical protein VITISV_044347                   73.6    3e-13   Vitis vinifera
ref|XP_010247024.1|  PREDICTED: cysteine-rich repeat secretory pr...  70.5    2e-12   
ref|XP_002274668.1|  PREDICTED: cysteine-rich repeat secretory pr...  69.7    3e-12   Vitis vinifera
emb|CBI28973.3|  unnamed protein product                              68.6    1e-11   
ref|XP_010684085.1|  PREDICTED: cysteine-rich repeat secretory pr...  68.2    1e-11   
emb|CAN73038.1|  hypothetical protein VITISV_044348                   68.2    1e-11   Vitis vinifera
ref|XP_002274745.2|  PREDICTED: cysteine-rich repeat secretory pr...  68.2    1e-11   Vitis vinifera
ref|XP_010109547.1|  hypothetical protein L484_018282                 67.0    3e-11   
ref|XP_008228882.1|  PREDICTED: cysteine-rich repeat secretory pr...  66.2    6e-11   
ref|XP_006469774.1|  PREDICTED: cysteine-rich repeat secretory pr...  65.9    7e-11   
ref|XP_010069666.1|  PREDICTED: cysteine-rich repeat secretory pr...  65.9    7e-11   
gb|KDO59870.1|  hypothetical protein CISIN_1g046481mg                 65.9    7e-11   
ref|XP_010532487.1|  PREDICTED: cysteine-rich repeat secretory pr...  65.1    2e-10   
ref|XP_008236988.1|  PREDICTED: cysteine-rich repeat secretory pr...  63.9    3e-10   
ref|XP_008342465.1|  PREDICTED: cysteine-rich repeat secretory pr...  63.9    4e-10   
ref|XP_008237025.1|  PREDICTED: cysteine-rich repeat secretory pr...  62.4    1e-09   
ref|XP_008228908.1|  PREDICTED: cysteine-rich repeat secretory pr...  61.6    2e-09   
ref|XP_006373161.1|  hypothetical protein POPTR_0017s09240g           62.0    5e-09   
ref|XP_007201324.1|  hypothetical protein PRUPE_ppa009992mg           60.5    1e-08   
ref|XP_008391617.1|  PREDICTED: cysteine-rich repeat secretory pr...  59.3    2e-08   
ref|XP_008788477.1|  PREDICTED: cysteine-rich repeat secretory pr...  59.7    2e-08   
ref|XP_008800494.1|  PREDICTED: putative receptor-like protein ki...  61.2    2e-08   
ref|XP_006447471.1|  hypothetical protein CICLE_v10018332mg           58.5    3e-08   
ref|XP_003633310.1|  PREDICTED: cysteine-rich repeat secretory pr...  58.5    3e-08   
ref|XP_011037144.1|  PREDICTED: cysteine-rich repeat secretory pr...  58.5    3e-08   
gb|KDP32106.1|  hypothetical protein JCGZ_12567                       58.2    4e-08   
ref|XP_006372982.1|  hypothetical protein POPTR_0017s06760g           58.2    4e-08   
ref|XP_004295244.1|  PREDICTED: uncharacterized protein LOC101314549  60.1    6e-08   
ref|XP_010908261.1|  PREDICTED: cysteine-rich repeat secretory pr...  57.8    8e-08   
ref|XP_008237024.1|  PREDICTED: cysteine-rich repeat secretory pr...  57.4    8e-08   
ref|XP_009412444.1|  PREDICTED: putative receptor-like protein ki...  58.9    1e-07   
ref|XP_008455405.1|  PREDICTED: cysteine-rich repeat secretory pr...  57.0    1e-07   
ref|XP_009412446.1|  PREDICTED: putative receptor-like protein ki...  58.5    2e-07   
ref|XP_011037143.1|  PREDICTED: cysteine-rich repeat secretory pr...  56.6    2e-07   
gb|KDP20813.1|  hypothetical protein JCGZ_21284                       57.4    2e-07   
gb|KDP20811.1|  hypothetical protein JCGZ_21282                       58.5    2e-07   
ref|XP_002533571.1|  DUF26 domain-containing protein 2 precursor,...  56.2    2e-07   Ricinus communis
gb|AFK33693.1|  unknown                                               56.6    2e-07   
ref|XP_006373141.1|  hypothetical protein POPTR_0017s09090g           55.5    3e-07   
ref|XP_010931306.1|  PREDICTED: putative receptor-like protein ki...  57.4    4e-07   
ref|XP_007140710.1|  hypothetical protein PHAVU_008G135300g           55.8    4e-07   
ref|XP_008804396.1|  PREDICTED: putative receptor-like protein ki...  57.0    5e-07   
ref|XP_011010156.1|  PREDICTED: cysteine-rich repeat secretory pr...  56.2    5e-07   
ref|XP_011010157.1|  PREDICTED: cysteine-rich repeat secretory pr...  56.2    5e-07   
ref|XP_002518550.1|  Serine/threonine-protein kinase PBS1, putative   56.6    6e-07   Ricinus communis
ref|XP_006372983.1|  hypothetical protein POPTR_0017s06770g           55.1    6e-07   
ref|XP_008455404.1|  PREDICTED: cysteine-rich repeat secretory pr...  55.1    7e-07   
ref|XP_007149947.1|  hypothetical protein PHAVU_005G112700g           55.1    7e-07   
ref|XP_004144581.1|  PREDICTED: cysteine-rich repeat secretory pr...  55.1    8e-07   
ref|XP_004290148.1|  PREDICTED: cysteine-rich repeat secretory pr...  55.1    8e-07   
ref|XP_011010160.1|  PREDICTED: cysteine-rich receptor-like prote...  56.2    9e-07   
emb|CDP04313.1|  unnamed protein product                              54.7    1e-06   
ref|XP_004295245.1|  PREDICTED: uncharacterized protein LOC101314835  56.2    1e-06   
ref|XP_009405651.1|  PREDICTED: putative receptor-like protein ki...  55.5    1e-06   
ref|XP_010524650.1|  PREDICTED: cysteine-rich repeat secretory pr...  53.9    2e-06   
ref|XP_008225008.1|  PREDICTED: uncharacterized protein LOC103324687  55.5    2e-06   
emb|CAN80170.1|  hypothetical protein VITISV_018433                   53.5    3e-06   Vitis vinifera
emb|CBI29181.3|  unnamed protein product                              54.3    3e-06   
ref|XP_006406217.1|  hypothetical protein EUTSA_v10021371mg           53.1    3e-06   
ref|XP_007216147.1|  hypothetical protein PRUPE_ppa015075mg           52.8    4e-06   
ref|XP_010644356.1|  PREDICTED: cysteine-rich receptor-like prote...  53.5    4e-06   
ref|XP_010910239.1|  PREDICTED: putative receptor-like protein ki...  54.3    4e-06   
emb|CAN65760.1|  hypothetical protein VITISV_001837                   53.5    4e-06   Vitis vinifera
ref|NP_566697.1|  Receptor-like protein kinase-related family pro...  52.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049722.1|  Os03g0277700                                     52.8    6e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89462.1|  hypothetical protein OsI_10995                        52.8    6e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_004292427.1|  PREDICTED: cysteine-rich repeat secretory pr...  52.4    7e-06   
ref|XP_010240979.1|  PREDICTED: cysteine-rich receptor-like prote...  53.9    7e-06   
gb|KCW76451.1|  hypothetical protein EUGRSUZ_D00843                   53.5    7e-06   
ref|XP_010054432.1|  PREDICTED: uncharacterized protein LOC104442733  53.9    8e-06   
ref|XP_011007911.1|  PREDICTED: cysteine-rich receptor-like prote...  53.5    8e-06   
ref|XP_007216947.1|  hypothetical protein PRUPE_ppa016345mg           51.6    8e-06   
ref|XP_007043326.1|  Cysteine-rich RLK 10, putative                   53.1    9e-06   
ref|XP_007213610.1|  hypothetical protein PRUPE_ppa002309mg           53.5    9e-06   
ref|XP_002304943.2|  hypothetical protein POPTR_0004s02390g           52.4    9e-06   Populus trichocarpa [western balsam poplar]
gb|KFK39506.1|  hypothetical protein AALP_AA3G252600                  52.0    9e-06   
ref|XP_010100808.1|  hypothetical protein L484_015838                 52.0    1e-05   
ref|XP_007216907.1|  hypothetical protein PRUPE_ppa019252mg           51.2    1e-05   
ref|XP_008780547.1|  PREDICTED: cysteine-rich repeat secretory pr...  50.8    1e-05   
emb|CDY68211.1|  BnaCnng58060D                                        51.6    1e-05   
ref|XP_004492208.1|  PREDICTED: cysteine-rich repeat secretory pr...  51.6    1e-05   
ref|XP_010240969.1|  PREDICTED: cysteine-rich receptor-like prote...  52.4    2e-05   
ref|XP_010687006.1|  PREDICTED: cysteine-rich repeat secretory pr...  50.4    2e-05   
ref|XP_010910126.1|  PREDICTED: putative receptor-like protein ki...  52.4    2e-05   
gb|AAN46205.1|  unknown protein                                       50.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46194.1|  unknown protein                                       50.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46195.1|  unknown protein                                       50.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006484824.1|  PREDICTED: cysteine-rich repeat secretory pr...  51.2    2e-05   
ref|XP_006373162.1|  hypothetical protein POPTR_0017s09250g           52.4    2e-05   
emb|CAN80171.1|  hypothetical protein VITISV_018434                   51.2    2e-05   Vitis vinifera
ref|XP_007025960.1|  Cysteine-rich RLK 10, putative                   52.0    3e-05   
ref|XP_007025968.1|  Cysteine-rich RLK 10, putative                   51.6    3e-05   
gb|KGN43546.1|  hypothetical protein Csa_7G044860                     50.4    3e-05   
ref|XP_006850460.1|  hypothetical protein AMTR_s00035p00082360        50.4    3e-05   
ref|XP_010267901.1|  PREDICTED: cysteine-rich receptor-like prote...  50.4    3e-05   
ref|XP_010240976.1|  PREDICTED: cysteine-rich receptor-like prote...  51.6    3e-05   
gb|KHN01561.1|  Cysteine-rich receptor-like protein kinase 29         51.2    4e-05   
ref|XP_004144484.1|  PREDICTED: cysteine-rich repeat secretory pr...  50.4    4e-05   
ref|XP_006449123.1|  hypothetical protein CICLE_v10018168mg           50.1    4e-05   
ref|XP_006468227.1|  PREDICTED: cysteine-rich repeat secretory pr...  50.1    4e-05   
gb|KDO75587.1|  hypothetical protein CISIN_1g040542mg                 50.1    4e-05   
ref|XP_008778956.1|  PREDICTED: cysteine-rich repeat secretory pr...  50.1    4e-05   
ref|XP_008342466.1|  PREDICTED: cysteine-rich repeat secretory pr...  50.1    5e-05   
ref|XP_010533171.1|  PREDICTED: cysteine-rich receptor-like prote...  50.8    5e-05   
ref|XP_004168056.1|  PREDICTED: cysteine-rich repeat secretory pr...  50.1    5e-05   
ref|XP_010923982.1|  PREDICTED: cysteine-rich repeat secretory pr...  50.1    6e-05   
ref|XP_003622768.1|  Cysteine-rich repeat secretory protein           49.7    6e-05   
ref|XP_008455406.1|  PREDICTED: cysteine-rich repeat secretory pr...  49.7    7e-05   
ref|XP_006437221.1|  hypothetical protein CICLE_v10032523mg           49.7    7e-05   
ref|XP_010482102.1|  PREDICTED: cysteine-rich repeat secretory pr...  49.7    7e-05   
ref|XP_009417398.1|  PREDICTED: uncharacterized protein LOC103997793  50.8    7e-05   
gb|KDO60896.1|  hypothetical protein CISIN_1g036866mg                 49.3    7e-05   
ref|XP_010036761.1|  PREDICTED: cysteine-rich repeat secretory pr...  49.3    8e-05   
ref|XP_010052449.1|  PREDICTED: putative receptor-like protein ki...  50.4    8e-05   
ref|XP_010529370.1|  PREDICTED: cysteine-rich receptor-like prote...  50.4    8e-05   
gb|AGT15894.1|  hypothetical protein SHCRBa_258_I03_R_140             50.4    9e-05   
ref|XP_003555314.1|  PREDICTED: cysteine-rich receptor-like prote...  50.1    9e-05   
ref|XP_010036760.1|  PREDICTED: cysteine-rich repeat secretory pr...  49.3    9e-05   
ref|XP_006828418.1|  hypothetical protein AMTR_s00060p00084230        49.3    1e-04   
ref|XP_002865649.1|  hypothetical protein ARALYDRAFT_494916           49.3    1e-04   
gb|KFK31328.1|  hypothetical protein AALP_AA6G098000                  49.3    1e-04   
ref|XP_009418899.1|  PREDICTED: cysteine-rich receptor-like prote...  50.1    1e-04   
gb|KCW76452.1|  hypothetical protein EUGRSUZ_D00844                   50.1    1e-04   
ref|XP_009367024.1|  PREDICTED: cysteine-rich receptor-like prote...  50.1    1e-04   
emb|CDP14580.1|  unnamed protein product                              48.9    1e-04   
ref|XP_006649855.1|  PREDICTED: cysteine-rich repeat secretory pr...  48.9    1e-04   
gb|AGT17169.1|  ATP binding protein                                   50.1    1e-04   
gb|AGT17379.1|  hypothetical protein SHCRBa_240_C21_F_200             49.7    1e-04   
ref|XP_003551283.1|  PREDICTED: cysteine-rich repeat secretory pr...  48.9    1e-04   
ref|XP_010058609.1|  PREDICTED: cysteine-rich receptor-like prote...  49.7    1e-04   
ref|XP_009367095.1|  PREDICTED: cysteine-rich receptor-like prote...  49.7    1e-04   
ref|NP_199665.1|  receptor-like protein kinase-related family pro...  48.9    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442278.1|  PREDICTED: cysteine-rich repeat secretory pr...  48.5    1e-04   
ref|XP_008674038.1|  PREDICTED: cysteine-rich receptor-like prote...  49.7    1e-04   
ref|XP_002518555.1|  ATP binding protein, putative                    49.7    2e-04   Ricinus communis
gb|KDP20815.1|  hypothetical protein JCGZ_21286                       49.7    2e-04   
ref|XP_010931318.1|  PREDICTED: putative receptor-like protein ki...  49.3    2e-04   
ref|XP_010558703.1|  PREDICTED: cysteine-rich receptor-like prote...  49.3    2e-04   
ref|XP_010911643.1|  PREDICTED: cysteine-rich repeat secretory pr...  48.5    2e-04   
ref|NP_001049923.1|  Os03g0312300                                     47.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010054433.1|  PREDICTED: cysteine-rich receptor-like prote...  49.3    2e-04   
ref|XP_008224860.1|  PREDICTED: cysteine-rich receptor-like prote...  48.9    2e-04   
ref|XP_011007912.1|  PREDICTED: cysteine-rich receptor-like prote...  48.1    2e-04   
ref|XP_009145437.1|  PREDICTED: cysteine-rich repeat secretory pr...  48.1    2e-04   
gb|EEC75106.1|  hypothetical protein OsI_11281                        48.1    2e-04   Oryza sativa Indica Group [Indian rice]
gb|KCW73357.1|  hypothetical protein EUGRSUZ_E01828                   48.9    2e-04   
emb|CDP03947.1|  unnamed protein product                              48.1    2e-04   
ref|XP_006383955.1|  hypothetical protein POPTR_0004s02410g           47.4    3e-04   
gb|EYU40654.1|  hypothetical protein MIMGU_mgv1a012036mg              47.8    3e-04   
ref|XP_010241766.1|  PREDICTED: cysteine-rich repeat secretory pr...  47.8    3e-04   
ref|XP_007025550.1|  Cysteine-rich RLK 8, putative                    48.1    3e-04   
emb|CDY57408.1|  BnaA05g36230D                                        47.8    3e-04   
ref|XP_010059652.1|  PREDICTED: putative cysteine-rich receptor-l...  47.0    3e-04   
ref|XP_010655410.1|  PREDICTED: cysteine-rich receptor-like prote...  48.9    3e-04   
ref|XP_007211369.1|  hypothetical protein PRUPE_ppa002516mg           48.5    3e-04   
ref|XP_002526797.1|  DUF26 domain-containing protein 2 precursor,...  47.8    3e-04   Ricinus communis
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                   48.5    3e-04   
ref|XP_006372981.1|  hypothetical protein POPTR_0017s06750g           47.4    3e-04   
gb|EMS47764.1|  Cysteine-rich receptor-like protein kinase 25         48.5    4e-04   
ref|NP_001049721.1|  Os03g0277600                                     47.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05518.1|  hypothetical protein OsI_27735                        47.8    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006383957.1|  hypothetical protein POPTR_0004s024302g          45.8    4e-04   
gb|KCW61044.1|  hypothetical protein EUGRSUZ_H03818                   48.1    4e-04   
ref|XP_006377265.1|  hypothetical protein POPTR_0011s03300g           47.4    4e-04   
ref|XP_004982556.1|  PREDICTED: cysteine-rich repeat secretory pr...  47.4    4e-04   
ref|XP_006377262.1|  hypothetical protein POPTR_0011s03240g           47.4    4e-04   
ref|XP_007049618.1|  Receptor-like protein kinase-related family ...  47.4    4e-04   
gb|KCW75403.1|  hypothetical protein EUGRSUZ_E04157                   47.4    5e-04   
ref|XP_003637938.1|  Cysteine-rich receptor-like protein kinase       47.8    5e-04   
ref|XP_010679273.1|  PREDICTED: cysteine-rich repeat secretory pr...  47.0    5e-04   
ref|XP_010059668.1|  PREDICTED: cysteine-rich receptor-like prote...  47.4    5e-04   
ref|XP_010056934.1|  PREDICTED: cysteine-rich receptor-like prote...  47.8    5e-04   
ref|XP_009418900.1|  PREDICTED: putative receptor-like protein ki...  47.8    5e-04   
gb|KCW75010.1|  hypothetical protein EUGRSUZ_E037852                  47.8    5e-04   
ref|XP_010059519.1|  PREDICTED: cysteine-rich receptor-like prote...  47.8    6e-04   
ref|XP_010999539.1|  PREDICTED: cysteine-rich repeat secretory pr...  47.0    6e-04   
gb|ACG28478.1|  serine/threonine kinase-like protein                  47.0    6e-04   Zea mays [maize]
emb|CDP03948.1|  unnamed protein product                              47.0    6e-04   
ref|XP_010999538.1|  PREDICTED: cysteine-rich repeat secretory pr...  47.0    6e-04   
ref|XP_007148794.1|  hypothetical protein PHAVU_005G014900g           47.8    6e-04   
gb|KCW74325.1|  hypothetical protein EUGRSUZ_E02988                   47.0    7e-04   
gb|KDP20818.1|  hypothetical protein JCGZ_21289                       46.6    7e-04   
ref|XP_010553429.1|  PREDICTED: cysteine-rich receptor-like prote...  47.4    7e-04   
ref|XP_010932126.1|  PREDICTED: cysteine-rich receptor-like prote...  47.4    7e-04   
gb|KDP25876.1|  hypothetical protein JCGZ_22906                       46.2    7e-04   
ref|XP_011012775.1|  PREDICTED: cysteine-rich receptor-like prote...  47.4    7e-04   
gb|KFK22508.1|  hypothetical protein AALP_AAs69716U000100             45.8    7e-04   
ref|XP_006850463.1|  hypothetical protein AMTR_s00035p00086030        46.6    8e-04   
ref|XP_010910400.1|  PREDICTED: cysteine-rich repeat secretory pr...  47.0    8e-04   
gb|KCW73842.1|  hypothetical protein EUGRSUZ_E02441                   47.4    8e-04   
ref|XP_007143173.1|  hypothetical protein PHAVU_007G049800g           46.6    8e-04   
ref|XP_011007635.1|  PREDICTED: cysteine-rich receptor-like prote...  47.4    9e-04   
ref|XP_010553428.1|  PREDICTED: cysteine-rich receptor-like prote...  47.4    9e-04   
ref|XP_010553427.1|  PREDICTED: cysteine-rich receptor-like prote...  47.4    9e-04   
ref|XP_010059118.1|  PREDICTED: putative cysteine-rich receptor-l...  46.6    9e-04   
ref|XP_002304939.2|  hypothetical protein POPTR_0004s02320g           47.4    9e-04   Populus trichocarpa [western balsam poplar]
gb|KDO75584.1|  hypothetical protein CISIN_1g010329mg                 47.0    0.001   
ref|XP_011012773.1|  PREDICTED: cysteine-rich receptor-like prote...  47.4    0.001   
ref|XP_010924010.1|  PREDICTED: cysteine-rich repeat secretory pr...  45.8    0.001   
ref|XP_010042892.1|  PREDICTED: putative cysteine-rich receptor-l...  46.2    0.001   



>ref|XP_009591406.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
tomentosiformis]
Length=246

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            MA+S++ S L  +S   + +QT ++ DPLFHFCS SGNFT NS Y  NL  LLGDLYLKT
Sbjct  1    MASSRIISSLYFLSYIAILVQTVVSTDPLFHFCSKSGNFTANSYYAKNLKNLLGDLYLKT  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GF + S G+  DQTYGLSLCRGDVS+ +CKSCV 
Sbjct  61   PPTGFSTSSIGQTPDQTYGLSLCRGDVSSTNCKSCVV  97



>ref|XP_009793791.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
sylvestris]
Length=246

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            MA+SK+ S L  +    + +QT ++ DPLFHFCS SGNFT NS Y  NL  +LGDLYLKT
Sbjct  1    MASSKIISSLFFLLYIAILVQTVISTDPLFHFCSKSGNFTANSYYAKNLKNVLGDLYLKT  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GF + SAG+  DQTYG SLCRGDVS+ +CKSCV 
Sbjct  61   PPTGFSTSSAGQTPDQTYGFSLCRGDVSSTNCKSCVV  97



>ref|XP_009605992.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
tomentosiformis]
Length=246

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            MA+SK+ S L  +    +  QT ++ DPLFHFCS SGNFT NS Y  NL  LLGDLYLKT
Sbjct  1    MASSKIISSLFFLLHIAILAQTVISTDPLFHFCSKSGNFTANSYYAKNLKNLLGDLYLKT  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            P+ GF + S G+  DQTYGLSLCRGDVS+ +CKSCV 
Sbjct  61   PLTGFSTSSIGQTPDQTYGLSLCRGDVSSTNCKSCVV  97



>gb|ACU16205.1| unknown [Glycine max]
Length=242

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++SKLF+  L      + LQT+  ADPLFHFCSNS NFT NS Y++NL  L+  L  KT
Sbjct  1    MSSSKLFTTFLFSLNLALLLQTSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKT  60

Query  112  PINGFGSGSAGKYYDQT-YGLSLCRGDVSAADCKSCVA  2
            P  GFG+GS G+Y +Q  Y L+LCRGDVSA++CK+CV+
Sbjct  61   PSTGFGAGSVGQYQNQKAYALALCRGDVSASECKTCVS  98



>ref|XP_006351952.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=244

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++SKL S L  +S   + +QT ++ +PLFHFCSNS NFT NS Y  NL  LLGDLYLKT
Sbjct  1    MSSSKLISCLFFLSSIAILVQTVISTNPLFHFCSNSENFTANSYYAQNLKNLLGDLYLKT  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GF + S G+ +DQT GLSLCRGD+S+ +CKSCV
Sbjct  61   PPTGFSTCSIGQNHDQTNGLSLCRGDISSNNCKSCV  96



>gb|KHN36561.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=244

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++SKLF+  L      + LQT+  ADPLFHFCSNS NFT NS Y++NL  L+  L  KT
Sbjct  1    MSSSKLFTTFLFSLNLALLLQTSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKT  60

Query  112  PINGFGSGSAGKYYDQT-YGLSLCRGDVSAADCKSCVA  2
            P  GFG GS G+Y +Q  Y L+LCRGDVSA++CK+CV+
Sbjct  61   PSTGFGVGSVGQYQNQKAYALALCRGDVSASECKTCVS  98



>ref|XP_003543377.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Glycine 
max]
Length=244

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++SKLF+  L      + LQT+  ADPLFHFCSNS NFT NS Y++NL  L+  L  KT
Sbjct  1    MSSSKLFTTFLFSLNLALLLQTSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKT  60

Query  112  PINGFGSGSAGKYYDQT-YGLSLCRGDVSAADCKSCVA  2
            P  GFG GS G+Y +Q  Y L+LCRGDVSA++CK+CV+
Sbjct  61   PSTGFGVGSVGQYQNQKAYALALCRGDVSASECKTCVS  98



>ref|XP_009787631.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
sylvestris]
Length=246

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M +SK+ S L  +    +  QT ++ DPLFHFCS SGNFT NS Y  NL  +LGDLYLKT
Sbjct  1    MTSSKIISSLFFLLYIAILAQTVISTDPLFHFCSKSGNFTANSYYAKNLKNVLGDLYLKT  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GF + S G+  DQ YGLSLCRGDVS+ +CKSCV 
Sbjct  61   PPTGFSTSSVGQTPDQIYGLSLCRGDVSSTNCKSCVV  97



>ref|XP_006352035.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=244

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M +SKL S L  +S   + +QT ++ +PLFHFCSNS NFT NS Y  NL  LLGDLYLKT
Sbjct  1    MYSSKLISCLFFLSSIAILVQTVISTNPLFHFCSNSENFTANSYYAQNLKNLLGDLYLKT  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GF + S G+ +DQT GLSLCRGD+S+ +CKSCV
Sbjct  61   PPTGFSTCSIGQNHDQTNGLSLCRGDISSNNCKSCV  96



>gb|AES67291.2| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=246

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            MA SKL ++ L        +QT+  ADPLFHFCSNSGNFT NS Y++NL  L+  L  KT
Sbjct  1    MAFSKLMTIFLYSFTLAFLIQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYKT  60

Query  112  PINGFGSGSAG---KYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GFG+GS+        QTYGL+LCRGDVS ++CK+CV+
Sbjct  61   PSTGFGNGSSSLVQNQNQQTYGLALCRGDVSPSECKTCVS  100



>gb|AFK43074.1| unknown [Medicago truncatula]
Length=248

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            MA SKL ++ L        +QT+  ADPLFHFCSNSGNFT NS Y++NL  L+  L  KT
Sbjct  1    MAFSKLMTIFLYSFTLAFLIQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYKT  60

Query  112  PINGFGSGSAG---KYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GFG+GS+        QTYGL+LCRGDVS ++CK+CV+
Sbjct  61   PSTGFGNGSSSLVQNQNQQTYGLALCRGDVSPSECKTCVS  100



>ref|XP_007149948.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris]
 gb|ESW21942.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris]
Length=253

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+++KLFS  L      + LQT+  ADPLFHFCSNS NFT NS Y++NL  L+  L  KT
Sbjct  10   MSSTKLFSTFLFSLTLSLILQTSFGADPLFHFCSNSQNFTANSPYESNLKTLINSLIYKT  69

Query  112  PINGFGSGSAGKYYDQ-TYGLSLCRGDVSAADCKSCVA  2
            P  GFG  S G+  +Q  +GL+LCRGDVSA++CK+CV+
Sbjct  70   PSTGFGVASVGQNQNQMAHGLALCRGDVSASECKTCVS  107



>ref|XP_003597040.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
Length=316

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            MA SKL ++ L        +QT+  ADPLFHFCSNSGNFT NS Y++NL  L+  L  KT
Sbjct  1    MAFSKLMTIFLYSFTLAFLIQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYKT  60

Query  112  PINGFGSGSAG---KYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GFG+GS+        QTYGL+LCRGDVS ++CK+CV+
Sbjct  61   PSTGFGNGSSSLVQNQNQQTYGLALCRGDVSPSECKTCVS  100



>gb|KDP25874.1| hypothetical protein JCGZ_22904 [Jatropha curcas]
Length=243

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+ SK  S + L++  ++  QT +A DPLFHFCS+S NFT N  Y++NLN+++G+LY++T
Sbjct  1    MSFSKFTSFIYLLTFPLLH-QTILATDPLFHFCSSSENFTTNGPYESNLNKIIGNLYIQT  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GFG GS+G+  DQ YGL+LCRGDVS +DCK+CV 
Sbjct  60   PQTGFGFGSSGQKPDQAYGLALCRGDVSTSDCKTCVV  96



>ref|XP_007024474.1| Receptor-like protein kinase-related family protein [Theobroma 
cacao]
 gb|EOY27096.1| Receptor-like protein kinase-related family protein [Theobroma 
cacao]
Length=242

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++S+  SLL L++ A + LQ A   DPLFHFCSN+GNF+ +  Y++NLN+L G L ++ 
Sbjct  1    MSSSRFPSLLYLLTFAFL-LQAAFGVDPLFHFCSNAGNFSAHDPYEDNLNKLTGYLSIQA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P +GFG GS G+  +Q YGL+LCRGDVS  DCK+C+
Sbjct  60   PPSGFGLGSIGQKPNQAYGLALCRGDVSTPDCKTCI  95



>ref|XP_010051179.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89432.1| hypothetical protein EUGRSUZ_A01731 [Eucalyptus grandis]
Length=240

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = -2

Query  286  TSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPI  107
            +S  F LL L S   + L+ A+ ADPLFHFCS   NFT  S Y++NLN+L   LY KTP 
Sbjct  2    SSARFVLLSLCS--AILLRAALGADPLFHFCSTPENFTAGSPYESNLNKLTSFLYTKTPS  59

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            +GFG GS G+Y DQ YGL+LCRGD+S +DCK+ VA
Sbjct  60   SGFGLGSIGQYQDQVYGLALCRGDISPSDCKAFVA  94



>gb|EYU43107.1| hypothetical protein MIMGU_mgv1a022379mg [Erythranthe guttata]
Length=242

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -2

Query  265  LLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGS  86
            +L++S+  + +QTA++A PLF  CS++ NFT NS Y+ NLN+LLGDLY KTP  GFG GS
Sbjct  9    ILVISINSLLIQTALSASPLFSICSSTQNFTTNSLYERNLNKLLGDLYFKTPPTGFGFGS  68

Query  85   AGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            +G+Y D+ YGLSLCRGDVS  DCK+CV 
Sbjct  69   SGQYTDRVYGLSLCRGDVSTNDCKTCVV  96



>ref|XP_003597035.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
 gb|AES67286.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=246

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M +SKLF+++L     V  +QT +  DPLFH CS S NFT +S Y++NL  L+  L  KT
Sbjct  1    MGSSKLFTIILFSFTFVFLIQTTLGTDPLFHICSTSENFTAHSPYESNLKTLINSLIYKT  60

Query  112  PINGFGSGSAG--KYYDQT-YGLSLCRGDVSAADCKSCVA  2
            P  GFGSGS    +Y +Q  YGL+LCRGDVS ++CK+CV+
Sbjct  61   PSTGFGSGSIDLTQYQNQKAYGLALCRGDVSTSECKTCVS  100



>ref|XP_006351953.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=240

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++SKL S L  +S   + + T    DPLFHFCSNS NFT NS Y  NL  LLGDLYLKT
Sbjct  1    MSSSKLISCLFFLSSIALVIST----DPLFHFCSNSENFTANSYYAQNLKNLLGDLYLKT  56

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GF + S G+ +DQT GLSLCRGDVS+  CKSCV
Sbjct  57   PPTGFSTSSIGQNHDQTNGLSLCRGDVSSNSCKSCV  92



>ref|XP_004251507.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Solanum 
lycopersicum]
Length=240

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 70/97 (72%), Gaps = 6/97 (6%)
 Frame = -2

Query  292  MATSKLFS-LLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            M++SKL S L  L S+A+V     ++ DPLFHFCSN  NFT NS Y  NL  LLGDLYLK
Sbjct  1    MSSSKLISCLFFLSSIAIV-----ISTDPLFHFCSNHENFTANSYYAQNLKNLLGDLYLK  55

Query  115  TPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            TP  GF + S G+ +DQT GLSLCRGDV++ +CKSCV
Sbjct  56   TPPTGFSTSSIGQNHDQTNGLSLCRGDVTSNNCKSCV  92



>gb|AFK48353.1| unknown [Medicago truncatula]
Length=241

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 3/81 (4%)
 Frame = -2

Query  235  LQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAG---KYYDQ  65
            +QT+  ADPLFHFCSNSGNFT NS Y++NL  L+  L  KTP  GFG+GS+        Q
Sbjct  14   IQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYKTPSTGFGNGSSSLVQNQNQQ  73

Query  64   TYGLSLCRGDVSAADCKSCVA  2
            TYGL+LCRGDVS ++CK+CV+
Sbjct  74   TYGLALCRGDVSPSECKTCVS  94



>ref|XP_002515716.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF46663.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=240

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 3/94 (3%)
 Frame = -2

Query  286  TSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPI  107
            +S  F LL+  ++ V   QT    DPLFHFCS+S NFT N  Y++NLN+L G+LY + P 
Sbjct  2    SSSFFYLLIAFALLV---QTVYGDDPLFHFCSSSENFTANGPYESNLNKLAGNLYFQVPK  58

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             GFG GS+G+  DQ YGL+LCRGDVS++DCK+CV
Sbjct  59   EGFGFGSSGRDPDQAYGLALCRGDVSSSDCKTCV  92



>ref|XP_010051171.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89430.1| hypothetical protein EUGRSUZ_A01729 [Eucalyptus grandis]
Length=240

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
            Q  + ADPL HFCS+S NFT  S Y++NLN+L   LY KTP +GFG GS G+Y DQ YGL
Sbjct  18   QATLGADPLSHFCSSSENFTAGSPYESNLNKLTSFLYTKTPSSGFGLGSIGQYQDQVYGL  77

Query  52   SLCRGDVSAADCKSCVA  2
            +LCRGD S +DCK+CVA
Sbjct  78   ALCRGDTSPSDCKACVA  94



>ref|XP_006447470.1| hypothetical protein CICLE_v10017568mg, partial [Citrus clementina]
 gb|ESR60710.1| hypothetical protein CICLE_v10017568mg, partial [Citrus clementina]
Length=254

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = -2

Query  301  LAAMATSKLF---SLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllg  131
            LA MA+  +    SL LL++ A   LQTA   DPLFHFCS+S NFT N  Y+ NLN+L+G
Sbjct  18   LATMASPSIKFASSLYLLIAFAFF-LQTAFGVDPLFHFCSSSENFTANGPYETNLNKLIG  76

Query  130  dlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
             L  + P  GFG G+ G+  ++ YGL+LCRGDVS++DCK+C+ 
Sbjct  77   YLDYQAPPTGFGKGALGQRPNKAYGLALCRGDVSSSDCKTCIV  119



>ref|XP_006469729.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
 gb|KDO59871.1| hypothetical protein CISIN_1g025954mg [Citrus sinensis]
Length=245

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  271  SLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGS  92
            SL LL++ A   LQTA   DPLFHFCS+S NFT N  Y+ NLN+L+G L  + P  GFG 
Sbjct  11   SLYLLIAFAFF-LQTAFGVDPLFHFCSSSENFTANGPYETNLNKLIGYLDYQAPPTGFGK  69

Query  91   GSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            G+ G+  ++ YGL+LCRGDVS++DCK+C+ 
Sbjct  70   GALGQRPNKAYGLALCRGDVSSSDCKTCIV  99



>gb|KHN36560.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=227

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++SKL S +  + +  +  QT   A+PL+HFCS+S NF  NS Y++NL  L+  L  +T
Sbjct  1    MSSSKLSSPVTFLLIFALVFQTCFGANPLYHFCSSSQNFKANSPYESNLKTLINSLIYRT  60

Query  112  PINGFGSGSAGKYYDQT-YGLSLCRGDVSAADCKSCVA  2
            P  GFG GS G+Y ++  YGL+LCRGDVS+++CK+CV+
Sbjct  61   PSTGFGVGSVGQYQNEKAYGLALCRGDVSSSECKTCVS  98



>ref|XP_003541936.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine 
max]
Length=245

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++SKL S +  + +  +  QT   A+PL+HFCS+S NF  NS Y++NL  L+  L  +T
Sbjct  1    MSSSKLSSPVTFLLIFALVFQTCFGANPLYHFCSSSQNFKANSPYESNLKTLINSLIYRT  60

Query  112  PINGFGSGSAGKYYDQT-YGLSLCRGDVSAADCKSCVA  2
            P  GFG GS G+Y ++  YGL+LCRGDVS+++CK+CV+
Sbjct  61   PSTGFGVGSVGQYQNEKAYGLALCRGDVSSSECKTCVS  98



>ref|XP_002309843.2| hypothetical protein POPTR_0007s02720g [Populus trichocarpa]
 ref|XP_006387148.1| receptor-like protein kinase [Populus trichocarpa]
 gb|ERP46062.1| receptor-like protein kinase [Populus trichocarpa]
 gb|EEE90293.2| hypothetical protein POPTR_0007s02720g [Populus trichocarpa]
Length=242

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++S   S L L++ +++ + T   ADPLFHFCS   NFT N  Y++NLN+L   LY + 
Sbjct  1    MSSSNFASFLCLLAFSLL-VHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSYLYYQA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G+  DQ YGL+LCRGD S +DCK+CV
Sbjct  60   PSTGFGLGSIGQNPDQAYGLALCRGDASTSDCKTCV  95



>ref|XP_011003220.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=242

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+ S   S L L++ +++ + T   ADPLFHFCS   NFT N  Y++NLN+L   LY +T
Sbjct  1    MSFSNFASFLCLLAFSLL-VHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSYLYYQT  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GFG GS G+  D+ YGL+LCRGD S +DCK+CV 
Sbjct  60   PSTGFGLGSIGQKPDRAYGLALCRGDASTSDCKTCVV  96



>ref|XP_004487372.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cicer 
arietinum]
Length=248

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMA-ADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            M++S  F+++L+     +  QT+ A  DPLFH CS S NFTP++ Y++NL  L+  L  K
Sbjct  1    MSSSNFFTIILISLTLALIPQTSFALNDPLFHICSTSKNFTPHTPYESNLKTLINSLIYK  60

Query  115  TPINGFGSGSAGK--YYDQ-TYGLSLCRGDVSAADCKSCVA  2
            TP  GFG GS G+  Y +Q  YGL+LCRGD++  +CK+CV+
Sbjct  61   TPSTGFGIGSVGQAQYQNQPAYGLALCRGDITTLECKTCVS  101



>ref|XP_011079182.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Sesamum 
indicum]
Length=245

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
            QTA++A PLF  CSNS NFT NS Y+ NL +LLG+LY KTP  GFG GS+G+ YD+ YGL
Sbjct  22   QTAISATPLFSICSNSHNFTANSPYEKNLIKLLGELYFKTPPTGFGLGSSGQGYDRAYGL  81

Query  52   SLCRGDVSAADCKSCV  5
            SLCRGDVS  DC +CV
Sbjct  82   SLCRGDVSTKDCGACV  97



>ref|XP_010069655.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89428.1| hypothetical protein EUGRSUZ_A01727 [Eucalyptus grandis]
Length=240

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
            Q  +  DPL HFCS+S NFT  S Y++NLN+L   LY KTP +GFG GS  +Y DQ YGL
Sbjct  18   QATLGFDPLSHFCSSSENFTAGSPYESNLNKLTSFLYTKTPSSGFGLGSIRQYQDQVYGL  77

Query  52   SLCRGDVSAADCKSCVA  2
            +LCRGD S +DCK+CVA
Sbjct  78   ALCRGDTSPSDCKACVA  94



>ref|XP_006372985.1| hypothetical protein POPTR_0017s06790g [Populus trichocarpa]
 gb|ERP50782.1| hypothetical protein POPTR_0017s06790g [Populus trichocarpa]
Length=242

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+ S   S L L++ +++ L T   A P FH CS+  NFT N  Y++NLN+L   LY K 
Sbjct  1    MSFSNFASSLCLITFSLL-LHTVFGAGPNFHLCSSPENFTANGPYESNLNKLTSYLYYKA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G   DQTYGL+LCRGDVS +DCK+CV
Sbjct  60   PPTGFGMGSRGHTPDQTYGLALCRGDVSTSDCKTCV  95



>ref|XP_006372978.1| hypothetical protein POPTR_0017s06720g [Populus trichocarpa]
 gb|ERP50775.1| hypothetical protein POPTR_0017s06720g [Populus trichocarpa]
Length=242

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+ S   S L L++ +++ L T   A P FH CS+  NFT N  Y++NLN+L   LY K 
Sbjct  1    MSFSNFASSLCLITFSLL-LHTVFGAGPNFHLCSSPENFTANGPYESNLNKLTSYLYYKA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G   DQTYGL+LCRGDVS +DCK+CV
Sbjct  60   PPTGFGMGSRGHTPDQTYGLALCRGDVSTSDCKTCV  95



>ref|XP_006372979.1| hypothetical protein POPTR_0017s06730g [Populus trichocarpa]
 gb|ERP50776.1| hypothetical protein POPTR_0017s06730g [Populus trichocarpa]
Length=242

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+ S   S L L++ +++ L T   A P FH CS+  NFT N  Y++NL +L   LY K 
Sbjct  1    MSFSNFASSLCLITFSLL-LHTVFGAGPNFHLCSSPENFTANGPYESNLKKLTSYLYYKA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G   DQTYGL LCRGDVS +DCK+CV
Sbjct  60   PPTGFGMGSRGHTPDQTYGLDLCRGDVSTSDCKTCV  95



>ref|XP_006387991.1| receptor-like protein kinase [Populus trichocarpa]
 gb|ERP46905.1| receptor-like protein kinase [Populus trichocarpa]
Length=242

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+ S   S L L++ +++ + T   ADPLFHFCS   NFT N  Y++NLN+L   LY + 
Sbjct  1    MSFSNFASFLCLLAFSLL-VHTGFEADPLFHFCSTPENFTANGPYESNLNKLTSFLYYQA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G+   Q YGL+LCRGD S +DCK+CV
Sbjct  60   PRTGFGMGSKGQKPVQAYGLALCRGDASTSDCKTCV  95



>ref|XP_010051188.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89433.1| hypothetical protein EUGRSUZ_A01732 [Eucalyptus grandis]
Length=242

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
             T+ +ADPL+H C    N+T  S ++ NL+ LL  L  K P +GFG+GS+G+  DQ YGL
Sbjct  19   DTSFSADPLYHICFGKDNYTSGSPFKTNLDSLLTTLVSKVPPSGFGTGSSGEGNDQVYGL  78

Query  52   SLCRGDVSAADCKSCVA  2
            +LCRGDVS++DCKSCV+
Sbjct  79   ALCRGDVSSSDCKSCVS  95



>ref|XP_006380319.1| hypothetical protein POPTR_0007s02730g [Populus trichocarpa]
 gb|ERP58116.1| hypothetical protein POPTR_0007s02730g [Populus trichocarpa]
Length=242

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+ S   S L L++ +++ + T   ADPLFHFCS   NFT N  Y++NLN+L   LY + 
Sbjct  1    MSFSNFASFLCLLAFSLL-VHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSFLYYQA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G+   Q YGL+LCRGD S +DCK+CV
Sbjct  60   PRTGFGMGSKGQKPVQAYGLALCRGDASTSDCKTCV  95



>ref|XP_010051151.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89427.1| hypothetical protein EUGRSUZ_A01726 [Eucalyptus grandis]
Length=240

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  214  DPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGD  35
            DPLFHFCSN  NFT +S Y++NLN+L   LY KTP +GFG GS G+Y +Q +GL+LCRGD
Sbjct  24   DPLFHFCSNPENFTASSPYESNLNKLTSFLYTKTPPSGFGLGSIGQYQNQVFGLALCRGD  83

Query  34   VSAADCKSCVA  2
             S + CK+CVA
Sbjct  84   ASPSVCKACVA  94



>ref|XP_010247023.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=240

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFG  95
            F+ L L++++++ +   ++ADPLFHFCS SGNF+  S Y+ NLN+L+  L  K   +GFG
Sbjct  6    FTPLCLLTISLL-VHGVISADPLFHFCSKSGNFSAKSPYEINLNKLMSSLSYKVVPSGFG  64

Query  94   SGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
             GS G+  D+  GL+LCRGDVS+ DCK+CV+
Sbjct  65   LGSVGQAPDRANGLALCRGDVSSTDCKTCVS  95



>gb|EYU43106.1| hypothetical protein MIMGU_mgv1a021349mg, partial [Erythranthe 
guttata]
Length=220

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  223  MAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLC  44
            ++A PLF  CSN+ NF+ NS Y+ NLN+LLGDLY KTP  GFG GS+G+Y D+ YGLSLC
Sbjct  1    LSASPLFSICSNTQNFSTNSLYERNLNKLLGDLYFKTPPTGFGFGSSGQYNDRVYGLSLC  60

Query  43   RGDVSAADCKSCVA  2
            RGDVS  DCK+CV 
Sbjct  61   RGDVSTNDCKTCVV  74



>ref|XP_010051161.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89429.1| hypothetical protein EUGRSUZ_A01728 [Eucalyptus grandis]
Length=240

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
            +  + ADPLFH CS   +FT  S Y++NLN+L   LY  TP +GFG GS G+Y DQ YGL
Sbjct  18   RATLGADPLFHVCSTPEDFTAGSPYESNLNKLTSFLYTNTPSSGFGPGSIGQYPDQPYGL  77

Query  52   SLCRGDVSAADCKSCVA  2
            +LCRGD S  DC++CVA
Sbjct  78   TLCRGDTSPLDCEACVA  94



>ref|XP_006387993.1| hypothetical protein POPTR_0421s00220g [Populus trichocarpa]
 gb|ERP46907.1| hypothetical protein POPTR_0421s00220g [Populus trichocarpa]
Length=230

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M+ S   S L L++ +++     + ADPL+HFCS   NFT N  Y++NLN+L   LY + 
Sbjct  1    MSFSNFASFLCLLAFSLLVHTGLIGADPLYHFCSTPENFTANGPYESNLNKLTSYLYYQA  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            P  GFG  S G   DQ YGL+LCRGD S +DCK+CV 
Sbjct  61   PRKGFGLCSKGHKPDQAYGLALCRGDASTSDCKTCVV  97



>emb|CAN73039.1| hypothetical protein VITISV_044349 [Vitis vinifera]
Length=231

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M  S+  + L L+S A + LQT +  DPLFHFCS+S  F  N  Y+ NLN+L+G LYL  
Sbjct  1    MYFSRXXTSLYLLSFAFL-LQTIVGTDPLFHFCSSSZKFIDNGXYETNLNKLMGYLYLAA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G+  D+  GL+LCRGDVS  DCK+C+
Sbjct  60   PPTGFGKGSVGEKNDKVNGLALCRGDVSNTDCKACI  95



>ref|XP_002274604.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=242

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M  S+  + L L+S A + LQT +  DPLFHFCS+S  F  N  Y+ NLN+L+G LYL  
Sbjct  1    MYFSRFATSLYLLSFAFL-LQTIVGTDPLFHFCSSSEKFIDNGTYETNLNKLMGYLYLAA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G+  D+  GL+LCRGDVS  DCK+C+
Sbjct  60   PPTGFGKGSVGEKNDKVNGLALCRGDVSNTDCKACI  95



>gb|EYU43108.1| hypothetical protein MIMGU_mgv1a018557mg, partial [Erythranthe 
guttata]
Length=220

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  223  MAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLC  44
            ++A PLF  CS++ NFT NS Y+ NLN+LLGDLY KTP  GFG GS+G+Y D+ YGLSLC
Sbjct  1    LSASPLFSICSSTQNFTTNSLYERNLNKLLGDLYFKTPPTGFGFGSSGQYNDRAYGLSLC  60

Query  43   RGDVSAADCKSCVA  2
            RGDVS  DCK+CV 
Sbjct  61   RGDVSTNDCKTCVV  74



>emb|CAN73037.1| hypothetical protein VITISV_044347 [Vitis vinifera]
Length=337

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M  S+  + L L+S A + LQT    DPL+HFCS+S  F  N  Y+ NLN+L+G LYL  
Sbjct  1    MYFSRFVTSLYLLSFAFL-LQTIAGTDPLYHFCSSSZKFIDNGTYETNLNKLMGYLYLAA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG GS G+  DQ  GL+LCRGDVS  DCK+C+
Sbjct  60   PPTGFGKGSVGENNDQVNGLALCRGDVSNTDCKACI  95



>ref|XP_010247024.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=238

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCR  41
            +ADPLFHFCS S N+T N  Y+ NLNQL   L  K P  GFG  S G+  D+  GL+LCR
Sbjct  20   SADPLFHFCSGSANYTSNGTYEKNLNQLTDYLSSKVPPTGFGFDSVGEAPDRVNGLALCR  79

Query  40   GDVSAADCKSCV  5
            GDVS  DCKSCV
Sbjct  80   GDVSTEDCKSCV  91



>ref|XP_002274668.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=242

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M  S+  + L L+S A + LQT    DPL+HFCS+S  F  N  Y+ NLN+L+G LYL  
Sbjct  1    MYFSRFATSLYLLSFAFL-LQTIAGTDPLYHFCSSSQKFIDNGTYETNLNKLMGYLYLAA  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GF  GS G+  DQ  GL+LCRGDVS  DCK+C+
Sbjct  60   PPTGFRKGSVGENNDQVNGLALCRGDVSNTDCKACI  95



>emb|CBI28973.3| unnamed protein product [Vitis vinifera]
Length=266

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdly  122
            L+ M+ S+ F+  L +   V+ LQT +  DPLFHFCS+S  F  N  Y+ NLN+L+G LY
Sbjct  21   LSKMSFSR-FASFLYLLSFVLLLQTVVGVDPLFHFCSSSEKFIDNGPYETNLNKLMGYLY  79

Query  121  LKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            L  P  G G GS G+ +DQ  GL+LCRGDVS  DCK C+
Sbjct  80   LAAPPTGSGKGSVGQNHDQVNGLALCRGDVSNTDCKDCI  118



>ref|XP_010684085.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=243

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyLK  116
            M++ K+   + L+S     LQT  A +PL+HFC S SGNFT N+ Y  NLN LL  L  K
Sbjct  1    MSSIKITPFIFLLSFTF--LQTTFAVNPLYHFCLSTSGNFTLNTPYDTNLNTLLTLLQRK  58

Query  115  TPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            T  +GF   S G+   Q YGL+LCRGDV++ DC +CV
Sbjct  59   TSPSGFSLASTGQNPSQVYGLALCRGDVNSTDCTTCV  95



>emb|CAN73038.1| hypothetical protein VITISV_044348 [Vitis vinifera]
Length=243

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
            Q A+ ADPLFHFC    N+T N  + +NLN+L   L  K P  GFG  S G+  D   GL
Sbjct  19   QAAIGADPLFHFCFIPENYTANDPFSSNLNELTTLLSSKVPPTGFGLASTGQGQDSVNGL  78

Query  52   SLCRGDVSAADCKSCV  5
            +LCRGDVS+ DCK+CV
Sbjct  79   ALCRGDVSSRDCKTCV  94



>ref|XP_002274745.2| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=243

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
            QT +  DPLFHFCS+S  F  N  Y+ NLN+L+G LYL  P  G G GS G+ +DQ  GL
Sbjct  20   QTVVGVDPLFHFCSSSEKFIDNGPYETNLNKLMGYLYLAAPPTGSGKGSVGQNHDQVNGL  79

Query  52   SLCRGDVSAADCKSCV  5
            +LCRGDVS  DCK C+
Sbjct  80   ALCRGDVSNTDCKDCI  95



>ref|XP_010109547.1| hypothetical protein L484_018282 [Morus notabilis]
 gb|EXC23151.1| hypothetical protein L484_018282 [Morus notabilis]
Length=249

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 59/96 (61%), Gaps = 0/96 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++SK  SLL       + L  A+AADPL+HFC N  N+T NS +  NLN+LL  L +K 
Sbjct  1    MSSSKPISLLTFSLFFFLFLNAAIAADPLYHFCFNKENYTANSPFGANLNELLSRLSVKV  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GFG  + G+   Q  GL LCRGDVS  DCK+C 
Sbjct  61   PPTGFGVSTTGQGDSQVNGLGLCRGDVSTEDCKTCT  96



>ref|XP_008228882.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=241

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
              A+ A PLFHFC +  N+T NS Y  NL QL   LY K P  GFG GS G+  +Q  GL
Sbjct  19   HAALGASPLFHFCFSKENYTANSPYGANLIQLFNLLYTKVPPTGFGLGSTGEGQNQANGL  78

Query  52   SLCRGDVSAADCKSCV  5
            +LCRGDVS+ DCK+CV
Sbjct  79   ALCRGDVSSQDCKTCV  94



>ref|XP_006469774.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=246

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 58/84 (69%), Gaps = 4/84 (5%)
 Frame = -2

Query  244  VVTLQT-AMAA--DPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKY  74
            V+ LQT A+ A  DPLFH CSN  NFT N  YQ NLN L+G LY + P  GFG GS G+ 
Sbjct  16   VLLLQTVALGANVDPLFHSCSNE-NFTANGPYQTNLNTLVGYLYHQAPTTGFGIGSLGQN  74

Query  73   YDQTYGLSLCRGDVSAADCKSCVA  2
              Q  GL+LCRGDVSA+DCK CVA
Sbjct  75   PSQANGLALCRGDVSASDCKRCVA  98



>ref|XP_010069666.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89431.1| hypothetical protein EUGRSUZ_A01730 [Eucalyptus grandis]
Length=239

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
            + A+   PLFHFC+ SGNFT NS Y++NLN+L   L+ KTP +GF   S G++  + YG+
Sbjct  18   RAALGEGPLFHFCT-SGNFTANSPYESNLNKLTSFLHTKTPPSGFALDSIGRHQHRVYGI  76

Query  52   SLCRGDVSAADCKSCVA  2
            +LCRGDVS + CK+CVA
Sbjct  77   ALCRGDVSPSVCKACVA  93



>gb|KDO59870.1| hypothetical protein CISIN_1g046481mg [Citrus sinensis]
Length=247

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdly  122
            +++   S  FSLL+  ++ + T+      DP+ + CSN  NFT N  YQ NLN L+G +Y
Sbjct  1    MSSPRVSSTFSLLISFALLLQTVTFGANVDPISYSCSNE-NFTANGRYQTNLNALMGYIY  59

Query  121  LKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
             + P  GFG GS GK   Q  GL+LCRGDVSA+DCK+CVA
Sbjct  60   HQAPPTGFGIGSLGKNPIQANGLALCRGDVSASDCKTCVA  99



>ref|XP_010532487.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Tarenaya 
hassleriana]
Length=251

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = -2

Query  271  SLLLLVSMAVVTLQTAMAADP----LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPI  107
            +L+LL  MAV+ L  ++++      LFH CS+  G FT  S Y+ NLN LLG L  K P 
Sbjct  5    NLVLLHCMAVLLLVRSVSSSQDNAFLFHVCSDIEGTFTTKSPYETNLNMLLGSLSYKAPP  64

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             GFG GSAG+  D+  GL+LCRGDVS ADC+SC+
Sbjct  65   TGFGLGSAGQSPDKVNGLALCRGDVSPADCRSCI  98



>ref|XP_008236988.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M  SK   L LLV       ++A+ A PL+HFC +  N+T NS+Y  NLN L   LY K 
Sbjct  1    MIFSKSIPLFLLV--LCFFHRSAIGASPLYHFCFSPENYTANSSYGANLNLLFNLLYSKV  58

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P +GFG GS G   +Q  GL+LCRGDVS+ +C +CV
Sbjct  59   PPSGFGLGSTGHAQNQANGLALCRGDVSSKNCNTCV  94



>ref|XP_008342465.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=242

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
             +A+ A PL+HFC +  N+T +S Y  NLN L   LY K P  GFG GS G+  +Q  GL
Sbjct  19   HSAIGASPLYHFCFSPENYTADSPYGANLNSLFSLLYTKVPPTGFGLGSTGQAKNQVNGL  78

Query  52   SLCRGDVSAADCKSCV  5
            +LCRGDVS+ DC +CV
Sbjct  79   ALCRGDVSSKDCNTCV  94



>ref|XP_008237025.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
             +A+ A PL+HFC +  N+T NS+Y  NLN L   LY K P +GFG GS G   +Q  GL
Sbjct  19   HSAIGASPLYHFCFSQENYTANSSYGANLNLLFNLLYTKVPPSGFGLGSTGDAQNQVNGL  78

Query  52   SLCRGDVSAADCKSCV  5
            +LCRGDVS+ +C +CV
Sbjct  79   ALCRGDVSSKNCNTCV  94



>ref|XP_008228908.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=240

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -2

Query  229  TAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLS  50
            TA+ A  LFHFC +  N+T  S Y  NL QL   LY K P  GFG GS GK  +Q  GL+
Sbjct  20   TALGAS-LFHFCFSKENYTARSPYDANLIQLFNLLYKKVPPTGFGLGSTGKGQNQANGLA  78

Query  49   LCRGDVSAADCKSCV  5
            LCRGDVS+ DCK+CV
Sbjct  79   LCRGDVSSQDCKTCV  93



>ref|XP_006373161.1| hypothetical protein POPTR_0017s09240g [Populus trichocarpa]
 gb|ERP50958.1| hypothetical protein POPTR_0017s09240g [Populus trichocarpa]
Length=327

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = -2

Query  295  AMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            AMA SKL      + + ++ L  A A DPL+HFCS +GNFT +S+Y++NLN LL      
Sbjct  4    AMAASKLLFFFCPIFIYLLVLSIAQA-DPLYHFCSKTGNFTNSSDYKSNLNNLLSSFSSN  62

Query  115  TPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            T I+ GF + S G+  D+   +SLCRGD     C+SC+
Sbjct  63   TKIDYGFYNDSYGQNNDKVTAISLCRGDKKPETCRSCI  100



>ref|XP_007201324.1| hypothetical protein PRUPE_ppa009992mg [Prunus persica]
 gb|EMJ02523.1| hypothetical protein PRUPE_ppa009992mg [Prunus persica]
Length=268

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  229  TAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLS  50
            +A+ A PL HFC +  N+T  S+Y  NLN L   LY K P +GFG GS G   +Q  GL+
Sbjct  20   SAIGASPLKHFCFSPENYTAESSYGANLNLLFNLLYTKVPPSGFGLGSTGHAQNQVNGLA  79

Query  49   LCRGDVSAADCKSCV  5
            LCRGDVS  +C +CV
Sbjct  80   LCRGDVSRQNCNTCV  94



>ref|XP_008391617.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=242

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
             +A+ A PL+H C +  N+  +S Y  NLN L   LY K P  GFG GS G   +Q  GL
Sbjct  19   HSAIGASPLYHICFSQQNYPASSPYGANLNLLFNLLYTKVPPTGFGLGSTGHAKNQVNGL  78

Query  52   SLCRGDVSAADCKSCVA  2
            +LCRGDVS+ DC +CV 
Sbjct  79   ALCRGDVSSKDCNTCVV  95



>ref|XP_008788477.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Phoenix 
dactylifera]
Length=262

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (58%), Gaps = 1/95 (1%)
 Frame = -2

Query  286  TSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPI  107
            T KL  LL   +   +   ++   DPL +FC+NS N T N     N+NQ++ +L     +
Sbjct  4    TQKLLHLLYFFTFLFILPPSSNCTDPLGNFCNNSNNIT-NGQTSANINQVVAELLANASV  62

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            +GF + S G   DQ +GL+ CRGDVSA  CKSC+A
Sbjct  63   SGFATASYGSKNDQVFGLAQCRGDVSADGCKSCLA  97



>ref|XP_008800494.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix 
dactylifera]
Length=686

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING-FGSGSAGKYYDQTYGLSLC  44
            AADPL+  C  +GN+TP S Y +NL  +L  L   T ++G F + + G+  +Q YGL+LC
Sbjct  30   AADPLYQICGKTGNYTPKSTYDSNLQLVLNSLDANTSLSGGFSNATVGQVPNQIYGLALC  89

Query  43   RGDVSAADCKSCV  5
            RGD +A+ C+SC+
Sbjct  90   RGDTNASVCRSCL  102



>ref|XP_006447471.1| hypothetical protein CICLE_v10018332mg, partial [Citrus clementina]
 gb|ESR60711.1| hypothetical protein CICLE_v10018332mg, partial [Citrus clementina]
Length=219

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 57/91 (63%), Gaps = 7/91 (8%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFG  95
            F+LLL       T+      DP+ + CSN  NFT N  YQ NLN L+G +Y + P  GFG
Sbjct  1    FALLLQ------TVTFGANVDPISYSCSNE-NFTANGRYQTNLNALMGYIYHQAPPTGFG  53

Query  94   SGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
             GS GK   Q  GL+LCRGDVSA+DCK+CVA
Sbjct  54   IGSLGKNPIQANGLALCRGDVSASDCKTCVA  84



>ref|XP_003633310.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Vitis vinifera]
 emb|CBI28970.3| unnamed protein product [Vitis vinifera]
Length=241

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
              A+  DPLFHFC+ S  F  N  Y+ NLN+L+  L +  P  GFG  S G   D++ GL
Sbjct  20   NNAVGVDPLFHFCTGSEKFIDNGPYETNLNKLMDSLQILAPPTGFGKASVGLNADRSNGL  79

Query  52   SLCRGDVSAADCKSCV  5
            +LCR DVS  DCK+CV
Sbjct  80   ALCRPDVSNTDCKACV  95



>ref|XP_011037144.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKY-YDQTYG  56
            Q  +  DPLF  CS++ N T NS+Y+ +LN L+G LY   P+ GF  GS G+   D+ YG
Sbjct  20   QNVLGTDPLFSRCSSNANSTANSSYKTSLNVLMGSLYHLAPVEGFALGSLGQNNQDRPYG  79

Query  55   LSLCRGDVSAADCKSCVA  2
            L LCRGDVS++DC++C A
Sbjct  80   LVLCRGDVSSSDCRTCAA  97



>gb|KDP32106.1| hypothetical protein JCGZ_12567 [Jatropha curcas]
Length=241

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -2

Query  214  DPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKY-YDQTYGLSLCRG  38
            DPLF+ CS + NFT +S+Y  +L++L+ ++    P  GF  GS G+   D+ YGL+LCRG
Sbjct  24   DPLFYSCSRTENFTVSSSYAKSLHKLIENIKYLAPAKGFALGSLGQTSQDRPYGLTLCRG  83

Query  37   DVSAADCKSCVA  2
            D+SA+DC +C+A
Sbjct  84   DISASDCLTCIA  95



>ref|XP_006372982.1| hypothetical protein POPTR_0017s06760g [Populus trichocarpa]
 gb|ERP50779.1| hypothetical protein POPTR_0017s06760g [Populus trichocarpa]
Length=245

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKY-YDQTYG  56
            Q  +  DPLF  CS++ N T NS+Y+ +LN L+G LY   P+ GF  GS G+   D+ YG
Sbjct  20   QNVLGTDPLFSRCSSNANSTANSSYKTSLNVLMGSLYHLAPVEGFALGSLGQNNQDRPYG  79

Query  55   LSLCRGDVSAADCKSCVA  2
            L LCRGDVS++DC++C A
Sbjct  80   LVLCRGDVSSSDCRTCAA  97



>ref|XP_004295244.1| PREDICTED: uncharacterized protein LOC101314549 [Fragaria vesca 
subsp. vesca]
Length=1272

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPI-NG  101
             S++L + +A++   T   ADPLF  CS+  GN+TP++ ++ NL QLL  L   T I  G
Sbjct  614  LSVMLFMILALLLPATVSGADPLFTLCSSGDGNYTPSTQFETNLKQLLESLSFNTSIFGG  673

Query  100  FGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            F S + G   D  YG +LCRGDV++  C+ CV+
Sbjct  674  FYSNTIGTGRDTVYGQTLCRGDVNSTVCQKCVS  706



>ref|XP_010908261.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Elaeis 
guineensis]
Length=262

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 50/95 (53%), Gaps = 1/95 (1%)
 Frame = -2

Query  286  TSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPI  107
            T KL  L    +   +   ++   DPL +FC+NS N T +    N    L   L   +  
Sbjct  4    TQKLLHLFYFATFLFLLPLSSNCTDPLGNFCNNSNNITNSQTSANINKVLAELLANASG-  62

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            +GF + S G   DQ +GL+ CRGDVSA DCKSC+A
Sbjct  63   SGFATASYGSKNDQVFGLAQCRGDVSADDCKSCLA  97



>ref|XP_008237024.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -2

Query  271  SLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGS  92
            S+ L   +  V   +A+ A PL HFC +  N+T +S+Y  NLN L   LY K P +GFG 
Sbjct  6    SIPLCFLVLCVFHHSAIGASPLKHFCFSPENYTADSSYGANLNLLFNLLYTKVPPSGFGL  65

Query  91   GSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            GS G   +Q  GL+LCRGDV + +C +CV
Sbjct  66   GSTGHAQNQVNGLALCRGDVLSQNCSTCV  94



>ref|XP_009412444.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Musa 
acuminata subsp. malaccensis]
Length=674

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            MATS   SLL L+ +   +   AMA  PL+  C ++GN+T NS Y++N++ LL  L    
Sbjct  1    MATSGSISLLCLLVVLCFSCSPAMA-QPLYQVCDDTGNYTANSTYKSNIDLLLSSLASNG  59

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
             ++GF +G+AG+  DQ  G+ LCRGDV+ ADC SC+A
Sbjct  60   SLSGFYNGTAGRSPDQISGIILCRGDVTTADCSSCLA  96



>ref|XP_008455405.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=258

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = -2

Query  208  LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYD---QTYGLSLCRG  38
            LFH CS+  N+T NS Y +NLNQ L  L    P +GFG  S GK  D   Q  GL+LCRG
Sbjct  34   LFHICSSFDNYTSNSPYASNLNQALDQLISNAPPSGFGLSSVGKDDDLQNQVNGLALCRG  93

Query  37   DVSAADCKSCVA  2
            DVS+ADCK+C+A
Sbjct  94   DVSSADCKNCIA  105



>ref|XP_009412446.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -2

Query  298  AAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyL  119
            + MATS   SLL L+ +   +   AMA  PL+  C N+GN+T NS Y++NL+ LL  L  
Sbjct  22   STMATSGSISLLCLLVVLCFSSSPAMA-QPLYQVCDNTGNYTANSTYKSNLDLLLSSLAS  80

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
               ++GF +G+AG+  DQ  G+ LCRGDV+ ADC SC+A
Sbjct  81   NGSLSGFYNGTAGQSPDQVSGIILCRGDVATADCSSCLA  119



>ref|XP_011037143.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKY-YDQTYG  56
            Q  +  DPLF  CS++ N T  S+Y  +LN L+G LY   P+ GF  GS G+   D+ YG
Sbjct  20   QNILGTDPLFSRCSSNANSTATSSYITSLNVLMGSLYRLAPVEGFALGSLGQNNQDRPYG  79

Query  55   LSLCRGDVSAADCKSCVA  2
            L LCRGDV ++DC++C A
Sbjct  80   LVLCRGDVPSSDCRTCAA  97



>gb|KDP20813.1| hypothetical protein JCGZ_21284 [Jatropha curcas]
Length=315

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 61/99 (62%), Gaps = 5/99 (5%)
 Frame = -2

Query  292  MATSKLFSLLL--LVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyL  119
            M +S+L  L    L+ + VVT+  A    PLF+FC+N+GNFT NS Y +NL+++L  L  
Sbjct  1    MGSSRLLLLFYPTLIQLLVVTI--AQPIPPLFYFCNNNGNFTANSTYSSNLDRILTSLSS  58

Query  118  KTPI-NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             T I +GF + S G+  D+   ++LCRGD     C+SC+
Sbjct  59   NTKISSGFYNDSIGQNTDKVNAIALCRGDTKPEICRSCI  97



>gb|KDP20811.1| hypothetical protein JCGZ_21282 [Jatropha curcas]
Length=1279

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -2

Query  262  LLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSA  83
            L + + ++ L   + ADPL+  CS + N+T NS ++NNL  L   L  KTP+ GF + S 
Sbjct  10   LFLIIPLIVLPKPIGADPLYTDCSAANNYTLNSTFENNLKLLFQTLTSKTPLTGFYNNSI  69

Query  82   GKYYDQTYGLSLCRGDVSAADCKSCV  5
            G   D+ +G +LCRGD++A  C+ CV
Sbjct  70   GGGPDRVHGQALCRGDLNAKACQDCV  95



>ref|XP_002533571.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF28806.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=243

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFG  95
             SL LL +  V+ +Q+    +PLFH CS + NFT N +Y  +LN+L+G+        GF 
Sbjct  6    ISLYLLST--VLLVQSVYGIEPLFHSCSTNENFTANGHYDKSLNKLIGNFNYLAAAKGFA  63

Query  94   SGSAG-KYYDQTYGLSLCRGDVSAADCKSCVA  2
             GS G    D  YGL+LCRGD++A+DC +CVA
Sbjct  64   LGSLGMNRQDLPYGLTLCRGDITASDCITCVA  95



>gb|AFK33693.1| unknown [Lotus japonicus]
Length=261

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = -2

Query  277  LFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGF  98
            +FSLLL +S+A    ++   + PL  FC+ +   +       N+++LL +  LKTP  GF
Sbjct  8    IFSLLLCISIA----ESQDLSGPLGEFCNENTKISSGGKLSANIDKLLAEFILKTPSTGF  63

Query  97   GSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             + S G   DQ YGL+ CRGDVS  DC +C+
Sbjct  64   VATSYGNNQDQVYGLAQCRGDVSTQDCSNCI  94



>ref|XP_006373141.1| hypothetical protein POPTR_0017s09090g, partial [Populus trichocarpa]
 gb|ERP50938.1| hypothetical protein POPTR_0017s09090g, partial [Populus trichocarpa]
Length=233

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADP--LFHFCSNSGNFTPnsnyqnnlnqllgdly---LKTP  110
            FS+ LL   A++T+    A +    +HFC N+  F  NS YQ NL  LL  L     +  
Sbjct  6    FSIFLLSFAALMTINITEAQEINYRYHFCQNTTTFVRNSTYQANLKILLSSLAFNATRND  65

Query  109  INGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            INGF + SAG+  D+ YGL LCRGDVS   C  CV
Sbjct  66   INGFYNASAGQDIDEVYGLFLCRGDVSVEVCLKCV  100



>ref|XP_010931306.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=681

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK-TPINGFGSGSAGKYYDQTYGLSLC  44
            AADPL+  C  +GN+T NS Y +NLN L  +L    +  NGF + S G   +Q YGL+LC
Sbjct  27   AADPLYEICGGTGNYTANSPYASNLNLLFPNLTSNASSSNGFATASTGLAPNQIYGLALC  86

Query  43   RGDVSAADCKSCV  5
            RGDV+ ++C+SC+
Sbjct  87   RGDVNISECQSCL  99



>ref|XP_007140710.1| hypothetical protein PHAVU_008G135300g [Phaseolus vulgaris]
 gb|ESW12704.1| hypothetical protein PHAVU_008G135300g [Phaseolus vulgaris]
Length=257

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  226  AMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSL  47
            A A DPL  FC+ + N +       N++++LG++ LKTP  GF + + GK  DQ Y L  
Sbjct  18   AKAVDPLGEFCNRNTNISNGGKLSANIDKVLGEVALKTPSTGFVATTYGKGRDQVYALGQ  77

Query  46   CRGDVSAADCKSCV  5
            CRGDVS  DC SC+
Sbjct  78   CRGDVSTEDCSSCI  91



>ref|XP_008804396.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix 
dactylifera]
Length=683

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query  265  LLLVSMAVVTLQTA-MAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK-TPINGFGS  92
            + L S+  + L+ A  AADPL+ FC  +GN+T  S Y +NLN L  +L    +  +GF +
Sbjct  13   VFLGSLVFLLLRCAPTAADPLYEFCGGTGNYTAKSAYASNLNLLFPNLTSNASSSDGFAT  72

Query  91   GSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             + G   +Q +GL+LCRGDV+ ++C+SC+
Sbjct  73   ATIGLTPNQIFGLALCRGDVNTSECQSCL  101



>ref|XP_011010156.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X1 [Populus euphratica]
Length=311

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = -2

Query  295  AMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            AMA S+L  L   + + ++ L  A + DPL+H CS +GNFT +S+Y++NLN LL      
Sbjct  2    AMAASRLLFLFCPIFINLLVLSIAQS-DPLYHICSETGNFTNSSDYKSNLNNLLSSFSSN  60

Query  115  TPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            T I+ GF + S G+   +   +SLCRGD     C+SC+
Sbjct  61   TKIDYGFYNDSYGQNNGKVNAISLCRGDKKPETCRSCI  98



>ref|XP_011010157.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X2 [Populus euphratica]
Length=304

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = -2

Query  295  AMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            AMA S+L  L   + + ++ L  A + DPL+H CS +GNFT +S+Y++NLN LL      
Sbjct  2    AMAASRLLFLFCPIFINLLVLSIAQS-DPLYHICSETGNFTNSSDYKSNLNNLLSSFSSN  60

Query  115  TPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            T I+ GF + S G+   +   +SLCRGD     C+SC+
Sbjct  61   TKIDYGFYNDSYGQNNGKVNAISLCRGDKKPETCRSCI  98



>ref|XP_002518550.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF43937.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=663

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSN---SGNFTPnsnyqnnlnqllgdly  122
            M  S L  +L LV + ++ L  ++AA+PLF  CS+   + N+T NS ++NNL  L  +L 
Sbjct  1    MDKSTLPDMLFLV-VPILILSNSVAANPLFTDCSHGTTAENYTLNSPFENNLKLLFQNLT  59

Query  121  LKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
              TP+ GF + S G+  D+ +G +LCRGD+ A  C++C+
Sbjct  60   SMTPLTGFYNTSIGESPDRVHGQALCRGDIHATACRTCI  98



>ref|XP_006372983.1| hypothetical protein POPTR_0017s06770g [Populus trichocarpa]
 gb|ERP50780.1| hypothetical protein POPTR_0017s06770g [Populus trichocarpa]
Length=245

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKY-YDQTYG  56
            Q  +  DP F  CS++ N T NS Y+ +LN L+G LY   P+ GF  GS G+   D+ YG
Sbjct  20   QNVLGTDPHFSRCSSNANSTANSFYKTSLNVLMGSLYHLAPVEGFALGSLGQNNQDRPYG  79

Query  55   LSLCRGDVSAADCKSCVA  2
            L LCRGDVS++DC++C A
Sbjct  80   LVLCRGDVSSSDCRTCAA  97



>ref|XP_008455404.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=249

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = -2

Query  292  MATSKLF-SLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            M  SK F  +LL    A+  + T + A  L+H CS+S N+T NS Y +NL Q L  L   
Sbjct  1    MRQSKPFVPILLFFLSALGNIITTINASYLYHTCSSSDNYTMNSLYASNLRQALDRLTNS  60

Query  115  TPINGFGSGSAG--KYYDQTYGLSLCRGDVSAADCKSCV  5
             P +GFG  S G     +Q  GL+LCRGD+S  DCK+CV
Sbjct  61   APPSGFGLSSTGGKDSQNQVNGLALCRGDISPTDCKTCV  99



>ref|XP_007149947.1| hypothetical protein PHAVU_005G112700g [Phaseolus vulgaris]
 gb|ESW21941.1| hypothetical protein PHAVU_005G112700g [Phaseolus vulgaris]
Length=249

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -2

Query  211  PLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDV  32
            PLF FC N  N+T +S Y  NLNQL   L+ K  +NGF   S G+  D+  GL+LCRGDV
Sbjct  34   PLFRFCFNHENYTDSSPYATNLNQLFDLLHTKVSLNGFALDSIGQGMDKVNGLALCRGDV  93

Query  31   SAADCKSCV  5
            +A +C SCV
Sbjct  94   NATNCMSCV  102



>ref|XP_004144581.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43545.1| hypothetical protein Csa_7G044850 [Cucumis sativus]
Length=256

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = -2

Query  208  LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYD---QTYGLSLCRG  38
            LFH CS+  N+T NS Y +NLNQ L  L   +P +GFG  S  K  D   Q  GL+LCRG
Sbjct  34   LFHICSSFDNYTSNSPYASNLNQALDQLISNSPPSGFGLSSVRKDDDLQNQVNGLALCRG  93

Query  37   DVSAADCKSCVA  2
            DVS+ADCK+CVA
Sbjct  94   DVSSADCKNCVA  105



>ref|XP_004290148.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=263

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M   +  S+L+L+ +++ +++   AADP+  FC+N    + +S    N++ LL  L  KT
Sbjct  1    MKIMRHTSILILLVLSICSIE---AADPMADFCNNDSKISKSSTISANIDALLAQLVSKT  57

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGD-VSAADCKSCV  5
            P  GF + S GK   Q YGL+ CRGD V + DC SC+
Sbjct  58   PSTGFSATSYGKGQAQVYGLAQCRGDVVGSKDCSSCI  94



>ref|XP_011010160.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Populus 
euphratica]
Length=684

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 46/94 (49%), Gaps = 7/94 (7%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNF---TPnsnyqnnlnqllgdlyLKTPIN  104
            FS+ LL   +   L  A  +  L+H CSN+  F   +P     N L   L     +  IN
Sbjct  6    FSIFLL---SFAALTEAQESPYLYHKCSNTTTFKRNSPYQANLNILLSSLAGNATRNEIN  62

Query  103  GFGSGSAG-KYYDQTYGLSLCRGDVSAADCKSCV  5
            GF + S G   YDQ YGL LCRGDVS   C  CV
Sbjct  63   GFYNASTGHDVYDQVYGLFLCRGDVSVEVCLECV  96



>emb|CDP04313.1| unnamed protein product [Coffea canephora]
Length=242

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGL  53
            Q A  A+PL+H C+   NFT N +Y  NLN LL DLY  TP +G+   S     D  YG 
Sbjct  20   QIAAGAEPLYHTCTTYKNFTANRDYDRNLNILLNDLYYNTPASGYKYISVSGKNDSVYGS  79

Query  52   SLCRGDVSAADCKSCV  5
            +LCRGD+S ADC+ CV
Sbjct  80   ALCRGDISKADCQICV  95



>ref|XP_004295245.1| PREDICTED: uncharacterized protein LOC101314835 [Fragaria vesca 
subsp. vesca]
Length=1322

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = -2

Query  277  LFSLLLLVSMAVVTLQTAMAADPLFHFCS-NSGNFTPnsnyqnnlnqllgdlyLKTPI-N  104
            + S++L + + ++   T    DPLF FCS  + N+TP+S +++NL QLL  L   T I  
Sbjct  664  ILSVMLFMILPLLFPATISGVDPLFTFCSPEARNYTPSSQFESNLKQLLESLSFNTSIFG  723

Query  103  GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            GF + + G  +D+ YG +LCRGDV++  C+ CV+
Sbjct  724  GFYNNTIGTSHDRVYGQTLCRGDVNSTVCQKCVS  757



>ref|XP_009405651.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Musa 
acuminata subsp. malaccensis]
Length=677

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -2

Query  226  AMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSL  47
             ++ADPL++ C  +GNF+ NS YQ NLN LL  L      +GF + + G+  DQ YG +L
Sbjct  21   VISADPLYNICGTTGNFSANSTYQTNLNLLLSRLASNVSASGFINDTVGRTPDQVYGFAL  80

Query  46   CRGDVSAADCKSCV  5
            CRGDV+++ C SCV
Sbjct  81   CRGDVNSSACGSCV  94



>ref|XP_010524650.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Tarenaya 
hassleriana]
Length=262

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGS-GSAGKYYDQTYGLSLC  44
            AAD ++  C+   NFT NS    N++ LL  L  +TP  GF +  S+G+  D+ YGL+ C
Sbjct  20   AADSIWELCNKDSNFTRNSRVSMNIDSLLVTLVSETPSKGFFTVSSSGQNQDKVYGLAQC  79

Query  43   RGDVSAADCKSCV  5
            RGD+S  DC SCV
Sbjct  80   RGDISRTDCSSCV  92



>ref|XP_008225008.1| PREDICTED: uncharacterized protein LOC103324687 [Prunus mume]
Length=1397

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 7/105 (7%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADP--LFHFCSNS-GNFTPnsnyqnnlnqllg  131
            + AMA+S+ F   L+ ++ ++ + T   A P  L+HFC N+ GN+T NS Y  NLN LL 
Sbjct  706  MPAMASSR-FLFFLIYAILLLIMITQAFAQPAFLYHFCINNIGNYTNNSTYHKNLNTLLS  764

Query  130  dlyLKTPINGFG---SGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             L      NG+G   S       DQ Y + LCRGDV A DC+SC+
Sbjct  765  SLPSDENGNGYGFYNSSYGQNSDDQVYAIGLCRGDVKAEDCRSCL  809



>emb|CAN80170.1| hypothetical protein VITISV_018433 [Vitis vinifera]
Length=283

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 49/95 (52%), Gaps = 1/95 (1%)
 Frame = -2

Query  283  SKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn-yqnnlnqllgdlyLKTPI  107
            S+    L  + +A+  L    A D ++H CSN+    PNS    N  + L       T  
Sbjct  5    SRNLLFLCALGLAISCLAIQAAPDYIYHLCSNTTTIKPNSTYQTNLNSLLSSLSSNATRA  64

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            NGF + +AG+  D TYGL LCRGDV+   C+ CVA
Sbjct  65   NGFYNATAGQSPDXTYGLFLCRGDVAIDYCRDCVA  99



>emb|CBI29181.3| unnamed protein product [Vitis vinifera]
Length=497

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 53/104 (51%), Gaps = 3/104 (3%)
 Frame = -2

Query  304  KLAAMATSKLFSLLLL--VSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn-yqnnlnqll  134
            ++  M  S   +LL L  + +A+  L    A D + H CSN+    PNS    N  + L 
Sbjct  159  EIVVMKVSFSRNLLFLCALGLAISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLS  218

Query  133  gdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
                  T  NGF + +AG+  D  YGL LCRGDV+  DC+ CVA
Sbjct  219  SLSSNATRANGFYNATAGQSPDVAYGLFLCRGDVAIDDCRDCVA  262



>ref|XP_006406217.1| hypothetical protein EUTSA_v10021371mg [Eutrema salsugineum]
 dbj|BAJ34612.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47670.1| hypothetical protein EUTSA_v10021371mg [Eutrema salsugineum]
Length=255

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPINGF  98
              LL + S++  +   A     L+H CS+  GNFT  S Y++NL+ L   +  + P +GF
Sbjct  20   IQLLFIQSVSSQSQNNAF----LYHKCSDIEGNFTSKSPYESNLDSLFRRISYRVPSSGF  75

Query  97   GSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
             + SAG   D   GL+LCRGD S++DC SC+A
Sbjct  76   AASSAGNSPDNVNGLALCRGDASSSDCGSCLA  107



>ref|XP_007216147.1| hypothetical protein PRUPE_ppa015075mg [Prunus persica]
 gb|EMJ17346.1| hypothetical protein PRUPE_ppa015075mg [Prunus persica]
Length=230

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            K P  GFG GS GK  +Q  GL+LCRGDVS+ DCK+CV
Sbjct  62   KVPPTGFGLGSTGKGQNQANGLALCRGDVSSQDCKTCV  99



>ref|XP_010644356.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Vitis 
vinifera]
Length=307

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 48/95 (51%), Gaps = 1/95 (1%)
 Frame = -2

Query  283  SKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn-yqnnlnqllgdlyLKTPI  107
            S+    L  + +A+  L    A D + H CSN+    PNS    N  + L       T  
Sbjct  6    SRNLLFLCALGLAISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLSSLSSNATRA  65

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            NGF + +AG+  D  YGL LCRGDV+  DC+ CVA
Sbjct  66   NGFYNATAGQSPDVAYGLFLCRGDVAIDDCRDCVA  100



>ref|XP_010910239.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=686

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = -2

Query  223  MAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING-FGSGSAGKYYDQTYGLSL  47
            ++ADPL+  C  +GN+T NS Y +NLN LL  L   T  +G F + + G+  +Q YGL+L
Sbjct  30   VSADPLYQICGKTGNYTTNSTYDSNLNILLTSLDSNTSRSGGFSNFTVGQTPNQIYGLAL  89

Query  46   CRGDVSAADCKSCV  5
            CRGD +A+ C+SC+
Sbjct  90   CRGDTNASTCRSCL  103



>emb|CAN65760.1| hypothetical protein VITISV_001837 [Vitis vinifera]
Length=316

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 48/95 (51%), Gaps = 1/95 (1%)
 Frame = -2

Query  283  SKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn-yqnnlnqllgdlyLKTPI  107
            S+    L  + +A+  L    A D + H CSN+    PNS    N  + L       T  
Sbjct  6    SRNLLFLCALGLAISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLSSLSSNATRA  65

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            NGF + +AG+  D  YGL LCRGDV+  DC+ CVA
Sbjct  66   NGFYNATAGQSPDVAYGLFLCRGDVAIDDCRDCVA  100



>ref|NP_566697.1| Receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
 sp|Q9LRJ9.1|CRR38_ARATH RecName: Full=Cysteine-rich repeat secretory protein 38; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB01391.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59407.1| unknown protein [Arabidopsis thaliana]
 gb|ABD91491.1| At3g22060 [Arabidopsis thaliana]
 gb|AEE76585.1| Receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
Length=252

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = -2

Query  265  LLLVSMAVVTLQTAMAADP----LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPING  101
            +L +++ ++++ T ++       LFH CS+  G+FT  S Y++NLN L   L  K P  G
Sbjct  12   ILAIAIQILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLFSQLSYKVPSTG  71

Query  100  FGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            F + S G   +   GL+LCRGD S++DC+SC+ 
Sbjct  72   FAASSTGNTPNNVNGLALCRGDASSSDCRSCLE  104



>ref|NP_001049722.1| Os03g0277700 [Oryza sativa Japonica Group]
 gb|ABF95271.1| 33 kDa secretory protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11636.1| Os03g0277700 [Oryza sativa Japonica Group]
Length=265

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = -2

Query  295  AMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            A+ +SK    LLLVS A++ L  +MA DPL  +CS +     +    +  + L   +   
Sbjct  2    AIISSKACRCLLLVSFALLPL--SMAMDPLGSYCSGNSLAGSSKAVASINSVLTDLVTKG  59

Query  115  TPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            +   GF + +AGK  +  YGL  CRGDVS +DC++C+A
Sbjct  60   STGVGFATSTAGKGNNVIYGLVQCRGDVSTSDCQACLA  97



>gb|EAY89462.1| hypothetical protein OsI_10995 [Oryza sativa Indica Group]
Length=265

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = -2

Query  295  AMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            A+ +SK    LLLVS A++ L  +MA DPL  +CS +     +    +  + L   +   
Sbjct  2    AIISSKACRCLLLVSFALLPL--SMAMDPLGSYCSGNSLAGSSKAVASINSVLTDLVTKG  59

Query  115  TPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            +   GF + +AGK  +  YGL  CRGDVS +DC++C+A
Sbjct  60   STGVGFATSTAGKGNNVIYGLVQCRGDVSTSDCQACLA  97



>ref|XP_004292427.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Fragaria 
vesca subsp. vesca]
Length=244

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -2

Query  235  LQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYG  56
            + ++  A  L HFC +  N+T +S Y  +L +L   L  K P  GFG  S G+   +  G
Sbjct  18   IHSSFGASSLNHFCFSHENYTADSPYDAHLTRLFTLLQTKVPPTGFGLASTGQGLKKANG  77

Query  55   LSLCRGDVSAADCKSCVA  2
            L+LCRGDVS+ DC +CV 
Sbjct  78   LALCRGDVSSEDCTTCVV  95



>ref|XP_010240979.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=947

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  217  ADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRG  38
            A  L++ CSN+ ++TPNS+++ NL+ LL  L       GF + S G+Y DQ YGL LCRG
Sbjct  441  AQLLYNACSNTSSYTPNSHFETNLDILLPSLSSNAINTGFYNTSVGEYPDQVYGLVLCRG  500

Query  37   DVSAADCKSCV  5
            D +  DC+ C+
Sbjct  501  DTTPEDCQDCL  511



>gb|KCW76451.1| hypothetical protein EUGRSUZ_D00843 [Eucalyptus grandis]
Length=669

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 10/78 (13%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPIN-GF-----GSGSAGKYYDQTY  59
             ADPL++FC  +GNFT N  Y +NLN LL  +   T  + GF     GSGSA    D   
Sbjct  24   GADPLYYFCGTNGNFTANGTYGDNLNALLTSVITATAADYGFYNLSAGSGSA----DAIN  79

Query  58   GLSLCRGDVSAADCKSCV  5
             ++LCRGDV AADC+SC+
Sbjct  80   AIALCRGDVGAADCRSCL  97



>ref|XP_010054432.1| PREDICTED: uncharacterized protein LOC104442733 [Eucalyptus grandis]
Length=1358

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 10/78 (13%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPIN-GF-----GSGSAGKYYDQTY  59
             ADPL++FC  +GNFT N  Y +NLN LL  +   T  + GF     GSGSA    D   
Sbjct  24   GADPLYYFCGTNGNFTANGTYGDNLNALLTSVITATAADYGFYNLSAGSGSA----DAIN  79

Query  58   GLSLCRGDVSAADCKSCV  5
             ++LCRGDV AADC+SC+
Sbjct  80   AIALCRGDVGAADCRSCL  97



>ref|XP_011007911.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Populus 
euphratica]
Length=567

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 49/102 (48%), Gaps = 8/102 (8%)
 Frame = -2

Query  298  AAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNF---TPnsnyqnnlnqllgd  128
            AA+   KL S+ LL   A+   Q     D   H CSN+  F   +P     N L   L  
Sbjct  245  AAVVKGKL-SIFLLSFAALTEAQEIFFLD---HKCSNTTTFVRNSPYQANLNILLSSLAA  300

Query  127  lyLKTPINGFGSGSAGK-YYDQTYGLSLCRGDVSAADCKSCV  5
               +  INGF + S G   YDQ YGL LCRGDVS   C+ CV
Sbjct  301  NATRNDINGFYNASTGHDVYDQVYGLFLCRGDVSVEVCQECV  342


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 6/94 (6%)
 Frame = -2

Query  268  LLLLVSMAVVTLQTAMAADPLF---HFCSNSGNF---TPnsnyqnnlnqllgdlyLKTPI  107
            L+L +S+ +++      A  +F   H CSN+  F   +P     N L   L     +  I
Sbjct  2    LVLKLSIFLLSFAALTEAQEIFFLDHKCSNTTTFVRNSPYQANLNILLSSLAANATRNDI  61

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            NGF + S G    + YGL LCRGDVS   C+ CV
Sbjct  62   NGFYNASTGHDVYEVYGLFLCRGDVSVEVCQECV  95



>ref|XP_007216947.1| hypothetical protein PRUPE_ppa016345mg [Prunus persica]
 gb|EMJ18146.1| hypothetical protein PRUPE_ppa016345mg [Prunus persica]
Length=210

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            K P  GFG GS G+  +Q  GL+LCRGDVS+ DCK+CV
Sbjct  26   KVPPTGFGLGSTGEGQNQANGLALCRGDVSSQDCKTCV  63



>ref|XP_007043326.1| Cysteine-rich RLK 10, putative [Theobroma cacao]
 gb|EOX99157.1| Cysteine-rich RLK 10, putative [Theobroma cacao]
Length=642

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  226  AMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSL  47
            ++A    F FC ++GN+T  S Y  N+N  L  L     +NGF + + G+  D+ YGL  
Sbjct  24   SVADQGRFFFCDSAGNYTTRSIYGQNVNTTLSSLAANASLNGFYTTTVGQDLDKVYGLVQ  83

Query  46   CRGDVSAADCKSCV  5
            CRGDVS  DC++CV
Sbjct  84   CRGDVSKEDCQTCV  97



>ref|XP_007213610.1| hypothetical protein PRUPE_ppa002309mg [Prunus persica]
 gb|EMJ14809.1| hypothetical protein PRUPE_ppa002309mg [Prunus persica]
Length=689

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = -2

Query  283  SKLFSLLLLVSMAVVTLQTAMAADP--LFHFCSNS-GNFTPnsnyqnnlnqllgdlyLKT  113
            S  F   L+ ++ ++ + T   A P  L+HFC N+ GN+T NS Y  NLN LL  L    
Sbjct  3    SSRFLFFLIYAILLLIMITQAFAQPAFLYHFCKNNIGNYTTNSTYHKNLNTLLSSLPSNE  62

Query  112  PINGFG---SGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
              NG+G   S       DQ Y + LCRGDV A DC+SC+
Sbjct  63   NGNGYGFYNSSYGQNSDDQVYAIGLCRGDVKAEDCRSCL  101



>ref|XP_002304943.2| hypothetical protein POPTR_0004s02390g, partial [Populus trichocarpa]
 gb|EEE85454.2| hypothetical protein POPTR_0004s02390g, partial [Populus trichocarpa]
Length=282

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 54/101 (53%), Gaps = 5/101 (5%)
 Frame = -2

Query  292  MATSKLFSLLL-LVSMAVVTL-QTAMAADPLFHFCSNSGNFT---Pnsnyqnnlnqllgd  128
            M + K + +LL L+++A++TL Q    A+ L HFC N+   T         N L   L  
Sbjct  1    MNSLKFYVILLSLLTLAIITLAQEDADANYLNHFCQNATTSTINSTYRVNLNLLLSSLAS  60

Query  127  lyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
               +   NGF + S G+  DQ YGL +CRGDVS   C++CV
Sbjct  61   NATRNNTNGFYNTSFGQNTDQVYGLFICRGDVSNTVCQNCV  101



>gb|KFK39506.1| hypothetical protein AALP_AA3G252600 [Arabis alpina]
Length=255

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -2

Query  208  LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDV  32
            LFH CS+  G FT  S Y+ NLN +   L  + P  GF S S+G   D+  GL+LCRGD 
Sbjct  38   LFHKCSDIEGKFTSKSPYETNLNSIFRQLSYRVPSTGFASSSSGNTPDKVNGLALCRGDA  97

Query  31   SAADCKSCVA  2
            S++DC SC+A
Sbjct  98   SSSDCGSCLA  107



>ref|XP_010100808.1| hypothetical protein L484_015838 [Morus notabilis]
 gb|EXB84506.1| hypothetical protein L484_015838 [Morus notabilis]
Length=260

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  229  TAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLS  50
            +A +ADPL +FC+     +  S   +N++ LL +L LKTP  GF +   G   D+ YGL+
Sbjct  17   SAESADPLGNFCNKDTEISNGSKISSNIDGLLPELVLKTPSTGFATAFNGNGKDRVYGLA  76

Query  49   LCRGDVSAADCKSCV  5
             CRGDVS  DC  CV
Sbjct  77   QCRGDVSTEDCSRCV  91



>ref|XP_007216907.1| hypothetical protein PRUPE_ppa019252mg [Prunus persica]
 gb|EMJ18106.1| hypothetical protein PRUPE_ppa019252mg [Prunus persica]
Length=215

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            K P  GFG GS G+  +Q  GL+LCRGDVS+ DCK+CV
Sbjct  31   KVPPTGFGLGSTGEGQNQANGLALCRGDVSSQDCKTCV  68



>ref|XP_008780547.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Phoenix dactylifera]
Length=202

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = -2

Query  196  CSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADC  17
            C N+GN+T NS +Q NLN LL  L  KTPI+G    + G   DQ YGL+LCRGDVS+ +C
Sbjct  34   CQNAGNYTMNSTFQTNLNVLLSSLSSKTPISG---DTEGMEPDQIYGLALCRGDVSSQEC  90

Query  16   KSCV  5
              CV
Sbjct  91   SDCV  94



>emb|CDY68211.1| BnaCnng58060D [Brassica napus]
 emb|CDY52060.1| BnaCnng21700D [Brassica napus]
Length=255

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = -2

Query  265  LLLVSMAVVTLQTAMAADP----LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPING  101
            LL +++ ++++ + ++       L+H CS+  GNFT  S Y++NLN L   L    P NG
Sbjct  15   LLALAIQLLSIHSVLSQSQDNAFLYHKCSDIEGNFTSRSPYESNLNSLFPRLSYSVPSNG  74

Query  100  FGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            F + S G   D   GL LCRGD S +DC++C+A
Sbjct  75   FAALSTGNKPDNVNGLGLCRGDASPSDCRTCLA  107



>ref|XP_004492208.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Cicer 
arietinum]
Length=257

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -2

Query  259  LVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAG  80
            ++ +  + + +A + DPL  FC+ + N +       N+++LL +L LKTP   F + S G
Sbjct  7    IIFLLFLCISSAKSQDPLGEFCNKNTNISIGGKLSTNIDKLLAELALKTPSTSFIATSYG  66

Query  79   KYYDQTYGLSLCRGDVSAADCKSCV  5
            K  ++ YGL+ CRGD++  DC +C+
Sbjct  67   KDQEKVYGLAQCRGDINTQDCSNCI  91



>ref|XP_010240969.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Nelumbo 
nucifera]
Length=628

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  217  ADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRG  38
            A  L++ CSN+ ++TPNS ++ NL+ LL  L       GF + S G+Y DQ YGL+LCRG
Sbjct  23   AQLLYNICSNTTSYTPNSPFETNLDILLPSLSSNAINTGFYNTSVGQYPDQVYGLALCRG  82

Query  37   DVSAADCKSCV  5
            D +   C++C+
Sbjct  83   DATPEVCRNCL  93



>ref|XP_010687006.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=205

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = -2

Query  265  LLLVSMAVVTLQT-AMAADPLFHFC---SNSGNFTPnsnyqnnlnqllgdlyLKTPINGF  98
            L L S    +L T  ++AD LF  C     +GN+TPNS ++ NL   L  L   T I+GF
Sbjct  9    LNLCSFVFYSLATNVLSADHLFTSCPPNDQTGNYTPNSIFELNLQTSLNSLPTNTSISGF  68

Query  97   GSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             +GS G   +  Y  +LCRGDV A++C  CV
Sbjct  69   YNGSVGNDTNNVYAQALCRGDVLASECDRCV  99



>ref|XP_010910126.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=683

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING-FGSGSAGKYYDQTYGLSLC  44
            AAD L   C N+GN+T NS Y +NLN LL  L   T ++G F + + G+  +Q YGL+LC
Sbjct  30   AADLLAQKCGNTGNYTTNSTYASNLNILLTSLDSNTSLSGGFSNFTVGQIPNQIYGLALC  89

Query  43   RGDVSAADCKSCV  5
            RGD +A+ C+SC+
Sbjct  90   RGDTNASTCRSCL  102



>gb|AAN46205.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = -2

Query  253  SMAVVTLQTAMAADP----LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPINGFGSG  89
            ++ ++++ T ++       LFH CS+  G+FT  S Y++NLN L   L  K P  GF + 
Sbjct  1    AIQILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLFSQLSYKVPSTGFAAS  60

Query  88   SAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            S G   +   GL+LCRGD S++DC+SC+ 
Sbjct  61   STGNTPNNVNGLALCRGDASSSDCRSCLE  89



>gb|AAN46194.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46196.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46198.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46199.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46200.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46201.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46202.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46203.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46204.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = -2

Query  253  SMAVVTLQTAMAADP----LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPINGFGSG  89
            ++ ++++ T ++       LFH CS+  G+FT  S Y++NLN L   L  K P  GF + 
Sbjct  1    AIQILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLFSQLSYKVPSTGFAAS  60

Query  88   SAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            S G   +   GL+LCRGD S++DC+SC+ 
Sbjct  61   STGNTPNNVNGLALCRGDASSSDCRSCLE  89



>gb|AAN46195.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46197.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = -2

Query  253  SMAVVTLQTAMAADP----LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPINGFGSG  89
            ++ ++++ T ++       LFH CS+  G+FT  S Y++NLN L   L  K P  GF + 
Sbjct  1    AIQILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLFSQLSYKVPSTGFAAS  60

Query  88   SAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            S G   +   GL+LCRGD S++DC+SC+ 
Sbjct  61   STGNTPNNVNGLALCRGDASSSDCRSCLE  89



>ref|XP_006484824.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Citrus 
sinensis]
Length=254

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = -2

Query  268  LLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSG  89
            + L+ S+ ++      AADPL  FC+   N + N     N++ LL +L  +T   G+ + 
Sbjct  1    MALVQSLVLLLFLYICAADPLGEFCNKDSNVSGNGMISANIDNLLAELVAETAKTGYIAT  60

Query  88   SAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            S GK  D+ +GL+ CRGDV + DC SC+
Sbjct  61   SYGKDQDKVFGLAQCRGDVDSKDCASCI  88



>ref|XP_006373162.1| hypothetical protein POPTR_0017s09250g [Populus trichocarpa]
 gb|ERP50959.1| hypothetical protein POPTR_0017s09250g [Populus trichocarpa]
Length=681

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 45/103 (44%), Positives = 61/103 (59%), Gaps = 9/103 (9%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPL------FHFCSNSGNFTPnsnyqnnlnqllg  131
            MA+S+LF  L L+ + V+ L  A A  P+      +H C   GN+T NS YQ NLNQLL 
Sbjct  1    MASSRLFFSLCLLFVEVLAL--AKAQQPVDQPKMSYHDCVGKGNYTTNSTYQANLNQLLT  58

Query  130  dlyLKTPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             +Y  T IN GF + S G+  D  Y ++LCR D+S   C+SC+
Sbjct  59   SIYTNTEINNGFYNFSNGQDADTVYSIALCRPDISPDACRSCI  101



>emb|CAN80171.1| hypothetical protein VITISV_018434 [Vitis vinifera]
Length=267

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 1/95 (1%)
 Frame = -2

Query  283  SKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn-yqnnlnqllgdlyLKTPI  107
            S+    L  + +A+  L    A D ++H CSN+    PNS    N  + L       T  
Sbjct  5    SRNLLFLCALGLAISCLAIQAAPDYIYHLCSNTTTIKPNSTYQTNLNSLLSSLSSNATRA  64

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            NGF + +AG+  D  YGL LCRGDV+   C+ CVA
Sbjct  65   NGFYNATAGQSPDVAYGLFLCRGDVAIDYCRDCVA  99



>ref|XP_007025960.1| Cysteine-rich RLK 10, putative [Theobroma cacao]
 gb|EOY28582.1| Cysteine-rich RLK 10, putative [Theobroma cacao]
Length=625

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -2

Query  208  LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVS  29
            LF FCS++ N+T NS ++NNL ++L  L   T   GF S S G   DQ YG +LCRGDV+
Sbjct  20   LFPFCSDNTNYTSNSTFENNLERVLEALPSNTSDTGFYSTSIGDGADQVYGRALCRGDVN  79

Query  28   AADCKSCV  5
             + C+SC+
Sbjct  80   TSLCRSCI  87



>ref|XP_007025968.1| Cysteine-rich RLK 10, putative [Theobroma cacao]
 gb|EOY28590.1| Cysteine-rich RLK 10, putative [Theobroma cacao]
Length=672

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -2

Query  208  LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVS  29
            LF FCS + N+T NS ++NNL ++L  L   T   GF S S G   DQ YG +LCRGDV+
Sbjct  42   LFTFCSENTNYTSNSTFENNLERVLEALPSNTSDTGFYSTSIGDGADQVYGRALCRGDVN  101

Query  28   AADCKSCV  5
             + C+SC+
Sbjct  102  TSLCRSCI  109



>gb|KGN43546.1| hypothetical protein Csa_7G044860 [Cucumis sativus]
Length=250

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  247  AVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAG--KY  74
            A+  + T + A  L+H CS+S N+T NS Y +NL Q +  L    P +GFG  S G    
Sbjct  18   ALGNIITTVNASYLYHTCSSSDNYTMNSLYASNLKQAVDRLTNSAPPSGFGLSSTGGKDS  77

Query  73   YDQTYGLSLCRGDVSAADCKSCV  5
             +Q  GL+LCRGD+S  DCK+CV
Sbjct  78   QNQVNGLALCRGDISPNDCKTCV  100



>ref|XP_006850460.1| hypothetical protein AMTR_s00035p00082360 [Amborella trichopoda]
 gb|ERN12041.1| hypothetical protein AMTR_s00035p00082360 [Amborella trichopoda]
Length=244

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 5/92 (5%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCS-NSGNFTPnsnyqnnlnqllgdlyLKTPINGF  98
            F L +L     + LQ  ++ADPL H CS  S N+T +    + L+ LL  L  KT I GF
Sbjct  6    FLLPILALCLTMRLQGTISADPLSHICSPTSTNYTTHPPLDHALSSLLRTLSAKTAITGF  65

Query  97   GSGSAGKYYDQTY-GLSLCRGDVSAADCKSCV  5
             + S+    D+ Y GL LCR DV+  DCK C+
Sbjct  66   ATASSP---DRKYHGLGLCRADVTRYDCKVCM  94



>ref|XP_010267901.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=260

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = -2

Query  304  KLAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdl  125
            ++ AM T +L   L  +S    T    ++A  L H C + GN+T NS Y+ NL  +L  L
Sbjct  12   RIEAMHTREL---LFFLSFMHATF-GFISAQTLVHRC-DGGNYTANSTYEPNLQTVLSSL  66

Query  124  yLK-TPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
                T  NGF +G+AG+  D+ YGL LCRGD+ A DC++C+
Sbjct  67   SSNSTRENGFYNGTAGQGPDKVYGLFLCRGDIVAQDCQNCI  107



>ref|XP_010240976.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=1221

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  238  TLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTY  59
            T + + A   L+H CSN+ ++TPNS +  NLN LL  L       GF + S G+Y DQ Y
Sbjct  670  TKKKSPAYAQLYHVCSNTTSYTPNSLFGINLNILLPSLSSNAISTGFYNTSVGEYPDQVY  729

Query  58   GLSLCRGDVSAADCKSCV  5
            GL +CRGD++   C +C+
Sbjct  730  GLIVCRGDITPEVCGNCL  747


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  208  LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVS  29
            L+  CSN+ +F PNS ++ NLN LL  L       GF + S G+Y DQ YGL LCRGD++
Sbjct  25   LYDVCSNTTSFAPNSLFETNLNILLPSLSSNAINTGFYNTSVGEYPDQVYGLILCRGDIT  84

Query  28   AADCKSCV  5
               C++C+
Sbjct  85   PEVCRNCL  92



>gb|KHN01561.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=650

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = -2

Query  301  LAAMATSKL-FSLLLLVSMAVVTLQTAMAADPLFHFC--SNSGNFTPnsnyqnnlnqllg  131
            +AA+    L F   LL+    ++  +A  A    +FC  SN GN+T  S Y  NL+ LL 
Sbjct  1    MAALPLRSLSFVCCLLIIANFISQASAEYAQNFTYFCDPSNRGNYTAESTYDANLDTLLS  60

Query  130  dlyLKTPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             L   T IN GF + S G+  D+ Y + LCRGDV   +C SC+
Sbjct  61   TLTSNTEINYGFYNSSYGENTDKVYAIGLCRGDVKPDECSSCL  103



>ref|XP_004144484.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43544.1| hypothetical protein Csa_7G044840 [Cucumis sativus]
Length=255

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = -2

Query  277  LFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGF  98
            +F L LL    V +      +  L H C++  N+T NS Y +NLNQ    L    P +GF
Sbjct  9    IFCLFLLFPSLVFSEDIVTDSAFLNHICTSFDNYTANSTYASNLNQAFYQLTSNAPPSGF  68

Query  97   GSGSAGK-YYDQTYGLSLCRGDVSAADCKSCVA  2
               S GK    Q  G++LCRGDVS ADC++CVA
Sbjct  69   AQVSIGKDLQTQVNGVALCRGDVSVADCRNCVA  101



>ref|XP_006449123.1| hypothetical protein CICLE_v10018168mg, partial [Citrus clementina]
 gb|ESR62363.1| hypothetical protein CICLE_v10018168mg, partial [Citrus clementina]
Length=250

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyLK  116
            MA+S+L   L  + + +V    A    PL   C S  GNFT  S Y+ NL+++L  +   
Sbjct  1    MASSRLPLFLCSIVLQLVAHTIAQQDTPLDELCLSEMGNFTKKSKYKANLDRVLSTISSN  60

Query  115  TPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
              IN GF + S G+  DQ   ++LCRGDV+   C+SC+
Sbjct  61   PKINYGFYTASYGRNNDQVNAMALCRGDVNPNSCRSCI  98



>ref|XP_006468227.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=251

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyLK  116
            MA+S+L   L  + + +V    A    PL   C S  GNFT  S Y+ NL+++L  +   
Sbjct  1    MASSRLPLFLCSIVLQLVAHTIAQQDTPLDELCLSEMGNFTKKSKYKANLDRVLSTISSN  60

Query  115  TPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            T I+ GF + S G+  DQ   ++LCRGDV+   C+SC+
Sbjct  61   TKISYGFYTASYGRNNDQVNAMALCRGDVNPNSCRSCI  98



>gb|KDO75587.1| hypothetical protein CISIN_1g040542mg, partial [Citrus sinensis]
Length=250

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyLK  116
            MA+S+L   L  + + +V    A    PL   C S  GNFT  S Y+ NL+++L  +   
Sbjct  1    MASSRLPLFLCSIVLQLVAHTIAQQDTPLDELCLSEMGNFTKKSKYKANLDRVLSTISSN  60

Query  115  TPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            T I+ GF + S G+  DQ   ++LCRGDV+   C+SC+
Sbjct  61   TKISYGFYTASYGRNNDQVNAMALCRGDVNPNSCRSCI  98



>ref|XP_008778956.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Phoenix dactylifera]
Length=277

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING-FGSGSAGKYYDQTYGLSLC  44
            A DP++  C ++GN+  NS Y  NLN LL  L  KT ++G F + + G+  DQ YGL++C
Sbjct  26   AGDPIYTHCGSTGNYAANSTYDTNLNLLLRSLASKTSLSGGFLNATVGQIPDQIYGLAMC  85

Query  43   RGDVSAADCKSCVA  2
            RGD +A+ C+SC++
Sbjct  86   RGDTNASVCRSCLS  99



>ref|XP_008342466.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=243

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M  SK   L LLV    +   +A+ A PL H C +  N+T NS Y  NLN L   LY K 
Sbjct  1    MFISKSIPLCLLV--LCLYHHSAIGASPLSHSCFSPENYTANSPYGANLNLLFNLLYTKV  58

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            P  GF   S G   +  +G++LCRGDVS  +C +CV
Sbjct  59   PPTGFALDSTGHGQNLVHGMALCRGDVSEKNCNTCV  94



>ref|XP_010533171.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Tarenaya 
hassleriana]
Length=661

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (9%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNS-GNFT--Pnsnyqnnlnqllg  131
            L++ A  +LFS+L+LVS+  + +++       +HFCSN  GN+T         N      
Sbjct  6    LSSSACLRLFSVLVLVSLQFLAVRSQQ-----YHFCSNDRGNYTVNSTFATNLNSLVSSL  60

Query  130  dlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
                + P +GF + S G+  +    +SLCRG+V+  DC +CV+
Sbjct  61   SSLQRNP-DGFYNVSVGETTNMVNSVSLCRGEVAPVDCLACVS  102



>ref|XP_004168056.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
Length=261

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = -2

Query  277  LFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGF  98
            +F L LL    V +      +  L H C++  N+T NS Y +NLNQ    L    P +GF
Sbjct  9    IFCLFLLFPSLVFSEDIITDSAFLNHICTSFDNYTANSTYASNLNQAFYQLTSNAPPSGF  68

Query  97   GSGSAGK-YYDQTYGLSLCRGDVSAADCKSCVA  2
               S GK    Q  G++LCRGDVS ADC++CVA
Sbjct  69   AQVSIGKDLQTQVNGVALCRGDVSVADCRNCVA  101



>ref|XP_010923982.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Elaeis 
guineensis]
Length=316

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -2

Query  280  KLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING  101
            KL  +L L ++         A++ +++ CS   N+T NS Y +NLN LL  L   T   G
Sbjct  36   KLPQVLFLSALFTTVYAPCWASENIWYECSTDSNYTMNSTYHSNLNLLLPSLSSATLSTG  95

Query  100  FGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            F + S G+  DQ +GL+LCRGDVS  +C+SC++
Sbjct  96   FATLSKGQAPDQVFGLALCRGDVSQDECQSCLS  128



>ref|XP_003622768.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
 gb|AES78986.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=257

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -2

Query  277  LFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGF  98
            ++ L  +V + +++  +A + DPL  FC+ + N +       N+++LL  L L+TP   F
Sbjct  1    MYLLYKIVFLLILSTSSAKSEDPLGEFCNKNTNISTGGKLSTNIDKLLSQLALQTPSTFF  60

Query  97   GSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             + + G   ++ YGL+ CRGD++  DC +C+
Sbjct  61   VATTYGNSKEKVYGLAQCRGDINTQDCSNCI  91



>ref|XP_008455406.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=262

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -2

Query  208  LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGK-YYDQTYGLSLCRGDV  32
            L+H C++  N+T NS Y +NLNQ    L    P +GF   S GK    Q  G++LCRGDV
Sbjct  33   LYHICTSFDNYTANSTYASNLNQAFYQLTSNAPPSGFAQVSIGKDLQTQVNGVALCRGDV  92

Query  31   SAADCKSCVA  2
            S ADC++CVA
Sbjct  93   SVADCRNCVA  102



>ref|XP_006437221.1| hypothetical protein CICLE_v10032523mg [Citrus clementina]
 gb|ESR50461.1| hypothetical protein CICLE_v10032523mg [Citrus clementina]
Length=254

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCR  41
            AADPL  FC+   N + N     N++ LL +L  +T   G+ + S GK  D+ +GL+ CR
Sbjct  17   AADPLGEFCNKDSNVSGNGMISANIDNLLAELVAETAKTGYIATSYGKDQDKVFGLAQCR  76

Query  40   GDVSAADCKSCV  5
            GDV + DC SC+
Sbjct  77   GDVDSKDCASCI  88



>ref|XP_010482102.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Camelina 
sativa]
Length=263

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = -2

Query  280  KLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING  101
            K F LL LV        +  AAD ++  C+ + N + +S    N++ LL  L  KTP  G
Sbjct  7    KCFLLLALVC-------SCRAADSIWDLCNKNSNISASSKVSKNIDSLLATLVSKTPSQG  59

Query  100  FGSGSAGKYYDQ--TYGLSLCRGDVSAADCKSCV  5
            F + ++  Y D+   YGL+ CRGD+S  DC +C+
Sbjct  60   FMTTTSSSYNDKEKVYGLAQCRGDISKTDCSTCI  93



>ref|XP_009417398.1| PREDICTED: uncharacterized protein LOC103997793 [Musa acuminata 
subsp. malaccensis]
Length=1356

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = -2

Query  298  AAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyL  119
            A +++S LF LL  V + ++   +   A  L   C  SG+F  NS YQ+NL   L  L  
Sbjct  11   AIVSSSSLFPLLGFV-LLILCHSSLTGAQNLDQICDTSGSFADNSTYQSNLKLYLSTLPS  69

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            K  ++GF   + G+  D+ YG+SLCRGD +A++C++C+
Sbjct  70   KGSVSGFLKEAVGEVPDKVYGVSLCRGDANASECRACL  107



>gb|KDO60896.1| hypothetical protein CISIN_1g036866mg [Citrus sinensis]
Length=254

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCR  41
            AADPL  FC+   N + N     N++ LL +L  +T   G+ + S GK  D+ +GL+ CR
Sbjct  17   AADPLGEFCNKDSNVSGNGMISANIDNLLAELVAETAKTGYIATSYGKDQDKVFGLAQCR  76

Query  40   GDVSAADCKSCV  5
            GDV + DC SC+
Sbjct  77   GDVDSKDCASCI  88



>ref|XP_010036761.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
X2 [Eucalyptus grandis]
Length=238

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  235  LQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYG  56
            +  A + DPL  FC+     +  S   +N++ +L +L  K P  GF + S G   D+ YG
Sbjct  19   VSNAQSDDPLGQFCNQDTVISKASPIWSNIDHVLTELVSKAPSTGFLTTSYGSGNDKVYG  78

Query  55   LSLCRGDVSAADCKSCV  5
            L+ CRGDVS  DC SC+
Sbjct  79   LAQCRGDVSQDDCSSCI  95



>ref|XP_010052449.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
 gb|KCW76443.1| hypothetical protein EUGRSUZ_D00833 [Eucalyptus grandis]
Length=671

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGS---GSAGKYYDQTYGLS  50
             ADPL+H C  +GNFT N  Y +NLN LL  +      + +G     + G   D    ++
Sbjct  24   GADPLYHVCGTNGNFTANGTYGDNLNALLTSVVAAAAADDYGFYNLSAGGGSADSVNAIA  83

Query  49   LCRGDVSAADCKSCV  5
            LCRGDV AADC+SC+
Sbjct  84   LCRGDVGAADCRSCL  98



>ref|XP_010529370.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Tarenaya 
hassleriana]
Length=675

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 51/98 (52%), Gaps = 10/98 (10%)
 Frame = -2

Query  286  TSKLFSLLLLVSMAVVTLQTAMAADP--LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            T  L S L L+S        A AADP  L+H C N+  FT NS Y +NL  +L  L    
Sbjct  12   TFSLISALFLMSF------NAEAADPTYLYHTCPNTTTFTRNSTYFSNLRTVLSSLSSPN  65

Query  112  PI--NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
                  F + +AG+  D  YG+ LCRGDVSA  C+ CV
Sbjct  66   ASYETAFANATAGQTPDTAYGIFLCRGDVSADVCRDCV  103



>gb|AGT15894.1| hypothetical protein SHCRBa_258_I03_R_140 [Saccharum hybrid cultivar 
R570]
Length=672

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -2

Query  280  KLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPIN-  104
            +L ++L L S  + T+  A A DP F  C N+ N+T  S +Q NL+ LL  L      + 
Sbjct  3    RLLAILFLCSSLLATV--ANADDPFFTGCPNNTNYTRGSAFQANLDALLASLPAAAAAST  60

Query  103  GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            GF + + G   DQ YGL+ CR DV+A+DC++C+
Sbjct  61   GFATNTTGTAPDQAYGLAQCRADVNASDCRACL  93



>ref|XP_003555314.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=675

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFC--SNSGNFTPnsnyqnnlnqllgdlyLKTPIN-  104
            F   LL+    ++  +A  A    +FC  SN GN+T +S Y  NL+ LL  L   T IN 
Sbjct  11   FVCCLLIIANFISQASADYAQNFTYFCDPSNRGNYTTDSTYDANLDTLLSTLTSNTEINY  70

Query  103  GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            GF + S G+  D+ Y + LCRGDV   +C SC+
Sbjct  71   GFYNSSYGENTDKVYAIGLCRGDVKPDECSSCL  103



>ref|XP_010036760.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW48396.1| hypothetical protein EUGRSUZ_K02100 [Eucalyptus grandis]
Length=263

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  235  LQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYG  56
            +  A + DPL  FC+     +  S   +N++ +L +L  K P  GF + S G   D+ YG
Sbjct  19   VSNAQSDDPLGQFCNQDTVISKASPIWSNIDHVLTELVSKAPSTGFLTTSYGSGNDKVYG  78

Query  55   LSLCRGDVSAADCKSCV  5
            L+ CRGDVS  DC SC+
Sbjct  79   LAQCRGDVSQDDCSSCI  95



>ref|XP_006828418.1| hypothetical protein AMTR_s00060p00084230 [Amborella trichopoda]
 gb|ERM95834.1| hypothetical protein AMTR_s00060p00084230 [Amborella trichopoda]
Length=261

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 47/89 (53%), Gaps = 1/89 (1%)
 Frame = -2

Query  268  LLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSG  89
            LLL     +  LQ ++ +D    FC NS     + +   N+  +L +L  K P NGF + 
Sbjct  4    LLLCTLFTLALLQLSLGSDHTGEFC-NSNKKISDKSTMTNIGLVLSELETKGPSNGFATA  62

Query  88   SAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            S G+  ++ YGL  CRGD+S  DC SC +
Sbjct  63   SIGQGKERVYGLLQCRGDISPKDCSSCTS  91



>ref|XP_002865649.1| hypothetical protein ARALYDRAFT_494916 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41908.1| hypothetical protein ARALYDRAFT_494916 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -2

Query  271  SLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGS  92
            +L++  S+ +  + +  AAD ++  C+ + N + +S    N++ LL  L  KTP  GF +
Sbjct  3    TLIVKCSLLLALVCSCKAADSIWQLCNTNSNISASSQVSKNIDSLLATLVSKTPSQGFVT  62

Query  91   GSAGKY--YDQTYGLSLCRGDVSAADCKSCV  5
             ++  Y   ++ YGL+ CRGD+S  DC +C+
Sbjct  63   TTSPSYNKKEKVYGLAQCRGDISKTDCSTCI  93



>gb|KFK31328.1| hypothetical protein AALP_AA6G098000 [Arabis alpina]
Length=263

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 7/98 (7%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M T  +  LLLL   A+V   +  AAD ++  C+   N + +S    N++ LL  L  KT
Sbjct  1    MKTLMVKGLLLL---AIVC--SCRAADSIWEVCNKDSNISGSSQISTNIDSLLATLVSKT  55

Query  112  PINGFGSGSAGKY--YDQTYGLSLCRGDVSAADCKSCV  5
            P  GF + ++  Y   D  YGL+ CRGD+S +DC SC+
Sbjct  56   PSRGFLTTTSSSYNNKDNVYGLAQCRGDISKSDCSSCI  93



>ref|XP_009418899.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Musa 
acuminata subsp. malaccensis]
Length=485

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFG  95
            + +LL  S+ ++      ++D L+ +C +  N+T NS +Q NLN LL  L   T   G+ 
Sbjct  5    YHVLLFFSLVLMLRCYGTSSDKLWSYCPHDANYTTNSTFQYNLNLLLASLSSSTAATGYS  64

Query  94   SGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            + + G+  DQ +GL+LCRGDVS++ C++C+
Sbjct  65   NDTEGRSSDQVHGLALCRGDVSSSVCQTCL  94



>gb|KCW76452.1| hypothetical protein EUGRSUZ_D00844 [Eucalyptus grandis]
Length=708

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 2/77 (3%)
 Frame = -2

Query  229  TAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFG--SGSAGKYYDQTYG  56
            +A  ADP+  FC  +GNFT N  YQ NLN LL  +      +G G  + SAG   +    
Sbjct  21   SAHGADPVKLFCGTTGNFTANGTYQANLNALLASVVATAAADGHGFYNLSAGGSTNAVNA  80

Query  55   LSLCRGDVSAADCKSCV  5
            ++LCRGDV A DC+SC+
Sbjct  81   IALCRGDVGATDCQSCL  97



>ref|XP_009367024.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=709

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 5/104 (5%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSN-SGNFTPnsnyqnnlnqllgdl  125
            + AM TS+    LL +   ++          L+HFC N SGN++ NS YQ NLN+LL  L
Sbjct  1    MPAMDTSRFLFCLLPILFLMINQALGQVPGFLYHFCINKSGNYSTNSTYQTNLNRLLSSL  60

Query  124  yLKTPINGFGSGSAGKYYDQT----YGLSLCRGDVSAADCKSCV  5
                  NG+G  +A    + +    Y + LCRGDV A DC+SC+
Sbjct  61   PSNESSNGYGFYNASYRLNSSNEHIYAIGLCRGDVKAEDCRSCL  104



>emb|CDP14580.1| unnamed protein product [Coffea canephora]
Length=262

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = -2

Query  262  LLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSA  83
            LL+   ++ + TA +A+    FC+++     ++    N++ LL +L   T  NGF + S 
Sbjct  7    LLLLFTILCICTAESAELWSQFCNHNSQIN-STQLSANIDSLLAELMSGTVQNGFSTISY  65

Query  82   GKYYDQTYGLSLCRGDVSAADCKSCVA  2
            GK  DQ +GL+ CRGDVS+ DC SCV 
Sbjct  66   GKAEDQVFGLAQCRGDVSSEDCSSCVE  92



>ref|XP_006649855.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Oryza 
brachyantha]
Length=267

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = -2

Query  265  LLLVSMAVVTLQTAMAADPLFHFCSNS--GNFTPnsnyqnnlnqllgdlyLKTPINGFGS  92
            L+LVS A++ L  +MA DP+  +CS +  G    +    +  + L   +   +   GF +
Sbjct  12   LVLVSFALLPL--SMAMDPIGSYCSGNSLGLAGNSKAVASINSVLTDLVSQGSAGGGFAT  69

Query  91   GSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
             SAGK  +  YGL+ CRGDVSA DC++C+A
Sbjct  70   SSAGKGPNVIYGLAQCRGDVSAGDCQACLA  99



>gb|AGT17169.1| ATP binding protein [Saccharum hybrid cultivar R570]
Length=669

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 3/93 (3%)
 Frame = -2

Query  280  KLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn-yqnnlnqllgdlyLKTPIN  104
            +L ++L L S  + T+  A A DP F  C N+ N+T  S    N  + L           
Sbjct  3    RLLAILFLCSSLLATV--ANADDPFFTGCPNNTNYTRGSAFQANLDDLLASLPAAAAAST  60

Query  103  GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            GF + + G   DQ YGL+ CR DV+A+DC++C+
Sbjct  61   GFATNTTGTAPDQAYGLAQCRADVNASDCRACL  93



>gb|AGT17379.1| hypothetical protein SHCRBa_240_C21_F_200 [Saccharum hybrid cultivar 
R570]
Length=621

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 3/93 (3%)
 Frame = -2

Query  280  KLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn-yqnnlnqllgdlyLKTPIN  104
            +L ++L L S  + T+  A A DP F  C N+ N+T  S    N  + L           
Sbjct  3    RLLAILFLCSSLLATV--ANADDPFFTGCPNNTNYTRGSAFQANLDDLLASLPAAAAAST  60

Query  103  GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            GF + + G   DQ YGL+ CR DV+A+DC++C+
Sbjct  61   GFATNTTGTAPDQAYGLAQCRADVNASDCRACL  93



>ref|XP_003551283.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Glycine 
max]
 gb|KHN31799.1| Cysteine-rich repeat secretory protein 55 [Glycine soja]
Length=257

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  226  AMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSL  47
            A A DPL  FC+ +           N++++L ++ LKTP  GF + + GK  D+ Y L+ 
Sbjct  18   AKAEDPLGRFCNENTIIGSGGKLSANIDKILTEIALKTPSTGFVATTYGKDQDKVYALAQ  77

Query  46   CRGDVSAADCKSCV  5
            CRGDVS  DC +C+
Sbjct  78   CRGDVSTQDCSNCI  91



>ref|XP_010058609.1| PREDICTED: cysteine-rich receptor-like protein kinase 19 [Eucalyptus 
grandis]
Length=674

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = -2

Query  199  FCSNSGNFTPnsnyqnnlnqllgdl----yLKTPINGFGSGSAGKYYDQTYGLSLCRGDV  32
            +C++ G++TP+SN+ +NLN L        Y K PI GF + +AG+  D+ YGL LCRGDV
Sbjct  55   WCADRGDYTPDSNFGDNLNILYPRAGYHDYSKGPIRGFYNTTAGEDPDKVYGLFLCRGDV  114

Query  31   SAADCKSCV  5
            +A  C+SC+
Sbjct  115  TANLCQSCI  123



>ref|XP_009367095.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 isoform 
X2 [Pyrus x bretschneideri]
Length=596

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 5/104 (5%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSN-SGNFTPnsnyqnnlnqllgdl  125
            + AM TS+    LL +   ++          L+HFC N SGN++ NS YQ NLN+LL  L
Sbjct  1    MPAMDTSRFLFCLLPILFLMINQALGQVPGFLYHFCINKSGNYSTNSTYQTNLNRLLSSL  60

Query  124  yLKTPINGFGSGSAGKYYDQT----YGLSLCRGDVSAADCKSCV  5
                  NG+G  +A    + +    Y + LCRGDV A DC+SC+
Sbjct  61   PSNESSNGYGFYNASYRLNSSNEHIYAIGLCRGDVKAEDCRSCL  104



>ref|NP_199665.1| receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
 sp|Q9LV60.1|CRR55_ARATH RecName: Full=Cysteine-rich repeat secretory protein 55; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96974.1| 33 kDa secretory protein-like [Arabidopsis thaliana]
 gb|AAK93601.1| putative 33 kDa secretory protein [Arabidopsis thaliana]
 gb|AAM14364.1| putative 33 kDa secretory protein [Arabidopsis thaliana]
 gb|AED95683.1| receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
Length=263

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = -2

Query  280  KLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING  101
            K F LL LV        +  AAD ++  C+ + N + +S    N++ LL  L  KTP  G
Sbjct  7    KCFLLLALVC-------SCRAADSIWQLCNTNSNISASSQVSKNIDSLLATLVSKTPSKG  59

Query  100  FGSGSAGKY--YDQTYGLSLCRGDVSAADCKSCV  5
            F + ++  Y   ++ YGL+ CRGD+S  DC +C+
Sbjct  60   FKTTTSSSYNNKEKVYGLAQCRGDISNTDCSTCI  93



>ref|XP_010442278.1| PREDICTED: cysteine-rich repeat secretory protein 55 [Camelina 
sativa]
Length=263

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQ--TYGLSL  47
            AAD ++  C+ + N + +S    N++ LL  L  KTP  GF + ++  Y D+   YGL+ 
Sbjct  20   AADSIWDLCNKNSNISASSKVSKNIDSLLATLVSKTPSQGFMTTTSSSYNDKEKVYGLAQ  79

Query  46   CRGDVSAADCKSCV  5
            CRGD+S  DC +C+
Sbjct  80   CRGDISKTDCSTCI  93



>ref|XP_008674038.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Zea 
mays]
Length=688

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 5/90 (6%)
 Frame = -2

Query  265  LLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING---FG  95
            + +V +A++   +A A    +  C N+GN+T  S YQ+NL+QL   L  K   N    F 
Sbjct  1    MAIVLLALLLFPSAYAQP--WSVCGNTGNYTAASTYQDNLSQLAASLPKKASSNTSPLFA  58

Query  94   SGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            +G+AG   D  Y L+LCRGD++A+ CK CV
Sbjct  59   TGTAGAVPDLVYALALCRGDINASACKDCV  88



>ref|XP_002518555.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43942.1| ATP binding protein, putative [Ricinus communis]
Length=671

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M++   F ++LL  + +  +  A + +  +HFCSN+  FTPNS YQ NLNQ+L  L    
Sbjct  1    MSSVIRFPIILLFLLRLAIIVKAESPEYRYHFCSNTTTFTPNSTYQTNLNQVLSSLSNNA  60

Query  112  PIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
              + GF +  +G+  D  YG  LCRGDVS   C+ CV
Sbjct  61   NNSIGFFNIPSGQQPDDVYGSFLCRGDVSTDVCQDCV  97



>gb|KDP20815.1| hypothetical protein JCGZ_21286 [Jatropha curcas]
Length=661

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 4/95 (4%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADP--LFHFCSNS-GNFTPnsnyqnnlnqllgdlyLKTPI-  107
             ++LL  S  ++ L +   A P  LF FC+N  GN+T NS Y+ NL+ LL  L   T I 
Sbjct  4    LTILLSCSYLLLRLVSLANAQPDFLFPFCNNGRGNYTTNSLYKRNLDNLLSSLASNTEID  63

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            NGF + S G+  DQ   + LCRGDV   DC+ C++
Sbjct  64   NGFYNLSVGEAPDQVSAIGLCRGDVGLEDCRGCIS  98



>ref|XP_010931318.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=683

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllg-dlyLKTPING-FGSGSAGKYYDQTYGLSL  47
            A++PL+  C  +GN+T NS Y++NL  LL   L   T ++G F + + G+  DQ YGL++
Sbjct  26   ASNPLYTQCGTTGNYTANSTYESNLMNLLLPSLASNTSLSGGFLNATVGQIPDQIYGLAM  85

Query  46   CRGDVSAADCKSCVA  2
            CRGD +A+ C+SC++
Sbjct  86   CRGDTNASVCRSCLS  100



>ref|XP_010558703.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Tarenaya 
hassleriana]
Length=668

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 6/96 (6%)
 Frame = -2

Query  277  LFSLLLLV--SMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPIN  104
            +FS L+L       VT Q + A  PL+HFC   GN+T  ++  +     L       P N
Sbjct  17   IFSTLVLWFHHFLAVTSQNS-APSPLYHFCYAGGNYT-VNSTFSGNLNNLISSLSSLPQN  74

Query  103  --GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
              GF + SAG+  D+   + LCRGDV   DC +CV+
Sbjct  75   DDGFYNVSAGEIPDKVNSVYLCRGDVKPVDCLACVS  110



>ref|XP_010911643.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Elaeis guineensis]
Length=285

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = -2

Query  223  MAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING-FGSGSAGKYYDQTYGLSL  47
            MA DPL   C N+GN+T NS Y++NL  LL  L   T ++G F + + G+  +Q +GL++
Sbjct  25   MAGDPLPTQCGNNGNYTANSTYESNLKLLLPYLASNTSLSGGFLNATVGEIPNQIHGLAM  84

Query  46   CRGDVSAADCKSCVA  2
            CRGD +A+ C+SC++
Sbjct  85   CRGDANASVCRSCLS  99



>ref|NP_001049923.1| Os03g0312300 [Oryza sativa Japonica Group]
 gb|ABF95589.1| 33 kDa secretory protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11837.1| Os03g0312300 [Oryza sativa Japonica Group]
 dbj|BAG99232.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58935.1| hypothetical protein OsJ_10601 [Oryza sativa Japonica Group]
Length=185

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = -2

Query  223  MAADPLFHFCSNSG----NFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYG  56
            MA DP+  +CS SG         +  ++  + +   +       GF + SAGK  +  YG
Sbjct  25   MATDPIGGYCSESGTSDAEINGKTRRRSINSVVSDLVAKAASNGGFATSSAGKGNNVFYG  84

Query  55   LSLCRGDVSAADCKSCV  5
            L+ CRGDVSA+DCK+C+
Sbjct  85   LAQCRGDVSASDCKACL  101



>ref|XP_010054433.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Eucalyptus 
grandis]
Length=634

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 2/77 (3%)
 Frame = -2

Query  229  TAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFG--SGSAGKYYDQTYG  56
            +A  ADP+  FC  +GNFT N  YQ NLN LL  +      +G G  + SAG   +    
Sbjct  21   SAHGADPVKLFCGTTGNFTANGTYQANLNALLASVVATAAADGHGFYNLSAGGSTNAVNA  80

Query  55   LSLCRGDVSAADCKSCV  5
            ++LCRGDV A DC+SC+
Sbjct  81   IALCRGDVGATDCQSCL  97



>ref|XP_008224860.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=679

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = -2

Query  304  KLAAMATSKLFSLLLLVSMAVVTL---QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqll  134
            ++  +  + L  + +L S+ VVTL    +   AD L+H C N+  FTPNS +Q+NLN+LL
Sbjct  8    QVKMLPMTNLMLVSILSSIFVVTLLSFPSPAEADYLYHVCQNTTTFTPNSTFQSNLNRLL  67

Query  133  gdlyLK-TPINGFGSGSAGKYY--DQTYGLSLCRGDVSAAD-CKSCVA  2
              L    T  +GF + +A      D  YGL LCRGDV+A D CKSCV+
Sbjct  68   STLSSNATRPSGFYNATASSSSSNDPVYGLFLCRGDVAATDACKSCVS  115



>ref|XP_011007912.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Populus 
euphratica]
Length=263

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 45/99 (45%), Gaps = 7/99 (7%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNF---TPnsnyqnnlnqllgdly  122
            M   KL S+ LL   A+   Q     D   H CSN+  F   +P     N L   L    
Sbjct  1    MVKGKL-SIFLLSFAALTEAQEIFFLD---HKCSNTTTFVRNSPYQANLNILLSSLAANA  56

Query  121  LKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             +  INGF + S G    + YGL LCRGDVS   C+ CV
Sbjct  57   TRNDINGFYNASTGHDVYEVYGLFLCRGDVSVEVCQECV  95



>ref|XP_009145437.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Brassica 
rapa]
Length=274

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -2

Query  208  LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDV  32
            L+H CS+  GNFT  S Y++NLN L   L    P +GF + S G   D   GL LCRGD 
Sbjct  57   LYHKCSDIEGNFTSRSPYESNLNSLFPRLSYSVPSSGFAALSTGNKPDNVNGLGLCRGDA  116

Query  31   SAADCKSCVA  2
            S +DC++C+A
Sbjct  117  SPSDCRTCLA  126



>gb|EEC75106.1| hypothetical protein OsI_11281 [Oryza sativa Indica Group]
Length=249

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = -2

Query  223  MAADPLFHFCSNSG----NFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYG  56
            MA DP+  +CS SG         +  ++  + +   +       GF + SAGK  +  YG
Sbjct  1    MATDPIGGYCSESGTSDAEINGKTRRRSINSVVSDLVAKAASNGGFATSSAGKGNNVFYG  60

Query  55   LSLCRGDVSAADCKSCV  5
            L+ CRGDVSA+DCK+C+
Sbjct  61   LAQCRGDVSASDCKACL  77



>gb|KCW73357.1| hypothetical protein EUGRSUZ_E01828 [Eucalyptus grandis]
Length=585

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            K PI GF + S G+  D+ YGL LCRGDV+A  C+SC+
Sbjct  172  KGPIRGFYNASQGEDPDKVYGLFLCRGDVAADQCQSCI  209



>emb|CDP03947.1| unnamed protein product [Coffea canephora]
Length=262

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -2

Query  115  TPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            T +NGF + S GK  DQ +GL  CRGDVS  DC SC+
Sbjct  55   TVLNGFTTSSYGKAKDQVFGLGQCRGDVSNEDCSSCI  91



>ref|XP_006383955.1| hypothetical protein POPTR_0004s02410g, partial [Populus trichocarpa]
 gb|ERP61752.1| hypothetical protein POPTR_0004s02410g, partial [Populus trichocarpa]
Length=212

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 5/100 (5%)
 Frame = -2

Query  292  MATSKLFSLLL-LVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK  116
            M + K + +LL L+++A++TL     A+ L+H C N+   T NS Y+ NLN LL  L   
Sbjct  1    MNSLKFYVILLSLLTLAIITL-AQEDANYLYHNCQNATTSTINSTYRVNLNLLLSSLASN  59

Query  115  TPIN---GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
              +N   GF + S G+  DQ YGL +CRGD+S + C++CV
Sbjct  60   ATLNNTIGFYNTSFGQSTDQVYGLFICRGDLSNSVCQNCV  99



>gb|EYU40654.1| hypothetical protein MIMGU_mgv1a012036mg [Erythranthe guttata]
Length=263

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCR  41
            +ADPL +FC+++      S    N++ LL  L   T  NGF + S G+   Q YGLS CR
Sbjct  21   SADPLANFCNDNSRTDNTSQISRNIDNLLSVLVSGTVQNGFTATSLGEADSQIYGLSQCR  80

Query  40   GDVSAADCKSCV  5
            GDVS  DC  C+
Sbjct  81   GDVSKNDCSVCI  92



>ref|XP_010241766.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Nelumbo 
nucifera]
Length=258

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -2

Query  217  ADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRG  38
            A+ L  FC+   N + +S    N++ LL DL  KT  NGF + S G   D+ YGL+ CRG
Sbjct  20   AEHLGEFCNKDKNISSDSPKSANIDHLLADLVSKTSSNGFTATSYGVGEDRVYGLAQCRG  79

Query  37   DVSAADCKSCV  5
            DVS  DC SC+
Sbjct  80   DVSKKDCSSCI  90



>ref|XP_007025550.1| Cysteine-rich RLK 8, putative [Theobroma cacao]
 gb|EOY28172.1| Cysteine-rich RLK 8, putative [Theobroma cacao]
Length=316

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 2/97 (2%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M +S+L  L  LVS+ +  L T++  + L   CS   NFT NS Y NNL  L   +   T
Sbjct  1    MDSSRLALLFFLVSIQLSAL-TSVQPEKLLRLCSTQSNFTMNSTYGNNLKHLFSTITSNT  59

Query  112  PIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             I+ GF + S G+  D+   L LCRGDV    C+SC+
Sbjct  60   QIDYGFYNVSYGQNSDEVNALGLCRGDVKPDICRSCI  96



>emb|CDY57408.1| BnaA05g36230D [Brassica napus]
Length=255

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -2

Query  208  LFHFCSN-SGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDV  32
            L+H CS+  GNFT  S Y++NLN L   L    P +GF + S G   D   GL LCRGD 
Sbjct  38   LYHKCSDIEGNFTSRSPYESNLNSLFPRLSYSVPSSGFAALSTGNKPDNVNGLGLCRGDA  97

Query  31   SAADCKSCVA  2
            S +DC++C+A
Sbjct  98   SPSDCRTCLA  107



>ref|XP_010059652.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 [Eucalyptus grandis]
Length=197

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 6/91 (7%)
 Frame = -2

Query  259  LVSMAVVTLQTAMAADPLF--HFCSNSGNFTPnsnyqnnlnqllgd--lyLKTPINGFGS  92
            LVS + +      AA P +  H+C N+  FTP S YQ NLN LL        T  +GF +
Sbjct  7    LVSKSRICTDITEAA-PTYTRHYCPNTALFTPKSTYQTNLNTLLSSLPSTAATDADGFAN  65

Query  91   GSAGKY-YDQTYGLSLCRGDVSAADCKSCVA  2
             +  K  +D+TYGL LCRGD++AA C  CV+
Sbjct  66   ATGDKNPHDRTYGLFLCRGDIAAATCGDCVS  96



>ref|XP_010655410.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=1241

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -2

Query  211  PLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDV  32
            PL    SN   +TPNS ++NNL  LL  L   T + GF S S G   +Q +G +LCRGDV
Sbjct  673  PLGKVRSNK-TYTPNSPFENNLKGLLQSLSSNTHLTGFNSASVGSNTNQVHGRALCRGDV  731

Query  31   SAADCKSCV  5
            +A DCK+CV
Sbjct  732  AAQDCKNCV  740



>ref|XP_007211369.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
 gb|EMJ12568.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
Length=663

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -2

Query  262  LLVSMAVVTL---QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLK-TPINGFG  95
            +L S+ VVTL    +   AD L+H C N+  FTPNS +Q+NLN+LL  L    T  +GF 
Sbjct  9    ILSSIFVVTLLSFPSPAEADYLYHVCPNTTTFTPNSTFQSNLNRLLSTLSSNATRPSGFY  68

Query  94   SGSAGKYY--DQTYGLSLCRGDVSAAD-CKSCVA  2
            + +A      D  YGL LCRGDV+A D CKSCV+
Sbjct  69   NATASSRTPNDAVYGLFLCRGDVAATDACKSCVS  102



>ref|XP_002526797.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF35603.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=260

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (58%), Gaps = 6/90 (7%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFG  95
            F++LLLVS     L T  AADPL + C+  G  + +     N++ LL DL  +   +G+ 
Sbjct  6    FTILLLVSF----LYTCDAADPLGNLCN--GGASSSRAVSVNIDYLLSDLVSEASTSGYS  59

Query  94   SGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            + S G   D+ YGL+ CRGDVS+ DC  C+
Sbjct  60   ATSFGNGRDKVYGLAQCRGDVSSRDCSDCL  89



>ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28559.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=680

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 3/98 (3%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyLK  116
            M +S+ F    L+   +++L  A   +PLFHFC   SGNFT NS Y+ NLN+ L      
Sbjct  1    MDSSRQFFFSSLIVTFLLSLTVAQQ-EPLFHFCLDTSGNFTRNSTYEANLNRQLSSFSSN  59

Query  115  TPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            T  + GF + S+G+  ++   ++LCRGDV++ DC  C+
Sbjct  60   TANDYGFYNMSSGQGSERANVIALCRGDVNSGDCLHCI  97



>ref|XP_006372981.1| hypothetical protein POPTR_0017s06750g [Populus trichocarpa]
 gb|ERP50778.1| hypothetical protein POPTR_0017s06750g [Populus trichocarpa]
Length=236

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = -2

Query  112  PINGFGSGSAGKY-YDQTYGLSLCRGDVSAADCKSCVA  2
            P+ GF  GS G+   D+ YGL LCRGDVS++DC++C A
Sbjct  51   PVEGFALGSLGQNNQDRPYGLVLCRGDVSSSDCRTCAA  88



>gb|EMS47764.1| Cysteine-rich receptor-like protein kinase 25 [Triticum urartu]
Length=692

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = -2

Query  205  FHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING--FGSGSAGKYYDQTYGLSLCRGDV  32
            + +C N+GN+TPNS YQ NL  L   L  K   N   F + + G   D  + L+LCRGD 
Sbjct  22   WQYCGNNGNYTPNSTYQANLRLLSSTLPNKAASNTTLFATATVGDIPDMVHALTLCRGDT  81

Query  31   SAADCKSCVA  2
            SA  C+ CVA
Sbjct  82   SAFACEDCVA  91



>ref|NP_001049721.1| Os03g0277600 [Oryza sativa Japonica Group]
 gb|ABF95270.1| 33 kDa secretory protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11635.1| Os03g0277600 [Oryza sativa Japonica Group]
 gb|EAY89459.1| hypothetical protein OsI_10992 [Oryza sativa Indica Group]
 gb|EAY89461.1| hypothetical protein OsI_10994 [Oryza sativa Indica Group]
 gb|EAZ26451.1| hypothetical protein OsJ_10339 [Oryza sativa Japonica Group]
 dbj|BAG87917.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = -2

Query  286  TSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPI  107
            +SK    L+L+S A++ L  +MA D +  +CS +     +    +  + L   +   +  
Sbjct  4    SSKACRCLVLMSFALLPL--SMAMDSIGSYCSGNSLAGNSKAVASINSVLTDLVAKGSTG  61

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
             GF + SAGK  +  YGL+ CRGDVS +DC++C+A
Sbjct  62   GGFATSSAGKANNVIYGLAQCRGDVSTSDCQACLA  96



>gb|EAZ05518.1| hypothetical protein OsI_27735 [Oryza sativa Indica Group]
Length=274

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 54/102 (53%), Gaps = 11/102 (11%)
 Frame = -2

Query  274  FSLLLLVS--MAVVTLQTAMAAD--PLFHFCSNSG------NFTPnsnyqnnlnqllgdl  125
             S L+LV+  +A   L   MAA   P+  FCS SG      N +     + ++N ++ DL
Sbjct  4    LSQLVLVTAFLAAALLPMGMAATTYPIGSFCSESGMNYGDLNSSEAVVRRRSVNFVVSDL  63

Query  124  yLKTPING-FGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
              K    G F +  AG+ YD  YGL+ CRGDVS  DC +C+A
Sbjct  64   VAKARTGGGFATSRAGRGYDAFYGLAQCRGDVSGGDCDACLA  105



>ref|XP_006383957.1| hypothetical protein POPTR_0004s024302g, partial [Populus trichocarpa]
 gb|ERP61754.1| hypothetical protein POPTR_0004s024302g, partial [Populus trichocarpa]
Length=125

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 56/101 (55%), Gaps = 7/101 (7%)
 Frame = -2

Query  292  MATSKLFSLLL-LVSMAVVTLQTAMAADPLFHFCSNSG----NFTPnsnyqnnlnqllgd  128
            M + K + +LL L+++A++TL     A+ L+H C N+     N T   N    L+ L  +
Sbjct  1    MNSLKFYVILLSLLTLAIITLAQE-DANYLYHNCQNATTSAINSTYRVNLNLLLSSLASN  59

Query  127  lyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
                  I GF + S G+  DQ YGL +CRGD+S + C++CV
Sbjct  60   ATRNNTI-GFYNTSFGQNTDQVYGLFICRGDLSNSVCQNCV  99



>gb|KCW61044.1| hypothetical protein EUGRSUZ_H03818 [Eucalyptus grandis]
Length=573

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 45/87 (52%), Gaps = 4/87 (5%)
 Frame = -2

Query  253  SMAVVTLQTAMAADPLFHFCSNSGNFTPnsn----yqnnlnqllgdlyLKTPINGFGSGS  86
            S AV  L   M    +   CS+ GN+   +       + L++     Y K PI GF + +
Sbjct  142  SEAVSYLILKMGTQFVMERCSDRGNYAAFTKFQDNLSSLLSKGNSADYSKGPIGGFYNTT  201

Query  85   AGKYYDQTYGLSLCRGDVSAADCKSCV  5
             G+  D+ YGL LCRGDV+A  C+SC+
Sbjct  202  EGEDPDKVYGLFLCRGDVAANRCQSCI  228



>ref|XP_006377265.1| hypothetical protein POPTR_0011s03300g [Populus trichocarpa]
 gb|ERP55062.1| hypothetical protein POPTR_0011s03300g [Populus trichocarpa]
Length=257

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (59%), Gaps = 10/95 (11%)
 Frame = -2

Query  283  SKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyLKTPI  107
            S +F  LL+++MA   L        L HFC  N GNF+ NS+Y++NL++L+      T  
Sbjct  13   SPVFIHLLVLTMAQTNL--------LQHFCIENHGNFSANSDYKSNLDRLISSFSSDTNN  64

Query  106  N-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            + GF +GS G+  D+ Y +SLCRGD     C+SC+
Sbjct  65   DYGFYTGSFGENIDKAYAISLCRGDKKPETCRSCI  99



>ref|XP_004982556.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Setaria 
italica]
Length=259

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  196  CSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADC  17
            CS +G F+    ++ NL++L   L  K P  GF  G+ G+  D+ +GL+LCRGDV+ A C
Sbjct  37   CSGAGTFSAGGAFEGNLHRLTSLLEAKAPAVGFEIGTVGERGDRVHGLALCRGDVARAAC  96

Query  16   KSCV  5
              CV
Sbjct  97   AECV  100



>ref|XP_006377262.1| hypothetical protein POPTR_0011s03240g [Populus trichocarpa]
 gb|ABK96183.1| unknown [Populus trichocarpa]
 gb|ERP55059.1| hypothetical protein POPTR_0011s03240g [Populus trichocarpa]
Length=257

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (59%), Gaps = 10/95 (11%)
 Frame = -2

Query  283  SKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyLKTPI  107
            S +F  LL+++MA   L        L HFC  N GNF+ NS+Y++NL++L+      T  
Sbjct  13   SPVFIHLLVLTMAQTNL--------LQHFCIENHGNFSANSDYKSNLDRLISSFSSDTNN  64

Query  106  N-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            + GF +GS G+  D+ Y +SLCRGD     C+SC+
Sbjct  65   DYGFYTGSFGENIDKAYAISLCRGDKKPETCRSCI  99



>ref|XP_007049618.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
 gb|EOX93775.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
Length=254

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -2

Query  217  ADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYGLSLCRG  38
            ADPL +FC+       +S    N+++LL ++  KT +  + + S+G+  D+ YGL+ CRG
Sbjct  18   ADPLGNFCNEDTFINISSPTSENIDRLLAEVVSKTSLTAYIATSSGRGPDRVYGLAQCRG  77

Query  37   DVSAADCKSCV  5
            DVS+ DC SC+
Sbjct  78   DVSSKDCSSCI  88



>gb|KCW75403.1| hypothetical protein EUGRSUZ_E04157, partial [Eucalyptus grandis]
Length=277

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 44/92 (48%), Gaps = 3/92 (3%)
 Frame = -2

Query  268  LLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn--yqnnlnqllgdlyLKTPINGFG  95
               L  ++V T  +  A + LFH C N+  FTPNS      +              +GF 
Sbjct  12   FFFLNFLSVYTRSSEAAPEYLFHDCPNTTLFTPNSTYGSNLDALLSSLSSTANNSTDGFA  71

Query  94   SGSAGKYY-DQTYGLSLCRGDVSAADCKSCVA  2
            + +AG+   DQ YGL LCRGD+  A C  CV+
Sbjct  72   NATAGQNPPDQAYGLFLCRGDLDIATCSDCVS  103



>ref|XP_003637938.1| Cysteine-rich receptor-like protein kinase, partial [Medicago 
truncatula]
Length=538

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 2/101 (2%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSN-SGNFTPnsnyqnnlnqllgdl  125
            +  +++  LFS    + +     Q     D L++FC N +GN+T NS YQNNLN LL +L
Sbjct  1    MTIVSSKLLFSFYSFLILITFVSQAKAQPDFLYNFCINDNGNYTANSTYQNNLNTLLSNL  60

Query  124  yLKTPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
              KT IN GF + S G+  D+   + LCRGDV    C+SC+
Sbjct  61   TSKTQINYGFYNFSYGQNTDKVNAIGLCRGDVKPDLCRSCL  101



>ref|XP_010679273.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=238

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAA--DPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING  101
            F+ + L+S  +  LQT + A  +PL + C NS NFT  S+Y+ NLN+L G L   T   G
Sbjct  3    FTNIFLIS-CIFFLQTTIIAANNPLSYSCINSQNFTTGSHYELNLNKLTGLLVYLTQPTG  61

Query  100  FGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            +   + G    Q +GL LCRGDVS+ DC SC++
Sbjct  62   YAQATVG----QAHGLGLCRGDVSSFDCLSCIS  90



>ref|XP_010059668.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Eucalyptus 
grandis]
Length=299

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 44/92 (48%), Gaps = 3/92 (3%)
 Frame = -2

Query  268  LLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsn--yqnnlnqllgdlyLKTPINGFG  95
               L  ++V T  +  A + LFH C N+  FTPNS      +              +GF 
Sbjct  12   FFFLNFLSVYTRSSEAAPEYLFHDCPNTTLFTPNSTYGSNLDALLSSLSSTANNSTDGFA  71

Query  94   SGSAGKYY-DQTYGLSLCRGDVSAADCKSCVA  2
            + +AG+   DQ YGL LCRGD+  A C  CV+
Sbjct  72   NATAGQNPPDQAYGLFLCRGDLDIATCSDCVS  103



>ref|XP_010056934.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=700

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            K PI GF + + G+  D+ YGL LCRGDV+A  C+SC+ 
Sbjct  86   KGPIRGFYNTTEGEDPDKVYGLFLCRGDVAANQCQSCIG  124



>ref|XP_009418900.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Musa 
acuminata subsp. malaccensis]
Length=654

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 55/90 (61%), Gaps = 0/90 (0%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFG  95
            + +LL  S+ ++      ++  L+ +C N  N+T NS +Q NLN LL  L   T   G+ 
Sbjct  5    YHVLLFFSLVLMLRCYGTSSSKLWSYCPNDANYTTNSTFQYNLNLLLASLSSSTAATGYS  64

Query  94   SGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            + + G+  DQ +GL+LCRGDVS++ C++C+
Sbjct  65   NDTEGQSSDQVHGLALCRGDVSSSVCQTCL  94



>gb|KCW75010.1| hypothetical protein EUGRSUZ_E037852, partial [Eucalyptus grandis]
Length=558

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 42/79 (53%), Gaps = 3/79 (4%)
 Frame = -2

Query  229  TAMAADPLFHFCSNSGNFTPnsnyq--nnlnqllgdlyLKTPINGFGSGSAGKYY-DQTY  59
            T  A   L+H CSN+  FTPNS Y+   +             INGF + +AG+   DQ Y
Sbjct  23   TEAAPTYLYHNCSNTTLFTPNSTYRFNLDTLLSSLSSASTNSINGFANATAGQNPPDQAY  82

Query  58   GLSLCRGDVSAADCKSCVA  2
            G+ LCRGD+  A C  CVA
Sbjct  83   GIFLCRGDLDTATCSDCVA  101



>ref|XP_010059519.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Eucalyptus 
grandis]
Length=574

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 42/79 (53%), Gaps = 3/79 (4%)
 Frame = -2

Query  229  TAMAADPLFHFCSNSGNFTPnsnyq--nnlnqllgdlyLKTPINGFGSGSAGKYY-DQTY  59
            T  A   L+H CSN+  FTPNS Y+   +             INGF + +AG+   DQ Y
Sbjct  23   TEAAPTYLYHNCSNTTLFTPNSTYRFNLDTLLSSLSSASTNSINGFANATAGQNPPDQAY  82

Query  58   GLSLCRGDVSAADCKSCVA  2
            G+ LCRGD+  A C  CVA
Sbjct  83   GIFLCRGDLDTATCSDCVA  101



>ref|XP_010999539.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X2 [Populus euphratica]
Length=273

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = -2

Query  295  AMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyL  119
            AM  SKL      V + ++ L T    + L HFC  N GNF+ NS+Y++NL++L+     
Sbjct  2    AMLPSKLLFFFGPVFIHLLVL-TRAQTNLLQHFCIENHGNFSANSDYKSNLDRLISSFSS  60

Query  118  KTPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
                + GF +GS GK  D+ Y +SLCRGD     C+SC+
Sbjct  61   NRKNDYGFYTGSFGKNIDKAYAISLCRGDKKPETCRSCI  99



>gb|ACG28478.1| serine/threonine kinase-like protein [Zea mays]
Length=267

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 0/97 (0%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKT  113
            M +S++   +LLV    + L   MAAD +  +CS S     +    N  + L   +   +
Sbjct  1    MESSRMRCCMLLVVSLALLLPLGMAADSIGSYCSGSSYAGSSKAVANINSVLADLVASAS  60

Query  112  PINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
               G+ + +AGK     YGL+ CRGDVSA+DC SC+A
Sbjct  61   STGGYATSTAGKGNSIIYGLAQCRGDVSASDCASCLA  97



>emb|CDP03948.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 5/101 (5%)
 Frame = -2

Query  307  TKLAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgd  128
            T++  MA S+   LL ++S  +     A+ AD     CS++    P +    N++ L+ +
Sbjct  57   TEIRNMALSRFIFLLWILSSCIF----AVLADVSVENCSDNSTI-PTAQMSANIDSLVAE  111

Query  127  lyLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            L   T  N F   + GK  D+ YGL  CRGDV++ DC +C+
Sbjct  112  LASSTSQNRFSIATYGKGTDKVYGLGQCRGDVNSTDCTTCI  152



>ref|XP_010999538.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X1 [Populus euphratica]
Length=298

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = -2

Query  295  AMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdlyL  119
            AM  SKL      V + ++ L T    + L HFC  N GNF+ NS+Y++NL++L+     
Sbjct  2    AMLPSKLLFFFGPVFIHLLVL-TRAQTNLLQHFCIENHGNFSANSDYKSNLDRLISSFSS  60

Query  118  KTPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
                + GF +GS GK  D+ Y +SLCRGD     C+SC+
Sbjct  61   NRKNDYGFYTGSFGKNIDKAYAISLCRGDKKPETCRSCI  99



>ref|XP_007148794.1| hypothetical protein PHAVU_005G014900g [Phaseolus vulgaris]
 gb|ESW20788.1| hypothetical protein PHAVU_005G014900g [Phaseolus vulgaris]
Length=661

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  106  NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            NGFG+G++G   D  YGL LCRGDV+ + C SCV
Sbjct  66   NGFGNGTSGIDQDMVYGLYLCRGDVNTSLCHSCV  99



>gb|KCW74325.1| hypothetical protein EUGRSUZ_E02988, partial [Eucalyptus grandis]
Length=304

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = -2

Query  250  MAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnn--lnqllgdlyLKTPINGFGSGSAGK  77
            ++V T  +  A + LFH C N+  FT NS Y++N                +GF + +AG+
Sbjct  18   LSVYTRSSEAAPEYLFHACPNTTLFTTNSTYRSNLDTLLSSLSSAATNSTDGFANATAGQ  77

Query  76   YY-DQTYGLSLCRGDVSAADCKSCVA  2
               DQ YGL LCRGDVS A C  CV+
Sbjct  78   NPPDQAYGLFLCRGDVSTATCSDCVS  103



>gb|KDP20818.1| hypothetical protein JCGZ_21289 [Jatropha curcas]
Length=263

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = -2

Query  112  PI-NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            PI NGF + +AGK  D+ YGL+ CRGD+S ADC +C+
Sbjct  52   PIQNGFYTATAGKGDDRIYGLAGCRGDISVADCSTCI  88



>ref|XP_010553429.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X3 [Tarenaya hassleriana]
Length=630

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADP--LFHFCSNSGNFTPnsnyqnnlnqllgd  128
            +A+   S + S L+L+    +  Q   A DP  + HFC    NFT  + Y++NL  LL +
Sbjct  1    MASCGFSSIVSCLVLICFRYLATQ---ATDPAYILHFCPQVINFTSTNTYESNLITLLSN  57

Query  127  lyLKTPI---NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            L         NGF +  +G+  D  YG+ LCRGD+S  +C++CV
Sbjct  58   LSSSINSSYANGFRTSESGRGPDIVYGVFLCRGDMSMDNCRNCV  101



>ref|XP_010932126.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Elaeis 
guineensis]
Length=552

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -2

Query  220  AADPLFHFCSNSGNFTPnsnyqnnlnqll--gdlyLKTPINGFGSGSAGKYYDQTYGLSL  47
            A +PL ++C  + N+T NS Y++NL  LL        +   GF + + G+  DQ YGL++
Sbjct  26   AGNPLHYYCGTTDNYTANSTYESNLMNLLLPSLASNASLSGGFLNATVGQIPDQIYGLAM  85

Query  46   CRGDVSAADCKSCV  5
            CRGD +A+ C+SC+
Sbjct  86   CRGDTNASVCRSCL  99



>gb|KDP25876.1| hypothetical protein JCGZ_22906 [Jatropha curcas]
Length=226

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -2

Query  235  LQTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPINGFGSGSAGKYYDQTYG  56
            L   +  +PL   CS+   + P+S Y+ NLN LL  L  K P  GFG    G   DQ  G
Sbjct  2    LTVVICVNPLESICSDL-EYPPHSPYEKNLNNLLNILSTKIPPYGFGLSILGNGVDQING  60

Query  55   LSLCRGDVSAADCKSCVA  2
            L LCRGDVS+ DC +CV+
Sbjct  61   LGLCRGDVSSKDCSACVS  78



>ref|XP_011012775.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 isoform 
X3 [Populus euphratica]
Length=666

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 53/90 (59%), Gaps = 6/90 (7%)
 Frame = -2

Query  268  LLLLVSMAVVTLQTAMAADPLFHFCSNS--GNFTPnsnyqnnlnqllgdlyLKTPINGFG  95
            L++L+SM    L   + ADPLF  CS++  GN+   S +  N+  +L  L   T   G+ 
Sbjct  19   LIILLSM----LFALVLADPLFTICSSTEYGNYDLKSPFGKNVKIVLETLPSITSSTGYN  74

Query  94   SGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            S + G+  D+  G +LCRGDV+++ C++C+
Sbjct  75   STAIGELPDKVTGKALCRGDVTSSACQTCL  104



>gb|KFK22508.1| hypothetical protein AALP_AAs69716U000100, partial [Arabis alpina]
Length=181

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 45/79 (57%), Gaps = 4/79 (5%)
 Frame = -2

Query  226  AMAADP--LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPI--NGFGSGSAGKYYDQTY  59
            A A DP  +FH C N+  FT NS Y  NL  LL  L  +      GF S +AG+  D+  
Sbjct  21   ASAQDPNYVFHNCPNTTTFTRNSTYFTNLQTLLSSLSSRNTSYSTGFQSTTAGQAPDRVT  80

Query  58   GLSLCRGDVSAADCKSCVA  2
            GL LCRGDVS   C+SCV+
Sbjct  81   GLFLCRGDVSRDVCRSCVS  99



>ref|XP_006850463.1| hypothetical protein AMTR_s00035p00086030 [Amborella trichopoda]
 gb|ERN12044.1| hypothetical protein AMTR_s00035p00086030 [Amborella trichopoda]
Length=255

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = -2

Query  232  QTAMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING-FGSGSAGKYYDQTYG  56
            + AMAA P  + C  + N+T NS Y+ NLNQLL  L    P++G F S + G   DQ +G
Sbjct  19   RAAMAAIPTGNVCLGTTNYTSNSQYEQNLNQLLQSLQANVPVSGGFNSTTLGTSPDQVFG  78

Query  55   LSLCRGDVSAADCKSCVA  2
            L LCRGDV   +C  C++
Sbjct  79   LGLCRGDVKTTECTKCIS  96



>ref|XP_010910400.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Elaeis 
guineensis]
Length=322

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -2

Query  226  AMAADPLFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPING-FGSGSAGKYYDQTYGLS  50
            A AADPL+  C  + N+T NS Y  NLN+LL  L + T ++G F S + G+  +Q  GL+
Sbjct  27   AAAADPLYQICGTTDNYTTNSTYAFNLNRLLTFLDINTSLSGGFSSFTVGQSSNQIDGLA  86

Query  49   LCRGDVSAADCKSCV  5
            LCRGD++A  C SC+
Sbjct  87   LCRGDINATVCHSCL  101



>gb|KCW73842.1| hypothetical protein EUGRSUZ_E02441 [Eucalyptus grandis]
Length=702

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            K PI+GF + + G+  D+ YGL LCRGDV+A  C+SC+
Sbjct  91   KGPIHGFHNTTEGEDPDKVYGLFLCRGDVAANLCQSCI  128



>ref|XP_007143173.1| hypothetical protein PHAVU_007G049800g [Phaseolus vulgaris]
 gb|ESW15167.1| hypothetical protein PHAVU_007G049800g [Phaseolus vulgaris]
Length=260

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADPLFHFC-SNSGNFTPnsnyqnnlnqllgdl  125
            +A + +S+L S +  +   +++ Q +     L HFC S+ G+FT NS Y  NLN LL +L
Sbjct  1    MAVVVSSRLHSYVCCLLFIIIS-QASAQPSFLNHFCLSDEGSFTANSTYHTNLNTLLSNL  59

Query  124  yLKTPIN-GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
               T I+ GF + S G+  D+ Y + +CRGDV   +C+SC+
Sbjct  60   TSNTQIDYGFYNLSYGENSDKVYAIGVCRGDVKPDECRSCI  100



>ref|XP_011007635.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=675

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = -2

Query  292  MATSKLFSLLL-LVSMAVVTLQTAMAADPLFHFCSN---SGNFTPnsnyqnnlnqllgdl  125
            M + K + +LL L+++A++TL     A+ L+H C N   S   +      N L   L   
Sbjct  1    MNSLKFYVILLSLLTVAIITLAQE-DANYLYHNCQNATTSAINSTYRVNLNLLLSSLASN  59

Query  124  yLKTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
              +   NGF + S G+  DQ YGL +CRGDVS   C++CV
Sbjct  60   ATRNNNNGFYNTSFGQNTDQVYGLFICRGDVSNTVCQNCV  99



>ref|XP_010553428.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X2 [Tarenaya hassleriana]
Length=660

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADP--LFHFCSNSGNFTPnsnyqnnlnqllgd  128
            +A+   S + S L+L+    +  Q   A DP  + HFC    NFT  + Y++NL  LL +
Sbjct  1    MASCGFSSIVSCLVLICFRYLATQ---ATDPAYILHFCPQVINFTSTNTYESNLITLLSN  57

Query  127  lyLKTPI---NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            L         NGF +  +G+  D  YG+ LCRGD+S  +C++CV
Sbjct  58   LSSSINSSYANGFRTSESGRGPDIVYGVFLCRGDMSMDNCRNCV  101



>ref|XP_010553427.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X1 [Tarenaya hassleriana]
Length=662

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = -2

Query  301  LAAMATSKLFSLLLLVSMAVVTLQTAMAADP--LFHFCSNSGNFTPnsnyqnnlnqllgd  128
            +A+   S + S L+L+    +  Q   A DP  + HFC    NFT  + Y++NL  LL +
Sbjct  1    MASCGFSSIVSCLVLICFRYLATQ---ATDPAYILHFCPQVINFTSTNTYESNLITLLSN  57

Query  127  lyLKTPI---NGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            L         NGF +  +G+  D  YG+ LCRGD+S  +C++CV
Sbjct  58   LSSSINSSYANGFRTSESGRGPDIVYGVFLCRGDMSMDNCRNCV  101



>ref|XP_010059118.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
9 [Eucalyptus grandis]
Length=334

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = -2

Query  268  LLLLVSMAVVTLQTAMAADPLFHFCSNSGNFTPnsnyqnn--lnqllgdlyLKTPINGFG  95
               L  ++V T  +  A + LFH C N+  FT NS Y++N                +GF 
Sbjct  52   FFFLNFLSVYTRSSEAAPEYLFHACPNTTLFTTNSTYRSNLDTLLSSLSSAATNSTDGFA  111

Query  94   SGSAGKYY-DQTYGLSLCRGDVSAADCKSCVA  2
            + +AG+   DQ YGL LCRGDVS A C  CV+
Sbjct  112  NATAGQNPPDQAYGLFLCRGDVSTATCSDCVS  143



>ref|XP_002304939.2| hypothetical protein POPTR_0004s02320g [Populus trichocarpa]
 gb|EEE85450.2| hypothetical protein POPTR_0004s02320g [Populus trichocarpa]
Length=690

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 31/98 (32%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -2

Query  292  MATSKLFSLLLLVSMAVVTLQTAMAADPLFHFCSNS--GNFTPnsnyqnnlnqllgdlyL  119
            M    L ++ LL+ +  +     +A DPLF  CS +  GN+   S +  N+  +L  L  
Sbjct  32   MTRHALLAMCLLIVLLSMLFPIVLA-DPLFTTCSTTEYGNYDLKSPFGKNVKIVLETLPS  90

Query  118  KTPINGFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             T   G+ S + G++ D+  G +LCRGDV+++ C++C+
Sbjct  91   ITSSTGYNSTAIGEFPDKVTGKALCRGDVTSSACQTCL  128



>gb|KDO75584.1| hypothetical protein CISIN_1g010329mg [Citrus sinensis]
Length=434

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = -2

Query  274  FSLLLLVSMAVVTLQTAM--AADP--LFHFCSNSGNFTPnsnyqnnlnqllgdlyLKTPI  107
            FS+L L  + + + Q +   AADP  ++HFCS++ NFT NS +++NLN+LL  L      
Sbjct  6    FSVLFLFVIYLSSFQFSFTAAADPTYVYHFCSDTANFTRNSTFESNLNRLLTSLPTNASR  65

Query  106  -NGFGSG----SAGKYYDQTYGLSLCRGDVSAADCKSCV  5
             NGF  G    +AG+  ++ Y L LCRGD +   C++CV
Sbjct  66   GNGFSRGFFNATAGQDPNRVYSLFLCRGDQTTNSCQNCV  104



>ref|XP_011012773.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 isoform 
X1 [Populus euphratica]
Length=718

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 53/90 (59%), Gaps = 6/90 (7%)
 Frame = -2

Query  268  LLLLVSMAVVTLQTAMAADPLFHFCSNS--GNFTPnsnyqnnlnqllgdlyLKTPINGFG  95
            L++L+SM    L   + ADPLF  CS++  GN+   S +  N+  +L  L   T   G+ 
Sbjct  19   LIILLSM----LFALVLADPLFTICSSTEYGNYDLKSPFGKNVKIVLETLPSITSSTGYN  74

Query  94   SGSAGKYYDQTYGLSLCRGDVSAADCKSCV  5
            S + G+  D+  G +LCRGDV+++ C++C+
Sbjct  75   STAIGELPDKVTGKALCRGDVTSSACQTCL  104



>ref|XP_010924010.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Elaeis 
guineensis]
Length=216

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  103  GFGSGSAGKYYDQTYGLSLCRGDVSAADCKSCVA  2
            GF + S G+  DQ +GL+LCRGDVS  +C+SC++
Sbjct  95   GFATLSKGQPPDQVFGLALCRGDVSQDECRSCLS  128



>ref|XP_010042892.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
9, partial [Eucalyptus grandis]
Length=274

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = -2

Query  208  LFHFCSNSGNFTPnsnyqnnlnqllgdlyLK--TPINGFGSGSAGK-YYDQTYGLSLCRG  38
            L HFC+    FTPNS Y++NLN +L  L     T  NGF + +AG+   DQ +GL LCRG
Sbjct  34   LKHFCARMSFFTPNSTYESNLNTVLSSLSSNATTSTNGFATATAGQDRPDQAHGLFLCRG  93

Query  37   DVSAADCKSCVA  2
            DVS + C  CVA
Sbjct  94   DVSISTCSDCVA  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522854037308