BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6553_g1_i3 len=1275 path=[1457:0-653 859:654-1274]

Length=1275
                                                                      Score     E

gb|ACK56115.1|  ELF4-like protein                                       124   2e-30   Ipomoea nil [qian niu]
ref|XP_010253891.1|  PREDICTED: protein EARLY FLOWERING 4-like          123   9e-30   
ref|XP_006350838.1|  PREDICTED: protein EARLY FLOWERING 4-like          121   2e-29   
ref|XP_002311221.1|  hypothetical protein POPTR_0008s06820g             117   7e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010033007.1|  PREDICTED: protein EARLY FLOWERING 4-like          117   9e-28   
ref|XP_002299809.2|  hypothetical protein POPTR_0001s25870g             116   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011045735.1|  PREDICTED: protein EARLY FLOWERING 4               114   5e-27   
emb|CDP09188.1|  unnamed protein product                                115   6e-27   
ref|XP_010322326.1|  PREDICTED: protein EARLY FLOWERING 4-like          115   9e-27   
ref|XP_006425066.1|  hypothetical protein CICLE_v10029554mg             114   9e-27   
ref|XP_009371495.1|  PREDICTED: protein EARLY FLOWERING 4-like          114   1e-26   
ref|XP_010262858.1|  PREDICTED: protein EARLY FLOWERING 4-like          114   1e-26   
ref|XP_002314100.2|  hypothetical protein POPTR_0009s05110g             112   3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_004250662.1|  PREDICTED: protein EARLY FLOWERING 4-like          112   4e-26   
ref|XP_002270733.1|  PREDICTED: protein EARLY FLOWERING 4               112   7e-26   Vitis vinifera
gb|AFN53671.1|  hypothetical protein                                    111   1e-25   
ref|XP_007163541.1|  hypothetical protein PHAVU_001G242900g             109   4e-25   
ref|XP_010106262.1|  hypothetical protein L484_002382                   108   6e-25   
ref|XP_007008976.1|  Uncharacterized protein TCM_042505                 108   8e-25   
gb|KHG10599.1|  Protein ELF4-LIKE 1 -like protein                       108   1e-24   
gb|EYU45718.1|  hypothetical protein MIMGU_mgv1a026961mg                106   3e-24   
ref|XP_003552375.1|  PREDICTED: protein EARLY FLOWERING 4-like          107   3e-24   
gb|KDP44774.1|  hypothetical protein JCGZ_01274                         105   6e-24   
ref|XP_003537487.1|  PREDICTED: protein EARLY FLOWERING 4-like          106   6e-24   
gb|KHN36376.1|  Protein EARLY FLOWERING 4                               105   1e-23   
ref|XP_002525644.1|  conserved hypothetical protein                     104   1e-23   Ricinus communis
gb|KHN34721.1|  Protein EARLY FLOWERING 4                               105   3e-23   
gb|KDP46495.1|  hypothetical protein JCGZ_08467                         104   3e-23   
ref|XP_003600889.1|  Early flowering                                    103   5e-23   
gb|AIY68669.1|  early flowering 4                                       103   6e-23   
ref|XP_004500487.1|  PREDICTED: protein EARLY FLOWERING 4-like          103   6e-23   
gb|AFK36717.1|  unknown                                                 103   7e-23   
ref|XP_010521948.1|  PREDICTED: protein ELF4-LIKE 1                     103   9e-23   
gb|AAX47177.2|  early flowering 4                                       102   1e-22   Pisum sativum [garden pea]
ref|XP_008226533.1|  PREDICTED: protein EARLY FLOWERING 4-like          102   1e-22   
ref|XP_010689678.1|  PREDICTED: protein EARLY FLOWERING 4-like          100   5e-22   
ref|XP_011084910.1|  PREDICTED: protein EARLY FLOWERING 4               100   7e-22   
ref|XP_010031219.1|  PREDICTED: protein EARLY FLOWERING 4               100   1e-21   
gb|ADQ20089.1|  ELF4 protein                                          98.6    2e-21   
ref|XP_008374004.1|  PREDICTED: protein EARLY FLOWERING 4-like        99.8    2e-21   
gb|KFK36896.1|  hypothetical protein AALP_AA4G186500                  98.2    3e-21   
ref|XP_009781846.1|  PREDICTED: protein EARLY FLOWERING 4-like        98.6    3e-21   
ref|XP_002533647.1|  conserved hypothetical protein                   98.6    5e-21   Ricinus communis
ref|XP_010322199.1|  PREDICTED: protein EARLY FLOWERING 4             97.4    8e-21   
ref|XP_010031220.1|  PREDICTED: protein EARLY FLOWERING 4-like        97.8    8e-21   
ref|XP_008463236.1|  PREDICTED: protein EARLY FLOWERING 4-like        97.4    1e-20   
ref|XP_010554657.1|  PREDICTED: protein EARLY FLOWERING 4-like        97.1    1e-20   
ref|XP_010650900.1|  PREDICTED: protein EARLY FLOWERING 4             97.1    1e-20   
emb|CAN79813.1|  hypothetical protein VITISV_018619                   97.1    1e-20   Vitis vinifera
ref|XP_009344899.1|  PREDICTED: protein EARLY FLOWERING 4-like is...  96.7    2e-20   
ref|XP_010534577.1|  PREDICTED: protein EARLY FLOWERING 4-like        96.7    2e-20   
ref|XP_009781337.1|  PREDICTED: protein EARLY FLOWERING 4-like        96.3    2e-20   
ref|XP_009788383.1|  PREDICTED: protein EARLY FLOWERING 4-like        96.7    3e-20   
ref|XP_008233752.1|  PREDICTED: protein EARLY FLOWERING 4-like        95.9    3e-20   
ref|XP_006338849.1|  PREDICTED: protein EARLY FLOWERING 4-like        95.9    3e-20   
ref|XP_007218599.1|  hypothetical protein PRUPE_ppa013347mg           95.9    4e-20   
ref|XP_009629950.1|  PREDICTED: protein EARLY FLOWERING 4-like        95.9    4e-20   
gb|AAQ73526.1|  early flowering 4                                     95.9    4e-20   Mesembryanthemum crystallinum
gb|KHN40071.1|  Protein ELF4-LIKE 1                                   96.3    4e-20   
gb|KDO66886.1|  hypothetical protein CISIN_1g031080mg                 96.7    4e-20   
emb|CDY07051.1|  BnaA04g22640D                                        94.7    5e-20   
ref|XP_006488526.1|  PREDICTED: protein ELF4-LIKE 1-like isoform X5   96.3    6e-20   
ref|XP_010414330.1|  PREDICTED: protein ELF4-LIKE 1-like              94.4    8e-20   
ref|XP_003544885.1|  PREDICTED: protein ELF4-LIKE 1-like isoform X1   95.9    8e-20   
ref|XP_004149248.1|  PREDICTED: protein EARLY FLOWERING 4-like        94.4    1e-19   
ref|XP_006488523.1|  PREDICTED: protein ELF4-LIKE 1-like isoform X2   96.3    1e-19   
ref|XP_010689700.1|  PREDICTED: protein EARLY FLOWERING 4-like        94.7    1e-19   
gb|AHZ89707.1|  early flowering 4                                     94.4    1e-19   
emb|CDY07627.1|  BnaA03g18840D                                        93.6    1e-19   
emb|CDY61710.1|  BnaC04g56730D                                        93.6    2e-19   
ref|XP_010505710.1|  PREDICTED: protein EARLY FLOWERING 4             93.6    2e-19   
ref|XP_009133403.1|  PREDICTED: protein EARLY FLOWERING 4-like        93.6    2e-19   
ref|XP_006596422.1|  PREDICTED: protein ELF4-LIKE 1-like isoform X2   95.5    2e-19   
ref|XP_010508920.1|  PREDICTED: protein EARLY FLOWERING 4-like        93.2    2e-19   
ref|XP_006488522.1|  PREDICTED: protein ELF4-LIKE 1-like isoform X1   95.9    2e-19   
ref|NP_180556.1|  protein ELF4-like 1                                 94.0    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411253.1|  hypothetical protein EUTSA_v10017822mg           93.6    2e-19   
ref|XP_009141860.1|  PREDICTED: protein EARLY FLOWERING 4-like        93.2    2e-19   
emb|CDY20515.1|  BnaC04g05290D                                        93.2    2e-19   
ref|XP_009143256.1|  PREDICTED: protein EARLY FLOWERING 4             92.8    3e-19   
ref|XP_006435734.1|  hypothetical protein CICLE_v10032998mg           94.0    3e-19   
gb|EYU22352.1|  hypothetical protein MIMGU_mgv1a015987mg              92.8    5e-19   
ref|XP_006295267.1|  hypothetical protein CARUB_v10024354mg           92.0    5e-19   
emb|CDY66370.1|  BnaUnng01460D                                        92.0    6e-19   
ref|XP_004307648.1|  PREDICTED: protein EARLY FLOWERING 4-like        92.0    7e-19   
ref|NP_565922.1|  protein EARLY FLOWERING 4                           91.3    1e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20512.1|  BnaC04g05320D                                        91.3    1e-18   
emb|CDY60339.1|  BnaC03g72320D                                        91.3    1e-18   
ref|XP_002862593.1|  hypothetical protein ARALYDRAFT_497391           90.9    2e-18   
ref|XP_009625081.1|  PREDICTED: protein EARLY FLOWERING 4-like        89.4    2e-17   
ref|XP_006293392.1|  hypothetical protein CARUB_v10024247mg           89.0    2e-17   
ref|XP_004171253.1|  PREDICTED: protein EARLY FLOWERING 4-like        88.2    2e-17   
emb|CDX95740.1|  BnaC03g26210D                                        87.8    5e-17   
ref|XP_006410045.1|  hypothetical protein EUTSA_v10017683mg           85.1    1e-16   
ref|XP_009784404.1|  PREDICTED: protein ELF4-LIKE 4-like              85.9    1e-16   
ref|XP_009593698.1|  PREDICTED: protein ELF4-LIKE 4                   85.9    1e-16   
ref|XP_002521338.1|  conserved hypothetical protein                   85.9    1e-16   Ricinus communis
ref|XP_010513223.1|  PREDICTED: protein ELF4-LIKE 1-like              85.9    1e-16   
ref|XP_002449890.1|  hypothetical protein SORBIDRAFT_05g025110        85.5    2e-16   Sorghum bicolor [broomcorn]
gb|KDP40710.1|  hypothetical protein JCGZ_24709                       85.1    2e-16   
ref|XP_010473960.1|  PREDICTED: protein ELF4-LIKE 1-like              85.1    2e-16   
ref|XP_007142208.1|  hypothetical protein PHAVU_008G261200g           85.9    2e-16   
ref|XP_009619416.1|  PREDICTED: protein ELF4-LIKE 3                   84.7    3e-16   
gb|ACK56122.1|  ELF4-like protein                                     85.1    3e-16   Saccharum officinarum [noble cane]
ref|XP_006369567.1|  hypothetical protein POPTR_0001s25870g           84.3    4e-16   
ref|XP_004303681.1|  PREDICTED: protein ELF4-LIKE 4-like isoform 1    84.3    5e-16   
ref|XP_002275438.1|  PREDICTED: protein ELF4-LIKE 4                   84.0    5e-16   Vitis vinifera
ref|XP_009412686.1|  PREDICTED: protein ELF4-LIKE 3-like              84.0    5e-16   
gb|ACK56113.1|  ELF4-like protein                                     84.0    6e-16   Hedyotis terminalis
ref|XP_009784512.1|  PREDICTED: protein ELF4-LIKE 3-like              83.6    6e-16   
gb|ACK56119.1|  ELF4-like protein                                     84.0    6e-16   Pinus taeda
ref|XP_009595000.1|  PREDICTED: protein EARLY FLOWERING 4-like        84.0    8e-16   
ref|XP_002279914.1|  PREDICTED: protein ELF4-LIKE 4                   83.6    9e-16   Vitis vinifera
gb|AFK39961.1|  unknown                                               83.2    1e-15   
ref|XP_009380046.1|  PREDICTED: protein ELF4-LIKE 3-like              83.2    1e-15   
ref|XP_010105509.1|  hypothetical protein L484_002611                 83.2    1e-15   
ref|XP_008797479.1|  PREDICTED: protein ELF4-LIKE 4-like              83.2    1e-15   
emb|CDP03105.1|  unnamed protein product                              83.2    1e-15   
emb|CDX83315.1|  BnaA03g21910D                                        83.6    1e-15   
gb|EYU25872.1|  hypothetical protein MIMGU_mgv1a016656mg              82.8    1e-15   
gb|ACK56128.1|  ELF4-like protein                                     82.8    1e-15   Antirrhinum majus [garden snapdragon]
ref|XP_003551140.1|  PREDICTED: protein ELF4-LIKE 4-like isoformX1    82.8    2e-15   
ref|XP_011036415.1|  PREDICTED: protein ELF4-LIKE 4-like              82.8    2e-15   
gb|AAD27669.1|AF119222_1  hypothetical protein                        82.8    2e-15   Oryza sativa [red rice]
ref|XP_011093804.1|  PREDICTED: protein ELF4-LIKE 3                   82.4    2e-15   
ref|NP_001068300.1|  Os11g0621500                                     82.8    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009419385.1|  PREDICTED: protein ELF4-LIKE 3-like              82.4    2e-15   
gb|ACG45265.1|  early flowering 4                                     82.8    2e-15   Zea mays [maize]
ref|NP_001275817.1|  ELF4-like protein                                82.4    2e-15   
ref|NP_001151292.1|  early flowering 4                                82.8    2e-15   Zea mays [maize]
ref|XP_010261931.1|  PREDICTED: protein ELF4-LIKE 4-like              82.4    2e-15   
gb|EYU21332.1|  hypothetical protein MIMGU_mgv1a016586mg              82.4    2e-15   
ref|XP_004243721.1|  PREDICTED: protein ELF4-LIKE 3-like              82.4    2e-15   
ref|NP_001275340.1|  ELF4-like protein                                82.4    2e-15   
ref|XP_007024603.1|  ELF4-like 4                                      82.4    2e-15   
ref|NP_001146184.1|  early flowering 4                                82.8    2e-15   Zea mays [maize]
ref|XP_007141770.1|  hypothetical protein PHAVU_008G224300g           82.0    2e-15   
ref|XP_008228208.1|  PREDICTED: protein ELF4-LIKE 4                   82.4    2e-15   
ref|XP_009133836.1|  PREDICTED: protein ELF4-LIKE 1                   82.8    2e-15   
ref|XP_010090124.1|  hypothetical protein L484_027356                 82.4    2e-15   
ref|XP_007138673.1|  hypothetical protein PHAVU_009G228400g           82.0    3e-15   
ref|XP_006849639.1|  hypothetical protein AMTR_s00024p00222370        82.0    3e-15   
ref|XP_008242208.1|  PREDICTED: protein ELF4-LIKE 3                   82.0    3e-15   
ref|XP_007202775.1|  hypothetical protein PRUPE_ppa013588mg           82.0    3e-15   
ref|XP_007215169.1|  hypothetical protein PRUPE_ppa013595mg           82.0    3e-15   
ref|XP_009404159.1|  PREDICTED: protein ELF4-LIKE 3-like              81.6    3e-15   
ref|XP_004287614.1|  PREDICTED: protein ELF4-LIKE 3-like isoform 1    82.0    3e-15   
ref|XP_006381644.1|  hypothetical protein POPTR_0006s14610g           81.6    3e-15   
gb|ADE75819.1|  unknown                                               82.0    3e-15   
gb|AJD80258.1|  EFL4                                                  81.6    4e-15   
ref|XP_010049534.1|  PREDICTED: protein ELF4-LIKE 3-like              81.3    4e-15   
ref|XP_009798445.1|  PREDICTED: protein ELF4-LIKE 3                   81.3    4e-15   
ref|XP_009628143.1|  PREDICTED: protein ELF4-LIKE 3-like              81.3    4e-15   
gb|EMS62766.1|  hypothetical protein TRIUR3_33924                     82.0    4e-15   
ref|XP_010936948.1|  PREDICTED: protein ELF4-LIKE 3-like              81.3    5e-15   
gb|EMT31043.1|  hypothetical protein F775_06613                       82.0    5e-15   
ref|XP_010537602.1|  PREDICTED: protein ELF4-LIKE 4 isoform X2        81.3    5e-15   
ref|XP_007012686.1|  Elf4-like 4 isoform 1                            81.3    5e-15   
ref|XP_009372348.1|  PREDICTED: protein ELF4-LIKE 4-like              81.3    5e-15   
ref|XP_006465931.1|  PREDICTED: protein ELF4-LIKE 4-like isoform X1   81.3    5e-15   
ref|XP_008337767.1|  PREDICTED: protein ELF4-LIKE 3                   81.3    5e-15   
ref|NP_001235393.1|  uncharacterized protein LOC100306717             81.3    6e-15   
ref|XP_008797489.1|  PREDICTED: protein ELF4-LIKE 3-like              80.9    6e-15   
ref|XP_002303249.1|  hypothetical protein POPTR_0003s06270g           80.9    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010537601.1|  PREDICTED: protein ELF4-LIKE 4 isoform X1        81.6    7e-15   
ref|XP_004513473.1|  PREDICTED: protein ELF4-LIKE 4-like              80.9    7e-15   
ref|XP_008787846.1|  PREDICTED: protein ELF4-LIKE 3-like              80.9    7e-15   
ref|XP_010033741.1|  PREDICTED: protein ELF4-LIKE 4                   80.9    7e-15   
gb|KDP33899.1|  hypothetical protein JCGZ_07470                       80.9    7e-15   
gb|ACK56117.1|  ELF4-like protein                                     80.9    8e-15   Lactuca serriola [compass-plant]
ref|XP_009361683.1|  PREDICTED: protein ELF4-LIKE 3                   80.9    8e-15   
ref|XP_011035705.1|  PREDICTED: protein ELF4-LIKE 4-like              80.5    9e-15   
gb|AFK49629.1|  unknown                                               80.5    9e-15   
ref|XP_002298099.1|  hypothetical protein POPTR_0001s17010g           80.5    9e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004507981.1|  PREDICTED: protein ELF4-LIKE 4-like isoform X1   80.1    1e-14   
ref|XP_010936947.1|  PREDICTED: protein ELF4-LIKE 4                   80.1    1e-14   
emb|CDO97858.1|  unnamed protein product                              80.1    1e-14   
gb|KCW53544.1|  hypothetical protein EUGRSUZ_J02822                   80.9    1e-14   
ref|XP_007154599.1|  hypothetical protein PHAVU_003G132400g           80.1    2e-14   
ref|XP_006663055.1|  PREDICTED: protein ELF4-LIKE 4-like isoform X1   80.1    2e-14   
ref|XP_006426639.1|  hypothetical protein CICLE_v10026798mg           79.7    2e-14   
gb|EYU28345.1|  hypothetical protein MIMGU_mgv1a019260mg              79.3    2e-14   
gb|ACJ84508.1|  unknown                                               79.7    2e-14   Medicago truncatula
ref|XP_010668016.1|  PREDICTED: protein ELF4-LIKE 4                   79.3    2e-14   
gb|EPS57304.1|  hypothetical protein M569_17515                       79.3    3e-14   
ref|XP_004144022.1|  PREDICTED: protein ELF4-LIKE 4-like isoform 1    79.0    4e-14   
gb|AFK43622.1|  unknown                                               79.0    4e-14   
ref|XP_010047504.1|  PREDICTED: protein ELF4-LIKE 3                   79.0    4e-14   
gb|ACK56112.1|  ELF4-like protein                                     78.2    5e-14   Helianthus annuus
ref|XP_010273934.1|  PREDICTED: protein ELF4-LIKE 4-like              78.2    6e-14   
gb|KEH32458.1|  early flowering protein                               78.2    6e-14   
ref|XP_011072576.1|  PREDICTED: protein ELF4-LIKE 4                   78.2    7e-14   
gb|AAD27564.1|AF114171_5  hypothetical protein                        83.2    7e-14   Sorghum bicolor [broomcorn]
gb|AAF79463.1|AC022492_7  F1L3.15                                     78.6    8e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ACK56111.1|  ELF4-like protein                                     77.8    9e-14   Gossypium arboreum [tree cotton]
dbj|BAK04623.1|  predicted protein                                    78.2    9e-14   
ref|XP_006426641.1|  hypothetical protein CICLE_v10026810mg           77.8    9e-14   
gb|KHG04759.1|  Protein ELF4-LIKE 3 -like protein                     77.8    1e-13   
ref|NP_001236861.1|  uncharacterized protein LOC100500360             77.4    1e-13   
ref|XP_002883737.1|  hypothetical protein ARALYDRAFT_899420           77.4    1e-13   
gb|AEW08246.1|  hypothetical protein 2_4126_01                        76.6    1e-13   
ref|XP_009149194.1|  PREDICTED: protein ELF4-LIKE 4                   77.4    1e-13   
ref|NP_565334.1|  protein ELF4-like 3                                 77.4    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54152.1|  ELF4-like protein                                     78.6    1e-13   
ref|XP_010459337.1|  PREDICTED: protein ELF4-LIKE 4-like              77.4    1e-13   
gb|KHG08699.1|  Protein ELF4-LIKE 4 -like protein                     77.4    1e-13   
ref|XP_010498097.1|  PREDICTED: protein ELF4-LIKE 4                   77.4    1e-13   
ref|XP_002890226.1|  hypothetical protein ARALYDRAFT_471952           77.0    1e-13   
ref|NP_564024.1|  protein ELF4-like 4                                 77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541979.1|  PREDICTED: protein ELF4-LIKE 3                   77.0    2e-13   
ref|NP_001236892.1|  uncharacterized protein LOC100305802             76.6    2e-13   
ref|XP_010237527.1|  PREDICTED: protein ELF4-LIKE 4-like              77.4    2e-13   
ref|XP_006416701.1|  hypothetical protein EUTSA_v10009148mg           76.6    2e-13   
ref|XP_004979763.1|  PREDICTED: protein ELF4-LIKE 4-like              76.6    3e-13   
ref|XP_010540086.1|  PREDICTED: protein ELF4-LIKE 4                   76.6    3e-13   
ref|XP_008787844.1|  PREDICTED: protein ELF4-LIKE 4-like              76.3    3e-13   
ref|XP_006598696.1|  PREDICTED: uncharacterized protein LOC100305...  76.3    3e-13   
ref|XP_009800392.1|  PREDICTED: protein ELF4-LIKE 3-like              76.3    3e-13   
ref|XP_007135454.1|  hypothetical protein PHAVU_010G130900g           76.3    3e-13   
ref|XP_003627239.1|  ELF4-like protein                                76.3    4e-13   
gb|ACK56110.1|  ELF4-like protein                                     76.3    4e-13   Gossypium arboreum [tree cotton]
gb|EYU45884.1|  hypothetical protein MIMGU_mgv1a016615mg              75.9    4e-13   
ref|NP_001234651.1|  ELF4-like protein                                75.9    5e-13   
ref|XP_009599561.1|  PREDICTED: protein ELF4-LIKE 3-like              75.9    5e-13   
gb|AFK44230.1|  unknown                                               75.5    5e-13   
ref|XP_006361341.1|  PREDICTED: protein ELF4-LIKE 3-like              75.5    6e-13   
ref|XP_010467122.1|  PREDICTED: protein ELF4-LIKE 3-like              75.1    7e-13   
ref|XP_006650186.1|  PREDICTED: protein ELF4-LIKE 3-like isoform X1   75.5    7e-13   
ref|XP_010412929.1|  PREDICTED: protein ELF4-LIKE 3                   75.1    7e-13   
ref|NP_001151033.1|  EARLY flowering 4 protein                        75.5    7e-13   Zea mays [maize]
ref|XP_004510455.1|  PREDICTED: protein ELF4-LIKE 4-like isoform X1   75.1    9e-13   
ref|XP_006304571.1|  hypothetical protein CARUB_v10011591mg           75.1    9e-13   
ref|XP_006848223.1|  hypothetical protein AMTR_s00029p00245280        75.5    1e-12   
gb|ACK56121.1|  ELF4-like protein                                     75.1    1e-12   Saccharum officinarum [noble cane]
gb|AAM61718.1|  unknown                                               74.7    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465144.1|  hypothetical protein SORBIDRAFT_01g032750        75.1    1e-12   Sorghum bicolor [broomcorn]
gb|EPS66572.1|  early flowering 4                                     73.9    2e-12   
ref|XP_004984055.1|  PREDICTED: protein ELF4-LIKE 4-like              74.3    2e-12   
ref|NP_001050343.1|  Os03g0410300                                     73.9    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011079766.1|  PREDICTED: protein ELF4-LIKE 4-like              73.9    3e-12   
gb|EAZ27292.1|  hypothetical protein OsJ_11231                        75.5    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148036.1|  EARLY flowering 4 protein                        73.2    4e-12   Zea mays [maize]
ref|XP_006300295.1|  hypothetical protein CARUB_v100149650mg          73.2    4e-12   
ref|NP_001235965.1|  uncharacterized protein LOC100305734             73.2    5e-12   
ref|XP_002983620.1|  hypothetical protein SELMODRAFT_118674           73.2    5e-12   
ref|XP_002990590.1|  hypothetical protein SELMODRAFT_131708           73.2    5e-12   
ref|XP_008369402.1|  PREDICTED: protein EARLY FLOWERING 4-like        72.4    5e-12   
ref|XP_009105922.1|  PREDICTED: protein ELF4-LIKE 2                   72.8    5e-12   
ref|XP_004157935.1|  PREDICTED: protein ELF4-LIKE 3-like              72.4    6e-12   
gb|KFK24385.1|  hypothetical protein AALP_AAs72209U000200             71.6    8e-12   
ref|XP_002325630.1|  hypothetical protein POPTR_0019s15230g           73.2    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003557729.1|  PREDICTED: protein ELF4-LIKE 4-like              72.0    1e-11   
ref|XP_002968989.1|  hypothetical protein SELMODRAFT_91083            71.6    1e-11   
ref|XP_002990652.1|  hypothetical protein SELMODRAFT_272149           71.6    1e-11   
ref|NP_001150561.1|  early flowering 4 isoform 1                      72.4    1e-11   Zea mays [maize]
ref|XP_009117659.1|  PREDICTED: protein ELF4-LIKE 4-like              71.6    1e-11   
emb|CDY21748.1|  BnaA09g44990D                                        71.6    1e-11   
ref|XP_002460178.1|  hypothetical protein SORBIDRAFT_02g023990        72.0    2e-11   Sorghum bicolor [broomcorn]
emb|CDX72930.1|  BnaC06g33780D                                        71.2    2e-11   
gb|ACG35353.1|  EARLY flowering 4 protein                             72.0    2e-11   Zea mays [maize]
ref|NP_001183932.1|  early flowering 4 isoform 2                      72.0    2e-11   
ref|XP_010416016.1|  PREDICTED: protein ELF4-LIKE 2                   71.2    2e-11   
gb|AAG51839.1|AC010926_2  hypothetical protein; 65517-65170           70.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ACK56127.1|  ELF4-like protein                                     70.5    3e-11   Lotus corniculatus
ref|XP_006390640.1|  hypothetical protein EUTSA_v10019317mg           70.9    3e-11   
ref|NP_565044.1|  protein ELF4-like 2                                 70.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81827.1|  BnaC08g37740D                                        70.5    3e-11   
ref|XP_006390641.1|  hypothetical protein EUTSA_v10019317mg           70.9    3e-11   
emb|CDY48303.1|  BnaC05g13570D                                        75.5    4e-11   
ref|XP_002887442.1|  hypothetical protein ARALYDRAFT_339481           70.9    4e-11   
ref|XP_010471290.1|  PREDICTED: protein ELF4-LIKE 2-like              70.5    4e-11   
ref|XP_009344906.1|  PREDICTED: protein EARLY FLOWERING 4-like is...  70.1    5e-11   
ref|XP_004956735.1|  PREDICTED: protein ELF4-LIKE 4-like              70.5    6e-11   
ref|XP_010428151.1|  PREDICTED: protein ELF4-LIKE 2-like              69.3    1e-10   
gb|ADN05857.1|  early flowering 4                                     68.9    2e-10   
ref|XP_009420255.1|  PREDICTED: protein ELF4-LIKE 3-like              68.2    2e-10   
ref|XP_001774658.1|  predicted protein                                67.0    3e-10   
emb|CDY49857.1|  BnaA02g16060D                                        67.8    4e-10   
ref|XP_009127944.1|  PREDICTED: protein ELF4-LIKE 2-like isoform X2   67.8    4e-10   
ref|XP_009127943.1|  PREDICTED: protein ELF4-LIKE 2-like isoform X1   67.4    5e-10   
ref|XP_006302969.1|  hypothetical protein CARUB_v10021108mg           67.8    5e-10   
gb|EMS60287.1|  hypothetical protein TRIUR3_30694                     67.8    5e-10   
ref|XP_007016103.1|  Uncharacterized protein TCM_041622               66.2    6e-10   
gb|ACK56114.1|  ELF4-like protein                                     66.2    1e-09   
ref|NP_001061648.1|  Os08g0366200                                     66.6    1e-09   
ref|XP_006661190.1|  PREDICTED: protein ELF4-LIKE 4-like              66.6    1e-09   
ref|XP_009104847.1|  PREDICTED: protein ELF4-LIKE 2-like              65.5    2e-09   
ref|XP_006396119.1|  hypothetical protein EUTSA_v10003045mg           65.9    2e-09   
emb|CDY11163.1|  BnaC06g24150D                                        64.3    8e-09   
ref|XP_009630739.1|  PREDICTED: uncharacterized protein LOC104120640  62.8    9e-09   
ref|XP_009420252.1|  PREDICTED: protein ELF4-LIKE 3-like              63.5    1e-08   
emb|CDX82140.1|  BnaC02g21500D                                        66.2    2e-08   
ref|XP_002505306.1|  hypothetical protein MICPUN_95499                60.5    1e-07   
gb|ACK56125.1|  ELF4-like protein                                     58.5    2e-07   
ref|XP_003060310.1|  hypothetical protein MICPUCDRAFT_59974           58.5    4e-07   
ref|XP_006396120.1|  hypothetical protein EUTSA_v10002780mg           58.5    5e-07   
ref|XP_005651402.1|  DUF1313-domain-containing protein                57.4    8e-07   
ref|XP_004959569.1|  PREDICTED: uncharacterized protein LOC101771041  57.8    2e-06   
ref|XP_010238142.1|  PREDICTED: protein ELF4-LIKE 4-like              55.5    9e-06   
ref|XP_006595865.1|  PREDICTED: protein EARLY FLOWERING 4-like        54.7    1e-05   
gb|EAZ06757.1|  hypothetical protein OsI_29002                        53.5    3e-05   
gb|EEE68580.1|  hypothetical protein OsJ_27079                        53.1    4e-05   
dbj|BAD03360.1|  hypothetical protein                                 52.8    3e-04   
ref|XP_001689467.1|  predicted protein                                48.5    0.001   



>gb|ACK56115.1| ELF4-like protein [Ipomoea nil]
Length=131

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
            CD EAWE LS+ FR+VQT LDQNR LIQQVNEN QSKLP+N+A N  LIREINGNIS+VV
Sbjct  48   CDQEAWETLSQSFRDVQTVLDQNRTLIQQVNENHQSKLPNNIARNVDLIREINGNISKVV  107

Query  791  GLYSDLSVNFAGLVRHRR  738
            G+YSDLS NF+G+V  RR
Sbjct  108  GMYSDLSGNFSGIVHQRR  125



>ref|XP_010253891.1| PREDICTED: protein EARLY FLOWERING 4-like [Nelumbo nucifera]
 ref|XP_010253892.1| PREDICTED: protein EARLY FLOWERING 4-like [Nelumbo nucifera]
 ref|XP_010253893.1| PREDICTED: protein EARLY FLOWERING 4-like [Nelumbo nucifera]
 ref|XP_010253894.1| PREDICTED: protein EARLY FLOWERING 4-like [Nelumbo nucifera]
 ref|XP_010253895.1| PREDICTED: protein EARLY FLOWERING 4-like [Nelumbo nucifera]
 ref|XP_010253896.1| PREDICTED: protein EARLY FLOWERING 4-like [Nelumbo nucifera]
Length=159

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            E  D  AWE LSK FR+VQT LDQNRALIQQVNEN QSK+PDNL  N ALIREINGNIS+
Sbjct  58   EGGDMGAWETLSKSFRQVQTVLDQNRALIQQVNENHQSKIPDNLTKNVALIREINGNISK  117

Query  797  VVGLYSDLSVNFAGLVRHRR  738
            V+ LYSDLS NF  +V  RR
Sbjct  118  VISLYSDLSTNFTNIVHQRR  137



>ref|XP_006350838.1| PREDICTED: protein EARLY FLOWERING 4-like [Solanum tuberosum]
Length=134

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = -2

Query  989  DGKEEE-CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREIN  813
            DG+EEE  D EAWE ++KCFREVQ+ LDQNRALIQQVNEN QSKL DNL  N ALIR+IN
Sbjct  31   DGEEEEGYDTEAWETITKCFREVQSVLDQNRALIQQVNENHQSKLRDNLVKNVALIRDIN  90

Query  812  GNISRVVGLYSDLSVNFAGLVRHRRaatataTINRSKNTTNEKS  681
             NIS+V  LYSDLSV+F  +V  RR      + NR  N    +S
Sbjct  91   SNISKVSRLYSDLSVDFCNIVHRRRELALFESKNRDDNVDTAES  134



>ref|XP_002311221.1| hypothetical protein POPTR_0008s06820g [Populus trichocarpa]
 gb|EEE88588.1| hypothetical protein POPTR_0008s06820g [Populus trichocarpa]
Length=122

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  1055  SGVEWSMEDITSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNE  876
             S  E SMED ++ +I     +N  KE+E DAE W   +  FR+VQ+ LD+NR LIQQVNE
Sbjct  9     SAAESSMEDTSNPSIT--TNQNANKEDEVDAEVWATFNNSFRQVQSVLDRNRVLIQQVNE  66

Query  875   NQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFAGLVRHR  741
             N QS+ PDN+  N +LI+E+NGNIS+VVGLYSDL+ NF+     R
Sbjct  67    NHQSRTPDNMVKNVSLIQELNGNISKVVGLYSDLNSNFSTAYHQR  111



>ref|XP_010033007.1| PREDICTED: protein EARLY FLOWERING 4-like [Eucalyptus grandis]
 gb|KCW52523.1| hypothetical protein EUGRSUZ_J01911 [Eucalyptus grandis]
Length=156

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            E CDAEAWEML++ FR VQ+ LD+NRALI QVNEN QSK+PDN+A N ALI EINGNIS+
Sbjct  58   EGCDAEAWEMLTESFRRVQSVLDRNRALISQVNENHQSKVPDNIAKNVALISEINGNISK  117

Query  797  VVGLYSDLSVNFAGLVRHR  741
            V+ +YSDLSVNF+ +V  R
Sbjct  118  VLSIYSDLSVNFSEVVHQR  136



>ref|XP_002299809.2| hypothetical protein POPTR_0001s25870g [Populus trichocarpa]
 gb|EEE84614.2| hypothetical protein POPTR_0001s25870g [Populus trichocarpa]
Length=129

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
            CD EAW+ LSK F++VQ+ LD NR LIQQVN N QSK+PDNL  N +LIREINGNIS+V+
Sbjct  35   CDVEAWDTLSKSFKQVQSVLDHNRDLIQQVNANHQSKIPDNLVKNVSLIREINGNISKVM  94

Query  791  GLYSDLSVNFAGLVRHRR  738
             +YSDLSVNF+ +V+ RR
Sbjct  95   SIYSDLSVNFSNIVQERR  112



>ref|XP_011045735.1| PREDICTED: protein EARLY FLOWERING 4 [Populus euphratica]
Length=122

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  1055  SGVEWSMEDITSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNE  876
             S  E SMED ++ +I     +N  KE+E DAE W   +  FR+VQ+ LD+NR LIQQVNE
Sbjct  9     SAAESSMEDTSNPSIT--TNQNANKEDEVDAEVWATFNDSFRQVQSVLDRNRVLIQQVNE  66

Query  875   NQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFAGLVRHR  741
             N QS+ P+N+  N +LI+E+NGNIS+VVGLYSDL+ NF+     R
Sbjct  67    NHQSRTPENMVKNVSLIQELNGNISKVVGLYSDLNSNFSTAYHQR  111



>emb|CDP09188.1| unnamed protein product [Coffea canephora]
Length=145

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
            CD +AWE LSK F +VQ+ LD NR LI+QVNEN QSK+ DNL  N ALI+EINGNIS+V+
Sbjct  52   CDVQAWETLSKSFNDVQSVLDHNRVLIKQVNENHQSKVADNLVKNVALIQEINGNISKVM  111

Query  791  GLYSDLSVNFAGLVRHRR  738
            G+YSDLSVNF+ +V+ R+
Sbjct  112  GIYSDLSVNFSSIVQQRQ  129



>ref|XP_010322326.1| PREDICTED: protein EARLY FLOWERING 4-like [Solanum lycopersicum]
Length=164

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D EAWE ++KCFREVQ+ LDQNRALIQQVNEN QSKL DNL  N ALIR+IN NIS+V  
Sbjct  69   DTEAWETITKCFREVQSVLDQNRALIQQVNENHQSKLRDNLVKNVALIRDINSNISKVSR  128

Query  788  LYSDLSVNFAGLVRHRRaatataTINRSKNTTNEKS  681
            LYSDLSV+F  +V  RR      + NR  N  + +S
Sbjct  129  LYSDLSVDFCNIVNRRRELALFESKNRDDNVDSAES  164



>ref|XP_006425066.1| hypothetical protein CICLE_v10029554mg [Citrus clementina]
 gb|ESR38306.1| hypothetical protein CICLE_v10029554mg [Citrus clementina]
Length=136

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  989  DGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREING  810
            D  EEE DAEAW  LSK F++VQT LD NR+LI++VNEN  S++PDN++ N  LIREING
Sbjct  38   DSDEEEYDAEAWNTLSKSFKQVQTVLDNNRSLIERVNENHLSRIPDNMSKNVELIREING  97

Query  809  NISRVVGLYSDLSVNFAGLVRHRR  738
            NIS+VV +YSDLS NF  +V  RR
Sbjct  98   NISKVVSIYSDLSANFCNIVSQRR  121



>ref|XP_009371495.1| PREDICTED: protein EARLY FLOWERING 4-like [Pyrus x bretschneideri]
Length=145

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -2

Query  1022  SKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLA  843
             S A E +   +D  ++E D E WE+LSK F +VQ+ LDQNRALIQQ N+N QS+ PDNL 
Sbjct  21    SAAEERNKRSDDELDQEVDVEVWEVLSKSFMQVQSVLDQNRALIQQANDNHQSRAPDNLT  80

Query  842   MNPALIREINGNISRVVGLYSDLSVNFAGLVRHRR  738
              N +LIREIN NIS+V+ +YSDLS NF+G+V   R
Sbjct  81    RNVSLIREINSNISKVISIYSDLSANFSGIVHQHR  115



>ref|XP_010262858.1| PREDICTED: protein EARLY FLOWERING 4-like [Nelumbo nucifera]
Length=158

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            E + E W   SK F +VQT LDQNR LIQQVN+N QSK+PDNL  N ALIREINGNIS+V
Sbjct  59   EGEREVWATFSKSFHQVQTVLDQNRVLIQQVNDNHQSKIPDNLTKNVALIREINGNISKV  118

Query  794  VGLYSDLSVNFAGLVRHRR  738
            V LYSDLS NF+ +V  RR
Sbjct  119  VSLYSDLSANFSNIVHRRR  137



>ref|XP_002314100.2| hypothetical protein POPTR_0009s05110g [Populus trichocarpa]
 gb|EEE88055.2| hypothetical protein POPTR_0009s05110g [Populus trichocarpa]
Length=124

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  983  KEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNI  804
            KEEECDAEAW+ LSK F++VQ+ LD N  LI+QVN N QSK+PDNL  N +LIREINGNI
Sbjct  26   KEEECDAEAWDTLSKSFKQVQSVLDHNSDLIRQVNANHQSKIPDNLVKNVSLIREINGNI  85

Query  803  SRVVGLYSDLSVNFAGLVRHRR  738
            ++V+ +YSDLS   + +V  RR
Sbjct  86   TKVMSIYSDLSFKVSNIVEERR  107



>ref|XP_004250662.1| PREDICTED: protein EARLY FLOWERING 4-like [Solanum lycopersicum]
Length=134

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D EAWE ++KCFREVQ+ LDQNRALIQQVNEN QSKL DNL  N ALIR+IN NIS+V  
Sbjct  39   DTEAWETITKCFREVQSVLDQNRALIQQVNENHQSKLRDNLVKNVALIRDINSNISKVSR  98

Query  788  LYSDLSVNFAGLVRHRRaatataTINRSKNTTNEKS  681
            LYSDLS++F  +V  R       + NR  N  + +S
Sbjct  99   LYSDLSIDFCNIVNQRWELALFESKNRDDNVDSAES  134



>ref|XP_002270733.1| PREDICTED: protein EARLY FLOWERING 4 [Vitis vinifera]
 emb|CBI25480.3| unnamed protein product [Vitis vinifera]
Length=145

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G+ EE  AE WE  +  FR+VQ+ LD+NR LIQQVNEN QSK+PDNL  N ALI+EINGN
Sbjct  42   GEAEEGSAEVWETFNDSFRQVQSVLDRNRVLIQQVNENHQSKIPDNLVKNVALIQEINGN  101

Query  806  ISRVVGLYSDLSVNFAGLVR  747
            IS+VV LYSDLS NF+G+  
Sbjct  102  ISKVVSLYSDLSTNFSGVFH  121



>gb|AFN53671.1| hypothetical protein [Linum usitatissimum]
Length=137

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  995  ENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREI  816
            E++  +EECD EAW  L+K FR+ Q+ LDQNR LI QVNEN QSK+P NL+ N +LI +I
Sbjct  41   ESEEGQEECDKEAWVALNKSFRQAQSVLDQNRDLIHQVNENHQSKIPANLSRNVSLINDI  100

Query  815  NGNISRVVGLYSDLSVNFAGLVRHRR  738
            NGNIS+V+ +YSDLSVNFA  V+ RR
Sbjct  101  NGNISKVMSIYSDLSVNFANAVQERR  126



>ref|XP_007163541.1| hypothetical protein PHAVU_001G242900g [Phaseolus vulgaris]
 gb|ESW35535.1| hypothetical protein PHAVU_001G242900g [Phaseolus vulgaris]
Length=130

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 78/119 (66%), Gaps = 14/119 (12%)
 Frame = -2

Query  1055  SGVEWSMEDITS-----KAIEEH---------VGENDGKEEECDAEAWEMLSKCFREVQT  918
             S  + +MED+++     K +  H         V    G+ E+ D EAW  L+K FR+VQ+
Sbjct  6     SAADSTMEDLSNHTRSKKHLRRHNSHHPAATTVSTTTGESEDGDTEAWASLNKGFRQVQS  65

Query  917   ALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFAGLVRHR  741
              LD+NR LIQQVNENQQS++ DN+  N +LI+E+NGNIS+VV LYSDL+ NF  + +HR
Sbjct  66    VLDRNRQLIQQVNENQQSRMHDNMVKNVSLIQELNGNISKVVSLYSDLNSNFTNVCQHR  124



>ref|XP_010106262.1| hypothetical protein L484_002382 [Morus notabilis]
 gb|EXC09419.1| hypothetical protein L484_002382 [Morus notabilis]
Length=115

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 5/103 (5%)
 Frame = -2

Query  1037  MED---ITSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQ  867
             MED   +T +A      EN G  EE D E W+   + FR+VQT LD+NR+LIQQVNEN Q
Sbjct  1     MEDRRNLTKRAAAAAGLENGG--EEGDTELWKGFDQSFRQVQTVLDRNRSLIQQVNENHQ  58

Query  866   SKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFAGLVRHRR  738
             S++PDN+A N ALI+E+NGNIS+VV LYSDL+ NF+ L  + R
Sbjct  59    SRIPDNMAKNVALIQELNGNISKVVSLYSDLNSNFSTLFNNHR  101



>ref|XP_007008976.1| Uncharacterized protein TCM_042505 [Theobroma cacao]
 gb|EOY17786.1| Uncharacterized protein TCM_042505 [Theobroma cacao]
Length=114

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = -2

Query  1025  TSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNL  846
             TS    +H  + D +E E D E W    K F++VQ+ LD+NRALIQQVN+N QSK+PDN+
Sbjct  6     TSNRKLKHHRDQDLEEVEGDPEVWATFDKSFKQVQSVLDRNRALIQQVNQNHQSKIPDNM  65

Query  845   AMNPALIREINGNISRVVGLYSDLSVNFAGLVRHR  741
               N ALI+EINGNIS+VV LYSDLS NF+ +  +R
Sbjct  66    VKNVALIQEINGNISKVVSLYSDLSSNFSTVFHNR  100



>gb|KHG10599.1| Protein ELF4-LIKE 1 -like protein [Gossypium arboreum]
Length=160

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  980  EEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNIS  801
            +EECD E W+ L   F++ Q  LDQNR LI++VNEN QSK+PDNL  N  LIREINGNIS
Sbjct  37   DEECDVEVWDTLRYSFKKAQAVLDQNRELIKKVNENHQSKIPDNLVKNVGLIREINGNIS  96

Query  800  RVVGLYSDLSVNFAGLVRHRR  738
            +VV +YS LSVNF+  VR R+
Sbjct  97   KVVEIYSGLSVNFSDTVRQRK  117



>gb|EYU45718.1| hypothetical protein MIMGU_mgv1a026961mg [Erythranthe guttata]
Length=115

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
            CD+EAWE+LSK F EVQ+ LD+NR LI+QVN+N +SK+P NLA+N  LIREIN NIS++ 
Sbjct  34   CDSEAWEILSKSFAEVQSLLDRNRRLIRQVNDNHRSKIPHNLAVNVKLIREINSNISKLA  93

Query  791  GLYSDLSVNFAGLVRHR  741
             LYS+LS NF+ +VR R
Sbjct  94   ALYSNLSANFSTVVRRR  110



>ref|XP_003552375.1| PREDICTED: protein EARLY FLOWERING 4-like [Glycine max]
Length=137

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  998  GENDGKEEE--CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALI  825
            GE+DG+E E   D EAW  L+K FR+VQ+ LD+NR LIQQVNENQQS++ DN+  N +LI
Sbjct  44   GESDGEEAEDVGDPEAWATLNKGFRQVQSVLDRNRLLIQQVNENQQSRMHDNMVKNVSLI  103

Query  824  REINGNISRVVGLYSDLSVNFAGLVRHR  741
            +E+NGNIS+VV LYSDL+ NF  + + R
Sbjct  104  QELNGNISKVVSLYSDLNTNFTNVCQQR  131



>gb|KDP44774.1| hypothetical protein JCGZ_01274 [Jatropha curcas]
Length=128

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = -2

Query  1055  SGVEWSMEDITSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNE  876
             +  E SM      A +      +  ++E D E W   +  FREVQ+ LD+NR LIQQVNE
Sbjct  8     AAAESSMNTSNPTATKRRHKHRNDDDDEGDPEVWSTFNSTFREVQSVLDRNRNLIQQVNE  67

Query  875   NQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFA  759
             N QS++PDN+A N ALI+E+NGNIS+VV LYSDLS NF+
Sbjct  68    NHQSRIPDNMAKNVALIQELNGNISKVVNLYSDLSSNFS  106



>ref|XP_003537487.1| PREDICTED: protein EARLY FLOWERING 4-like [Glycine max]
Length=134

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 69/89 (78%), Gaps = 3/89 (3%)
 Frame = -2

Query  998  GENDGKEEEC---DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPAL  828
            GE+DG+ EE    D EAW  L+K FR+VQ+ LD+NR LIQQVNENQQS++ DN+  N +L
Sbjct  40   GESDGEVEEAEDGDPEAWVTLNKGFRQVQSVLDRNRLLIQQVNENQQSRMHDNMVKNVSL  99

Query  827  IREINGNISRVVGLYSDLSVNFAGLVRHR  741
            I+E+NGNIS+VV LYSDL+ NF+ + + R
Sbjct  100  IQELNGNISKVVSLYSDLNTNFSNVCQQR  128



>gb|KHN36376.1| Protein EARLY FLOWERING 4 [Glycine soja]
Length=143

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  998  GENDGKEEE--CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALI  825
            GE+DG+E E   D EAW  L+K FR+VQ+ LD+NR LIQQVNENQQS++ DN+  N +LI
Sbjct  50   GESDGEEAEDVGDPEAWATLNKGFRQVQSVLDRNRLLIQQVNENQQSRMHDNMVKNVSLI  109

Query  824  REINGNISRVVGLYSDLSVNFAGLVRHR  741
            +E+NGNIS+VV LYSDL+ NF  + + R
Sbjct  110  QELNGNISKVVSLYSDLNTNFTNVCQQR  137



>ref|XP_002525644.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36762.1| conserved hypothetical protein [Ricinus communis]
Length=120

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  956  WEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSD  777
            W+ LS+ FR+VQ  LDQNR LI QVNEN QSK+PDNL  N +LIREINGNIS+V+ +YSD
Sbjct  44   WDTLSRSFRQVQAVLDQNRDLINQVNENHQSKVPDNLTKNISLIREINGNISKVISIYSD  103

Query  776  LSVNFAGLVRHRR  738
            LS+ F+ +V  RR
Sbjct  104  LSLRFSNIVHQRR  116



>gb|KHN34721.1| Protein EARLY FLOWERING 4 [Glycine soja]
Length=152

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = -2

Query  998  GENDGKEEE--CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALI  825
            GE+DG+E E   D EAW  L+K FR+VQ+ LD+NR LIQQVNENQQS++ DN+  N +LI
Sbjct  59   GESDGEEAEDVGDPEAWATLNKGFRQVQSVLDRNRLLIQQVNENQQSRMHDNMVKNVSLI  118

Query  824  REINGNISRVVGLYSDLSVNFAGLVRHR  741
            +E+NGNIS+VV LYSDL+ NF+ + + R
Sbjct  119  QELNGNISKVVSLYSDLNTNFSNVCQQR  146



>gb|KDP46495.1| hypothetical protein JCGZ_08467 [Jatropha curcas]
Length=139

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  962  EAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLY  783
            E W  L K FR+VQ+ LDQNR LI QVNEN QS++PDN+A N  LIREIN NIS+V+ +Y
Sbjct  52   EVWNTLCKSFRQVQSVLDQNRDLIHQVNENHQSRIPDNMAKNVPLIREINRNISKVISIY  111

Query  782  SDLSVNFAGLVRHRR  738
            SDLSVNF+ +V+ RR
Sbjct  112  SDLSVNFSNVVQERR  126



>ref|XP_003600889.1| Early flowering [Medicago truncatula]
Length=120

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            E+ D EAW+ L+K FR+VQ+ LD+NRA+IQQVNENQQS++PDN+  N  LI+E+NGNIS+
Sbjct  33   EDGDPEAWQTLNKSFRQVQSVLDRNRAIIQQVNENQQSRMPDNMVKNVGLIQELNGNISK  92

Query  797  VVGLYSDLSVNFAGL  753
            V  LYSDL+ +F  +
Sbjct  93   VASLYSDLNSDFTNI  107



>gb|AIY68669.1| early flowering 4 [Dimocarpus longan]
Length=144

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D E W+ L + F++VQT LD+NR LI++ N+N QSK+ DN+A N +LIR+INGNIS+VV 
Sbjct  47   DVEVWDSLIRSFKQVQTVLDRNRELIRRANDNHQSKIADNIAGNISLIRQINGNISKVVK  106

Query  788  LYSDLSVNFAGLVRHR  741
            +YSDLSVNFAG+VR R
Sbjct  107  IYSDLSVNFAGMVRLR  122



>ref|XP_004500487.1| PREDICTED: protein EARLY FLOWERING 4-like [Cicer arietinum]
Length=131

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -2

Query  1001  VGENDGKE-EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALI  825
              G++D +E E+ D E W  L+K FR+VQ+ LD+NRA+IQQVNENQQS++ DN+  N +LI
Sbjct  37    TGDSDLEEAEDGDPEVWATLNKSFRQVQSVLDRNRAIIQQVNENQQSRMADNMVKNVSLI  96

Query  824   REINGNISRVVGLYSDLSVNFAGLVRHR  741
             +E+NGNIS+V  LYSDL+ +F G+ + R
Sbjct  97    QELNGNISKVASLYSDLNSDFTGICQQR  124



>gb|AFK36717.1| unknown [Medicago truncatula]
 gb|AES71140.2| early flowering protein [Medicago truncatula]
Length=130

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            E+ D EAW+ L+K FR+VQ+ LD+NRA+IQQVNENQQS++PDN+  N  LI+E+NGNIS+
Sbjct  43   EDGDPEAWQTLNKSFRQVQSVLDRNRAIIQQVNENQQSRMPDNMVKNVGLIQELNGNISK  102

Query  797  VVGLYSDLSVNFAGL  753
            V  LYSDL+ +F  +
Sbjct  103  VASLYSDLNSDFTNI  117



>ref|XP_010521948.1| PREDICTED: protein ELF4-LIKE 1 [Tarenaya hassleriana]
 ref|XP_010521949.1| PREDICTED: protein ELF4-LIKE 1 [Tarenaya hassleriana]
Length=142

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  980  EEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNIS  801
            EEE D EAW+ LS  F+  Q  LDQNR LIQ+VN+N +S++ DNLA N  LI EINGNIS
Sbjct  41   EEEYDVEAWDTLSSGFKRAQVVLDQNRDLIQRVNDNHRSRIADNLASNVGLINEINGNIS  100

Query  800  RVVGLYSDLSVNFAGLVRHRR  738
            +V+ +YSDLSVNF  +V  RR
Sbjct  101  KVLEIYSDLSVNFTNIVHERR  121



>gb|AAX47177.2| early flowering 4 [Pisum sativum]
Length=135

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            E+ D EAW  L+K FR+VQ+ LD+NRA+IQQVNENQQS++PDN+  N +LI+E+NGNIS+
Sbjct  48   EDGDPEAWATLNKSFRQVQSVLDRNRAIIQQVNENQQSRMPDNMVKNVSLIQELNGNISK  107

Query  797  VVGLYSDLSVNFAGLVRHRR  738
            V  LYSDL+ +F  +   ++
Sbjct  108  VASLYSDLNSDFTNICHQQQ  127



>ref|XP_008226533.1| PREDICTED: protein EARLY FLOWERING 4-like [Prunus mume]
 ref|XP_008226540.1| PREDICTED: protein EARLY FLOWERING 4-like [Prunus mume]
 ref|XP_008226548.1| PREDICTED: protein EARLY FLOWERING 4-like [Prunus mume]
Length=147

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 74/109 (68%), Gaps = 6/109 (6%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            ++CD E WE LS+ FR+VQ+ LDQNRALIQQ N+N +S++PDNL+ N  LIR+IN NI++
Sbjct  43   KQCDVELWETLSRSFRQVQSVLDQNRALIQQANDNHRSRVPDNLSKNVVLIRDINSNINK  102

Query  797  VVGLYSDLSVNFAGLVRHRRaatataTINRSKNTTNEKSADSDWSKFRL  651
            V+ +YSDLS N + +V   R       I  +K+  N+   D+D   ++L
Sbjct  103  VLSIYSDLSANVSSIVHRPR------AIIPAKSNKNDGDEDNDTGNWKL  145



>ref|XP_010689678.1| PREDICTED: protein EARLY FLOWERING 4-like [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 62/91 (68%), Gaps = 3/91 (3%)
 Frame = -2

Query  1007  EHVGENDGKEEEC-DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPA  831
             +HV E  G  E C D E W   +  F  VQT LD+NR LIQQ NEN QS++PDN+  N A
Sbjct  35    DHVDEFSG--EGCGDPETWNAFADSFSRVQTVLDRNRMLIQQANENHQSRMPDNMEKNVA  92

Query  830   LIREINGNISRVVGLYSDLSVNFAGLVRHRR  738
             +I+E+NGNIS+V  +YSDLS NF+G VR  R
Sbjct  93    IIQELNGNISKVASIYSDLSTNFSGRVRQHR  123



>ref|XP_011084910.1| PREDICTED: protein EARLY FLOWERING 4 [Sesamum indicum]
Length=150

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = -2

Query  989  DGKEEECDAE-----AWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALI  825
            +G E +CD+       W   ++ FR+VQ+ LD+NRALIQQVNEN QSK+ DNL  N  LI
Sbjct  48   EGDEIDCDSNDGDPAVWAAFTQNFRQVQSVLDRNRALIQQVNENHQSKVHDNLVKNVTLI  107

Query  824  REINGNISRVVGLYSDLSVNFAGLVRHRRaatataTINRSK  702
            +E+NGNIS+VV LYSDLS NF+ +V+ R  ++  A  N S+
Sbjct  108  QELNGNISKVVSLYSDLSSNFSNVVQQRNGSSGDAKSNSSR  148



>ref|XP_010031219.1| PREDICTED: protein EARLY FLOWERING 4 [Eucalyptus grandis]
 gb|KCW50486.1| hypothetical protein EUGRSUZ_J00214 [Eucalyptus grandis]
Length=146

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            ECD E WEM +K FR+VQT LD+NR+LI+QVN+N QSK  +N+  N ALI EIN NIS+V
Sbjct  53   ECDPEVWEMFNKNFRQVQTVLDRNRSLIRQVNDNHQSKSANNMVKNVALIHEINQNISKV  112

Query  794  VGLYSDLSVNFAGLVRHR  741
            V LYSDLS +F+     R
Sbjct  113  VSLYSDLSTDFSSAFHQR  130



>gb|ADQ20089.1| ELF4 protein [Manihot esculenta]
Length=115

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            E D E W   +  FR+VQ+ LD+NR LIQQVNEN QS++PDN+  N ALI+E+NGNIS+V
Sbjct  24   EGDPEVWSTFNSTFRQVQSVLDRNRNLIQQVNENHQSRIPDNMVKNVALIQELNGNISKV  83

Query  794  VGLYSDLSVNFA  759
            V LYSDL+ NF 
Sbjct  84   VSLYSDLNSNFT  95



>ref|XP_008374004.1| PREDICTED: protein EARLY FLOWERING 4-like [Malus domestica]
Length=152

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = -2

Query  1055  SGVEWSMEDIT----SKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQ  888
             SG E SM+  +    +K         D  EE  D+E W+  ++ F EVQ+ LD+NR+LIQ
Sbjct  29    SGAESSMDYFSHESPTKRTVPATAVFDQDEEADDSELWDQFNRRFSEVQSLLDRNRSLIQ  88

Query  887   QVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFAGLVRH  744
             QVN+N +S++ DN+  N ALI+EINGNIS+VV LYSDLS NF+    H
Sbjct  89    QVNDNHRSRIADNMVKNVALIQEINGNISKVVSLYSDLSSNFSTFFHH  136



>gb|KFK36896.1| hypothetical protein AALP_AA4G186500 [Arabis alpina]
Length=112

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            E+ D E WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNIS+
Sbjct  18   EQEDPEMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISK  77

Query  797  VVGLYSDLSVNFAGLV  750
            VV +YSDL+ NF+  +
Sbjct  78   VVSMYSDLNTNFSSAI  93



>ref|XP_009781846.1| PREDICTED: protein EARLY FLOWERING 4-like [Nicotiana sylvestris]
Length=135

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -2

Query  1022  SKAIE---EHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPD  852
             S A+E   E  G +D   EE D+E W   S  +REVQ+ LD+NR LIQQVNEN QS+  D
Sbjct  35    SSAVETFTEERGYDDFNMEEGDSEMWNSFSSNYREVQSVLDRNRLLIQQVNENHQSRTHD  94

Query  851   NLAMNPALIREINGNISRVVGLYSDLSVNFAGLVRHRR  738
             ++  N  LI+E+NGNIS+V  LYSD + +FA +V  R+
Sbjct  95    SMVQNVGLIQELNGNISKVASLYSDFNTDFATMVYQRK  132



>ref|XP_002533647.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28735.1| conserved hypothetical protein [Ricinus communis]
Length=137

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D + W   +  FR+VQ+ LD+NR+LIQQVNEN QS++PDN+  N ALI+E+NGNIS+VV 
Sbjct  46   DPQVWSTFNTTFRQVQSVLDRNRSLIQQVNENHQSRIPDNMVKNVALIQELNGNISKVVS  105

Query  788  LYSDLSVNFAG  756
            LYSDL+ NF+ 
Sbjct  106  LYSDLNSNFSS  116



>ref|XP_010322199.1| PREDICTED: protein EARLY FLOWERING 4 [Solanum lycopersicum]
 gb|AAW22881.1| putative EARLY flowering 4 protein [Solanum lycopersicum]
Length=121

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  989  DGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREING  810
            D   EE +++ W   S  FR+VQ+ LD+NR+LIQQVNEN QS+  DN+  N +LI+E+NG
Sbjct  28   DLSTEEGNSDVWNNFSNRFRQVQSVLDRNRSLIQQVNENHQSRTTDNMVRNVSLIQELNG  87

Query  809  NISRVVGLYSDLSVNFAGLVR  747
            NIS+VV LYSD+S NF+ + R
Sbjct  88   NISKVVSLYSDISTNFSTMFR  108



>ref|XP_010031220.1| PREDICTED: protein EARLY FLOWERING 4-like [Eucalyptus grandis]
 gb|KCW50483.1| hypothetical protein EUGRSUZ_J00211 [Eucalyptus grandis]
Length=142

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            ECD E WEM +K FR+VQT LD+NR+LI+QVN+N QSK   N+  N ALI EIN NIS+V
Sbjct  51   ECDPEVWEMFNKNFRQVQTLLDRNRSLIRQVNDNHQSKSAKNMVKNEALIHEINQNISKV  110

Query  794  VGLYSDLSVNFAGLVRHR  741
            V LY DLS +F+     R
Sbjct  111  VSLYPDLSTDFSSAFHQR  128



>ref|XP_008463236.1| PREDICTED: protein EARLY FLOWERING 4-like [Cucumis melo]
Length=129

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -2

Query  992  NDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREIN  813
            +D   +E DAE W    + FR+VQ+ LD+NR LIQQVNEN QS++P N+  N ALI+E+N
Sbjct  32   HDAFPDEYDAEVWASFDQTFRQVQSVLDRNRTLIQQVNENHQSRIPSNMVDNVALIQELN  91

Query  812  GNISRVVGLYSDLSVNFA  759
            GNIS+VV +YSD S +F+
Sbjct  92   GNISKVVSMYSDFSSDFS  109



>ref|XP_010554657.1| PREDICTED: protein EARLY FLOWERING 4-like [Tarenaya hassleriana]
Length=126

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  980  EEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNIS  801
            EE  D   WE L + FR+VQ+ LD+NRALIQQVNEN QS++ DN+  N +LI+E+NGNIS
Sbjct  37   EEGGDPAMWETLDQNFRQVQSVLDRNRALIQQVNENHQSRMADNMVKNVSLIQELNGNIS  96

Query  800  RVVGLYSDLSVNFAGL  753
            +VV +YSDL+ NF+ +
Sbjct  97   KVVSMYSDLNTNFSSM  112



>ref|XP_010650900.1| PREDICTED: protein EARLY FLOWERING 4 [Vitis vinifera]
Length=125

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  959  AWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYS  780
             WE LS+ F +VQ+ LDQNR LIQQVNENQQS++ DNL  N +L REINGNI +V+ +YS
Sbjct  30   VWETLSRSFDQVQSVLDQNRLLIQQVNENQQSRIHDNLVKNVSLTREINGNICKVISMYS  89

Query  779  DLSVNFAGLVRHRR  738
             LS +F  +VR RR
Sbjct  90   KLSADFVDIVRRRR  103



>emb|CAN79813.1| hypothetical protein VITISV_018619 [Vitis vinifera]
Length=126

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  959  AWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYS  780
             WE LS+ F +VQ+ LDQNR LIQQVNENQQS++ DNL  N +L REINGNI +V+ +YS
Sbjct  31   VWETLSRSFDQVQSVLDQNRLLIQQVNENQQSRIHDNLVKNVSLTREINGNICKVISMYS  90

Query  779  DLSVNFAGLVRHRR  738
             LS +F  +VR RR
Sbjct  91   KLSADFVDIVRRRR  104



>ref|XP_009344899.1| PREDICTED: protein EARLY FLOWERING 4-like isoform X1 [Pyrus x 
bretschneideri]
Length=131

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = -2

Query  1055  SGVEWSMEDIT----SKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQ  888
             SG E SM+  +    +K         D   E  D+E W+  ++ F EVQ+ LD+NR+LIQ
Sbjct  8     SGAESSMDYFSHESPTKRTVSPTAVFDQDVEADDSELWDQFNRRFSEVQSLLDRNRSLIQ  67

Query  887   QVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFAGLVRHR  741
             QVN+N +S++ DN+  N ALI+EINGNIS+VV LYSDLS NF+    H 
Sbjct  68    QVNDNHRSRVADNMVKNVALIQEINGNISKVVSLYSDLSSNFSTFFHHH  116



>ref|XP_010534577.1| PREDICTED: protein EARLY FLOWERING 4-like [Tarenaya hassleriana]
Length=141

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR LIQQVNEN QS++ DN+A N ALI+EINGNI++VV 
Sbjct  48   DPAMWETLDQNFRQVQSVLDRNRVLIQQVNENHQSRMADNMAKNVALIQEINGNITKVVS  107

Query  788  LYSDLSVNFAGL  753
            +YSDL+ NF+ +
Sbjct  108  MYSDLNTNFSSM  119



>ref|XP_009781337.1| PREDICTED: protein EARLY FLOWERING 4-like [Nicotiana sylvestris]
Length=132

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = -2

Query  1013  IEEHVGEND-GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMN  837
             +EE   ++D   EEE D+E W   S  +R+VQ  LD+NR LIQQVNEN QS+  D++  N
Sbjct  37    VEEQYRDDDFSMEEESDSETWNSFSNNYRQVQPVLDRNRLLIQQVNENHQSRTHDSMVQN  96

Query  836   PALIREINGNISRVVGLYSDLSVNFAGLVRHRR  738
               LI+E+NGNIS+V  LYSD + +F  +V  R+
Sbjct  97    VGLIQELNGNISKVASLYSDFNTDFTAMVHQRK  129



>ref|XP_009788383.1| PREDICTED: protein EARLY FLOWERING 4-like [Nicotiana sylvestris]
Length=155

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = -2

Query  1013  IEEHVGEN-DGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMN  837
              +EH  EN DG  EE ++E W   S  FR+VQ+ LD+NR LIQQVNEN Q++  +N+  N
Sbjct  49    TDEHRDENADGSMEEDNSEMWNDFSNRFRQVQSVLDRNRLLIQQVNENHQARSHNNMVQN  108

Query  836   PALIREINGNISRVVGLYSDLSVNFAGLV  750
               LI+E+NGNIS+VV LYSDLS NF+ + 
Sbjct  109   VGLIQELNGNISKVVSLYSDLSTNFSTVF  137



>ref|XP_008233752.1| PREDICTED: protein EARLY FLOWERING 4-like [Prunus mume]
Length=128

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  956  WEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSD  777
            W+  ++ FREVQ  LD+NRALIQQVN+N +S++ DN+  N  LI+EINGNIS+VV LYSD
Sbjct  47   WDQFNRRFREVQAVLDRNRALIQQVNDNHRSRVADNMVKNVGLIQEINGNISKVVSLYSD  106

Query  776  LSVNFAGLVRHR  741
            LS NF+    HR
Sbjct  107  LSSNFSTFFHHR  118



>ref|XP_006338849.1| PREDICTED: protein EARLY FLOWERING 4-like [Solanum tuberosum]
Length=127

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            EE ++E W   S  FR+VQ+ LD+NR+LIQQVNEN QS+  DN+  N +LI+E+NGNIS+
Sbjct  35   EEGNSEMWNNFSNRFRQVQSVLDRNRSLIQQVNENHQSRTNDNMVQNVSLIQELNGNISK  94

Query  797  VVGLYSDLSVNFAGLV  750
            VV LYSD+S NF+ + 
Sbjct  95   VVSLYSDISTNFSTMF  110



>ref|XP_007218599.1| hypothetical protein PRUPE_ppa013347mg [Prunus persica]
 gb|EMJ19798.1| hypothetical protein PRUPE_ppa013347mg [Prunus persica]
Length=128

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  956  WEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSD  777
            W+  ++ FREVQ  LD+NRALIQQVN+N +S++ DN+  N  LI+EINGNIS+VV LYSD
Sbjct  47   WDQFNRRFREVQAVLDRNRALIQQVNDNHRSRVADNMVKNVGLIQEINGNISKVVSLYSD  106

Query  776  LSVNFAGLVRHR  741
            LS NF+    HR
Sbjct  107  LSSNFSTFFHHR  118



>ref|XP_009629950.1| PREDICTED: protein EARLY FLOWERING 4-like [Nicotiana tomentosiformis]
Length=135

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -2

Query  1019  KAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAM  840
             +   E  G +D   EE D+E W   S  +REVQ+ LD+NR LIQQVNEN QS+  D++  
Sbjct  39    ETFTEERGYDDFNMEEGDSEMWNSFSNNYREVQSVLDRNRLLIQQVNENHQSRSHDSMVQ  98

Query  839   NPALIREINGNISRVVGLYSDLSVNFAGLVRHRR  738
             N  LI+E+NGNIS+V  LYSD + +F  ++  R+
Sbjct  99    NVTLIQELNGNISKVTSLYSDFNTDFTNMIHQRK  132



>gb|AAQ73526.1| early flowering 4 [Mesembryanthemum crystallinum]
Length=139

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   W   ++ F +VQ+ LD+NR LIQQ NEN QS++PDN+  N A+I+E+NGNIS+V  
Sbjct  47   DPAEWNAFAESFSKVQSVLDRNRMLIQQANENHQSRVPDNMVKNVAIIQELNGNISKVAS  106

Query  788  LYSDLSVNFAGLVRHRR  738
            +YSDLSVNF G+V   R
Sbjct  107  IYSDLSVNFTGVVGQHR  123



>gb|KHN40071.1| Protein ELF4-LIKE 1 [Glycine soja]
Length=150

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  962  EAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLY  783
            EAW+ML++ F + QT LD+NRALI +VN N +SK+PDN+A N  LI +I+GNIS+V  +Y
Sbjct  40   EAWDMLTRSFWQAQTVLDENRALIDEVNSNHESKIPDNMAKNVGLITQIHGNISKVRSIY  99

Query  782  SDLSVNFAGLVRHR  741
            SDLSVNF  ++R R
Sbjct  100  SDLSVNFPNIIRQR  113



>gb|KDO66886.1| hypothetical protein CISIN_1g031080mg [Citrus sinensis]
Length=166

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  959  AWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYS  780
            AW  LSK F++VQT LD NR+LI++VNEN  S++PDN++ N  LIREINGNIS+VV +YS
Sbjct  48   AWNTLSKSFKQVQTVLDNNRSLIERVNENHLSRIPDNMSKNVELIREINGNISKVVSIYS  107

Query  779  DLSVNFAGLV  750
            DLS NF  +V
Sbjct  108  DLSANFCNIV  117



>emb|CDY07051.1| BnaA04g22640D [Brassica napus]
Length=114

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = -2

Query  1013  IEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNP  834
             + E  G   G E   D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N 
Sbjct  13    VAEDAGHGGGGE---DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNV  69

Query  833   ALIREINGNISRVVGLYSDLSVNFA  759
             ALI+E+NGNI++VV +YSDL+ NF+
Sbjct  70    ALIQELNGNITKVVSMYSDLNTNFS  94



>ref|XP_006488526.1| PREDICTED: protein ELF4-LIKE 1-like isoform X5 [Citrus sinensis]
 ref|XP_006488527.1| PREDICTED: protein ELF4-LIKE 1-like isoform X6 [Citrus sinensis]
Length=177

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  959  AWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYS  780
            AW  LSK F++VQT LD NR+LI++VNEN  S++PDN++ N  LIREINGNIS+VV +YS
Sbjct  48   AWNTLSKSFKQVQTVLDNNRSLIERVNENHLSRIPDNMSKNVELIREINGNISKVVSIYS  107

Query  779  DLSVNFAGLV  750
            DLS NF  +V
Sbjct  108  DLSANFCNIV  117



>ref|XP_010414330.1| PREDICTED: protein ELF4-LIKE 1-like [Camelina sativa]
Length=116

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  995  ENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREI  816
            E DG EEE D E W+ LS  F+  Q  LDQNR LIQ+VNEN  S++PDN+A N ALI EI
Sbjct  4    EVDGDEEE-DMEVWDTLSNGFKRAQAVLDQNRELIQRVNENHMSRIPDNVARNVALINEI  62

Query  815  NGNISRVVGLYSDLSVNFAGLVRHRR  738
            NGNI RV+ +YS LSV+FA     +R
Sbjct  63   NGNIFRVMEIYSVLSVDFANKFDQQR  88



>ref|XP_003544885.1| PREDICTED: protein ELF4-LIKE 1-like isoform X1 [Glycine max]
Length=168

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  962  EAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLY  783
            EAW+ML++ F + QT LD+NRALI +VN N +SK+PDN+A N  LI +I+GNIS+V  +Y
Sbjct  40   EAWDMLTRSFWQAQTVLDENRALIDEVNSNHESKIPDNMAKNVGLITQIHGNISKVRSIY  99

Query  782  SDLSVNFAGLVRHR  741
            SDLSVNF  ++R R
Sbjct  100  SDLSVNFPNIIRQR  113



>ref|XP_004149248.1| PREDICTED: protein EARLY FLOWERING 4-like [Cucumis sativus]
 gb|KGN50653.1| hypothetical protein Csa_5G202370 [Cucumis sativus]
Length=129

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            +E D E W    + FR+VQ+ LD+NR LIQQVNEN QS++P N+  N ALI+E+NGNIS+
Sbjct  37   DEYDPEVWASFDQTFRQVQSVLDRNRTLIQQVNENHQSRIPSNMVDNVALIQELNGNISK  96

Query  797  VVGLYSDLSVNFA  759
            VV +YSD S +F+
Sbjct  97   VVSMYSDFSSDFS  109



>ref|XP_006488523.1| PREDICTED: protein ELF4-LIKE 1-like isoform X2 [Citrus sinensis]
 ref|XP_006488524.1| PREDICTED: protein ELF4-LIKE 1-like isoform X3 [Citrus sinensis]
 ref|XP_006488525.1| PREDICTED: protein ELF4-LIKE 1-like isoform X4 [Citrus sinensis]
Length=195

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  959  AWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYS  780
            AW  LSK F++VQT LD NR+LI++VNEN  S++PDN++ N  LIREINGNIS+VV +YS
Sbjct  77   AWNTLSKSFKQVQTVLDNNRSLIERVNENHLSRIPDNMSKNVELIREINGNISKVVSIYS  136

Query  779  DLSVNFAGLV  750
            DLS NF  +V
Sbjct  137  DLSANFCNIV  146



>ref|XP_010689700.1| PREDICTED: protein EARLY FLOWERING 4-like [Beta vulgaris subsp. 
vulgaris]
Length=140

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 70/120 (58%), Gaps = 22/120 (18%)
 Frame = -2

Query  1055  SGVEWSMEDITSKA-----------------IEEHVGENDGKEEECDAEAWEMLSKCFRE  927
             SG E  MED T +                  +E+  G+  G     D E+W   +  F +
Sbjct  4     SGAESRMEDGTRRQNIASAGGAGNRRRRTNDVEDFSGDGCG-----DHESWNAFADSFSQ  58

Query  926   VQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFAGLVR  747
             VQT LD+NR LIQQ NEN QS++PDN+  N A+I+E+NGNI++V  +Y+DLS NF+G V+
Sbjct  59    VQTVLDRNRLLIQQANENHQSRMPDNMVKNVAIIQELNGNITKVASIYADLSTNFSGKVK  118



>gb|AHZ89707.1| early flowering 4 [Dimocarpus longan]
 gb|AHZ89708.1| early flowering 4 [Dimocarpus longan]
Length=140

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D + W  L+  F+EVQ+ LD+NR LIQQVNEN QS++PDN+  N ALI+EINGNIS+VV 
Sbjct  58   DPQVWMSLNCGFKEVQSVLDRNRVLIQQVNENHQSRIPDNMVKNVALIQEINGNISKVVS  117

Query  788  LYSDLSVNFAG  756
            LYSD+S +F+ 
Sbjct  118  LYSDMSSDFSS  128



>emb|CDY07627.1| BnaA03g18840D [Brassica napus]
Length=114

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QSK+ DN++ N ALI+E+NGNIS+VV 
Sbjct  23   DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSKMADNMSKNVALIQELNGNISKVVS  82

Query  788  LYSDLSVNFA  759
            +YSD++ NF+
Sbjct  83   MYSDINTNFS  92



>emb|CDY61710.1| BnaC04g56730D [Brassica napus]
Length=112

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = -2

Query  1004  HVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALI  825
             +V E+ G+  E D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI
Sbjct  12    NVAEDAGQGGE-DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALI  70

Query  824   REINGNISRVVGLYSDLSVNFA  759
             +E+NGNI++VV +YSDL+ NF+
Sbjct  71    QELNGNITKVVSMYSDLNTNFS  92



>ref|XP_010505710.1| PREDICTED: protein EARLY FLOWERING 4 [Camelina sativa]
 ref|XP_010517400.1| PREDICTED: protein EARLY FLOWERING 4 [Camelina sativa]
Length=110

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 8/83 (10%)
 Frame = -2

Query  1007  EHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPAL  828
             EH GE        D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N AL
Sbjct  18    EHGGE--------DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVAL  69

Query  827   IREINGNISRVVGLYSDLSVNFA  759
             I+E+NGNIS+VV +YSDL+ +FA
Sbjct  70    IQELNGNISKVVNMYSDLNTSFA  92



>ref|XP_009133403.1| PREDICTED: protein EARLY FLOWERING 4-like [Brassica rapa]
Length=114

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QSK+ DN++ N ALI+E+NGNIS+VV 
Sbjct  23   DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSKMADNMSKNVALIQELNGNISKVVS  82

Query  788  LYSDLSVNFA  759
            +YSD++ NF+
Sbjct  83   MYSDINTNFS  92



>ref|XP_006596422.1| PREDICTED: protein ELF4-LIKE 1-like isoform X2 [Glycine max]
Length=185

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  962  EAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLY  783
            EAW+ML++ F + QT LD+NRALI +VN N +SK+PDN+A N  LI +I+GNIS+V  +Y
Sbjct  40   EAWDMLTRSFWQAQTVLDENRALIDEVNSNHESKIPDNMAKNVGLITQIHGNISKVRSIY  99

Query  782  SDLSVNFAGLVRHR  741
            SDLSVNF  ++R R
Sbjct  100  SDLSVNFPNIIRQR  113



>ref|XP_010508920.1| PREDICTED: protein EARLY FLOWERING 4-like [Camelina sativa]
Length=110

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 8/83 (10%)
 Frame = -2

Query  1007  EHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPAL  828
             EH GE        D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N AL
Sbjct  18    EHGGE--------DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVAL  69

Query  827   IREINGNISRVVGLYSDLSVNFA  759
             I+E+NGNIS+VV +YSDL+ +FA
Sbjct  70    IQELNGNISKVVNMYSDLNTSFA  92



>ref|XP_006488522.1| PREDICTED: protein ELF4-LIKE 1-like isoform X1 [Citrus sinensis]
Length=206

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  959  AWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYS  780
            AW  LSK F++VQT LD NR+LI++VNEN  S++PDN++ N  LIREINGNIS+VV +YS
Sbjct  77   AWNTLSKSFKQVQTVLDNNRSLIERVNENHLSRIPDNMSKNVELIREINGNISKVVSIYS  136

Query  779  DLSVNFAGLV  750
            DLS NF  +V
Sbjct  137  DLSANFCNIV  146



>ref|NP_180556.1| protein ELF4-like 1 [Arabidopsis thaliana]
 sp|O80877.1|EF4L1_ARATH RecName: Full=Protein ELF4-LIKE 1 [Arabidopsis thaliana]
 gb|AAC31857.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT68736.1| hypothetical protein At2g29950 [Arabidopsis thaliana]
 gb|AAX55132.1| hypothetical protein At2g29950 [Arabidopsis thaliana]
 gb|AEC08326.1| protein ELF4-like 1 [Arabidopsis thaliana]
Length=125

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 62/93 (67%), Gaps = 5/93 (5%)
 Frame = -2

Query  1001  VGENDGKEEEC-----DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMN  837
             + ENDG++        D E W+ LS  F+  Q  LDQNR LIQ+VNEN  S++PDN++ N
Sbjct  18    MNENDGEDVAASAAVEDVEVWDTLSNGFKRAQLYLDQNRDLIQRVNENHMSRIPDNVSRN  77

Query  836   PALIREINGNISRVVGLYSDLSVNFAGLVRHRR  738
               LI EINGNIS+V+ +YSDLS+NFA     RR
Sbjct  78    VGLINEINGNISQVMEIYSDLSLNFAKKFDQRR  110



>ref|XP_006411253.1| hypothetical protein EUTSA_v10017822mg [Eutrema salsugineum]
 gb|ESQ52706.1| hypothetical protein EUTSA_v10017822mg [Eutrema salsugineum]
Length=115

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNIS+VV 
Sbjct  25   DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVS  84

Query  788  LYSDLSVNFA  759
            +YSDL+ NF+
Sbjct  85   MYSDLNTNFS  94



>ref|XP_009141860.1| PREDICTED: protein EARLY FLOWERING 4-like [Brassica rapa]
Length=114

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = -2

Query  1007  EHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPAL  828
             E  G+  G E   D   WE L + FR+VQ+  D+NR+LIQQVN+N QS++ DN++ N AL
Sbjct  15    EDAGQGGGGE---DPAMWENLDRNFRQVQSVFDRNRSLIQQVNDNHQSRMADNMSKNVAL  71

Query  827   IREINGNISRVVGLYSDLSVNFA  759
             I+E+NGNI++VV +YSDL+ NF+
Sbjct  72    IQELNGNITKVVSMYSDLNTNFS  94



>emb|CDY20515.1| BnaC04g05290D [Brassica napus]
Length=113

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNIS+VV 
Sbjct  23   DPAMWEDLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVS  82

Query  788  LYSDLSVNFA  759
            +YSDL+ NF+
Sbjct  83   MYSDLNTNFS  92



>ref|XP_009143256.1| PREDICTED: protein EARLY FLOWERING 4 [Brassica rapa]
 emb|CDX74810.1| BnaA05g05560D [Brassica napus]
Length=113

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNIS+VV 
Sbjct  23   DPAMWEDLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVS  82

Query  788  LYSDLSVNFA  759
            +YSDL+ NF+
Sbjct  83   MYSDLNTNFS  92



>ref|XP_006435734.1| hypothetical protein CICLE_v10032998mg [Citrus clementina]
 ref|XP_006435735.1| hypothetical protein CICLE_v10032998mg [Citrus clementina]
 ref|XP_006435736.1| hypothetical protein CICLE_v10032998mg [Citrus clementina]
 ref|XP_006435737.1| hypothetical protein CICLE_v10032998mg [Citrus clementina]
 ref|XP_006486320.1| PREDICTED: protein EARLY FLOWERING 4-like isoform X1 [Citrus 
sinensis]
 gb|ESR48974.1| hypothetical protein CICLE_v10032998mg [Citrus clementina]
 gb|ESR48975.1| hypothetical protein CICLE_v10032998mg [Citrus clementina]
 gb|ESR48976.1| hypothetical protein CICLE_v10032998mg [Citrus clementina]
 gb|ESR48977.1| hypothetical protein CICLE_v10032998mg [Citrus clementina]
Length=148

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  959  AWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYS  780
            AW+  +  F +VQ+ LD+NR LIQQVNEN QSK+PDN+  N  LI+E+NGNIS+VV LYS
Sbjct  66   AWQSFNTSFGQVQSVLDRNRVLIQQVNENHQSKIPDNMVKNVGLIQELNGNISKVVSLYS  125

Query  779  DLSVNFAGLVRHR  741
            DLS NF+     R
Sbjct  126  DLSTNFSRAFHQR  138



>gb|EYU22352.1| hypothetical protein MIMGU_mgv1a015987mg [Erythranthe guttata]
Length=139

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 5/95 (5%)
 Frame = -2

Query  1013  IEEHVGENDGKE----EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNL  846
             + EH  E DG E    E  D   WE  ++ FR VQT LD+NR LIQ+VNEN QSK+ +N+
Sbjct  29    VPEH-NEIDGGEQSFQEGGDPGVWEAFTENFRRVQTVLDRNRVLIQKVNENHQSKIHENI  87

Query  845   AMNPALIREINGNISRVVGLYSDLSVNFAGLVRHR  741
             A N  LI+EINGNI++VV LYS+LS +F+  V H 
Sbjct  88    AKNVGLIQEINGNINKVVSLYSELSAHFSTAVVHH  122



>ref|XP_006295267.1| hypothetical protein CARUB_v10024354mg [Capsella rubella]
 gb|EOA28165.1| hypothetical protein CARUB_v10024354mg [Capsella rubella]
Length=113

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNIS+VV 
Sbjct  24   DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVN  83

Query  788  LYSDLSVNFA  759
            +YSDL+ +FA
Sbjct  84   MYSDLNTSFA  93



>emb|CDY66370.1| BnaUnng01460D [Brassica napus]
Length=113

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNI++VV 
Sbjct  23   DPAMWEDLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNITKVVS  82

Query  788  LYSDLSVNFA  759
            +YSDL+ NF+
Sbjct  83   MYSDLNTNFS  92



>ref|XP_004307648.1| PREDICTED: protein EARLY FLOWERING 4-like [Fragaria vesca subsp. 
vesca]
Length=119

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = -2

Query  959  AW-EMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLY  783
            AW +  ++ FR+VQ  LD+NRALIQQVN+N QS++P N+  N ALI+EINGNIS+VV LY
Sbjct  39   AWVDNFNRSFRQVQAVLDRNRALIQQVNDNHQSRIPANMVKNVALIQEINGNISKVVSLY  98

Query  782  SDLSVNFAGLVRHR  741
            SDLS +F+ + R++
Sbjct  99   SDLSSDFSSVFRNK  112



>ref|NP_565922.1| protein EARLY FLOWERING 4 [Arabidopsis thaliana]
 sp|O04211.1|ELF4_ARATH RecName: Full=Protein EARLY FLOWERING 4; AltName: Full=Protein 
ARRHYTHMIC 44 [Arabidopsis thaliana]
 gb|AAB95293.1| expressed protein [Arabidopsis thaliana]
 gb|AAK59687.1| unknown protein [Arabidopsis thaliana]
 gb|AAL33809.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67064.1| unknown [Arabidopsis thaliana]
 gb|AEC09773.1| uncharacterized protein AT2G40080 [Arabidopsis thaliana]
Length=111

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  980  EEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNIS  801
            E+  D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNIS
Sbjct  18   EQGEDPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNIS  77

Query  800  RVVGLYSDLSVNFA  759
            +VV +YSDL+ +F+
Sbjct  78   KVVNMYSDLNTSFS  91



>emb|CDY20512.1| BnaC04g05320D [Brassica napus]
Length=113

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNIS+V  
Sbjct  23   DPAMWEDLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVAS  82

Query  788  LYSDLSVNFA  759
            +YSDL+ NF+
Sbjct  83   MYSDLNTNFS  92



>emb|CDY60339.1| BnaC03g72320D [Brassica napus]
Length=114

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QSK+ DN++ N ALI+E+NGNIS+VV 
Sbjct  23   DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSKMADNMSKNVALIQELNGNISKVVS  82

Query  788  LYSDLSVNFA  759
            +YSD++  F+
Sbjct  83   MYSDINTKFS  92



>ref|XP_002862593.1| hypothetical protein ARALYDRAFT_497391 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002881694.1| hypothetical protein ARALYDRAFT_903274 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38851.1| hypothetical protein ARALYDRAFT_497391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57953.1| hypothetical protein ARALYDRAFT_903274 [Arabidopsis lyrata subsp. 
lyrata]
Length=114

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D   WE L + FR+VQ+ LD+NR+LIQQVN+N QS++ DN++ N ALI+E+NGNIS+VV 
Sbjct  25   DPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVN  84

Query  788  LYSDLSVNFA  759
            +YSDL+ +F+
Sbjct  85   MYSDLNTSFS  94



>ref|XP_009625081.1| PREDICTED: protein EARLY FLOWERING 4-like [Nicotiana tomentosiformis]
Length=152

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = -2

Query  1022  SKAIEEHVGENDGKE---EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPD  852
             S A+E +  E++  +   EE ++E W   S  FR+VQ+ LD+NR LIQQVNEN +++  +
Sbjct  41    SSAVEAYNTEDENGDVSVEEDNSEMWNDFSNRFRQVQSVLDRNRLLIQQVNENHRARTHN  100

Query  851   NLAMNPALIREINGNISRVVGLYSDLSVNFAGLV  750
             N+  N  LI+E+NGNIS+VV  YSDLS NF+ + 
Sbjct  101   NMVQNVGLIQELNGNISKVVSFYSDLSTNFSTVF  134



>ref|XP_006293392.1| hypothetical protein CARUB_v10024247mg, partial [Capsella rubella]
 gb|EOA26290.1| hypothetical protein CARUB_v10024247mg, partial [Capsella rubella]
Length=152

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  965  AEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGL  786
             E W+ LS  F+  Q  LDQNR LIQ+VNEN  S++PDN+A N ALI EINGNI RV+ +
Sbjct  49   VEVWDTLSNGFKRAQVVLDQNRDLIQRVNENHMSRIPDNVARNVALINEINGNIFRVMEI  108

Query  785  YSDLSVNFAGLVRHRR  738
            YS LSV+FA  +  RR
Sbjct  109  YSALSVDFATKLDQRR  124



>ref|XP_004171253.1| PREDICTED: protein EARLY FLOWERING 4-like [Cucumis sativus]
Length=118

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            +E D E W    + FR+VQ+ LD+NR LIQQVNEN QS++P N+  N ALI+E+NGNIS+
Sbjct  26   DEYDPEVWASFDQTFRQVQSVLDRNRTLIQQVNENHQSRIPSNMVDNVALIQELNGNISK  85

Query  797  VVGLYSDLSVNFA  759
            VV +YSD S +F+
Sbjct  86   VVSMYSDFSSDFS  98



>emb|CDX95740.1| BnaC03g26210D [Brassica napus]
Length=141

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -2

Query  980  EEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNIS  801
            EE  D E W  LS  F+  Q  LDQNR LIQ+VN+N  S++P+N++ N  LI EINGNIS
Sbjct  37   EEFNDVEVWNTLSNGFKRAQIVLDQNRDLIQRVNDNHLSRIPENVSRNVGLINEINGNIS  96

Query  800  RVVGLYSDLSVNFA  759
            RV+ +Y+DL+V+FA
Sbjct  97   RVMEIYTDLAVDFA  110



>ref|XP_006410045.1| hypothetical protein EUTSA_v10017683mg [Eutrema salsugineum]
 gb|ESQ51498.1| hypothetical protein EUTSA_v10017683mg [Eutrema salsugineum]
Length=86

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D E W+ LS  F+  Q  LDQNR LIQ+VNEN +S++PDN+  N  LI EINGNISRV+ 
Sbjct  4    DDEVWDTLSNGFKRAQLVLDQNRDLIQRVNENHRSRIPDNVTRNVGLINEINGNISRVME  63

Query  788  LYSDLSVNFAGLVRHR  741
             Y+DLS     +   R
Sbjct  64   TYTDLSFEITKMFHER  79



>ref|XP_009784404.1| PREDICTED: protein ELF4-LIKE 4-like [Nicotiana sylvestris]
Length=115

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D + ++   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQVDGKVFQTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS NF 
Sbjct  70   IRRVVDLYADLSCNFT  85



>ref|XP_009593698.1| PREDICTED: protein ELF4-LIKE 4 [Nicotiana tomentosiformis]
Length=115

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D + ++   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQVDGKVFQTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS NF 
Sbjct  70   IRRVVDLYADLSCNFT  85



>ref|XP_002521338.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41006.1| conserved hypothetical protein [Ricinus communis]
Length=114

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  + + K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LIRE+N N
Sbjct  10   GNGTQVDGKVLQTVQKSFMQVQDILDQNRLLINEINQNHESKIPDNLTRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS NF+
Sbjct  70   IRRVVDLYADLSTNFS  85



>ref|XP_010513223.1| PREDICTED: protein ELF4-LIKE 1-like [Camelina sativa]
Length=121

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  956  WEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSD  777
            W+ LS  F+  Q  LDQNR LIQ+VNEN  S++PDN+A N ALI EINGNI RV+ +YS 
Sbjct  18   WDTLSNGFKRAQVVLDQNRELIQRVNENHMSRIPDNVARNVALINEINGNIFRVMEIYSV  77

Query  776  LSVNFA  759
            LSV+FA
Sbjct  78   LSVDFA  83



>ref|XP_002449890.1| hypothetical protein SORBIDRAFT_05g025110 [Sorghum bicolor]
 gb|EES08878.1| hypothetical protein SORBIDRAFT_05g025110 [Sorghum bicolor]
Length=122

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  989  DGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREING  810
            +G  +  D +  +   K F +VQ+ LDQNR LI ++N+N +S+ PDNL  N  LIRE+N 
Sbjct  12   NGGGQAVDGKLIQTFHKSFVQVQSLLDQNRMLISEINQNHESRAPDNLTRNVGLIRELNN  71

Query  809  NISRVVGLYSDLSVNFA  759
            NI RVVGLY+DLS +FA
Sbjct  72   NIRRVVGLYADLSASFA  88



>gb|KDP40710.1| hypothetical protein JCGZ_24709 [Jatropha curcas]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  + + K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LIRE+N N
Sbjct  10   GNGTQVDGKVLQTVQKSFMQVQDILDQNRLLINEINQNHESKVPDNLTRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS NF 
Sbjct  70   IRRVVDLYADLSTNFT  85



>ref|XP_010473960.1| PREDICTED: protein ELF4-LIKE 1-like [Camelina sativa]
Length=115

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = -2

Query  995  ENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREI  816
            E DG EEE D E W+ LS  F+  +  LDQNR LIQ+VNEN  S++PDN+A N AL   I
Sbjct  6    EVDGDEEE-DVEVWDTLSNGFKRARVVLDQNRELIQRVNENHMSRIPDNVARNVAL---I  61

Query  815  NGNISRVVGLYSDLSVNFA  759
            NGNI RV+ +YS LSV+FA
Sbjct  62   NGNIFRVMEIYSVLSVDFA  80



>ref|XP_007142208.1| hypothetical protein PHAVU_008G261200g [Phaseolus vulgaris]
 gb|ESW14202.1| hypothetical protein PHAVU_008G261200g [Phaseolus vulgaris]
Length=149

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  956  WEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSD  777
            W ML++ FR+ QT LD+NRALI++VN N + K PD++  N +L+ +I+GNIS+V  +YSD
Sbjct  41   WNMLTRSFRQAQTVLDENRALIEEVNRNHELKNPDSMVKNVSLMTQIHGNISKVRSIYSD  100

Query  776  LSVNFAGLVRHRR  738
            LSV+F+ +V  RR
Sbjct  101  LSVSFSNIVGQRR  113



>ref|XP_009619416.1| PREDICTED: protein ELF4-LIKE 3 [Nicotiana tomentosiformis]
 ref|XP_009619417.1| PREDICTED: protein ELF4-LIKE 3 [Nicotiana tomentosiformis]
Length=105

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+NQ+SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDGKVVQTFQKSFVQVQNILDQNRLLINEINQNQESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSTSFT  85



>gb|ACK56122.1| ELF4-like protein [Saccharum officinarum]
Length=119

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  989  DGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREING  810
            +G  +  D +  +   K F +VQ+ LDQNR LI ++N+N +S+ PDNL  N  LIRE+N 
Sbjct  12   NGGGQAVDGKLIQTFHKSFVQVQSLLDQNRMLISEINQNHESRAPDNLTRNVGLIRELNN  71

Query  809  NISRVVGLYSDLSVNFA  759
            NI RVVGLY+DLS +FA
Sbjct  72   NIRRVVGLYADLSSSFA  88



>ref|XP_006369567.1| hypothetical protein POPTR_0001s25870g [Populus trichocarpa]
 gb|ERP66136.1| hypothetical protein POPTR_0001s25870g [Populus trichocarpa]
Length=110

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  998  GENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIRE  819
             +N  +EEECD EAW+ LSK F++VQ+ LD NR LIQQVN N QSK+PDNL  N +LIRE
Sbjct  26   AKNGEEEEECDVEAWDTLSKSFKQVQSVLDHNRDLIQQVNANHQSKIPDNLVKNVSLIRE  85

Query  818  INGNISR  798
            INGNIS+
Sbjct  86   INGNISK  92



>ref|XP_004303681.1| PREDICTED: protein ELF4-LIKE 4-like isoform 1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004303682.1| PREDICTED: protein ELF4-LIKE 4-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=114

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQLDSKVVQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS NF+
Sbjct  70   IRRVVDLYADLSSNFS  85



>ref|XP_002275438.1| PREDICTED: protein ELF4-LIKE 4 [Vitis vinifera]
 ref|XP_010654445.1| PREDICTED: protein ELF4-LIKE 4 [Vitis vinifera]
 ref|XP_010654446.1| PREDICTED: protein ELF4-LIKE 4 [Vitis vinifera]
 ref|XP_010654447.1| PREDICTED: protein ELF4-LIKE 4 [Vitis vinifera]
Length=114

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LIRE+N N
Sbjct  10   GNGTQVDSKVLQTFHKSFVQVQNLLDQNRLLINEINQNHESKIPDNLNRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LYSDLS +FA
Sbjct  70   IRRVVDLYSDLSSSFA  85



>ref|XP_009412686.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009412687.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009412688.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009412689.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
Length=110

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = -2

Query  998  GENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIRE  819
            G  DG  +  D +  + L K F +VQ+ LDQNR LI ++N+N +SK+P+NL+ N  LIRE
Sbjct  8    GIGDGATQ-VDNKVLQSLQKSFLQVQSILDQNRLLINEINQNHESKIPENLSRNVGLIRE  66

Query  818  INGNISRVVGLYSDLSVNFA  759
            +N NI RVVGLY DLS++F+
Sbjct  67   LNNNIQRVVGLYDDLSLSFS  86



>gb|ACK56113.1| ELF4-like protein [Hedyotis terminalis]
Length=116

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  16   QIDGKVMQTFQKSFVQVQNILDQNRLLINEINQNHESKMPDNLSRNVGLIRELNNNIKRV  75

Query  794  VGLYSDLSVNFA  759
            V LYSDLS +F 
Sbjct  76   VNLYSDLSSSFT  87



>ref|XP_009784512.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana sylvestris]
 ref|XP_009784514.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana sylvestris]
Length=105

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+NQ+SK+PDNL+ N  LIRE+N N
Sbjct  10   GNVTQIDGKVVQTFQKNFVQVQNILDQNRLLINEINQNQESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSTSFT  85



>gb|ACK56119.1| ELF4-like protein [Pinus taeda]
Length=119

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ+ LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGSQIDGKVLQTFQKSFGQVQSILDQNRLLINEINQNHESKIPDNLSRNVTLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            ISRVV LY  LS +FA
Sbjct  70   ISRVVDLYDGLSTSFA  85



>ref|XP_009595000.1| PREDICTED: protein EARLY FLOWERING 4-like [Nicotiana tomentosiformis]
Length=124

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  995  ENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREI  816
            ++D   E+ ++E W   S  + +VQ+ LD+NR LIQQVNEN QS+  +++  N  LI+E+
Sbjct  36   DDDFSIEKGESETWNTFSNNYSQVQSVLDRNRLLIQQVNENHQSRTHNSMVQNVGLIQEL  95

Query  815  NGNISRVVGLYSDLSVNFAGLVRHRR  738
            NGNIS+V  LYSD + +F  +V  R+
Sbjct  96   NGNISKVASLYSDFNTDFRTMVHQRK  121



>ref|XP_002279914.1| PREDICTED: protein ELF4-LIKE 4 [Vitis vinifera]
 ref|XP_010656130.1| PREDICTED: protein ELF4-LIKE 4 [Vitis vinifera]
 emb|CBI27831.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDGKVLQTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSTSFT  85



>gb|AFK39961.1| unknown [Lotus japonicus]
Length=117

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  998  GENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIRE  819
            G  +G  +  D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE
Sbjct  9    GLGNGSTQVVDGKILQTFQKSFVQVQNILDQNRVLINEINQNHESKVPDNLSRNVGLIRE  68

Query  818  INGNISRVVGLYSDLSVNFA  759
            +N NI RVV LY+DLS +F 
Sbjct  69   LNNNIRRVVDLYADLSSSFT  88



>ref|XP_009380046.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009380047.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009380048.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009380049.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
Length=109

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  11   GNGTQVDSKVLQTFQKSFLQVQRILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS++F 
Sbjct  71   IRRVVDLYADLSLSFT  86



>ref|XP_010105509.1| hypothetical protein L484_002611 [Morus notabilis]
 gb|EXC04960.1| hypothetical protein L484_002611 [Morus notabilis]
Length=114

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQVDGKVVQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSTSFT  85



>ref|XP_008797479.1| PREDICTED: protein ELF4-LIKE 4-like [Phoenix dactylifera]
Length=114

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++  +   K F +VQ+ LDQNR LI ++N+N +S++PDNL+ N  LIRE+N N
Sbjct  10   GNGTQVDSKVLQTFQKSFVQVQSILDQNRLLINEINQNHESRIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +FA
Sbjct  70   IRRVVELYADLSSSFA  85



>emb|CDP03105.1| unnamed protein product [Coffea canephora]
Length=114

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDGKVLQTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSTSFT  85



>emb|CDX83315.1| BnaA03g21910D [Brassica napus]
Length=138

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 9/109 (8%)
 Frame = -2

Query  1085  GNHKATPYDRSGVEWSMEDITSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQ  906
             GN++ +   R+  E + +D+   A E        KEE  D + W  LS  F+  Q  LD+
Sbjct  11    GNNRKSS-KRALTEMNKDDVHVTAAE--------KEEFNDVKVWNTLSSGFKRAQLVLDE  61

Query  905   NRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFA  759
             NR LI++VN+N  S++P+N++ N  LI EINGNISRV+ +Y+DL+V+F+
Sbjct  62    NRDLIRRVNDNHLSRIPENVSRNVGLINEINGNISRVMEIYTDLAVDFS  110



>gb|EYU25872.1| hypothetical protein MIMGU_mgv1a016656mg [Erythranthe guttata]
Length=112

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNIAQMDGKILQSFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LYSDLS +F 
Sbjct  70   IRRVVDLYSDLSTSFT  85



>gb|ACK56128.1| ELF4-like protein [Antirrhinum majus]
Length=110

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
              D +      K F +VQ  LDQNR LI Q+N+N +SK+PDNL  N  LIRE+N NI RV
Sbjct  14   HVDGKIAHTFQKSFVQVQNILDQNRLLINQINQNHESKVPDNLNRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS NF 
Sbjct  74   VDLYADLSTNFT  85



>ref|XP_003551140.1| PREDICTED: protein ELF4-LIKE 4-like isoformX1 [Glycine max]
 ref|XP_003551141.1| PREDICTED: protein ELF4-LIKE 4-like isoformX2 [Glycine max]
 ref|XP_006600445.1| PREDICTED: protein ELF4-LIKE 4-like isoform X3 [Glycine max]
 gb|KHN17709.1| Protein ELF4-LIKE 4 [Glycine soja]
Length=114

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDSKILQTFKKSFVQVQNILDQNRVLINEINQNHESKVPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|XP_011036415.1| PREDICTED: protein ELF4-LIKE 4-like [Populus euphratica]
 ref|XP_011036416.1| PREDICTED: protein ELF4-LIKE 4-like [Populus euphratica]
 ref|XP_011036417.1| PREDICTED: protein ELF4-LIKE 4-like [Populus euphratica]
Length=114

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -2

Query  980  EEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNIS  801
            E + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LI+E+N NI 
Sbjct  12   ENQVDGKVLQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLTRNVGLIKELNNNIR  71

Query  800  RVVGLYSDLSVNFA  759
            RVV LY+DLS NF 
Sbjct  72   RVVDLYADLSSNFT  85



>gb|AAD27669.1|AF119222_1 hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY81696.1| hypothetical protein OsI_36872 [Oryza sativa Indica Group]
Length=117

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ+ LDQNR LI ++N+N +S+ PDNL  N  LIRE+N NI RV
Sbjct  14   QVDNKLIQTFHKSFVQVQSILDQNRMLINEINQNHESRAPDNLTRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            VGLY+DLS +FA
Sbjct  74   VGLYADLSASFA  85



>ref|XP_011093804.1| PREDICTED: protein ELF4-LIKE 3 [Sesamum indicum]
 ref|XP_011093805.1| PREDICTED: protein ELF4-LIKE 3 [Sesamum indicum]
 ref|XP_011093806.1| PREDICTED: protein ELF4-LIKE 3 [Sesamum indicum]
Length=112

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQMDGKVLQSFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSTSFT  85



>ref|NP_001068300.1| Os11g0621500 [Oryza sativa Japonica Group]
 gb|ABA94824.1| early flowering 4, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA94825.1| early flowering 4, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG22557.1| early flowering 4, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28663.1| Os11g0621500 [Oryza sativa Japonica Group]
 dbj|BAG90723.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52489.1| hypothetical protein OsJ_34677 [Oryza sativa Japonica Group]
Length=117

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ+ LDQNR LI ++N+N +S+ PDNL  N  LIRE+N NI RV
Sbjct  14   QVDNKLIQTFHKSFVQVQSILDQNRMLINEINQNHESRAPDNLTRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            VGLY+DLS +FA
Sbjct  74   VGLYADLSASFA  85



>ref|XP_009419385.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419386.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419387.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
Length=112

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +A+    K F +VQ+ L+QNR LI ++N+N ++ +PDNL  N  LIRE+N N
Sbjct  11   GNGNQVDNKAFHAFQKSFVQVQSILNQNRLLINEINQNHETMIPDNLGRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFAG  756
            I RVV LY+DLS++F G
Sbjct  71   IRRVVDLYADLSLSFTG  87



>gb|ACG45265.1| early flowering 4 [Zea mays]
Length=128

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +      + F +VQ+ LDQNR LI ++N+N +S+ PDNL  N  LIRE+N NI RVV
Sbjct  26   VDGKLIHTFHRSFVQVQSLLDQNRMLISEINQNHESRAPDNLTRNVGLIRELNNNIRRVV  85

Query  791  GLYSDLSVNFAGLVRH  744
            GLY+DLS +FA  + H
Sbjct  86   GLYADLSASFARTMDH  101



>ref|NP_001275817.1| ELF4-like protein [Citrus sinensis]
 ref|XP_006448539.1| hypothetical protein CICLE_v10017236mg [Citrus clementina]
 ref|XP_006468627.1| PREDICTED: protein ELF4-LIKE 4 isoform X2 [Citrus sinensis]
 gb|ACK56109.1| ELF4-like protein [Citrus sinensis]
 gb|ESR61779.1| hypothetical protein CICLE_v10017236mg [Citrus clementina]
 gb|KDO77130.1| hypothetical protein CISIN_1g033658mg [Citrus sinensis]
Length=114

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LI+E+N N
Sbjct  10   GNGTQVDGKVLQTFRKSFGQVQDILDQNRLLINEINQNHESKVPDNLTRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +FA
Sbjct  70   IRRVVSLYADLSSSFA  85



>ref|NP_001151292.1| early flowering 4 [Zea mays]
 gb|ACG42260.1| early flowering 4 [Zea mays]
Length=129

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +      + F +VQ+ LDQNR LI ++N+N +S+ PDNL  N  LIRE+N NI RVV
Sbjct  25   VDGKLIHTFHRSFVQVQSLLDQNRMLISEINQNHESRAPDNLTRNVGLIRELNNNIRRVV  84

Query  791  GLYSDLSVNFAGLVRH  744
            GLY+DLS +FA  + H
Sbjct  85   GLYADLSASFARTMDH  100



>ref|XP_010261931.1| PREDICTED: protein ELF4-LIKE 4-like [Nelumbo nucifera]
 ref|XP_010261932.1| PREDICTED: protein ELF4-LIKE 4-like [Nelumbo nucifera]
Length=114

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQVDNKVLQTFQKSFVQVQNILDQNRLLINEINQNHESKMPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSTSFT  85



>gb|EYU21332.1| hypothetical protein MIMGU_mgv1a016586mg [Erythranthe guttata]
 gb|EYU21333.1| hypothetical protein MIMGU_mgv1a016586mg [Erythranthe guttata]
Length=115

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -2

Query  1013  IEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNP  834
             +EE +  +     + D++  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL  N 
Sbjct  1     MEEDIFSSIANGSQVDSKVVQTFQKNFVQVQNILDQNRLLITEINQNHESKIPDNLTRNV  60

Query  833   ALIREINGNISRVVGLYSDLSVNFA  759
              LIRE+N NI RVV LY DLS NF 
Sbjct  61    GLIRELNNNIRRVVDLYGDLSSNFT  85



>ref|XP_004243721.1| PREDICTED: protein ELF4-LIKE 3-like [Solanum lycopersicum]
Length=109

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D + ++   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  15   QIDGKVFQTFQKSFVQVQNLLDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNNIRRV  74

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F 
Sbjct  75   VDLYADLSCSFT  86



>ref|NP_001275340.1| ELF4-like protein [Solanum tuberosum]
 ref|XP_006342358.1| PREDICTED: protein ELF4-LIKE 3 isoform X1 [Solanum tuberosum]
 ref|XP_006342359.1| PREDICTED: protein ELF4-LIKE 3 isoform X2 [Solanum tuberosum]
 gb|ACK56123.1| ELF4-like protein [Solanum tuberosum]
Length=109

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D + ++   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  15   QIDGKVFQTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNNIRRV  74

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F 
Sbjct  75   VDLYADLSCSFT  86



>ref|XP_007024603.1| ELF4-like 4 [Theobroma cacao]
 gb|EOY27225.1| ELF4-like 4 [Theobroma cacao]
Length=114

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQVDGKVLQTFQKSFVQVQGILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|NP_001146184.1| early flowering 4 [Zea mays]
 ref|XP_008677116.1| PREDICTED: early flowering 4 isoform X1 [Zea mays]
 ref|XP_008677117.1| PREDICTED: early flowering 4 isoform X1 [Zea mays]
 gb|ACL53422.1| unknown [Zea mays]
 gb|AFW60319.1| early flowering 4 [Zea mays]
Length=129

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +      + F +VQ+ LDQNR LI ++N+N +S+ PDNL  N  LIRE+N NI RVV
Sbjct  26   VDGKLIHTFHRSFVQVQSLLDQNRMLISEINQNHESRAPDNLTRNVGLIRELNNNIRRVV  85

Query  791  GLYSDLSVNFAGLVRH  744
            GLY+DLS +FA  + H
Sbjct  86   GLYADLSASFARTMDH  101



>ref|XP_007141770.1| hypothetical protein PHAVU_008G224300g [Phaseolus vulgaris]
 gb|ESW13764.1| hypothetical protein PHAVU_008G224300g [Phaseolus vulgaris]
Length=108

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = -2

Query  995  ENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREI  816
            E+DG +   D   W  + +  REVQ+ LD+NR LI++VNENQQS+L  N+  N +LI+E+
Sbjct  13   EHDGVD--ADPLVWAAVDESLREVQSMLDRNRRLIEEVNENQQSRLRHNMVKNVSLIQEL  70

Query  815  NGNISRVVGLYSDLSVNFAG  756
            NGNI++V+ LYSDL+ NF+ 
Sbjct  71   NGNIAKVLSLYSDLNSNFSA  90



>ref|XP_008228208.1| PREDICTED: protein ELF4-LIKE 4 [Prunus mume]
Length=114

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQLDTKVVQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNSN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F+
Sbjct  70   IRRVVDLYADLSSSFS  85



>ref|XP_009133836.1| PREDICTED: protein ELF4-LIKE 1 [Brassica rapa]
Length=138

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -2

Query  980  EEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNIS  801
            EE  D E W  LS  F+  Q  LD+NR LI++VN+N  S++P+N++ N  LI EINGNIS
Sbjct  37   EEFNDVEVWNTLSSGFKRAQLVLDENRDLIRRVNDNHLSRIPENVSRNVGLINEINGNIS  96

Query  800  RVVGLYSDLSVNFA  759
            RV+ +Y+DL+V+F+
Sbjct  97   RVMEIYTDLAVDFS  110



>ref|XP_010090124.1| hypothetical protein L484_027356 [Morus notabilis]
 gb|EXB38921.1| hypothetical protein L484_027356 [Morus notabilis]
Length=116

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI Q+N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  15   QIDGKILQTFQKNFVQVQNILDQNRLLINQINQNHESKIPDNLSRNVGLIRELNNNIRRV  74

Query  794  VGLYSDLSVNFA  759
            V LYSDLS +F 
Sbjct  75   VDLYSDLSSSFT  86



>ref|XP_007138673.1| hypothetical protein PHAVU_009G228400g [Phaseolus vulgaris]
 ref|XP_007138674.1| hypothetical protein PHAVU_009G228400g [Phaseolus vulgaris]
 ref|XP_007138675.1| hypothetical protein PHAVU_009G228400g [Phaseolus vulgaris]
 gb|ESW10667.1| hypothetical protein PHAVU_009G228400g [Phaseolus vulgaris]
 gb|ESW10668.1| hypothetical protein PHAVU_009G228400g [Phaseolus vulgaris]
 gb|ESW10669.1| hypothetical protein PHAVU_009G228400g [Phaseolus vulgaris]
Length=114

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + DA+  +   K F +VQT  DQNR LI ++N+N +SK+PDNL  N  LIRE+N N
Sbjct  10   GDGAQIDAKIMQTFHKSFVQVQTIFDQNRLLINEINQNHESKVPDNLTRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY+DLS +F 
Sbjct  70   IRRVYDLYADLSSSFT  85



>ref|XP_006849639.1| hypothetical protein AMTR_s00024p00222370 [Amborella trichopoda]
 gb|ERN11220.1| hypothetical protein AMTR_s00024p00222370 [Amborella trichopoda]
Length=118

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGAQVDGKVLQTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNSN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|XP_008242208.1| PREDICTED: protein ELF4-LIKE 3 [Prunus mume]
Length=114

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDGKVLQTFQKSFVQVQNILDQNRLLINEINHNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|XP_007202775.1| hypothetical protein PRUPE_ppa013588mg [Prunus persica]
 gb|EMJ03974.1| hypothetical protein PRUPE_ppa013588mg [Prunus persica]
Length=114

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDGKVLQTFQKSFVQVQKILDQNRLLINEINHNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|XP_007215169.1| hypothetical protein PRUPE_ppa013595mg [Prunus persica]
 gb|EMJ16368.1| hypothetical protein PRUPE_ppa013595mg [Prunus persica]
Length=114

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQLDTKVVQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNSN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY DLS +F+
Sbjct  70   IRRVVDLYGDLSSSFS  85



>ref|XP_009404159.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009404160.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009404161.1| PREDICTED: protein ELF4-LIKE 3-like [Musa acuminata subsp. malaccensis]
Length=109

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +V+  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  11   GNGTQVDGKVLQTFQKSFLQVENILDQNRQLINEINQNHESKIPDNLSRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS++F 
Sbjct  71   IRRVVDLYADLSLSFT  86



>ref|XP_004287614.1| PREDICTED: protein ELF4-LIKE 3-like isoform 1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004287615.1| PREDICTED: protein ELF4-LIKE 3-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=116

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  11   GNGTQIDGKVLQTFQKSFGQVQDILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  71   IRRVVELYADLSSSFT  86



>ref|XP_006381644.1| hypothetical protein POPTR_0006s14610g [Populus trichocarpa]
 ref|XP_011045972.1| PREDICTED: protein ELF4-LIKE 3 [Populus euphratica]
 gb|ERP59441.1| hypothetical protein POPTR_0006s14610g [Populus trichocarpa]
Length=114

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDGKILQTFQKNFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSTSFT  85



>gb|ADE75819.1| unknown [Picea sitchensis]
Length=117

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +A +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N ALIRE+N N
Sbjct  10   GNGNQIDGKALQSFQKSFGQVQNILDQNRLLINEINQNHESKIPDNLSRNVALIRELNNN  69

Query  806  ISRVVGLYSDLSVNFAGLV  750
            I+RVV  Y+ LS +F   V
Sbjct  70   ITRVVDHYAGLSTSFTKAV  88



>gb|AJD80258.1| EFL4 [x Doritaenopsis hybrid cultivar]
Length=114

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D++  +  +  F +VQT LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RVV
Sbjct  15   VDSKVLQHFNNSFGQVQTILDQNRLLINEINQNHESKIPDNLSRNVRLIRELNNNIRRVV  74

Query  791  GLYSDLSVNFA  759
             LY+DLS +F+
Sbjct  75   DLYADLSTSFS  85



>ref|XP_010049534.1| PREDICTED: protein ELF4-LIKE 3-like [Eucalyptus grandis]
 ref|XP_010049535.1| PREDICTED: protein ELF4-LIKE 3-like [Eucalyptus grandis]
 gb|KCW82166.1| hypothetical protein EUGRSUZ_C03559 [Eucalyptus grandis]
 gb|KCW82167.1| hypothetical protein EUGRSUZ_C03559 [Eucalyptus grandis]
Length=109

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D    +   K F +VQ  LDQNR LI+++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGAQNDGRVLQTFRKSFVQVQNILDQNRLLIREINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFAGLV  750
            I +VV LY DLS NF+ ++
Sbjct  70   IKQVVDLYGDLSGNFSKIM  88



>ref|XP_009798445.1| PREDICTED: protein ELF4-LIKE 3 [Nicotiana sylvestris]
Length=100

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            E D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  8    EIDGKVMQTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNNIRRV  67

Query  794  VGLYSDLSVNF  762
            V LY+ LS NF
Sbjct  68   VDLYAHLSGNF  78



>ref|XP_009628143.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana tomentosiformis]
 ref|XP_009628144.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana tomentosiformis]
Length=99

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            E D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  12   EIDGKVMKTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNNIRRV  71

Query  794  VGLYSDLSVNF  762
            V LY+ LS NF
Sbjct  72   VDLYAHLSGNF  82



>gb|EMS62766.1| hypothetical protein TRIUR3_33924 [Triticum urartu]
Length=134

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +  +   K F +VQ+ LDQNR LI ++N+N +S+ PD+L  N  LIRE+N NI RVV
Sbjct  24   VDGKLIQTFHKSFVQVQSILDQNRMLISEINQNHESRAPDSLTRNVGLIRELNNNIRRVV  83

Query  791  GLYSDLSVNFA  759
            GLY+DLS +FA
Sbjct  84   GLYADLSASFA  94



>ref|XP_010936948.1| PREDICTED: protein ELF4-LIKE 3-like [Elaeis guineensis]
Length=109

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ+ LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  15   QADNKVLQAFKKSFVQVQSILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNNIRRV  74

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F 
Sbjct  75   VDLYADLSFSFT  86



>gb|EMT31043.1| hypothetical protein F775_06613 [Aegilops tauschii]
Length=136

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +  +   K F +VQ+ LDQNR LI ++N+N +S+ PD+L  N  LIRE+N NI RVV
Sbjct  27   VDGKLIQTFHKSFVQVQSILDQNRMLISEINQNHESRAPDSLTRNVGLIRELNNNIRRVV  86

Query  791  GLYSDLSVNFA  759
            GLY+DLS +FA
Sbjct  87   GLYADLSASFA  97



>ref|XP_010537602.1| PREDICTED: protein ELF4-LIKE 4 isoform X2 [Tarenaya hassleriana]
 ref|XP_010537603.1| PREDICTED: protein ELF4-LIKE 4 isoform X2 [Tarenaya hassleriana]
 ref|XP_010537604.1| PREDICTED: protein ELF4-LIKE 4 isoform X2 [Tarenaya hassleriana]
 ref|XP_010537605.1| PREDICTED: protein ELF4-LIKE 4 isoform X2 [Tarenaya hassleriana]
Length=114

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G+    D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL  N  LIRE+N N
Sbjct  10   GERYHIDGKLLQSFQKSFVQVQDILDQNRLLINEINQNHESKQPDNLGRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV GLY+DLS +FA
Sbjct  70   IRRVAGLYADLSNSFA  85



>ref|XP_007012686.1| Elf4-like 4 isoform 1 [Theobroma cacao]
 ref|XP_007012687.1| Elf4-like 4 isoform 1 [Theobroma cacao]
 gb|EOY30305.1| Elf4-like 4 isoform 1 [Theobroma cacao]
 gb|EOY30306.1| Elf4-like 4 isoform 1 [Theobroma cacao]
Length=114

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDGKVVQTFQKSFVQVQHILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|XP_009372348.1| PREDICTED: protein ELF4-LIKE 4-like [Pyrus x bretschneideri]
 ref|XP_009372349.1| PREDICTED: protein ELF4-LIKE 4-like [Pyrus x bretschneideri]
Length=114

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQLDTKVVQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F+
Sbjct  70   IRRVVDLYADLSGSFS  85



>ref|XP_006465931.1| PREDICTED: protein ELF4-LIKE 4-like isoform X1 [Citrus sinensis]
 gb|KDO65049.1| hypothetical protein CISIN_1g033638mg [Citrus sinensis]
 gb|KDO65050.1| hypothetical protein CISIN_1g033638mg [Citrus sinensis]
 gb|KDO65051.1| hypothetical protein CISIN_1g033638mg [Citrus sinensis]
 gb|KDO65052.1| hypothetical protein CISIN_1g033638mg [Citrus sinensis]
Length=114

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G + + D +  ++  K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LI+E+N N
Sbjct  10   GNDAQVDDKILQIFQKSFGQVQDILDQNRLLINEINQNHESKVPDNLTRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I+RVV LY+DLS +F 
Sbjct  70   ITRVVNLYADLSNSFT  85



>ref|XP_008337767.1| PREDICTED: protein ELF4-LIKE 3 [Malus domestica]
 ref|XP_008337768.1| PREDICTED: protein ELF4-LIKE 3 [Malus domestica]
 ref|XP_009340439.1| PREDICTED: protein ELF4-LIKE 3-like [Pyrus x bretschneideri]
 ref|XP_009340440.1| PREDICTED: protein ELF4-LIKE 3-like [Pyrus x bretschneideri]
Length=116

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI ++N N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  15   QIDGKVLQTFQKSFVQVQNILDQNRVLINEINHNHESKIPDNLSRNVGLIRELNNNIRRV  74

Query  794  VGLYSDLSVNFA  759
            V LY DLS +F 
Sbjct  75   VDLYGDLSSSFT  86



>ref|NP_001235393.1| uncharacterized protein LOC100306717 [Glycine max]
 ref|XP_006593362.1| PREDICTED: uncharacterized protein LOC100306717 isoform X1 [Glycine 
max]
 ref|XP_006593363.1| PREDICTED: uncharacterized protein LOC100306717 isoform X2 [Glycine 
max]
 gb|ACU15026.1| unknown [Glycine max]
 gb|KHN07915.1| Protein ELF4-LIKE 4 [Glycine soja]
Length=114

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++      K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDSKILLTFKKSFVQVQNILDQNRVLINEINQNHESKVPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|XP_008797489.1| PREDICTED: protein ELF4-LIKE 3-like [Phoenix dactylifera]
 ref|XP_008797497.1| PREDICTED: protein ELF4-LIKE 3-like [Phoenix dactylifera]
Length=109

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ+ LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  15   QADNKVLQGFKKSFVQVQSILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNNIRRV  74

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F 
Sbjct  75   VDLYADLSFSFT  86



>ref|XP_002303249.1| hypothetical protein POPTR_0003s06270g [Populus trichocarpa]
 gb|EEE78228.1| hypothetical protein POPTR_0003s06270g [Populus trichocarpa]
Length=114

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LI+E+N NI RV
Sbjct  14   QVDGKVLQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLTRNVGLIKELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS NF 
Sbjct  74   VDLYADLSSNFT  85



>ref|XP_010537601.1| PREDICTED: protein ELF4-LIKE 4 isoform X1 [Tarenaya hassleriana]
Length=132

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -2

Query  1013  IEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNP  834
             +E  V    G+    D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL  N 
Sbjct  19    MEGDVFSGFGERYHIDGKLLQSFQKSFVQVQDILDQNRLLINEINQNHESKQPDNLGRNV  78

Query  833   ALIREINGNISRVVGLYSDLSVNFA  759
              LIRE+N NI RV GLY+DLS +FA
Sbjct  79    GLIRELNNNIRRVAGLYADLSNSFA  103



>ref|XP_004513473.1| PREDICTED: protein ELF4-LIKE 4-like [Cicer arietinum]
Length=114

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 8/93 (9%)
 Frame = -2

Query  1037  MEDITSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKL  858
             MED T   I        G   + D++      K F +VQ  LDQNR LI ++N+N +SK+
Sbjct  1     MEDDTFSGI--------GNGTQIDSKILGTFQKSFVQVQNILDQNRLLINEINQNHESKI  52

Query  857   PDNLAMNPALIREINGNISRVVGLYSDLSVNFA  759
             PDNL+ N  LI+E+N NI RVV LY+DLS +F 
Sbjct  53    PDNLSRNVGLIKELNNNIRRVVDLYADLSSSFT  85



>ref|XP_008787846.1| PREDICTED: protein ELF4-LIKE 3-like [Phoenix dactylifera]
Length=109

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ+ LD NR LI ++N+N +SK+PDNL  N  LIRE+N N
Sbjct  11   GNGTQVDNKTLQTFQKSFVQVQSILDHNRLLINEINQNHESKIPDNLTRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  71   IRRVVDLYADLSFSFT  86



>ref|XP_010033741.1| PREDICTED: protein ELF4-LIKE 4 [Eucalyptus grandis]
 ref|XP_010033742.1| PREDICTED: protein ELF4-LIKE 4 [Eucalyptus grandis]
 ref|XP_010033743.1| PREDICTED: protein ELF4-LIKE 4 [Eucalyptus grandis]
 gb|KCW53545.1| hypothetical protein EUGRSUZ_J02822 [Eucalyptus grandis]
Length=110

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     DA+  +M  K F +VQ  LDQNR LI ++N N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTPVDAKMLQMFQKSFLQVQGILDQNRLLINEINLNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLS  771
            I RVV LY+DLS
Sbjct  70   IRRVVDLYADLS  81



>gb|KDP33899.1| hypothetical protein JCGZ_07470 [Jatropha curcas]
Length=114

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDSKILQTFQKNFVQVQHILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>gb|ACK56117.1| ELF4-like protein [Lactuca serriola]
Length=113

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  998  GENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIRE  819
            G  +G +   D +  +   K F +VQ  LDQNR LI ++N+NQ+SKLP NL  N  LIRE
Sbjct  8    GIGNGSQLGVDGKVLQTFQKSFVQVQNILDQNRLLINEINQNQESKLPVNLTRNVGLIRE  67

Query  818  INGNISRVVGLYSDLSVNFA  759
            +N N+ RVV LY DLS +F+
Sbjct  68   LNNNVKRVVDLYGDLSNSFS  87



>ref|XP_009361683.1| PREDICTED: protein ELF4-LIKE 3 [Pyrus x bretschneideri]
Length=116

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI ++N N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  15   QIDGKVLQTFQKSFVQVQNILDQNRLLINEINHNHESKIPDNLSRNVGLIRELNNNIRRV  74

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F 
Sbjct  75   VDLYADLSSSFT  86



>ref|XP_011035705.1| PREDICTED: protein ELF4-LIKE 4-like [Populus euphratica]
 ref|XP_011035707.1| PREDICTED: protein ELF4-LIKE 4-like [Populus euphratica]
 ref|XP_011035708.1| PREDICTED: protein ELF4-LIKE 4-like [Populus euphratica]
Length=114

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LI+E+N NI RV
Sbjct  14   QVDGKVLQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLTRNVGLIKELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS NF 
Sbjct  74   VDLYADLSNNFT  85



>gb|AFK49629.1| unknown [Medicago truncatula]
 gb|KEH37551.1| early flowering protein [Medicago truncatula]
Length=114

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 8/93 (9%)
 Frame = -2

Query  1037  MEDITSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKL  858
             MED T   I        G   + D +      K F +VQ  LDQNR LI ++N+N +SK+
Sbjct  1     MEDDTFSGI--------GNGTQIDTKILGTFQKSFVQVQNILDQNRLLINEINQNHESKI  52

Query  857   PDNLAMNPALIREINGNISRVVGLYSDLSVNFA  759
             PDNL+ N  LI+E+N NI RVV LY+DLS +F 
Sbjct  53    PDNLSRNVGLIKELNNNIRRVVDLYADLSSSFT  85



>ref|XP_002298099.1| hypothetical protein POPTR_0001s17010g [Populus trichocarpa]
 gb|EEE82904.1| hypothetical protein POPTR_0001s17010g [Populus trichocarpa]
Length=114

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LI+E+N NI RV
Sbjct  14   QVDGKVLQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLTRNVGLIKELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS NF 
Sbjct  74   VDLYADLSNNFT  85



>ref|XP_004507981.1| PREDICTED: protein ELF4-LIKE 4-like isoform X1 [Cicer arietinum]
 ref|XP_004507982.1| PREDICTED: protein ELF4-LIKE 4-like isoform X2 [Cicer arietinum]
Length=114

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
              D +  +   K F +VQ  LDQNR LI ++N+N +S++PDNL+ N  LIRE+N NI RV
Sbjct  14   HIDGKILQTFQKSFVQVQNILDQNRVLINEINQNHESRIPDNLSRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
              LY+DLS +FA
Sbjct  74   AELYADLSTSFA  85



>ref|XP_010936947.1| PREDICTED: protein ELF4-LIKE 4 [Elaeis guineensis]
Length=113

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ+ LDQNR LI ++N+N +SK+PDNL  N  LIRE+N NI RV
Sbjct  14   QVDNKVLQNFQKSFVQVQSILDQNRLLINEINQNHESKIPDNLNRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +FA
Sbjct  74   VDLYADLSSSFA  85



>emb|CDO97858.1| unnamed protein product [Coffea canephora]
Length=114

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PD+L  N  LIRE+N N
Sbjct  11   GIGAQVDGKVVQTFQKSFLQVQNILDQNRLLINEINQNHESKIPDHLTRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +FA
Sbjct  71   IRRVVDLYADLSNSFA  86



>gb|KCW53544.1| hypothetical protein EUGRSUZ_J02822 [Eucalyptus grandis]
Length=145

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     DA+  +M  K F +VQ  LDQNR LI ++N N +SK+PDNL+ N  LIRE+N N
Sbjct  45   GNGTPVDAKMLQMFQKSFLQVQGILDQNRLLINEINLNHESKIPDNLSRNVGLIRELNNN  104

Query  806  ISRVVGLYSDLS  771
            I RVV LY+DLS
Sbjct  105  IRRVVDLYADLS  116



>ref|XP_007154599.1| hypothetical protein PHAVU_003G132400g [Phaseolus vulgaris]
 ref|XP_007154600.1| hypothetical protein PHAVU_003G132400g [Phaseolus vulgaris]
 ref|XP_007154601.1| hypothetical protein PHAVU_003G132400g [Phaseolus vulgaris]
 gb|ESW26593.1| hypothetical protein PHAVU_003G132400g [Phaseolus vulgaris]
 gb|ESW26594.1| hypothetical protein PHAVU_003G132400g [Phaseolus vulgaris]
 gb|ESW26595.1| hypothetical protein PHAVU_003G132400g [Phaseolus vulgaris]
Length=114

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NI RV
Sbjct  14   QIDNKILQTFKKSFVQVQDILDQNRVLINEINQNHESKVPDNLSRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F 
Sbjct  74   VDLYADLSSSFT  85



>ref|XP_006663055.1| PREDICTED: protein ELF4-LIKE 4-like isoform X1 [Oryza brachyantha]
 ref|XP_006663056.1| PREDICTED: protein ELF4-LIKE 4-like isoform X2 [Oryza brachyantha]
 ref|XP_006663057.1| PREDICTED: protein ELF4-LIKE 4-like isoform X3 [Oryza brachyantha]
 ref|XP_006663058.1| PREDICTED: protein ELF4-LIKE 4-like isoform X4 [Oryza brachyantha]
Length=117

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ+ LD+NR LI ++N+N +S+ PDNL  N  LIRE+N NI RV
Sbjct  14   QVDNKLIQTFHKSFVQVQSILDKNRMLINEINQNHESRAPDNLTRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            VGLY+DLS +F+
Sbjct  74   VGLYADLSASFS  85



>ref|XP_006426639.1| hypothetical protein CICLE_v10026798mg [Citrus clementina]
 ref|XP_006426640.1| hypothetical protein CICLE_v10026798mg [Citrus clementina]
 gb|ESR39879.1| hypothetical protein CICLE_v10026798mg [Citrus clementina]
 gb|ESR39880.1| hypothetical protein CICLE_v10026798mg [Citrus clementina]
Length=114

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -2

Query  1013  IEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNP  834
             +E  +  + G + + D +  ++  K F +VQ  LDQNR LI ++N+N +SK+PDNL  N 
Sbjct  1     MEGDIFSSAGYDAQVDDKILQIFQKSFGQVQDILDQNRLLINEINQNHESKVPDNLTRNV  60

Query  833   ALIREINGNISRVVGLYSDLSVNFA  759
              LI+E+N NI RVV LY+DLS +F 
Sbjct  61    GLIKELNNNIRRVVNLYADLSNSFT  85



>gb|EYU28345.1| hypothetical protein MIMGU_mgv1a019260mg [Erythranthe guttata]
Length=107

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  953  EMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDL  774
            +   K F +VQT LDQNR LIQ++N+N +SK+PDNL+ N  LI+E+N NI RVV +Y+DL
Sbjct  17   QTFQKSFVQVQTILDQNRLLIQEINQNHESKIPDNLSRNVGLIKELNSNIKRVVDIYADL  76

Query  773  SVNFA  759
            S  FA
Sbjct  77   SNCFA  81



>gb|ACJ84508.1| unknown [Medicago truncatula]
Length=114

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 8/93 (9%)
 Frame = -2

Query  1037  MEDITSKAIEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKL  858
             MED T   I        G   + D +      K F +VQ  LDQNR LI ++N+N +SK+
Sbjct  1     MEDDTFSGI--------GNGTQIDTKILGTFQKSFVQVQNILDQNRLLINEINQNHESKI  52

Query  857   PDNLAMNPALIREINGNISRVVGLYSDLSVNFA  759
             PDNL+ N  LI+E+N NI RVV LY DLS +F 
Sbjct  53    PDNLSRNVGLIKELNNNIRRVVDLYVDLSSSFT  85



>ref|XP_010668016.1| PREDICTED: protein ELF4-LIKE 4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010668017.1| PREDICTED: protein ELF4-LIKE 4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010668018.1| PREDICTED: protein ELF4-LIKE 4 [Beta vulgaris subsp. vulgaris]
 gb|ACK56108.1| ELF4-like protein [Beta vulgaris]
Length=114

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++  +   K F +VQ+ LDQNR LI ++N+N +S++PDNL+ N  LIRE+N N
Sbjct  10   GNGTQIDSKVLQTFQKSFVQVQSILDQNRLLINEINQNHESRIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLS  771
            I RVV LY DLS
Sbjct  70   IRRVVDLYGDLS  81



>gb|EPS57304.1| hypothetical protein M569_17515, partial [Genlisea aurea]
Length=115

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + + +  + L K F +VQ+ LDQNR LI ++N+NQ+SK P NL  N  LIRE+N N
Sbjct  10   GDPTQVETKVAQKLHKNFIQVQSILDQNRLLINEINQNQESKAPVNLTRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +FA
Sbjct  70   IRRVVDLYADLSTSFA  85



>ref|XP_004144022.1| PREDICTED: protein ELF4-LIKE 4-like isoform 1 [Cucumis sativus]
 ref|XP_004144023.1| PREDICTED: protein ELF4-LIKE 4-like isoform 2 [Cucumis sativus]
 ref|XP_004171952.1| PREDICTED: protein ELF4-LIKE 4-like isoform 1 [Cucumis sativus]
 ref|XP_004171953.1| PREDICTED: protein ELF4-LIKE 4-like isoform 2 [Cucumis sativus]
 ref|XP_008450908.1| PREDICTED: protein ELF4-LIKE 4 [Cucumis melo]
 ref|XP_008450909.1| PREDICTED: protein ELF4-LIKE 4 [Cucumis melo]
 ref|XP_008450910.1| PREDICTED: protein ELF4-LIKE 4 [Cucumis melo]
 gb|KGN66281.1| hypothetical protein Csa_1G595850 [Cucumis sativus]
Length=114

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D++  +   K F +VQ  LDQN+ LI ++N+N +SK+PDNL  N  LIRE+N N
Sbjct  10   GSSPQIDSKILQTFQKNFVQVQNILDQNKLLISEINQNHESKIPDNLNRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSCSFT  85



>gb|AFK43622.1| unknown [Lotus japonicus]
Length=116

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  998  GENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIRE  819
            G   G  ++ D +      K F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LI+E
Sbjct  8    GVGHGILQQIDGKVLHTFQKSFVQVQNILDQNRVLINEINQNHESKVPDNLNRNVGLIKE  67

Query  818  INGNISRVVGLYSDLSVNFA  759
            +N N+ RVV LY+DLS +F 
Sbjct  68   LNNNVRRVVDLYADLSSSFT  87



>ref|XP_010047504.1| PREDICTED: protein ELF4-LIKE 3 [Eucalyptus grandis]
 ref|XP_010047505.1| PREDICTED: protein ELF4-LIKE 3 [Eucalyptus grandis]
 gb|KCW79439.1| hypothetical protein EUGRSUZ_C00829 [Eucalyptus grandis]
 gb|KCW79440.1| hypothetical protein EUGRSUZ_C00829 [Eucalyptus grandis]
Length=118

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -2

Query  980  EEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNIS  801
              + D +  +   K F +VQ+ LDQNR LI ++N+NQ+S++PD+L+ N  LIRE+N NI 
Sbjct  15   HHQIDTKILQTFQKSFVQVQSILDQNRLLINEINQNQESRVPDSLSRNVGLIRELNNNIR  74

Query  800  RVVGLYSDLSVNFA  759
             VV LY+DLS NF 
Sbjct  75   TVVNLYADLSSNFT  88



>gb|ACK56112.1| ELF4-like protein [Helianthus annuus]
Length=104

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            +   +  +   K F +VQ+ LDQNR LI ++N+N +SK+PDNL  N  LIRE+N NI +V
Sbjct  4    DVQGKGMQAFEKSFVQVQSILDQNRVLINEINQNHESKIPDNLGRNVGLIRELNNNIRKV  63

Query  794  VGLYSDLSVNFA  759
            V LYS LS NF+
Sbjct  64   VDLYSHLSSNFS  75



>ref|XP_010273934.1| PREDICTED: protein ELF4-LIKE 4-like [Nelumbo nucifera]
Length=111

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGMQADNKVLQTFQKSFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLS  771
            I RVV LY+DLS
Sbjct  70   IRRVVDLYADLS  81



>gb|KEH32458.1| early flowering protein [Medicago truncatula]
Length=115

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            ++ D +  +   K F +VQ  LDQNR LI ++N+N +S++PDNL  N  LI+E+N NI R
Sbjct  14   QQIDGKILQTFQKRFVQVQNILDQNRVLINEINQNHESRVPDNLNKNVGLIKELNSNIRR  73

Query  797  VVGLYSDLSVNFA  759
            VV LY+DLS +F 
Sbjct  74   VVDLYADLSTSFT  86



>ref|XP_011072576.1| PREDICTED: protein ELF4-LIKE 4 [Sesamum indicum]
Length=115

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + + +  +   K F +VQ+ LDQNR LI ++N+N +SK+PDNL  N  LIRE+N NI RV
Sbjct  14   QIEGKVLQTFQKNFVQVQSILDQNRLLINEINQNHESKIPDNLTRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F 
Sbjct  74   VDLYADLSNSFT  85



>gb|AAD27564.1|AF114171_5 hypothetical protein [Sorghum bicolor]
Length=438

 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  989  DGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREING  810
            +G  +  D +  +   K F +VQ+ LDQNR LI ++N+N +S+ PDNL  N  LIRE+N 
Sbjct  3    NGGGQAVDGKLIQTFHKSFVQVQSLLDQNRMLISEINQNHESRAPDNLTRNVGLIRELNN  62

Query  809  NISRVVGLYSDLSVNFA  759
            NI RVVGLY+DLS +FA
Sbjct  63   NIRRVVGLYADLSASFA  79



>gb|AAF79463.1|AC022492_7 F1L3.15 [Arabidopsis thaliana]
 gb|AAF97300.1|AC007843_3 Hypothetical protein [Arabidopsis thaliana]
Length=141

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 63/114 (55%), Gaps = 1/114 (1%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL  N  LI+E+N N
Sbjct  10   GDRHNMDGKLLQSFQKSFVDVQDILDQNRLLINEINQNHESKQPDNLGRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFAGLVRHRRaatataTINRSKNTTNEKSADSDWSKFRLVA  645
            I RV  LY DLS +FA  V       ++ T+ +S    N+K   SD S F  VA
Sbjct  70   IRRVASLYGDLSHSFARSVDASSEGESSGTL-KSDGKANQKRFRSDISLFADVA  122



>gb|ACK56111.1| ELF4-like protein [Gossypium arboreum]
 gb|KHG11659.1| Protein ELF4-LIKE 4 -like protein [Gossypium arboreum]
Length=114

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LI+E+N N
Sbjct  10   GNGGQVDGKVLQTFQKSFVQVQDILDQNRLLINEINQNHESKIPDNLSRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY+DLS +F 
Sbjct  70   IRRVADLYADLSSSFT  85



>dbj|BAK04623.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=134

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +  +   K F +VQ+ LDQNR LI ++N+N +S+ PD+L  N  LIRE+N NI RVV
Sbjct  26   VDGKLIQTFHKSFVQVQSILDQNRMLISEINQNHESRAPDSLTRNVGLIRELNNNIRRVV  85

Query  791  GLYSDLSVNFA  759
             LY+DLS +FA
Sbjct  86   RLYADLSASFA  96



>ref|XP_006426641.1| hypothetical protein CICLE_v10026810mg [Citrus clementina]
 ref|XP_006465930.1| PREDICTED: protein ELF4-LIKE 4-like [Citrus sinensis]
 gb|ESR39881.1| hypothetical protein CICLE_v10026810mg [Citrus clementina]
 gb|KDO65048.1| hypothetical protein CISIN_1g033906mg [Citrus sinensis]
Length=109

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + +    +   + F +VQ  LDQNR LI ++N+N +SK+PDNL  N  LI+E+N NI RV
Sbjct  15   QVNGRVMQTFQRSFGQVQDILDQNRLLINEINQNHESKIPDNLTRNVGLIKELNNNIRRV  74

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F+
Sbjct  75   VNLYADLSTSFS  86



>gb|KHG04759.1| Protein ELF4-LIKE 3 -like protein [Gossypium arboreum]
Length=117

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            E D++  +   K F +VQ  LDQNR LI ++N+N +SK+P NL  N  LIRE+N NI +V
Sbjct  15   EIDSKVVQTFQKSFVQVQNILDQNRLLINEINQNHESKIPHNLTRNVGLIRELNNNIRKV  74

Query  794  VGLYSDLSVNFA  759
            V LY DLS +F 
Sbjct  75   VDLYGDLSSSFT  86



>ref|NP_001236861.1| uncharacterized protein LOC100500360 [Glycine max]
 gb|ACU15414.1| unknown [Glycine max]
 gb|KHN37782.1| Protein ELF4-LIKE 3 [Glycine soja]
Length=112

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + DA+  +   K F +VQ   DQNR LI ++N+N +SK+PDNL  N  LIRE+N NI RV
Sbjct  10   QIDAKIMQTFKKNFVQVQDIFDQNRLLINEINQNHESKVPDNLTRNVGLIRELNNNIRRV  69

Query  794  VGLYSDLSVNFA  759
              LY+DLS +F 
Sbjct  70   YDLYADLSSSFT  81



>ref|XP_002883737.1| hypothetical protein ARALYDRAFT_899420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59996.1| hypothetical protein ARALYDRAFT_899420 [Arabidopsis lyrata subsp. 
lyrata]
Length=109

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LD NR LI ++N+N +SK+PDNL  N  LIRE+N N
Sbjct  11   GNGVQMDGKILQTFEKSFVQVQNILDHNRLLINEINQNHESKIPDNLGRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            + RV  LY DLS NF+
Sbjct  71   VRRVAHLYVDLSNNFS  86



>gb|AEW08246.1| hypothetical protein 2_4126_01, partial [Pinus radiata]
 gb|AFG58994.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG58995.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG58996.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG58997.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG58998.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG58999.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59000.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59001.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59002.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59003.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59004.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59005.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59006.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59007.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59008.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59009.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59010.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
 gb|AFG59011.1| hypothetical protein 2_4126_01, partial [Pinus taeda]
Length=85

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  935  FREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSVNFA  759
            F +VQ+ LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N NISRVV LY  LS +FA
Sbjct  1    FGQVQSILDQNRLLINEINQNHESKIPDNLSRNVTLIRELNNNISRVVDLYDGLSTSFA  59



>ref|XP_009149194.1| PREDICTED: protein ELF4-LIKE 4 [Brassica rapa]
 emb|CDY26244.1| BnaA06g11730D [Brassica napus]
Length=114

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G+    D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL  N  LI+E+N N
Sbjct  10   GERHNMDGKLLQSFQKSFVDVQDILDQNRLLINEINQNHESKQPDNLGRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY DLS +FA
Sbjct  70   IRRVASLYGDLSHSFA  85



>ref|NP_565334.1| protein ELF4-like 3 [Arabidopsis thaliana]
 sp|Q8S8F5.1|EF4L3_ARATH RecName: Full=Protein ELF4-LIKE 3 [Arabidopsis thaliana]
 gb|AAM15312.1| Expressed protein [Arabidopsis thaliana]
 gb|AAM63737.1| unknown [Arabidopsis thaliana]
 gb|AEC06006.1| protein ELF4-like 3 [Arabidopsis thaliana]
Length=109

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LD NR LI ++N+N +SK+PDNL  N  LIRE+N N
Sbjct  11   GSGVQMDGKILQTFEKSFVQVQNILDHNRLLINEINQNHESKIPDNLGRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            + RV  LY DLS NF+
Sbjct  71   VRRVAHLYVDLSNNFS  86



>gb|AGV54152.1| ELF4-like protein [Phaseolus vulgaris]
Length=162

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ  LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGIQIDNKILQTFKKSFVQVQDILDQNRVLINEINQNHESKVPDNLSRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|XP_010459337.1| PREDICTED: protein ELF4-LIKE 4-like [Camelina sativa]
 ref|XP_010459338.1| PREDICTED: protein ELF4-LIKE 4-like [Camelina sativa]
 ref|XP_010476895.1| PREDICTED: protein ELF4-LIKE 4-like [Camelina sativa]
 ref|XP_010476896.1| PREDICTED: protein ELF4-LIKE 4-like [Camelina sativa]
Length=114

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL+ N  LI+E+N N
Sbjct  10   GDRHNVDGKLLQGFQKSFVDVQDILDQNRLLINEINQNHESKQPDNLSRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY DLS +FA
Sbjct  70   IRRVASLYGDLSHSFA  85



>gb|KHG08699.1| Protein ELF4-LIKE 4 -like protein [Gossypium arboreum]
Length=116

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQNR LI ++N+N +SK+P+NL+ N  LI+E+N NI RV
Sbjct  14   QIDGKVLQTFQKSFVQVQDILDQNRLLINEINQNHESKIPNNLSRNVGLIKELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS ++ 
Sbjct  74   VDLYADLSTSYT  85



>ref|XP_010498097.1| PREDICTED: protein ELF4-LIKE 4 [Camelina sativa]
Length=114

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL  N  LI+E+N N
Sbjct  10   GDRHNVDGKLLQGFQKSFVDVQDILDQNRLLINEINQNHESKQPDNLGRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY DLS +FA
Sbjct  70   IRRVASLYGDLSHSFA  85



>ref|XP_002890226.1| hypothetical protein ARALYDRAFT_471952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66485.1| hypothetical protein ARALYDRAFT_471952 [Arabidopsis lyrata subsp. 
lyrata]
Length=106

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL  N  LI+E+N N
Sbjct  10   GDRHNMDGKLLQSFQKSFVDVQDILDQNRLLINEINQNHESKQPDNLGRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY DLS +FA
Sbjct  70   IRRVASLYGDLSHSFA  85



>ref|NP_564024.1| protein ELF4-like 4 [Arabidopsis thaliana]
 ref|NP_001154348.1| protein ELF4-like 4 [Arabidopsis thaliana]
 sp|Q570U6.1|EF4L4_ARATH RecName: Full=Protein ELF4-LIKE 4 [Arabidopsis thaliana]
 dbj|BAD94981.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF59006.1| At1g17455 [Arabidopsis thaliana]
 gb|AEE29591.1| protein ELF4-like 4 [Arabidopsis thaliana]
 gb|AEE29592.1| protein ELF4-like 4 [Arabidopsis thaliana]
Length=114

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL  N  LI+E+N N
Sbjct  10   GDRHNMDGKLLQSFQKSFVDVQDILDQNRLLINEINQNHESKQPDNLGRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY DLS +FA
Sbjct  70   IRRVASLYGDLSHSFA  85



>ref|XP_010541979.1| PREDICTED: protein ELF4-LIKE 3 [Tarenaya hassleriana]
 ref|XP_010541980.1| PREDICTED: protein ELF4-LIKE 3 [Tarenaya hassleriana]
Length=106

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LDQN+ LI ++N+N +SK+PDNL  N  LIRE+N N+ RV
Sbjct  10   QFDGKILQTFQKSFVQVQNILDQNKLLINEINKNHESKIPDNLGRNVGLIRELNNNMRRV  69

Query  794  VGLYSDLSVNFA  759
              LY+DLS NF+
Sbjct  70   ADLYADLSNNFS  81



>ref|NP_001236892.1| uncharacterized protein LOC100305802 [Glycine max]
 ref|XP_006586616.1| PREDICTED: uncharacterized protein LOC100305802 isoform X1 [Glycine 
max]
 gb|ACU13665.1| unknown [Glycine max]
 gb|KHN35886.1| Protein ELF4-LIKE 3 [Glycine soja]
Length=112

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + DA+  +   K F +VQ   DQNR LI ++N+N +SK+PDNL  N  LIRE+N NI RV
Sbjct  10   QIDAKIMQTFKKNFVQVQDIFDQNRLLINEINQNHESKVPDNLTRNVGLIRELNNNIRRV  69

Query  794  VGLYSDLSVNFA  759
              LY DLS +F 
Sbjct  70   YDLYVDLSSSFT  81



>ref|XP_010237527.1| PREDICTED: protein ELF4-LIKE 4-like [Brachypodium distachyon]
 ref|XP_010237528.1| PREDICTED: protein ELF4-LIKE 4-like [Brachypodium distachyon]
 ref|XP_010237529.1| PREDICTED: protein ELF4-LIKE 4-like [Brachypodium distachyon]
 ref|XP_010237530.1| PREDICTED: protein ELF4-LIKE 4-like [Brachypodium distachyon]
Length=138

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  953  EMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDL  774
            +   K F +VQ+ LDQNR LI ++N+N +S+ PD+L  N  LIRE+N NI RVVGLY+DL
Sbjct  30   QTFHKSFVQVQSILDQNRMLISEINQNHESRAPDSLTRNVGLIRELNNNIRRVVGLYADL  89

Query  773  SVNF  762
            S +F
Sbjct  90   SASF  93



>ref|XP_006416701.1| hypothetical protein EUTSA_v10009148mg [Eutrema salsugineum]
 ref|XP_006416702.1| hypothetical protein EUTSA_v10009148mg [Eutrema salsugineum]
 gb|ESQ35054.1| hypothetical protein EUTSA_v10009148mg [Eutrema salsugineum]
 gb|ESQ35055.1| hypothetical protein EUTSA_v10009148mg [Eutrema salsugineum]
Length=114

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     D +  +   K F +VQ  LDQNR LI ++N+N +SK PDNL  N  LI+E+N N
Sbjct  10   GDRHNMDGKLLQNFQKSFVDVQDILDQNRLLINEINQNHESKQPDNLGRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY DLS +FA
Sbjct  70   IRRVASLYGDLSHSFA  85



>ref|XP_004979763.1| PREDICTED: protein ELF4-LIKE 4-like [Setaria italica]
Length=124

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +  +   K F +VQ+ L+QNR LI ++N+N +S+ P NL  N  LIRE+N NI RVV
Sbjct  20   VDGKLIQTFHKSFVQVQSLLEQNRLLISEINQNHESRAPRNLTRNVGLIRELNNNIRRVV  79

Query  791  GLYSDLSVNFA  759
            GLY+D+S +FA
Sbjct  80   GLYADISASFA  90



>ref|XP_010540086.1| PREDICTED: protein ELF4-LIKE 4 [Tarenaya hassleriana]
 ref|XP_010540087.1| PREDICTED: protein ELF4-LIKE 4 [Tarenaya hassleriana]
Length=117

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -2

Query  986  GKEEEC--DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREIN  813
            G E+ C  D +  +   K F +VQ  LDQNR LI ++N+N +S+ PDNL  N  LIRE+N
Sbjct  8    GFEDRCHVDGKLLQSFQKSFVQVQDILDQNRLLINEINQNHESRQPDNLKRNVGLIRELN  67

Query  812  GNISRVVGLYSDLSVNFA  759
             N+ RV  LY+DLS +FA
Sbjct  68   NNVRRVANLYADLSNSFA  85



>ref|XP_008787844.1| PREDICTED: protein ELF4-LIKE 4-like [Phoenix dactylifera]
 ref|XP_008787845.1| PREDICTED: protein ELF4-LIKE 4-like [Phoenix dactylifera]
Length=113

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  +   K F +VQ+ LDQNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNGAQVDNKILQTFQKSFVQVQSILDQNRLLINEINQNHESKVPDNLSRNVGLIRELNSN  69

Query  806  ISRVVGLYSDL  774
            I RVV LY+DL
Sbjct  70   IRRVVDLYADL  80



>ref|XP_006598696.1| PREDICTED: uncharacterized protein LOC100305734 isoform X1 [Glycine 
max]
 ref|XP_006598697.1| PREDICTED: uncharacterized protein LOC100305734 isoform X2 [Glycine 
max]
 gb|KHN01397.1| Protein ELF4-LIKE 4 [Glycine soja]
 gb|KHN39639.1| Protein ELF4-LIKE 4 [Glycine soja]
Length=114

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D+   ++  K   + Q  L+QNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNSTQVDSRLLQVFQKSLLQAQDILNQNRLLINEINQNHESKMPDNLSRNVGLIRELNSN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSNSFT  85



>ref|XP_009800392.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana sylvestris]
Length=115

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D + ++ L K F +VQ  LDQNR LI ++N+N +S +PDNL  N  LIRE+N N
Sbjct  10   GNGIQADRKVFQTLQKNFVQVQNILDQNRLLINEINQNHESTIPDNLTRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLS  771
            I RVV LY DLS
Sbjct  70   IRRVVDLYDDLS  81



>ref|XP_007135454.1| hypothetical protein PHAVU_010G130900g [Phaseolus vulgaris]
 ref|XP_007135455.1| hypothetical protein PHAVU_010G130900g [Phaseolus vulgaris]
 gb|ESW07448.1| hypothetical protein PHAVU_010G130900g [Phaseolus vulgaris]
 gb|ESW07449.1| hypothetical protein PHAVU_010G130900g [Phaseolus vulgaris]
Length=114

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D+   ++  K   + Q  L+QNR LI ++N+N +SK+PDNL+ N  LIRE+N N
Sbjct  10   GNSTQVDSRLLQVFQKSLLQAQDILNQNRLLINEINQNHESKMPDNLSRNVGLIRELNSN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSNSFT  85



>ref|XP_003627239.1| ELF4-like protein [Medicago truncatula]
 gb|ACK56118.1| ELF4-like protein [Medicago truncatula]
 gb|AET01715.1| early flowering protein [Medicago truncatula]
 gb|AFK41113.1| unknown [Medicago truncatula]
Length=114

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D+    +  K   + Q  L+QNR LI Q+N+N +S++PDNL+ N +LI+E+N N
Sbjct  10   GDTSQVDSRVLHVFQKSLVQAQDILNQNRLLINQINQNHESRIPDNLSRNVSLIKELNSN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>gb|ACK56110.1| ELF4-like protein [Gossypium arboreum]
 gb|KHG00420.1| Protein ELF4-LIKE 3 -like protein [Gossypium arboreum]
Length=127

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  977  EECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISR  798
            +E D +  + L K   +VQT LDQNR LI ++N N +SK+P NL  N  LI+E+N NI R
Sbjct  14   DEMDPKVVQTLQKGLVQVQTMLDQNRLLINEINMNHESKVPHNLTRNVGLIKELNNNIKR  73

Query  797  VVGLYSDLSVNF  762
            VV LY+DLS +F
Sbjct  74   VVDLYTDLSSSF  85



>gb|EYU45884.1| hypothetical protein MIMGU_mgv1a016615mg [Erythranthe guttata]
Length=114

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + + +  +  +K F  VQT LDQNR LI ++N NQ+SK+PDNL+ N  LI+E+N NI RV
Sbjct  14   QIEGKFLQTFNKNFVLVQTILDQNRLLINEINRNQESKIPDNLSRNVGLIKELNNNIRRV  73

Query  794  VGLYSDLS  771
            V LY+DLS
Sbjct  74   VDLYADLS  81



>ref|NP_001234651.1| ELF4-like protein [Solanum lycopersicum]
 gb|ACK56116.1| ELF4-like protein [Solanum lycopersicum]
Length=114

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  1013  IEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNP  834
             +E+ V    G   + D +  + L K F +VQ  LDQNR LI ++N+N +S +PDNL  N 
Sbjct  1     MEDVVFSCTGNGVQVDRKVVQTLQKNFVQVQNILDQNRLLINEINQNHESTIPDNLTRNV  60

Query  833   ALIREINGNISRVVGLYSDLS  771
              LIRE+N NI RVV LY+DLS
Sbjct  61    GLIRELNNNIRRVVDLYADLS  81



>ref|XP_009599561.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana tomentosiformis]
 ref|XP_009599562.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana tomentosiformis]
 ref|XP_009599563.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana tomentosiformis]
 ref|XP_009599564.1| PREDICTED: protein ELF4-LIKE 3-like [Nicotiana tomentosiformis]
Length=114

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D +  + L K F +VQ  LDQNR LI ++N+N +S +PDNL  N  LIRE+N N
Sbjct  10   GNGIQVDRKVLQTLQKNFVQVQNILDQNRLLINEINQNHESTIPDNLTRNVGLIRELNNN  69

Query  806  ISRVVGLYSDLS  771
            I RVV LY+DLS
Sbjct  70   IRRVVDLYADLS  81



>gb|AFK44230.1| unknown [Lotus japonicus]
Length=114

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D+   ++  K   + Q  L+QNR LI ++N+N +SK+PDNL+ N  LI+E+N N
Sbjct  10   GNTSQVDSRVMQVFQKSLLQAQDILNQNRVLINEINQNHESKMPDNLSRNVGLIKELNSN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+D+S +F 
Sbjct  70   IRRVVDLYADISSSFT  85



>ref|XP_006361341.1| PREDICTED: protein ELF4-LIKE 3-like [Solanum tuberosum]
Length=114

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  1013  IEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNP  834
             +E+ V    G   + D +  + L K F +VQ  LDQNR LI ++N+N +S +PDNL  N 
Sbjct  1     MEDVVFSCTGNGIQVDRKVVQTLQKNFVQVQNILDQNRLLINEINQNHESTIPDNLTRNV  60

Query  833   ALIREINGNISRVVGLYSDLS  771
              LIRE+N NI RVV LY+DLS
Sbjct  61    GLIRELNNNIRRVVDLYADLS  81



>ref|XP_010467122.1| PREDICTED: protein ELF4-LIKE 3-like [Camelina sativa]
 ref|XP_010467123.1| PREDICTED: protein ELF4-LIKE 3-like [Camelina sativa]
 ref|XP_010467124.1| PREDICTED: protein ELF4-LIKE 3-like [Camelina sativa]
Length=107

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   E D +  +   K F +VQ  LD NR LI ++N+N +SK+P NL  N +LIRE+N N
Sbjct  11   GNGAEMDGKILQTFQKSFVQVQNILDHNRLLINEINQNHESKIPGNLGRNVSLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            + +V  LY DLS NF+
Sbjct  71   VRKVAHLYVDLSNNFS  86



>ref|XP_006650186.1| PREDICTED: protein ELF4-LIKE 3-like isoform X1 [Oryza brachyantha]
Length=116

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D +  +     F +VQ  LDQNRALI ++N+N +SK+P +L+ N  LIRE+N NI RVV 
Sbjct  15   DGKVLQAFQTSFVQVQRLLDQNRALISEINQNHESKVPGDLSRNVGLIRELNDNIRRVVD  74

Query  788  LYSDLSVNFA  759
            LY+DLS  FA
Sbjct  75   LYADLSSLFA  84



>ref|XP_010412929.1| PREDICTED: protein ELF4-LIKE 3 [Camelina sativa]
 ref|XP_010488795.1| PREDICTED: protein ELF4-LIKE 3 [Camelina sativa]
Length=107

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   E D +  +   K F +VQ  LD NR LI ++N+N +SK+P NL  N  LIRE+N N
Sbjct  11   GNGAEMDGKILQTFQKSFVQVQNILDHNRLLINEINQNHESKIPGNLGRNVGLIRELNNN  70

Query  806  ISRVVGLYSDLSVNFA  759
            + +V  LY DLS NF+
Sbjct  71   VRKVAHLYVDLSNNFS  86



>ref|NP_001151033.1| EARLY flowering 4 protein [Zea mays]
 ref|XP_008658691.1| PREDICTED: EARLY flowering 4 protein isoform X1 [Zea mays]
 ref|XP_008658692.1| PREDICTED: EARLY flowering 4 protein isoform X1 [Zea mays]
 ref|XP_008658693.1| PREDICTED: EARLY flowering 4 protein isoform X1 [Zea mays]
 gb|ACG24168.1| EARLY flowering 4 protein [Zea mays]
 gb|ACG41369.1| EARLY flowering 4 protein [Zea mays]
 gb|ACN36402.1| unknown [Zea mays]
 gb|AFW88092.1| EARLY flowering 4 protein [Zea mays]
Length=118

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +        F +VQT LDQNR LI ++N N +SK+P +L+ N  LIRE+N NI RVV
Sbjct  18   VDTKVLHAFQTSFVQVQTLLDQNRLLISEINHNHESKVPGDLSRNVGLIRELNNNIRRVV  77

Query  791  GLYSDLSVNFA  759
             LY+DLS  FA
Sbjct  78   DLYADLSSLFA  88



>ref|XP_004510455.1| PREDICTED: protein ELF4-LIKE 4-like isoform X1 [Cicer arietinum]
 ref|XP_004510456.1| PREDICTED: protein ELF4-LIKE 4-like isoform X2 [Cicer arietinum]
 ref|XP_004510457.1| PREDICTED: protein ELF4-LIKE 4-like isoform X3 [Cicer arietinum]
Length=114

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D+   ++  K   + Q  L+QNR LI ++N+N +SK+PDNL+ N  LI+E+N N
Sbjct  10   GDTSQVDSRLLQVFQKSLLQAQDILNQNRLLINEINQNHESKIPDNLSRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSSSFT  85



>ref|XP_006304571.1| hypothetical protein CARUB_v10011591mg [Capsella rubella]
 gb|EOA37469.1| hypothetical protein CARUB_v10011591mg [Capsella rubella]
Length=114

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     D +  +   K F +VQ  LDQNR LI ++N+N +SK P+NL  N  LI+E+N N
Sbjct  10   GDRHNMDGKLLQSFQKSFVDVQDILDQNRLLINEINQNHESKQPENLGRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY DLS +FA
Sbjct  70   IRRVASLYGDLSHSFA  85



>ref|XP_006848223.1| hypothetical protein AMTR_s00029p00245280 [Amborella trichopoda]
 gb|ERN09804.1| hypothetical protein AMTR_s00029p00245280 [Amborella trichopoda]
Length=140

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -2

Query  947  LSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGLYSDLSV  768
             S  FREVQ  L++NR LI QVN+N  S+LP+NL  N ALIR+IN NIS+V+ LYS LS 
Sbjct  58   FSSGFREVQGVLEENRLLISQVNDNHSSRLPENLTKNVALIRQINANISKVLSLYSRLSA  117

Query  767  N  765
            N
Sbjct  118  N  118



>gb|ACK56121.1| ELF4-like protein [Saccharum officinarum]
Length=123

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +        F +VQT LDQNR LI ++N N +SK+P +L+ N  LIRE+N NI RVV
Sbjct  21   VDTKVLHAFQTSFVQVQTLLDQNRLLINEINHNHESKVPGDLSRNVGLIRELNNNIRRVV  80

Query  791  GLYSDLSVNFA  759
             LY+DLS  FA
Sbjct  81   DLYADLSSLFA  91



>gb|AAM61718.1| unknown [Arabidopsis thaliana]
Length=114

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G     D +  +   K F +VQ  LDQNR LI ++N+  +SK PDNL  N  LI+E+N N
Sbjct  10   GDRHNMDGKLLQSFQKSFVDVQDILDQNRLLINEINQXHESKQPDNLGRNVGLIKELNNN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RV  LY DLS +FA
Sbjct  70   IRRVASLYGDLSHSFA  85



>ref|XP_002465144.1| hypothetical protein SORBIDRAFT_01g032750 [Sorghum bicolor]
 gb|ACK56120.1| ELF4-like protein [Sorghum bicolor]
 gb|EER92142.1| hypothetical protein SORBIDRAFT_01g032750 [Sorghum bicolor]
Length=127

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +        F +VQT LDQNR LI ++N+N +SK+P +L+ N  LIRE+N NI RVV
Sbjct  24   VDTKVLHAFQTSFVQVQTLLDQNRLLINEINQNHESKVPGDLSRNVGLIRELNNNIRRVV  83

Query  791  GLYSDLSVNFA  759
             LY+DLS  FA
Sbjct  84   DLYADLSSLFA  94



>gb|EPS66572.1| early flowering 4, partial [Genlisea aurea]
Length=96

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 58/90 (64%), Gaps = 3/90 (3%)
 Frame = -2

Query  998  GENDGKEEEC-DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQS--KLPDNLAMNPAL  828
            G+N  +E+ C D EA E+L+K F +VQ  LD+NR +IQQVN++  +      N +MN  L
Sbjct  3    GDNQAEEDYCRDPEAMEILNKNFAQVQPILDRNRTIIQQVNDSHAAAGTSASNSSMNARL  62

Query  827  IREINGNISRVVGLYSDLSVNFAGLVRHRR  738
            IRE++ NIS +  LYSD+S  F   V+ RR
Sbjct  63   IRELHENISLIARLYSDMSKRFIATVKERR  92



>ref|XP_004984055.1| PREDICTED: protein ELF4-LIKE 4-like [Setaria italica]
Length=124

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +        F +VQ+ LDQNR LI ++N+N +SK+P +L+ N  LIRE+N NI RVV
Sbjct  22   VDTKVLHAFQTSFVQVQSLLDQNRVLINEINQNHESKVPGDLSRNVGLIRELNNNIRRVV  81

Query  791  GLYSDLSVNFA  759
             LY+DLS  FA
Sbjct  82   DLYADLSSLFA  92



>ref|NP_001050343.1| Os03g0410300 [Oryza sativa Japonica Group]
 gb|AAR06305.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF96557.1| EARLY flowering 4 protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12257.1| Os03g0410300 [Oryza sativa Japonica Group]
 gb|EAY90421.1| hypothetical protein OsI_12004 [Oryza sativa Indica Group]
 dbj|BAG96475.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92725.1| unnamed protein product [Oryza sativa Japonica Group]
Length=114

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D +        F +VQ+ LDQNR LI ++N+N +SK+P +L+ N  LIRE+N NI RVV 
Sbjct  13   DGKVLHAFQTSFVQVQSLLDQNRVLINEINQNHESKVPGDLSRNVGLIRELNNNIRRVVD  72

Query  788  LYSDLSVNFA  759
            LY+DLS  FA
Sbjct  73   LYADLSSLFA  82



>ref|XP_011079766.1| PREDICTED: protein ELF4-LIKE 4-like [Sesamum indicum]
 ref|XP_011079774.1| PREDICTED: protein ELF4-LIKE 4-like [Sesamum indicum]
Length=115

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K   +VQ  LDQNR LI ++N+N +SK+P NL  N  LIRE+N NI RV
Sbjct  14   QVDGKVLQTFQKNIVQVQNILDQNRLLIIEINQNHESKVPRNLTRNVGLIRELNNNIRRV  73

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +FA
Sbjct  74   VDLYNDLSNSFA  85



>gb|EAZ27292.1| hypothetical protein OsJ_11231 [Oryza sativa Japonica Group]
Length=244

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 68/130 (52%), Gaps = 13/130 (10%)
 Frame = -2

Query  1142  ISSFLISANLFLKLER*SNGNHKATPYDRSGVEWSME-DITSKAIEEHVGENDGKEEECD  966
             +S F IS +L  ++      N +     RS  + +M+ D  S A  E            D
Sbjct  96    VSLFTISFHLGCRIAERQKKNKQRARTSRSRSKEAMDGDTLSAAAAE------------D  143

Query  965   AEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVGL  786
              +        F +VQ+ LDQNR LI ++N+N +SK+P +L+ N  LIRE+N NI RVV L
Sbjct  144   GKVLHAFQTSFVQVQSLLDQNRVLINEINQNHESKVPGDLSRNVGLIRELNNNIRRVVDL  203

Query  785   YSDLSVNFAG  756
             Y+DLS  FA 
Sbjct  204   YADLSSLFAA  213


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
            D +        F +VQ+ LDQNR LI ++N+N +SK+P +L+ N  LIRE+N NI RV+
Sbjct  13   DGKVLHAFQTSFVQVQSLLDQNRVLINEINQNHESKVPGDLSRNVGLIRELNNNIRRVI  71



>ref|NP_001148036.1| EARLY flowering 4 protein [Zea mays]
 ref|XP_008675217.1| PREDICTED: EARLY flowering 4 protein isoform X1 [Zea mays]
 ref|XP_008675224.1| PREDICTED: EARLY flowering 4 protein isoform X1 [Zea mays]
 ref|XP_008675232.1| PREDICTED: EARLY flowering 4 protein isoform X1 [Zea mays]
 ref|XP_008675241.1| PREDICTED: EARLY flowering 4 protein isoform X1 [Zea mays]
 ref|XP_008675248.1| PREDICTED: EARLY flowering 4 protein isoform X1 [Zea mays]
 gb|ACG29543.1| EARLY flowering 4 protein [Zea mays]
 tpg|DAA45753.1| TPA: EARLY flowering 4 protein [Zea mays]
Length=124

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  971  CDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVV  792
             D +        F +VQT LDQNR LI ++N N +SK+P +L+ N  LIRE+N NI RVV
Sbjct  19   VDTKVLHAFQTSFVQVQTLLDQNRLLINEINHNHESKVPGDLSRNVGLIRELNNNIRRVV  78

Query  791  GLYSDLSVNF  762
             LY+DLS  F
Sbjct  79   DLYADLSSLF  88



>ref|XP_006300295.1| hypothetical protein CARUB_v100149650mg [Capsella rubella]
 gb|EOA33193.1| hypothetical protein CARUB_v100149650mg [Capsella rubella]
Length=111

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            + D +  +   K F +VQ  LD NR LI ++N+N +SK+P NL  N  LIRE+N N+ +V
Sbjct  19   QMDGKILQTFEKSFVQVQNILDHNRLLINEINQNHESKIPGNLGRNIGLIRELNDNVRKV  78

Query  794  VGLYSDLSVNFA  759
              LY DLS NF+
Sbjct  79   AHLYVDLSNNFS  90



>ref|NP_001235965.1| uncharacterized protein LOC100305734 [Glycine max]
 gb|ACU13580.1| unknown [Glycine max]
Length=114

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G   + D+   ++  K   + Q  L+QNR LI ++N+N +SK+PDNL+ N  LI E+N N
Sbjct  10   GNSTQVDSRLLQVFQKSLLQAQDILNQNRLLINEINQNHESKMPDNLSRNVGLIGELNSN  69

Query  806  ISRVVGLYSDLSVNFA  759
            I RVV LY+DLS +F 
Sbjct  70   IRRVVDLYADLSNSFT  85



>ref|XP_002983620.1| hypothetical protein SELMODRAFT_118674 [Selaginella moellendorffii]
 gb|EFJ15116.1| hypothetical protein SELMODRAFT_118674 [Selaginella moellendorffii]
Length=124

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -2

Query  1013  IEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNP  834
             +E        K    D + W    + F +VQ  LD NR LI ++N+NQ+SK+P++L+ N 
Sbjct  1     MEADASSAPAKAPPVDRKMWAAFERGFSQVQFLLDHNRLLINEINQNQESKVPESLSRNV  60

Query  833   ALIREINGNISRVVGLYSDLSVNF  762
              LI+E+N NI +VV LYS +S +F
Sbjct  61    VLIKELNKNIGQVVSLYSTISSSF  84



>ref|XP_002990590.1| hypothetical protein SELMODRAFT_131708 [Selaginella moellendorffii]
 gb|EFJ08467.1| hypothetical protein SELMODRAFT_131708 [Selaginella moellendorffii]
Length=124

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -2

Query  1013  IEEHVGENDGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNP  834
             +E        K    D + W    + F +VQ  LD NR LI ++N+NQ+SK+P++L+ N 
Sbjct  1     MEADASSAPAKAPPVDRKMWAAFERGFSQVQFLLDHNRLLINEINQNQESKVPESLSRNV  60

Query  833   ALIREINGNISRVVGLYSDLSVNF  762
              LI+E+N NI +VV LYS +S +F
Sbjct  61    VLIKELNKNIGQVVSLYSTISSSF  84



>ref|XP_008369402.1| PREDICTED: protein EARLY FLOWERING 4-like [Malus domestica]
Length=91

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 14/83 (17%)
 Frame = -2

Query  989  DGKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREING  810
            D  EE  D+E W+  ++ F EVQ+ LD+NR+LIQQVN+N +S++ D              
Sbjct  8    DQVEEAYDSEVWDQFNRRFHEVQSVLDRNRSLIQQVNDNHRSRVAD--------------  53

Query  809  NISRVVGLYSDLSVNFAGLVRHR  741
            NIS+V  LYSDLS NF+    H 
Sbjct  54   NISKVFSLYSDLSSNFSTFFHHH  76



>ref|XP_009105922.1| PREDICTED: protein ELF4-LIKE 2 [Brassica rapa]
 emb|CDX96422.1| BnaA07g30330D [Brassica napus]
Length=112

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  986  GKEEECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGN  807
            G+  + D +  +   K F +VQ  LDQNR LI ++N+N +SK  D+L  N  LIRE+N N
Sbjct  14   GERHQMDGKVLQSFQKSFVQVQDILDQNRLLINEINQNHESKQADHLGRNVGLIRELNNN  73

Query  806  ISRVVGLYSDLSVNFA  759
            I  V  LY DLS +FA
Sbjct  74   IRTVASLYGDLSHSFA  89



>ref|XP_004157935.1| PREDICTED: protein ELF4-LIKE 3-like [Cucumis sativus]
 gb|KGN60512.1| hypothetical protein Csa_2G000210 [Cucumis sativus]
Length=100

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  974  ECDAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRV  795
            E D +  +   K F +VQ  L+QNR LI ++N+NQ+S++  N++ N  LIRE+N NI RV
Sbjct  10   EIDGKMVQRFQKNFVQVQNILEQNRMLINEINQNQESRMAGNVSRNVGLIRELNNNIRRV  69

Query  794  VGLYSDLSVNFA  759
            V LY+DLS +F 
Sbjct  70   VDLYADLSTSFT  81



>gb|KFK24385.1| hypothetical protein AALP_AAs72209U000200 [Arabis alpina]
Length=81

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = -2

Query  968  DAEAWEMLSKCFREVQTALDQNRALIQQVNENQQSKLPDNLAMNPALIREINGNISRVVG  789
            D E W+ LS   +  Q  LDQNR LIQ+VN+N +S++PDN+A N  L   INGNISRV+ 
Sbjct  21   DVEVWDKLSNGIKRAQVVLDQNRDLIQRVNDNHRSRIPDNIARNVGL---INGNISRVIE  77

Query  788  LYS  780
            +YS
Sbjct  78   IYS  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3338119460130