BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6521_g2_i1 len=851 path=[2589:0-850]

Length=851
                                                                      Score     E

gb|AAB69758.1|  putative pectate lyase Nt59                             342   4e-114   Nicotiana tabacum [American tobacco]
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    344   2e-112   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              343   4e-112   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              342   6e-112   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    342   1e-111   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              337   6e-110   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         333   4e-108   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         323   1e-104   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    322   5e-104   Solanum lycopersicum
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              320   3e-103   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              307   4e-98    
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         304   5e-97    
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      303   1e-96    
ref|XP_002282500.3|  PREDICTED: pectate lyase                           301   7e-96    Vitis vinifera
emb|CAN79927.1|  hypothetical protein VITISV_042447                     301   9e-96    Vitis vinifera
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              301   1e-95    
emb|CBI22159.3|  unnamed protein product                                301   1e-95    
ref|XP_010242445.1|  PREDICTED: pectate lyase                           300   2e-95    
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              300   2e-95    
ref|XP_010066949.1|  PREDICTED: pectate lyase                           299   4e-95    
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              297   4e-94    
ref|XP_010112093.1|  putative pectate lyase 7                           296   4e-94    
ref|XP_007046218.1|  Pectate lyase family protein, putative             296   5e-94    
ref|XP_002520133.1|  Pectate lyase precursor, putative                  295   1e-93    Ricinus communis
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      293   8e-93    
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     293   9e-93    
gb|KHN08855.1|  Putative pectate lyase P59                              291   4e-92    
gb|EPS66620.1|  hypothetical protein M569_08154                         288   2e-90    
emb|CDP02198.1|  unnamed protein product                                288   3e-90    
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              286   4e-90    
ref|XP_002311599.2|  pectate lyase family protein                       286   6e-90    Populus trichocarpa [western balsam poplar]
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    285   7e-90    
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      285   8e-90    
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      285   1e-89    
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      285   2e-89    
ref|XP_007037229.1|  Pectate lyase family protein                       284   3e-89    
emb|CDP14850.1|  unnamed protein product                                282   2e-88    
emb|CAN69905.1|  hypothetical protein VITISV_001007                     279   3e-88    Vitis vinifera
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              281   4e-88    
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      280   1e-87    
ref|XP_002270089.1|  PREDICTED: pectate lyase                           279   2e-87    Vitis vinifera
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      279   4e-87    
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          278   5e-87    
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             278   6e-87    
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                277   1e-86    
ref|XP_010096345.1|  putative pectate lyase 7                           275   2e-86    
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               274   3e-85    
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      274   3e-85    
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       273   7e-85    
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      272   9e-85    
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      271   1e-84    
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             272   2e-84    
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      271   2e-84    
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                272   2e-84    
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     272   2e-84    
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              270   2e-84    
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           271   2e-84    
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      270   6e-84    
emb|CDY45254.1|  BnaA06g09240D                                          270   2e-83    
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                270   2e-83    
emb|CAN69904.1|  hypothetical protein VITISV_001006                     269   2e-83    Vitis vinifera
ref|XP_002270112.1|  PREDICTED: pectate lyase                           269   2e-83    Vitis vinifera
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                269   2e-83    
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      268   3e-83    
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                269   3e-83    
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             268   4e-83    
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   268   5e-83    
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                268   5e-83    
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                267   1e-82    
ref|XP_003609009.1|  Pectate lyase                                      267   1e-82    
emb|CDY39314.1|  BnaC05g10650D                                          267   1e-82    
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              267   2e-82    
gb|AES91206.2|  pectate lyase P59-like protein                          266   2e-82    
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         266   2e-82    
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    266   3e-82    
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         266   3e-82    
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                266   3e-82    
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             265   4e-82    
gb|KHG08055.1|  putative pectate lyase P59                              265   1e-81    
ref|XP_007032453.1|  Pectate lyase family protein                       265   2e-81    
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             263   3e-81    
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             263   3e-81    Populus trichocarpa [western balsam poplar]
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             263   6e-81    
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    263   7e-81    
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      262   9e-81    
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      261   1e-80    
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                261   2e-80    
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             261   2e-80    
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      260   3e-80    
gb|AAB69759.1|  putative pectate lyase                                  261   3e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517472.1|  pectate lyase, putative                            260   4e-80    Ricinus communis
ref|NP_172894.1|  putative pectate lyase 3                              261   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      261   4e-80    
gb|KHG07401.1|  putative pectate lyase P59                              259   9e-80    
emb|CDX96854.1|  BnaA08g23970D                                          260   1e-79    
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                259   2e-79    
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              258   3e-79    
ref|XP_008230729.1|  PREDICTED: pectate lyase                           258   4e-79    
emb|CDX81636.1|  BnaC08g39650D                                          259   4e-79    
emb|CDY68729.1|  BnaCnng60280D                                          258   4e-79    
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      258   4e-79    
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      258   5e-79    
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      258   5e-79    
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       256   6e-79    
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    258   6e-79    
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      257   7e-79    Vitis vinifera
emb|CDY09356.1|  BnaA02g26540D                                          258   7e-79    
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                258   8e-79    
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         257   1e-78    
ref|NP_197015.4|  putative pectate lyase 19                             258   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         256   1e-78    
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      256   1e-78    
gb|ABK28696.1|  unknown                                                 258   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010105747.1|  putative pectate lyase P59                         256   1e-78    
ref|XP_004228388.1|  PREDICTED: pectate lyase                           256   1e-78    
emb|CDY17432.1|  BnaC09g21050D                                          257   2e-78    
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                256   2e-78    
emb|CDY53552.1|  BnaA09g57110D                                          258   2e-78    
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             256   2e-78    
ref|NP_178375.1|  putative pectate lyase 6                              256   2e-78    Arabidopsis thaliana [mouse-ear cress]
emb|CDY04133.1|  BnaA09g19110D                                          256   2e-78    
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                256   3e-78    
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    256   3e-78    
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      255   4e-78    
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      254   8e-78    
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                254   1e-77    
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           254   2e-77    
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              254   2e-77    
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      254   2e-77    
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             253   3e-77    
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          253   3e-77    Sorghum bicolor [broomcorn]
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      251   3e-77    
ref|XP_002875142.1|  pectate lyase family protein                       253   3e-77    
gb|KHN13652.1|  Pectate lyase                                           253   3e-77    
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                253   4e-77    
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      253   4e-77    
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             253   6e-77    Populus trichocarpa [western balsam poplar]
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      252   6e-77    
emb|CDY41679.1|  BnaC02g34750D                                          253   6e-77    
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         253   8e-77    
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          251   2e-76    
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   250   4e-76    
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             250   6e-76    Elaeis guineensis
gb|KHG16093.1|  hypothetical protein F383_07683                         250   7e-76    
ref|XP_010925369.1|  PREDICTED: pectate lyase                           249   1e-75    
gb|KHG23093.1|  hypothetical protein F383_29772                         247   2e-75    
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                248   4e-75    
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                248   4e-75    
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    248   4e-75    
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      247   7e-75    
emb|CDX85564.1|  BnaA02g02490D                                          248   7e-75    
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                248   8e-75    
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      246   1e-74    
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             246   1e-74    
ref|XP_010322971.1|  PREDICTED: probable pectate lyase P59              242   1e-74    
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              247   1e-74    
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      246   2e-74    
dbj|BAK06965.1|  predicted protein                                      246   2e-74    
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                246   2e-74    
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      244   2e-74    
ref|XP_003543726.1|  PREDICTED: pectate lyase                           245   4e-74    
gb|KHG05193.1|  hypothetical protein F383_30875                         243   4e-74    
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         244   4e-74    
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          246   6e-74    
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          244   7e-74    Sorghum bicolor [broomcorn]
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             244   7e-74    
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      244   9e-74    
gb|ACU23277.1|  unknown                                                 243   1e-73    Glycine max [soybeans]
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      243   2e-73    
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      242   6e-73    
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             241   6e-73    
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      242   6e-73    
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          241   7e-73    
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    243   7e-73    
emb|CDX91953.1|  BnaC03g32550D                                          243   8e-73    
emb|CDP00293.1|  unnamed protein product                                241   8e-73    
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      241   9e-73    
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    242   9e-73    
ref|XP_002871648.1|  pectate lyase family protein                       242   1e-72    
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3                239   1e-72    
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             241   1e-72    
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               242   1e-72    
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                241   2e-72    
emb|CDX74293.1|  BnaA03g27540D                                          241   2e-72    
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           241   2e-72    
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             240   2e-72    
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          240   2e-72    
ref|XP_002511525.1|  Pectate lyase precursor, putative                  240   3e-72    Ricinus communis
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      239   4e-72    
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      240   5e-72    
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               241   6e-72    
ref|NP_186776.1|  putative pectate lyase 7                              240   6e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    237   7e-72    
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      239   1e-71    
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                238   2e-71    
gb|AAM60924.1|  putative pectate lyase                                  239   2e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KEH24975.1|  pectate lyase P59-like protein                          238   2e-71    
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           238   3e-71    
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    238   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003613596.1|  Pectate lyase                                      237   5e-71    
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      238   5e-71    
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     243   7e-71    
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           237   7e-71    
ref|XP_008679844.1|  PREDICTED: pectate lyase                           236   1e-70    
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              236   1e-70    
gb|KHN08706.1|  Putative pectate lyase 3                                235   2e-70    
gb|KEH19822.1|  pectate lyase-like protein                              235   3e-70    
ref|NP_001046281.1|  Os02g0214400                                       234   4e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               236   6e-70    
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      234   7e-70    
gb|KHN13240.1|  Putative pectate lyase 3                                234   8e-70    
gb|ACF87417.1|  unknown                                                 234   8e-70    Zea mays [maize]
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    235   1e-69    
ref|NP_001057945.1|  Os06g0583900                                       233   1e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                233   2e-69    
gb|AFW87059.1|  pectate lyase                                           233   2e-69    
ref|NP_001150723.1|  pectate lyase precursor                            232   3e-69    Zea mays [maize]
gb|ACN96319.1|  hypothetical protein                                    227   4e-69    Zea mays subsp. mays [corn]
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             232   5e-69    
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           232   5e-69    
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      232   5e-69    
gb|ACN96320.1|  hypothetical protein                                    226   7e-69    Zea mays subsp. mays [corn]
gb|EPS73633.1|  hypothetical protein M569_01123                         231   1e-68    
gb|EAY85003.1|  hypothetical protein OsI_06363                          230   2e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             230   2e-68    
gb|ACN96380.1|  hypothetical protein                                    224   2e-68    Tripsacum sp. JRI-2009
gb|KHN01171.1|  Putative pectate lyase 3                                229   4e-68    
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      229   4e-68    
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             229   5e-68    
gb|ACN96322.1|  hypothetical protein                                    224   5e-68    Zea mays subsp. mays [corn]
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             229   5e-68    
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             229   5e-68    Elaeis guineensis
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    229   7e-68    
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    230   8e-68    
emb|CDX70590.1|  BnaC03g06740D                                          229   9e-68    
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               229   9e-68    
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              228   9e-68    
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         228   1e-67    
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          228   1e-67    
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     226   2e-67    
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          228   2e-67    Sorghum bicolor [broomcorn]
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         228   2e-67    
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          228   2e-67    Sorghum bicolor [broomcorn]
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          228   2e-67    
ref|XP_002297822.1|  pectate lyase family protein                       228   2e-67    Populus trichocarpa [western balsam poplar]
ref|XP_011087066.1|  PREDICTED: pectate lyase                           227   2e-67    
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               228   2e-67    
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     228   2e-67    
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     227   3e-67    
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               228   3e-67    
gb|ACN96379.1|  hypothetical protein                                    221   3e-67    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010481247.1|  PREDICTED: uncharacterized protein LOC104760096    226   3e-67    
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      227   4e-67    
gb|ACN96341.1|  hypothetical protein                                    221   4e-67    Zea luxurians [Florida teosinte]
dbj|BAI94495.1|  pectate lyase                                          226   4e-67    
gb|ACN96360.1|  hypothetical protein                                    221   4e-67    Zea mays subsp. mexicana [annual teosinte]
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      228   5e-67    
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                226   5e-67    
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                227   5e-67    
emb|CDY45202.1|  BnaA06g34060D                                          227   5e-67    
gb|ACN96359.1|  hypothetical protein                                    221   5e-67    Zea mays subsp. mexicana [annual teosinte]
gb|ACN96356.1|  hypothetical protein                                    221   5e-67    Zea mays subsp. mexicana [annual teosinte]
gb|ACN96354.1|  hypothetical protein                                    221   6e-67    Zea mays subsp. mexicana [annual teosinte]
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          225   6e-67    
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    226   6e-67    Lilium longiflorum [Easter lily]
ref|XP_002518146.1|  Pectate lyase precursor, putative                  224   7e-67    Ricinus communis
gb|ACN96372.1|  hypothetical protein                                    221   7e-67    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACN96358.1|  hypothetical protein                                    221   7e-67    Zea mays subsp. mexicana [annual teosinte]
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                226   7e-67    
gb|ACN96364.1|  hypothetical protein                                    220   8e-67    Zea mays subsp. mexicana [annual teosinte]
gb|ACN96355.1|  hypothetical protein                                    220   9e-67    Zea mays subsp. mexicana [annual teosinte]
gb|ACN96353.1|  hypothetical protein                                    220   1e-66    Zea mays subsp. mexicana [annual teosinte]
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           226   1e-66    
gb|ACN96362.1|  hypothetical protein                                    220   1e-66    Zea mays subsp. mexicana [annual teosinte]
gb|AAL06861.1|  At1g04680/T1G11_6                                       223   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002304700.1|  pectate lyase family protein                       225   2e-66    Populus trichocarpa [western balsam poplar]
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         225   3e-66    
ref|XP_007037817.1|  Pectate lyase family protein isoform 3             220   3e-66    
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              224   3e-66    
gb|ACN96346.1|  hypothetical protein                                    219   3e-66    
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      224   4e-66    
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             224   4e-66    
emb|CDY03043.1|  BnaC07g21840D                                          224   4e-66    
ref|XP_004233352.1|  PREDICTED: pectate lyase-like                      223   4e-66    
dbj|BAD68402.1|  putative pectate lyase homolog                         224   4e-66    
emb|CDX89799.1|  BnaA10g02830D                                          224   5e-66    
gb|ACN96342.1|  hypothetical protein                                    218   5e-66    
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                223   5e-66    
emb|CAN77957.1|  hypothetical protein VITISV_021245                     223   5e-66    
gb|EAY99626.1|  hypothetical protein OsI_21605                          224   5e-66    
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                224   5e-66    
ref|NP_001056781.1|  Os06g0144200                                       224   6e-66    
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           225   6e-66    
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      223   7e-66    
ref|XP_010106682.1|  hypothetical protein L484_004616                   222   8e-66    
emb|CDY03419.1|  BnaC01g16630D                                          222   9e-66    
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              223   1e-65    
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          222   1e-65    
ref|NP_563715.1|  putative pectate lyase 1                              223   1e-65    
gb|AAA16476.1|  pectate lyase homolog                                   223   1e-65    
ref|XP_009119265.1|  PREDICTED: probable pectate lyase 1                222   1e-65    
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               221   2e-65    
ref|XP_010100325.1|  hypothetical protein L484_027633                   221   2e-65    
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               223   2e-65    
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    223   2e-65    
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          221   2e-65    
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                221   2e-65    
dbj|BAF43573.1|  pectate lyase                                          222   2e-65    
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                222   3e-65    
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                222   3e-65    
gb|KEH41255.1|  pectate lyase family protein                            222   3e-65    
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                221   3e-65    
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    223   3e-65    
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             222   3e-65    
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               221   4e-65    
gb|AFZ78654.1|  pectate lyase                                           222   4e-65    
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                222   4e-65    
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                221   4e-65    
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             221   5e-65    
emb|CDY63769.1|  BnaCnng42620D                                          222   5e-65    
emb|CDY61137.1|  BnaC05g48970D                                          221   5e-65    
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                221   5e-65    
ref|XP_002892236.1|  pectate lyase family protein                       221   5e-65    
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    220   6e-65    
ref|NP_001280201.1|  probable pectate lyase 18 precursor                220   6e-65    
gb|KDO55843.1|  hypothetical protein CISIN_1g010437mg                   219   7e-65    
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          220   7e-65    
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             221   7e-65    
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                220   7e-65    
gb|EPS68938.1|  hypothetical protein M569_05827                         219   7e-65    
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    220   8e-65    
gb|KHN34377.1|  Putative pectate lyase 22                               219   8e-65    
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                221   8e-65    
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     221   9e-65    
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     219   9e-65    
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     220   9e-65    
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               219   1e-64    
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                219   1e-64    
dbj|BAH20311.1|  AT3G01270                                              218   1e-64    
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                219   1e-64    
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          219   1e-64    
gb|ACB12931.1|  pectate lyase 1-27                                      221   1e-64    
emb|CDY11033.1|  BnaA03g46920D                                          219   1e-64    
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               221   1e-64    
gb|AFK44189.1|  unknown                                                 219   1e-64    
ref|NP_001289258.1|  probable pectate lyase 18 precursor                219   1e-64    
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                220   1e-64    
gb|AAK66161.1|  pectate lyase                                           218   1e-64    
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                219   1e-64    
ref|XP_003608909.1|  Pectate lyase                                      219   1e-64    
gb|EAY99621.1|  hypothetical protein OsI_21600                          220   1e-64    
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    221   1e-64    
emb|CDX92652.1|  BnaC07g39100D                                          219   1e-64    
ref|XP_002866540.1|  pectate lyase                                      219   1e-64    
ref|NP_001056784.1|  Os06g0144900                                       220   1e-64    
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                220   1e-64    
gb|KHG06252.1|  hypothetical protein F383_10745                         219   2e-64    
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               219   2e-64    
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             221   2e-64    
emb|CDX86615.1|  BnaC08g00880D                                          219   2e-64    
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         219   2e-64    
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    220   2e-64    
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                219   2e-64    
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      219   2e-64    
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          220   2e-64    
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               219   2e-64    
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               219   2e-64    
emb|CDY01119.1|  BnaA04g07000D                                          219   2e-64    
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               220   2e-64    
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    219   2e-64    
gb|KHG30349.1|  hypothetical protein F383_15991                         221   2e-64    
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               218   2e-64    
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               218   3e-64    
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           218   3e-64    
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                218   3e-64    
gb|AEN70965.1|  pectate lyase                                           218   3e-64    
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                219   3e-64    
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                218   3e-64    
gb|AFW76465.1|  hypothetical protein ZEAMMB73_776134                    219   3e-64    
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               221   3e-64    
ref|NP_001147553.1|  pectate lyase 8                                    220   4e-64    
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                218   4e-64    
gb|KHN13490.1|  Putative pectate lyase 3                                217   4e-64    
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             220   4e-64    
gb|KHG22990.1|  hypothetical protein F383_28754                         218   4e-64    
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              220   4e-64    
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               218   4e-64    
emb|CDY66593.1|  BnaCnng51570D                                          220   4e-64    
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               218   4e-64    
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           219   4e-64    
ref|NP_568967.1|  putative pectate lyase 22                             218   5e-64    
dbj|BAB10560.1|  pectate lyase                                          218   5e-64    
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                219   5e-64    
emb|CAN76500.1|  hypothetical protein VITISV_004734                     217   6e-64    
emb|CBI33346.3|  unnamed protein product                                218   6e-64    
ref|NP_001280839.1|  probable pectate lyase 18 precursor                218   6e-64    
gb|KDO69410.1|  hypothetical protein CISIN_1g015569mg                   214   6e-64    
gb|KHN45481.1|  Putative pectate lyase 3                                216   7e-64    
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                218   7e-64    
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                217   7e-64    
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                219   7e-64    
ref|XP_009118623.1|  PREDICTED: probable pectate lyase 1 isoform X2     218   7e-64    
emb|CDP13269.1|  unnamed protein product                                217   7e-64    
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             217   7e-64    
ref|XP_003621115.1|  Pectate lyase                                      218   7e-64    
ref|XP_009118622.1|  PREDICTED: probable pectate lyase 1 isoform X1     218   7e-64    
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     217   8e-64    
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     218   8e-64    
gb|ABO28477.1|  pectate lyase precursor                                 214   8e-64    
ref|XP_002870357.1|  pectate lyase family protein                       219   8e-64    
ref|XP_010102919.1|  hypothetical protein L484_018936                   217   8e-64    
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               218   8e-64    
gb|AGC94753.1|  putative pectate lyase                                  217   8e-64    
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                218   8e-64    
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                219   9e-64    
ref|XP_006420566.1|  hypothetical protein CICLE_v10004783mg             219   9e-64    
ref|XP_010522431.1|  PREDICTED: probable pectate lyase 1                217   9e-64    
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           217   1e-63    
gb|AEN70985.1|  pectate lyase                                           217   1e-63    
ref|XP_009757256.1|  PREDICTED: pectate lyase                           216   1e-63    
gb|KHG22755.1|  hypothetical protein F383_29653                         217   1e-63    
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     219   1e-63    
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    216   1e-63    
gb|AEN70981.1|  pectate lyase                                           217   1e-63    
gb|ADB90478.1|  pectate lyase                                           217   1e-63    
gb|AEN70968.1|  pectate lyase                                           217   1e-63    
emb|CDY01151.1|  BnaA04g06680D                                          218   1e-63    
gb|ADB90477.1|  pectate lyase                                           217   1e-63    
gb|AEN70964.1|  pectate lyase                                           217   1e-63    
gb|AEN70963.1|  pectate lyase                                           217   1e-63    
gb|KHG19997.1|  hypothetical protein F383_02891                         217   1e-63    
gb|ADB90479.1|  pectate lyase                                           217   1e-63    
gb|ADB90476.1|  pectate lyase                                           217   1e-63    
gb|ADB90475.1|  pectate lyase                                           217   1e-63    
gb|AEN70977.1|  pectate lyase                                           217   1e-63    
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    217   1e-63    
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                218   1e-63    
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                216   1e-63    
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               216   1e-63    
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             216   2e-63    
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                217   2e-63    
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                218   2e-63    
gb|AAY85180.1|  pectate lyase                                           216   2e-63    
emb|CDY41506.1|  BnaA06g22590D                                          216   2e-63    
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    217   2e-63    
emb|CAA63496.1|  pectate lyase                                          216   2e-63    
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                   214   2e-63    
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               216   2e-63    
gb|AAA86241.1|  pectate lyase homolog                                   217   2e-63    
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      217   2e-63    
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             218   2e-63    
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                216   3e-63    
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          217   3e-63    
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                217   3e-63    
gb|AEN70984.1|  pectate lyase                                           216   3e-63    
gb|EPS62426.1|  hypothetical protein M569_12361                         216   4e-63    
ref|XP_010536660.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    215   4e-63    
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                215   4e-63    
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             215   4e-63    
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     216   4e-63    
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                215   4e-63    
ref|XP_002882189.1|  pectate lyase family protein                       217   4e-63    
gb|ABR18471.1|  unknown                                                 218   4e-63    
emb|CDY65626.1|  BnaC03g74840D                                          216   4e-63    
emb|CDY53564.1|  BnaC04g55760D                                          216   5e-63    
emb|CDP02199.1|  unnamed protein product                                214   5e-63    
emb|CDY18738.1|  BnaC08g08780D                                          217   5e-63    
ref|XP_006495480.1|  PREDICTED: probable pectate lyase 19-like          208   5e-63    
emb|CDY48132.1|  BnaCnng15740D                                          216   5e-63    
emb|CDY28691.1|  BnaCnng05770D                                          216   6e-63    
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         215   6e-63    
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               215   6e-63    
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    216   6e-63    
ref|XP_006357121.1|  PREDICTED: pectate lyase-like                      214   6e-63    
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               215   7e-63    
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      216   7e-63    
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                216   7e-63    
gb|AAF19195.1|AF206319_1  pectate lyase 1                               214   7e-63    
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                215   7e-63    
emb|CDO99404.1|  unnamed protein product                                216   7e-63    
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    213   8e-63    
ref|XP_008456538.1|  PREDICTED: probable pectate lyase 12               217   9e-63    
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                214   9e-63    
ref|NP_567409.1|  probable pectate lyase 15                             216   9e-63    
ref|XP_003613595.1|  Pectate lyase                                      216   1e-62    
ref|NP_001190720.1|  probable pectate lyase 15                          216   1e-62    
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                215   1e-62    
dbj|BAK05605.1|  predicted protein                                      215   1e-62    
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               214   1e-62    
ref|XP_009137472.1|  PREDICTED: probable pectate lyase 18               214   1e-62    
gb|KDO69408.1|  hypothetical protein CISIN_1g015569mg                   214   1e-62    
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                214   1e-62    
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             214   1e-62    
ref|XP_002446075.1|  hypothetical protein SORBIDRAFT_06g001410          213   1e-62    
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               214   1e-62    
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               215   2e-62    
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     215   2e-62    
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   214   2e-62    
gb|KEH35002.1|  pectate lyase family protein                            210   2e-62    
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                214   2e-62    



>gb|AAB69758.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=274

 Score =   342 bits (877),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 195/240 (81%), Gaps = 5/240 (2%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F+ I+F T +   P LMAHIGDFD+VWRRR  EARE+A   YE +P NVT+AFN++V+  
Sbjct  12   FLFIIFATII---PCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRD-  67

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
              ++E   SN++TRR L +K YKGPC  TNPIDRCWRC  NW  NRKRLA C +GFG KA
Sbjct  68   -SMKEVTVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKA  126

Query  490  TGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            TGGK+G IY+VTD+SD+  +PKPGTLR+AVIQK+PLWIIF+R M IRLHQELIMQ DKTI
Sbjct  127  TGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKTI  186

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VHI+ GAGITLQ++KNVIIHG++IH+IV GSGG+VRDA DH G+RT+SDGDGIS
Sbjct  187  DARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGIS  246



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 195/240 (81%), Gaps = 6/240 (3%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F+ I+F T +   P LMAHIGDFD+VWRRR  EARE+A   YE +P NVT+AFN   QKV
Sbjct  12   FLFIIFATII---PCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFN---QKV  65

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
             +++E   SN++TRR L +K YKGPC  TNPIDRCWRC  NW  NRKRLA C +GFG KA
Sbjct  66   RDMKEVTVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKA  125

Query  490  TGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            TGGK+G IY+VTD+SD+  +PKPGTLR+AVIQK+PLWIIF+R M IRLHQELIMQ DKTI
Sbjct  126  TGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKTI  185

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VHI+ GAGITLQ++KNVIIHG++IH+IV GSGG+VRDA DH G+RT+SDGDGIS
Sbjct  186  DARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGIS  245



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   343 bits (879),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 191/240 (80%), Gaps = 2/240 (1%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
              +LFF   A+ P  +AHIG+FD+VWRRR  EAR+ AL TYES+P NVT+AFN++V+  +
Sbjct  10   FFVLFFIFTAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAM  69

Query  313  -EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
             E+ E I  N T RR L +K Y GPC  TNPID+CWRC  NW  NRK+LA C +GFG KA
Sbjct  70   KELSEVIPKNDT-RRELGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKA  128

Query  490  TGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            TGGK GR YVV DSSD+ TDPKPGTLRHAVIQK+PLWIIF R M IRLHQELIMQ DKTI
Sbjct  129  TGGKAGRFYVVNDSSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIMQSDKTI  188

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VHI+GGAGI +Q+ KNVIIHG++IH+IV+G+GG+VRDA DH GLRTMSDGDGIS
Sbjct  189  DARGANVHIAGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGIS  248



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   342 bits (878),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 193/246 (78%), Gaps = 2/246 (1%)
 Frame = +1

Query  115  NKMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR  294
            +K+     +LFF   A+ P  +AHIG+FD+VWRRR  EAR+ AL TYES+P NVT+AFN+
Sbjct  4    SKVTHSFFVLFFIFAAIIPSFLAHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNK  63

Query  295  EVQKVL-EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            +V+  + E+ E I  N T RR L +K Y GPC  TNPID+CWRC  NW  NRK+LA C +
Sbjct  64   QVRDAMKELSEVIPKNDT-RRELGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAM  122

Query  472  GFGRKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            GFG KATGGK GR YVV D SD+ TDPKPGTLRHAVIQK+PLWIIF R M IRLHQELIM
Sbjct  123  GFGSKATGGKAGRFYVVNDPSDDYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIM  182

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
            Q DKTID RGA VHISGGAGI +Q+ KNVIIHG++IH+IV+G+GG+VRDA DH GLRTMS
Sbjct  183  QSDKTIDARGANVHISGGAGIMIQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMS  242

Query  832  DGDGIS  849
            DGDGIS
Sbjct  243  DGDGIS  248



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 195/240 (81%), Gaps = 5/240 (2%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F+ I+F T +   P LMAHIGDFD+VWRRR  EARE+A   YE +P NVT+AFN++V+  
Sbjct  12   FLFIIFATII---PCLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDS  68

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            +  +E   SN++TRR L +K YKGPC  TNPIDRCWRC  NW  NRKRLA C +GFG KA
Sbjct  69   M--KEVTVSNNSTRRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKA  126

Query  490  TGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            TGGK+G IY+VTD+SD+  +PKPGTLR+AVIQK+PLWIIF+R M IRLHQELIMQ DKTI
Sbjct  127  TGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKTI  186

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VHI+ GAGITLQ++KNVIIHG++IH+IV GSGG+VRDA DH G+RT+SDGDGIS
Sbjct  187  DARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGIS  246



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   337 bits (865),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 194/245 (79%), Gaps = 2/245 (1%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+K     LF     +   LMAHIGDFD+VWRRR  EARE+A   YE +P NVT+AFN++
Sbjct  5    KLKYSFFFLFIIFATIIRNLMAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQK  64

Query  298  VQKVL-EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLG  474
            V+  + E+R+   SNST RR L +K YKGPC  TNPIDRCWRC  NW  NRKRLA C +G
Sbjct  65   VRDTMKELRQVTVSNST-RRGLGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMG  123

Query  475  FGRKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            FG KATGGK+G IY+VTD+SD+  +PKPGTLR+AVIQK+PLWIIF+R M IRLHQE+IMQ
Sbjct  124  FGYKATGGKDGEIYIVTDNSDDYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQEMIMQ  183

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
             DKTID RGA VHI+ GAGITLQ++KNVIIHG++IH+IV GSGG+VRDA DH G+RT+SD
Sbjct  184  SDKTIDARGANVHIAKGAGITLQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSD  243

Query  835  GDGIS  849
            GDGIS
Sbjct  244  GDGIS  248



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 189/244 (77%), Gaps = 0/244 (0%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            KM   + +LFF   A+ P   AHIGDFD+VWRRR  EA +  + TYES+P N+T+AFN++
Sbjct  6    KMTHSLFVLFFVFGAIIPAFNAHIGDFDEVWRRRAEEAMKFTIQTYESEPANITLAFNQK  65

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
             +  ++   A+ S + TRR L +K Y+GPC  TNPID+CWRC  NW  NRK+L  C +GF
Sbjct  66   TRDSVKELSAVVSKNETRRELGTKKYEGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGF  125

Query  478  GRKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQG  657
            G K TGG++G+ YVV+DSSD+ T PKPGTLRHAVIQK+PLWIIF R+M I+LHQELIMQG
Sbjct  126  GYKTTGGRDGKYYVVSDSSDDYTTPKPGTLRHAVIQKEPLWIIFDRNMKIKLHQELIMQG  185

Query  658  DKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDG  837
            DKTIDGRGA VHI+GGA I +Q+ KNVIIHG++IH+IV G+GG+VRDA DH G RT SDG
Sbjct  186  DKTIDGRGATVHITGGASIMIQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHIGFRTKSDG  245

Query  838  DGIS  849
            DGIS
Sbjct  246  DGIS  249



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 187/244 (77%), Gaps = 0/244 (0%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+K   + L  T   + P LMAHIG +D+VWRRR  EA+E+A   YE  P NVT+AFN++
Sbjct  5    KIKYTFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARQIYERHPENVTLAFNQK  64

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            ++  ++  + +   ++TRR L +K Y GPC  TNPIDRCWRC  NW  NRKRLA C +GF
Sbjct  65   LRNTMKELKEVKGTNSTRRGLGTKKYCGPCIVTNPIDRCWRCDPNWADNRKRLADCAMGF  124

Query  478  GRKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQG  657
            G K TGGKNG  YVVTD+SD+  DPKPGTLR+AVIQK+PLWIIFKR M IRLHQE+IMQ 
Sbjct  125  GSKVTGGKNGEFYVVTDNSDDYNDPKPGTLRYAVIQKEPLWIIFKRGMNIRLHQEMIMQS  184

Query  658  DKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDG  837
            DKTID RG  VHI+ GAGITLQ++KNVIIHG++IH+IV G+GG+VRDA DH G+RT SDG
Sbjct  185  DKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDG  244

Query  838  DGIS  849
            DGIS
Sbjct  245  DGIS  248



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 191/246 (78%), Gaps = 2/246 (1%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+K   + L  T   + P LMAHIG +D+VWRRR  EA+E+A N YE  P NVT+AFN++
Sbjct  5    KIKYSFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARNIYEPHPENVTLAFNQK  64

Query  298  VQKVL-EIREAIAS-NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            ++  + E+++   + N++TRR L +K Y GPC  TNPID+CWRC  NW  NRK+LA C +
Sbjct  65   LRDTMKELKKVKGTHNNSTRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAM  124

Query  472  GFGRKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            GFG KA GGK+G  YVVTD+SD+  DPKPGTLRHAVIQK+PLWIIFKR M IRLHQE+IM
Sbjct  125  GFGSKAIGGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRLHQEMIM  184

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
            Q DKTID RG  VHI+ GAGITLQ++KNVIIHG++IH+IV G+GG+VRDA DH G+RT S
Sbjct  185  QSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKS  244

Query  832  DGDGIS  849
            DGDGIS
Sbjct  245  DGDGIS  250



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 190/246 (77%), Gaps = 2/246 (1%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+K   + L  T   + P LMAHIG +D+VWRRR  EA+E+A   YE  P NVT+AFN++
Sbjct  5    KIKYSFLFLCITFATIIPSLMAHIGHYDEVWRRRAEEAKEYARKIYEPHPENVTLAFNQK  64

Query  298  VQKVL-EIREAIAS-NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            ++  + E+++   + N++TRR L +K Y GPC  TNPID+CWRC  NW  NRK+LA C +
Sbjct  65   LRDTMKELKKVKGTHNNSTRRGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAM  124

Query  472  GFGRKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            GFG KA GGK+G  YVVTD+SD+  DPKPGTLRHAVIQK+PLWIIFKR M IRLHQE+IM
Sbjct  125  GFGSKAIGGKDGEFYVVTDNSDDYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRLHQEMIM  184

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
            Q DKTID RG  VHI+ GAGITLQ++KNVIIHG++IH+IV G+GG+VRDA DH G+RT S
Sbjct  185  QSDKTIDARGVNVHITKGAGITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKS  244

Query  832  DGDGIS  849
            DGDGIS
Sbjct  245  DGDGIS  250



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 175/229 (76%), Gaps = 3/229 (1%)
 Frame = +1

Query  172  VLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL-EIREAIASNSTT  348
            V+  HIG+FD+VWRRR  EA E A+  Y+ DP NVT+AF +E  + L EI+EA  + + T
Sbjct  19   VINGHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIKEAKLAVNGT  78

Query  349  RRLLRS--KHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVV  522
            RR L+   K Y GPC+ TNPIDRCWRC  +W  NRKRLA C +GF +  TGGK G IYVV
Sbjct  79   RRELKGGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLADCAMGFAKGTTGGKAGEIYVV  138

Query  523  TDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISG  702
            TDSSD+ +DPKPGTLR+ VIQK+PLWIIF + M IRLHQELI+Q DKTIDGRG  VHI+ 
Sbjct  139  TDSSDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIAN  198

Query  703  GAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GAG  LQ+VKNVIIHG+ IH+IV GSGG++RDA DH G RT SDGDGIS
Sbjct  199  GAGFMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGIS  247



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 172/226 (76%), Gaps = 3/226 (1%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL-EIREAIASNSTTRRL  357
             HIG+FD+VWRRR  EA E A+  Y+ DP NVT+AF ++  + L EI+EA  + + TRR 
Sbjct  22   GHIGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIKEAKLAINGTRRE  81

Query  358  LRS--KHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS  531
            L+   K Y GPC  TNPIDRCWRC  NW  NRKRLA C +GF +  TGGK G IYVVTDS
Sbjct  82   LKGGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLADCAMGFAKGTTGGKAGEIYVVTDS  141

Query  532  SDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAG  711
            SD+ +DPKPGTLR+ VIQK+PLWIIF + M IRLHQELI+Q DKTIDGRG  VHI+ GAG
Sbjct  142  SDDTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIANGAG  201

Query  712  ITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
              LQ+VKNVIIHG+ IH+IV GSGG++RDA DH G RT SDGDGIS
Sbjct  202  FMLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGIS  247



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 181/240 (75%), Gaps = 7/240 (3%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            + +L F    + P L AHI +FD+VW++R  EA+++A++ Y  +P  V    N      +
Sbjct  10   LFLLAFNLAVITPTLRAHIAEFDEVWQKRAEEAKKNAMDAYHPNPDEVINHLN------M  63

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
             +  A+  ++ TRR L++K Y GPC ATNPIDRCWRC  NW  NRK+LA C +GFGRK  
Sbjct  64   NVHLAMQESNGTRRSLKTKPYGGPCLATNPIDRCWRCQKNWSRNRKKLADCVVGFGRKTI  123

Query  493  GGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGK G+ YVVTD SDN   +PKPGTLRHAVIQK+PLWIIF RDM+IRL+QEL+M GDKTI
Sbjct  124  GGKLGKFYVVTDGSDNDMLNPKPGTLRHAVIQKEPLWIIFARDMVIRLNQELLMAGDKTI  183

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VH++ GAGIT+QFVKNVIIHG+++H+IV GSGGL+RD+ DH+GLRT SDGDGIS
Sbjct  184  DARGANVHVAYGAGITIQFVKNVIIHGLHVHDIVPGSGGLIRDSVDHYGLRTQSDGDGIS  243



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   301 bits (771),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 179/230 (78%), Gaps = 9/230 (4%)
 Frame = +1

Query  163  MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNS  342
            +AP + AHIG+FD+VW++R  EA++ AL  Y+ +P  VT  FN+ V+K ++        +
Sbjct  24   LAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQ------GTN  77

Query  343  TTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVV  522
            TTRR LRS +  GPC ATNPIDRCWRC  +W  NRK+LA C LGFGR+ TGGK+G  YVV
Sbjct  78   TTRRNLRSNN--GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEFYVV  135

Query  523  TDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHIS  699
            TD+SDN   DPKPGTLRHAVIQK+PLWIIF RDMIIRL QELIM G+KTIDGRGA VHI+
Sbjct  136  TDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHIA  195

Query  700  GGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             G GIT+QFVKN+IIH ++IH+IV   GG++RD+ DH+GLRT SDGDG+S
Sbjct  196  YGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVS  245



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   301 bits (770),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 179/230 (78%), Gaps = 9/230 (4%)
 Frame = +1

Query  163  MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNS  342
            +AP + AHIG+FD+VW++R  EA++ AL  Y+ +P  VT  FN+ V+K ++        +
Sbjct  20   LAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQ------GTN  73

Query  343  TTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVV  522
            TTRR LRS +  GPC ATNPIDRCWRC  +W  NRK+LA C LGFGR+ TGGK+G  YVV
Sbjct  74   TTRRNLRSNN--GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEFYVV  131

Query  523  TDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHIS  699
            TD+SDN   DPKPGTLRHAVIQK+PLWIIF RDMIIRL QELIM G+KTIDGRGA VHI+
Sbjct  132  TDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHIA  191

Query  700  GGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             G GIT+QFVKN+IIH ++IH+IV   GG++RD+ DH+GLRT SDGDG+S
Sbjct  192  YGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVS  241



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 177/241 (73%), Gaps = 3/241 (1%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            ++ LF     +   + AHI +FD+VW+RR  EA    L +YE  P  +    N  V + L
Sbjct  10   VLFLFAFASTLPGAVRAHIAEFDEVWQRRAEEAWNRTLESYEPAPAKIVSHLNLNVHRAL  69

Query  313  -EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
             E++E   S ++TRR L S  Y GPC  TNPIDRCWRC +NW  NR RLA C LGFG KA
Sbjct  70   KEVKEEELSLNSTRRQL-SHGYDGPCRVTNPIDRCWRCQANWAQNRFRLADCVLGFGYKA  128

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
             GGKNG+IYVVTD SDN   +PKPGTLRHAVIQK+PLWIIF+RDM+IRL QELI+Q DKT
Sbjct  129  KGGKNGKIYVVTDPSDNDMVNPKPGTLRHAVIQKEPLWIIFQRDMLIRLSQELIVQSDKT  188

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRGARV I+ GAGITLQFVKNVIIHGI I+NI  G GG++RDA DH+GLRT SDGDGI
Sbjct  189  IDGRGARVLIANGAGITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHYGLRTRSDGDGI  248

Query  847  S  849
            S
Sbjct  249  S  249



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 179/230 (78%), Gaps = 9/230 (4%)
 Frame = +1

Query  163  MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNS  342
            +AP + AHIG+FD+VW++R  EA++ AL  Y+ +P  VT  FN+ V+K ++        +
Sbjct  49   LAPSIRAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKSMQ------GTN  102

Query  343  TTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVV  522
            TTRR LRS +  GPC ATNPIDRCWRC  +W  NRK+LA C LGFGR+ TGGK+G  YVV
Sbjct  103  TTRRNLRSNN--GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEFYVV  160

Query  523  TDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHIS  699
            TD+SDN   DPKPGTLRHAVIQK+PLWIIF RDMIIRL QELIM G+KTIDGRGA VHI+
Sbjct  161  TDASDNDMIDPKPGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHIA  220

Query  700  GGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             G GIT+QFVKN+IIH ++IH+IV   GG++RD+ DH+GLRT SDGDG+S
Sbjct  221  YGCGITIQFVKNIIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVS  270



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 172/232 (74%), Gaps = 3/232 (1%)
 Frame = +1

Query  157  VAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIAS  336
             A+ P L AHIGDFD+VW++R  EA+ +AL  Y  DP  V   FN  V   L   E  + 
Sbjct  20   AAIIPTLRAHIGDFDEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVH--LATAEVRSG  77

Query  337  NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            NS+TRR LR+K YKGPC ATNPIDRCWRC S W  NRK+LA C LGFGRK  GGK G+ Y
Sbjct  78   NSSTRRSLRNKEYKGPCMATNPIDRCWRCRSKWGKNRKKLADCVLGFGRKTVGGKYGKFY  137

Query  517  VVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            VVTD SD+  + PKPGTLRHAVIQ +PLWIIF+ DMIIRL QELIM  DKT+DGRGARVH
Sbjct  138  VVTDGSDDDMENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMTSDKTLDGRGARVH  197

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I+ GAGIT+QF+KNVIIH ++ H+IV   GG++RD+ +H G RT SDGD IS
Sbjct  198  IAYGAGITIQFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGDAIS  249



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 190/249 (76%), Gaps = 6/249 (2%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+    + LF T +A+ P L  HIGDFD+VWRRR  EA E AL  YE DP NVT+AF ++
Sbjct  5    KLINLSLFLFSTFLAIIPSLNGHIGDFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQ  64

Query  298  VQKVL-EIREA--IASNSTTRRLLRS--KHYKGPCNATNPIDRCWRCHSNWESNRKRLAA  462
             ++ + E++E   +A+N T RR LR   K+Y GPC  TNPIDRCWRC  NW  NRKRLA 
Sbjct  65   TKESMKELKEVKKLATNDT-RRELRGFHKNYAGPCLVTNPIDRCWRCQGNWADNRKRLAD  123

Query  463  CGLGFGRKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
            C LGFG+  TGGK GR YVVTDSSD+ ++PKPGTLRHAVIQK+PLWIIF + M IRLHQE
Sbjct  124  CALGFGKGTTGGKAGRFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMNIRLHQE  183

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            LIMQ DKTIDGRG  VHI+ GAGITLQ+VKNVIIHG++IH+IV G+GG+V  A DH G+R
Sbjct  184  LIMQSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIR  243

Query  823  TMSDGDGIS  849
            T SDGDGIS
Sbjct  244  TQSDGDGIS  252



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   299 bits (765),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/240 (64%), Positives = 178/240 (74%), Gaps = 10/240 (4%)
 Frame = +1

Query  136  IILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
              LFF+  A + P L A+I +FD+ W +R  EA++ AL  Y+  P  VT  FN +V K  
Sbjct  7    FFLFFSSFAVLVPSLQANIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNAKVDK--  64

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
                A+  N++TRR L  K YKGPC ATNPIDRCWRC+ NW  NRKRLA C LGFGRK  
Sbjct  65   ----AVRGNNSTRRQL--KKYKGPCLATNPIDRCWRCNRNWARNRKRLANCVLGFGRKTR  118

Query  493  GGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGK G  YVVTDSSDN   +PKPGTLRHAV+QK PLWIIF   M+IRL+QELIM  DKTI
Sbjct  119  GGKRGWFYVVTDSSDNDMVNPKPGTLRHAVVQKGPLWIIFAGSMVIRLNQELIMTSDKTI  178

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VHI+ GAGITLQF++NVIIHG++IH+IVRGSGGL+RDA DH GLRT SDGDGIS
Sbjct  179  DARGANVHIAYGAGITLQFIRNVIIHGLHIHDIVRGSGGLIRDAHDHVGLRTASDGDGIS  238



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 187/248 (75%), Gaps = 4/248 (2%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+    + LF T +A+ P L  HIG+FD+VWRRR  EA E AL  YE DP NVT+AF ++
Sbjct  5    KLINLSLFLFSTFLAIIPSLNGHIGNFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQ  64

Query  298  VQKVL-EIREA-IASNSTTRRLLRSKH--YKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
             ++ + E++E    S + TRR LR  H  Y GPC  TNPIDRCWRC  NW  NRKRLA C
Sbjct  65   TRESMKELKEVNKLSTNETRRELRGFHKIYAGPCLVTNPIDRCWRCQGNWADNRKRLADC  124

Query  466  GLGFGRKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQEL  645
             +GFG+  TGGK G+ YVVTDSSD+ ++PKPGTLRHAVIQK+PLWIIF + M IRLHQEL
Sbjct  125  AMGFGKGTTGGKAGQFYVVTDSSDDSSNPKPGTLRHAVIQKEPLWIIFAKSMTIRLHQEL  184

Query  646  IMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            IMQ DKTIDGRG  VHI+ GAGITLQ+VKNVIIHG++IH+IV G+GG+V  A DH G+RT
Sbjct  185  IMQSDKTIDGRGVNVHIAYGAGITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRT  244

Query  826  MSDGDGIS  849
             SDGDGIS
Sbjct  245  QSDGDGIS  252



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 176/239 (74%), Gaps = 9/239 (4%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            ++     V + P L A+IGDFD+ W++R  EA + AL  Y+ +P  VT +FN EV KV++
Sbjct  9    LVFLIGFVVLIPSLQANIGDFDESWQQRAEEAHKAALEAYDPNPEEVTDSFNEEVDKVID  68

Query  316  IREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                  SNST R L R   Y GPC ATNPIDRCWRC SNW SNRKRLA C LGFGRK TG
Sbjct  69   -----GSNSTRRELRR---YSGPCAATNPIDRCWRCRSNWASNRKRLARCVLGFGRKTTG  120

Query  496  GKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            G++GR YVVTD SDN   +P+PGTLRHAVIQK+PLWIIF   MIIRL QEL++   KTID
Sbjct  121  GRSGRYYVVTDPSDNDVQNPRPGTLRHAVIQKQPLWIIFAHSMIIRLSQELLITSHKTID  180

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             RGA +HI+ GAGIT+QF +NVIIHG++IH+IV   GG++RD+ DHFG RT +DGDGIS
Sbjct  181  ARGANIHIANGAGITIQFARNVIIHGLHIHDIVASGGGMIRDSVDHFGFRTPADGDGIS  239



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 171/232 (74%), Gaps = 7/232 (3%)
 Frame = +1

Query  157  VAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIAS  336
            V + P L AHI ++DD WR+R  EA+EH    Y  +P  VT  FN  V + L     +  
Sbjct  18   VVIIPTLHAHIAEYDDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTL-----MGF  72

Query  337  NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            NST RR LR K   GPC ATNPID+CWRC  NW  NRKRLA C LGFGR   GGKNGR Y
Sbjct  73   NST-RRSLRGKRRTGPCQATNPIDQCWRCDPNWHRNRKRLADCSLGFGRGTIGGKNGRYY  131

Query  517  VVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            +VTD SDN   +PKPGTLRHAVIQK+PLWIIF R MII+L+QELIM  DKTID RGA VH
Sbjct  132  IVTDPSDNDMVNPKPGTLRHAVIQKRPLWIIFARSMIIKLNQELIMTSDKTIDARGANVH  191

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            ++ GAGIT+QF +N+IIHG++IH+IV+GSGG++RD+ DH+G RT SDGDG+S
Sbjct  192  VAYGAGITIQFARNIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGDGVS  243



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 175/241 (73%), Gaps = 7/241 (3%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F  +LF +   + P L A+IGDFD+ W+++   ARE A  +Y  +PFNV+   N +V K 
Sbjct  9    FTFVLFASFAVIFPTLHANIGDFDEYWKQKADIAREAAYRSYNPNPFNVSNQLNYQVNKA  68

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            +       +NST R L+R K   GPC ATNPIDRCWRC   W  NRKRL  C LGFG   
Sbjct  69   VS-----GTNSTRRNLMRRKG-GGPCKATNPIDRCWRCDPKWALNRKRLVECVLGFGHST  122

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGGK+G+ Y+VTD SDN   +PKPGTLRHAVIQ +PLWIIF R MIIRL+QEL++  +KT
Sbjct  123  TGGKDGKFYIVTDPSDNDMVNPKPGTLRHAVIQNEPLWIIFARSMIIRLNQELMISSNKT  182

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            ID RGA VHI+GGAG+TLQFV+NVIIHGI IH+IV GSGGLVRD+ DH+G RT SDGDGI
Sbjct  183  IDARGANVHIAGGAGLTLQFVQNVIIHGIRIHDIVSGSGGLVRDSVDHYGFRTKSDGDGI  242

Query  847  S  849
            S
Sbjct  243  S  243



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   293 bits (750),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 175/245 (71%), Gaps = 9/245 (4%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+ GF  IL  +   + P L AHI +FD+ W++R  EA + AL  +  +P NVT  FN  
Sbjct  2    KLVGF--ILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNAN  59

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            V KVL+       N++TRR L    Y GPC ATNPIDRCWRC  NW  +RKRLA C LGF
Sbjct  60   VNKVLD------GNNSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLGF  113

Query  478  GRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            GRK TGG  G+ YVV D SDN   +PKPGTLRHAVIQK+PLWIIF R M+IRL+QEL++ 
Sbjct  114  GRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMVA  173

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
              KTIDGRGA VHI+ GAGIT+QFV+NVIIH I IH+IV   GG++RDA DH G+RTMSD
Sbjct  174  SHKTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSD  233

Query  835  GDGIS  849
            GDGIS
Sbjct  234  GDGIS  238



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   293 bits (751),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 177/249 (71%), Gaps = 9/249 (4%)
 Frame = +1

Query  106  ICSNKMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVA  285
            + + K+ GF  IL  +   + P L AHI +FD+ W++R  EA + AL  +  +P NVT  
Sbjct  1    MAAMKLVGF--ILALSLAVLVPSLEAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQ  58

Query  286  FNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
            FN  V KVL+       N++TRR L    Y GPC ATNPIDRCWRC  NW  +RKRLA C
Sbjct  59   FNANVNKVLD------GNNSTRRQLHMHKYSGPCLATNPIDRCWRCRKNWAKDRKRLAKC  112

Query  466  GLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
             LGFGRK TGG  G+ YVV D SDN   +PKPGTLRHAVIQK+PLWIIF R M+IRL+QE
Sbjct  113  VLGFGRKTTGGLKGKYYVVYDCSDNDVVNPKPGTLRHAVIQKRPLWIIFARSMVIRLNQE  172

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            L++   KTIDGRGA VHI+ GAGIT+QFV+NVIIH I IH+IV   GG++RDA DH G+R
Sbjct  173  LMVASHKTIDGRGANVHIAFGAGITIQFVRNVIIHNIRIHDIVTRPGGIIRDAVDHVGIR  232

Query  823  TMSDGDGIS  849
            TMSDGDGIS
Sbjct  233  TMSDGDGIS  241



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 175/242 (72%), Gaps = 9/242 (4%)
 Frame = +1

Query  130  FMIILFFT-CVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            F ++ F+  C+A+ P L A+IG FD VW RR  EARE A   Y+ +P  VT  FN  V  
Sbjct  6    FSLLFFYVICLAIFPTLNANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHV--  63

Query  307  VLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
               IR    SN++ R L  S  Y GPC ATNPID+CWRC  NWE NRKRLA C LGFG  
Sbjct  64   ---IRAMRGSNNSRRGL--SNQYDGPCKATNPIDKCWRCDPNWEKNRKRLADCALGFGHG  118

Query  487  ATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
             TGGK+G+IYVV DSSDN   +PKPGTLRHA IQ++PLWIIF R+M I+LH EL++  +K
Sbjct  119  TTGGKDGKIYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNK  178

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            TID RGA VHIS GA ITLQ+VKN+IIHG++IH+I + SGGL+RD+ DH+G+R MSDGD 
Sbjct  179  TIDARGANVHISEGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDA  238

Query  844  IS  849
            IS
Sbjct  239  IS  240



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 172/243 (71%), Gaps = 7/243 (3%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            ++   +C  + P   A I ++DD W++R  EA    L +YE +P  +    N    ++L 
Sbjct  9    VVAISSC--LVPTSDARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLHSHRLLH  66

Query  316  IREAIAS----NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGR  483
               A        + TRR LR + Y GPC  TNPIDRCWRC S+W +NR RLA CGLGFG 
Sbjct  67   ELNATDHFHLVGNHTRRSLRGRRYNGPCTVTNPIDRCWRCRSDWATNRFRLADCGLGFGY  126

Query  484  KATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGD  660
            KA GGKNG IYVVTDSSDN   +PKPGTLRHAVIQ  PLWI+F R M+IRL QEL++  D
Sbjct  127  KAKGGKNGPIYVVTDSSDNDMVNPKPGTLRHAVIQPGPLWIVFARSMVIRLSQELLVTSD  186

Query  661  KTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGD  840
            KTIDGRGARVH++ GAGITLQFV NVIIHG++IH+IV+GSGG++RD+ DH+G RT SDGD
Sbjct  187  KTIDGRGARVHVAYGAGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFRTRSDGD  246

Query  841  GIS  849
            GIS
Sbjct  247  GIS  249



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 180/266 (68%), Gaps = 28/266 (11%)
 Frame = +1

Query  136  IILFFTC---VAMAPVLMAHIGD---FDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            ++  F C   + + P L+   G     ++ WR R  EA  H L  YE++P  V  AFN++
Sbjct  8    LVCVFLCAFTIVVVPTLITAQGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTVIGAFNKQ  67

Query  298  VQK---------------------VLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRC  414
              +                         ++ ++  ++TRR LR K + G C ATNPIDRC
Sbjct  68   ASENEMPGKTAAQDDKLTKLNLPPCCHTQQFLSEKNSTRRELRGKKWGGGCLATNPIDRC  127

Query  415  WRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKK  591
            WRC  NW  NRKRLA C +GFGR  TGGKNG  YVVTDSSD+    PKPGTLRHAVIQK+
Sbjct  128  WRCQPNWADNRKRLADCVVGFGRGTTGGKNGAFYVVTDSSDDSILAPKPGTLRHAVIQKE  187

Query  592  PLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIV  771
            PLWIIF+RDM+IRL QELIMQGDKTIDGRG  VHI+ GAGIT+QFVKNVIIHG++IH+I 
Sbjct  188  PLWIIFERDMVIRLTQELIMQGDKTIDGRGVSVHIAYGAGITIQFVKNVIIHGLHIHDIH  247

Query  772  RGSGGLVRDAEDHFGLRTMSDGDGIS  849
            +GSGGLVRD+ DHFG+RTMSDGDGIS
Sbjct  248  QGSGGLVRDSVDHFGIRTMSDGDGIS  273



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 173/237 (73%), Gaps = 8/237 (3%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            LF +     P L  HIG+FD+ W+++  EAR+ A   +  DP NVT  FN +V KVL   
Sbjct  13   LFVSLAVFVPTLQGHIGEFDEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQVNKVLT--  70

Query  322  EAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGK  501
                +NST R L+R +   G C ATNPIDRCWRC  NW S+R++LA C LGFG K  GGK
Sbjct  71   ---ETNSTRRSLVRKR--GGRCIATNPIDRCWRCDPNWASHRQKLADCVLGFGHKTVGGK  125

Query  502  NGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGR  678
             G+IYVVTD+SDN   +PKPGTLRHAVIQK+PLWIIF   M+IRL+QEL++  +KTID R
Sbjct  126  YGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQELMVASNKTIDSR  185

Query  679  GARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            G +VHI+ GAGITLQF +NVIIHG+ IH+IV GSGGL+RD+ DH+G RT SDGDGIS
Sbjct  186  GFKVHIAYGAGITLQFAQNVIIHGLRIHDIVSGSGGLIRDSVDHYGFRTKSDGDGIS  242



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   286 bits (731),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 174/237 (73%), Gaps = 8/237 (3%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            LF +  A  P L  HIG+FD+ W+++  EA + A   +  DP NVT  FN +V KV+   
Sbjct  13   LFVSLAAFVPTLQGHIGEFDEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQVNKVM---  69

Query  322  EAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGK  501
                  ++TRR L SK   G C ATNPIDRCWRC  NW S+R++LA C LGFG K  GGK
Sbjct  70   ---TETNSTRRSLVSKR-GGRCMATNPIDRCWRCDPNWASHRQKLADCVLGFGHKTVGGK  125

Query  502  NGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGR  678
             G+IYVVTD+SDN   +PKPGTLRHAVIQK+PLWIIF   M+IRL+QEL++  +KTID R
Sbjct  126  YGKIYVVTDASDNDMLNPKPGTLRHAVIQKEPLWIIFSGSMVIRLNQELMVASNKTIDSR  185

Query  679  GARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GA+VHI+ GAGITLQFV+NVIIHG+ IH+IV GSGGLVRD+ DH+G RT SDGDGIS
Sbjct  186  GAKVHIAYGAGITLQFVQNVIIHGLRIHDIVIGSGGLVRDSVDHYGFRTKSDGDGIS  242



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   285 bits (730),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 176/242 (73%), Gaps = 9/242 (4%)
 Frame = +1

Query  127  GFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            G  +++ F  V + P L A+I DFD+VW++R +EA++ +   YE  P   T  FN++V +
Sbjct  10   GIKLLMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHR  69

Query  307  VLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
             L+        + TRR LR   Y GPC ATNPIDRCWRC  NW  NRK+LA C LGFGR+
Sbjct  70   SLD------GGNNTRRHLRK--YTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRR  121

Query  487  ATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
             TGGK+G+IYVV DSSDN   +PKPGTLRHAVIQ++PLWIIF  DM+IRL +ELI+  DK
Sbjct  122  TTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIVTDDK  181

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            T+DGRGA VHI+ G  ITLQFVKN+IIH ++IH+I  G+GG++RD+  H+G RT SDGDG
Sbjct  182  TLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDG  241

Query  844  IS  849
            IS
Sbjct  242  IS  243



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   285 bits (730),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 176/242 (73%), Gaps = 9/242 (4%)
 Frame = +1

Query  127  GFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            G  +++ F  V + P L A+I DFD+VW++R +EA++ +   YE  P   T  FN++V +
Sbjct  10   GIKLLMIFGFVMIFPTLKANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHR  69

Query  307  VLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
             L+        + TRR LR   Y GPC ATNPIDRCWRC  NW  NRK+LA C LGFGR+
Sbjct  70   SLD------GGNNTRRHLRK--YTGPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRR  121

Query  487  ATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
             TGGK+G+IYVV DSSDN   +PKPGTLRHAVIQ++PLWIIF  DM+IRL +ELI+  DK
Sbjct  122  TTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIVTDDK  181

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            T+DGRGA VHI+ G  ITLQFVKN+IIH ++IH+I  G+GG++RD+  H+G RT SDGDG
Sbjct  182  TLDGRGANVHIANGGQITLQFVKNIIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDG  241

Query  844  IS  849
            IS
Sbjct  242  IS  243



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 179/250 (72%), Gaps = 11/250 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMA-------HIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            +++   +   + P L A       +I +FD VW+ R ++A++ AL  Y+ +P  VT  FN
Sbjct  12   LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERAMKAQKAALKAYQPNPEQVTEDFN  71

Query  292  REVQKVL---EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAA  462
              V++ +   ++ +  ++ ++TRR LR K YKGPC ATNPIDRCWRC +NW +NRK+LA+
Sbjct  72   ESVEQTVVEEDLEDDQSAGNSTRRNLRGKXYKGPCKATNPIDRCWRCRANWANNRKKLAS  131

Query  463  CGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQ  639
            C  GFGRK  GGK G  Y+VTDSSD N  DPKPGTLRHAVIQ +PLWIIF R M+IRL Q
Sbjct  132  CVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQ  191

Query  640  ELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGL  819
            ELI+   KTID RGA VHI+ GAGITLQFV+NVIIHG+ IH+ V GSGG++RD+  H G+
Sbjct  192  ELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGI  251

Query  820  RTMSDGDGIS  849
            RT SDGDGIS
Sbjct  252  RTQSDGDGIS  261



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 179/250 (72%), Gaps = 11/250 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMA-------HIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            +++   +   + P L A       +I +FD VW+ R ++A++ AL  Y+ +P  VT  FN
Sbjct  7    LVLFMISFCMLVPSLKAETANDTLNIANFDAVWQERGMKAQKAALKAYQPNPEQVTEDFN  66

Query  292  REVQKVL---EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAA  462
              V++ +   ++ +  ++ ++TRR LR KH KGPC ATNPIDRCWRC +NW +NRK+LA+
Sbjct  67   ESVEQTVVEEDLEDDQSAGNSTRRHLRGKHNKGPCKATNPIDRCWRCRANWANNRKKLAS  126

Query  463  CGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQ  639
            C  GFGRK  GGK G  Y+VTDSSD N  DPKPGTLRHAVIQ +PLWIIF R M+IRL Q
Sbjct  127  CVKGFGRKTRGGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQ  186

Query  640  ELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGL  819
            ELI+   KTID RGA VHI+ GAGITLQFV+NVIIHG+ IH+ V GSGG++RD+  H G+
Sbjct  187  ELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGI  246

Query  820  RTMSDGDGIS  849
            RT SDGDGIS
Sbjct  247  RTQSDGDGIS  256



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 172/229 (75%), Gaps = 9/229 (4%)
 Frame = +1

Query  166  APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNST  345
            +P++ A+IG+FD+VW++R  EA++ AL  YE +P  VT   N+E  K L+      SNST
Sbjct  18   SPIVKANIGEFDEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKALK-----GSNST  72

Query  346  TRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVT  525
             R L R   Y+GPC ATNPIDRCWRC  +W  NRK+LA C LGFGR+ TGGK+GR YVVT
Sbjct  73   RRNLGR---YRGPCLATNPIDRCWRCDPHWAENRKKLATCVLGFGRRTTGGKDGRFYVVT  129

Query  526  DSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISG  702
            D SDN   +PKPGT+RHAVIQK+PLWIIF  DM+IRL++ELIM  DKTIDGRGA VH   
Sbjct  130  DPSDNDMINPKPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKTIDGRGANVHFFR  189

Query  703  GAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GA ITLQ+++NVIIHGI+I   V  +GG++RD+ DHFG RT SDGDGIS
Sbjct  190  GAQITLQYIQNVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGIS  238



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 175/245 (71%), Gaps = 9/245 (4%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            + K   +IL F  +A+   + AHI +FD+VW++R  EA++ A   Y  +P NVT  FN E
Sbjct  2    EFKKSSLILAFALIALVYTIEAHIAEFDEVWQKRAEEAKKAARQAYHPNPENVTSHFNEE  61

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            V + ++       NS  R L +   Y GPC ATNPID+CWRC  NW  NR +LA C LGF
Sbjct  62   VHRSID-----GHNSRRRDLHK---YNGPCTATNPIDQCWRCQKNWRKNRMKLADCALGF  113

Query  478  GRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            GR ATGGK GRIY VTD SDN   +PKPGTLRHA+IQ +PLW+IF ++M+IRL QELIM 
Sbjct  114  GRHATGGKGGRIYKVTDPSDNDLVNPKPGTLRHALIQPEPLWVIFTKNMVIRLSQELIMT  173

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
             +KTIDGRG +VHI+ GAG TLQFV N+IIH ++IH+I  G+GG++RD+ +H+G+R+ SD
Sbjct  174  SNKTIDGRGVQVHIAYGAGFTLQFVHNIIIHNLHIHDIKSGNGGMIRDSVNHYGIRSRSD  233

Query  835  GDGIS  849
            GDGIS
Sbjct  234  GDGIS  238



>emb|CAN69905.1| hypothetical protein VITISV_001007 [Vitis vinifera]
Length=358

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 165/230 (72%), Gaps = 9/230 (4%)
 Frame = +1

Query  163  MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNS  342
            +AP + A+I ++DD W+ R  EA++ AL  +   P  V   FN      L + + +  ++
Sbjct  20   IAPTIRANIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFN------LHVEDELTGSN  73

Query  343  TTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVV  522
             TRR LR    KGPC ATNPIDRCWRC  NW S RKRLA C LGFGR   GGK G+ Y V
Sbjct  74   GTRRSLRVN--KGPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTVGGKYGKYYFV  131

Query  523  TDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHIS  699
            TD SDN   +PK GTLRHAVIQ +PLWI+F R MIIRL+QELIM  DKTIDGRG  VHI+
Sbjct  132  TDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTIDGRGVNVHIA  191

Query  700  GGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             GAGIT+QFVKNVIIHG++IH+IV GSGGL+RD+ DHFG R+ SDGDGIS
Sbjct  192  YGAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVDHFGYRSRSDGDGIS  241



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 174/245 (71%), Gaps = 7/245 (3%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            +++I F    ++ P+L A I ++D+VWRRR  EA    +  Y  DP  V + FN+ V K 
Sbjct  8    WLLISFLAFASILPLLRADIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMHFNKHVNKH  67

Query  310  LE----IREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            +E    + + +  N+T R L   K YKGPC  TNPID CWRC+  W  NR RLA CG+GF
Sbjct  68   VEESGGLDDVMMLNTTRRHL--GKAYKGPCKVTNPIDACWRCNPKWHLNRFRLADCGMGF  125

Query  478  GRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            G KATGGK GRIY+VTD SD+   +PKPGTLRHAVIQ++PLWI F+R+M+I+L QEL++ 
Sbjct  126  GSKATGGKGGRIYMVTDKSDDDVLNPKPGTLRHAVIQEEPLWITFRRNMVIKLKQELMVT  185

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
             DKTIDGRGA V I+ GAGIT+QFVKNVIIH + IH+IV   GGL+RD+  H GLRT SD
Sbjct  186  SDKTIDGRGAIVQIAYGAGITIQFVKNVIIHNLKIHHIVEKDGGLIRDSASHTGLRTQSD  245

Query  835  GDGIS  849
            GDGIS
Sbjct  246  GDGIS  250



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 167/232 (72%), Gaps = 9/232 (4%)
 Frame = +1

Query  160  AMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASN  339
            A A    AHIGDFD+ W+++   AR+ A  +Y  DP +VT +FN  V K LE        
Sbjct  16   ASAAFSNAHIGDFDEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAVSKDLE-------G  68

Query  340  STTRRLLRSKH-YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            + TRR LR KH + GPC ATNPIDRCWRC  +W  NRKRLA C  GFGR   GGKNG +Y
Sbjct  69   NVTRRSLRGKHKFNGPCVATNPIDRCWRCKKDWMQNRKRLAKCAKGFGRHTIGGKNGDLY  128

Query  517  VVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            VVTD+SDN    PK GTLR+ VIQ +PLWI+F  DMIIRL++EL++  DKTID RG+ VH
Sbjct  129  VVTDASDNDLISPKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDARGSNVH  188

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I GGAGI LQFV NVIIHG++IH+I  G+GG++RD+E HFGLRT SDGDGIS
Sbjct  189  IMGGAGIMLQFVHNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGIS  240



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 165/230 (72%), Gaps = 9/230 (4%)
 Frame = +1

Query  163  MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNS  342
            +AP + AHI ++DD W+ R  EA++ AL  +   P  V   FN      L + + +  ++
Sbjct  20   IAPTIRAHIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFN------LHVEDELTGSN  73

Query  343  TTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVV  522
             TRR LR    KGPC ATNPIDRCWRC  NW S RKRLA C LGFGR   GGK G+ Y V
Sbjct  74   GTRRSLRVN--KGPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTVGGKYGKYYFV  131

Query  523  TDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHIS  699
            TD SDN   +PK GTLRHAVIQ +PLWI+F R MIIRL+QELIM  DKTIDGRG  VHI+
Sbjct  132  TDPSDNDMVNPKKGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTIDGRGVNVHIA  191

Query  700  GGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             GAGIT+QFVKNVIIHG++IH+IV GSGGL+RD+ +HFG R+ SDGDGIS
Sbjct  192  YGAGITIQFVKNVIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGDGIS  241



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/251 (57%), Positives = 175/251 (70%), Gaps = 13/251 (5%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMA-------HIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            + +L  +   + P L A       +I +FD VW++R L+A++ AL  Y+ +P  VT  FN
Sbjct  7    LALLMISFCMLVPSLKAETQNDTLNIAEFDSVWQQRALKAQKAALKAYQPNPEQVTEDFN  66

Query  292  REVQKVL----EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLA  459
              V+  +       +  A NST R LL  K Y GPC ATNPIDRCWRC +NW  NRK LA
Sbjct  67   ESVEMTIIEDDHDDDHAAGNSTGRHLL-GKRYTGPCKATNPIDRCWRCQANWADNRKHLA  125

Query  460  ACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLH  636
            +C  GFGRK  GGK G  Y+VTDSSD N  DPKPGTLRHAVIQK+PLWIIF R M+IRL 
Sbjct  126  SCVKGFGRKTRGGKKGAYYIVTDSSDDNIHDPKPGTLRHAVIQKQPLWIIFARSMVIRLT  185

Query  637  QELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFG  816
            QELI+   KTID RGA VHI+ GAGITLQFV+NVIIHG++IH+ V G+GG++RD+ DH G
Sbjct  186  QELIVTSHKTIDARGANVHIAHGAGITLQFVQNVIIHGLHIHDTVPGNGGMIRDSVDHIG  245

Query  817  LRTMSDGDGIS  849
            +RT SDGDGIS
Sbjct  246  IRTHSDGDGIS  256



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 167/241 (69%), Gaps = 10/241 (4%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F++++  +     P   AHI DFD+ W+ R   AR+ AL  Y  +P NVT   N  V K 
Sbjct  10   FVVLVLASSSFTVPKAEAHIADFDETWQNRSAIARQVALEAYVHEPHNVTDHVNHMVHKA  69

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            LE       NST R L +   Y G C ATNPIDRCWRC  NW  +RKRLA C LGFGRK 
Sbjct  70   LE------GNSTRRHLGK---YTGACMATNPIDRCWRCQRNWARDRKRLAKCALGFGRKT  120

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGG  GR YVVTD+SD   TDPKPGTLRHAVIQ +PLWI FK DMIIRL +EL++   KT
Sbjct  121  TGGLKGRFYVVTDASDESLTDPKPGTLRHAVIQDRPLWITFKHDMIIRLTEELLVNSHKT  180

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRG  VHI+ GAGIT+Q+ KNVIIHG++IH+I  G+GG++RD+ +H+GLRT SDGD I
Sbjct  181  IDGRGTNVHIAYGAGITIQYQKNVIIHGLHIHDIKAGNGGMIRDSPEHYGLRTKSDGDAI  240

Query  847  S  849
            S
Sbjct  241  S  241



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 169/244 (69%), Gaps = 9/244 (4%)
 Frame = +1

Query  121  MKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            +K +M+++FF        L A I +FD+ W++R  EA+E +   YE +P  VT  FN EV
Sbjct  4    VKNYMLLVFFALAMQTSTLKAGIANFDEYWKKRAEEAKEASREAYEPNPAKVTKHFNDEV  63

Query  301  QKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFG  480
             K LE       NST R L ++K   GPC ATNPIDRCWRC  NW  NRK+L  C LGFG
Sbjct  64   HKSLE-----GGNSTRRNLGKNK---GPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFG  115

Query  481  RKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQG  657
            RK  GGK+G+ Y VTD SDN   +PK GTLR+ VIQ KPLWIIF  DM+IRL +EL++  
Sbjct  116  RKTIGGKHGKYYRVTDPSDNDMVNPKAGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVAS  175

Query  658  DKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDG  837
            +KTIDGRG  VHI  GA ITLQFVKNVIIHGI+IH+   G+GG++RD+ DH+G R+ SDG
Sbjct  176  NKTIDGRGVNVHIYNGAQITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDG  235

Query  838  DGIS  849
            DGIS
Sbjct  236  DGIS  239



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 180/242 (74%), Gaps = 8/242 (3%)
 Frame = +1

Query  142  LFFTCVAMA---PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            L F  +A A   P + A+  DFDD W +R ++A  + L +YES P  +    N   ++ L
Sbjct  7    LLFLLIAFASALPSISANFADFDDYWLKRSVQAWNNTLQSYESHPAKIVSHLNLHSKRAL  66

Query  313  -EIREA-IASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
             EI++  + SNS+ R+L     Y+GPC ATNPIDRCWRC +NW  NR RLA CGLGFG K
Sbjct  67   KEIKDINLVSNSSRRQLAHG--YEGPCMATNPIDRCWRCQANWADNRFRLADCGLGFGYK  124

Query  487  ATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
            A GGK GRIYVV DSSD +  +PKPGTLRHAVIQ +PLWIIF R M+IRL QELIMQ DK
Sbjct  125  AKGGKGGRIYVVNDSSDGDMVNPKPGTLRHAVIQTEPLWIIFSRSMVIRLSQELIMQSDK  184

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            TIDGRG RVHI+GGAGIT+QFVKN+IIHGI IH+IV G+GGL+RD+ DH+GLRT SDGDG
Sbjct  185  TIDGRGVRVHITGGAGITIQFVKNIIIHGILIHDIVPGNGGLIRDSVDHYGLRTRSDGDG  244

Query  844  IS  849
            IS
Sbjct  245  IS  246



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 160/226 (71%), Gaps = 9/226 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            +HI +FDD W+ R  EAR+ AL  Y   P  VT   N +VQ      EA+ + + TRR L
Sbjct  4    SHIAEFDDYWKSRAEEARKDALQAYSPHPHEVTDQLNYDVQ------EALTAKNNTRRQL  57

Query  361  RSKHYK--GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSS  534
            R +  K  GPC ATNPIDRCWRC  NW +NRKRLA C LGFGR   GGK G  Y+VTD S
Sbjct  58   RGRKNKKGGPCMATNPIDRCWRCDPNWANNRKRLADCTLGFGRNTVGGKFGPYYIVTDPS  117

Query  535  DNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAG  711
            D    +PKPGTLRHAVIQKKPLWIIF R MIIRL +ELIM GDKTID RGA V I+ GAG
Sbjct  118  DTDLINPKPGTLRHAVIQKKPLWIIFARSMIIRLSEELIMTGDKTIDARGANVRIAYGAG  177

Query  712  ITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            IT+QFVKNVIIH ++IH+IV   GG +RD+ DH G RT SDGDGIS
Sbjct  178  ITIQFVKNVIIHNLHIHDIVASGGGNIRDSADHVGFRTKSDGDGIS  223



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 172/247 (70%), Gaps = 9/247 (4%)
 Frame = +1

Query  121  MKGFMIILFFTCVAMA---PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            + G  I L    V+MA   P L A I +FDD   ++  EA++ +L  +  DP NVT  FN
Sbjct  2    VAGCKIKLLMVLVSMAVLMPTLRAGIAEFDDYLLQKAEEAKQASLEAFHPDPMNVTDHFN  61

Query  292  REVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            + V   LE  E   SNST R L +   YKGPC ATNPIDRCWRC  NW  NRK+LA C L
Sbjct  62   QHVHLALEGIEG--SNSTRRSLAK---YKGPCLATNPIDRCWRCDPNWAKNRKKLAKCVL  116

Query  472  GFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELI  648
            GFGRK TGGK GRIYVVTD SDN   +PKPGTLR+  +QK+PLWIIF R MIIRL +EL+
Sbjct  117  GFGRKTTGGKKGRIYVVTDPSDNDVVNPKPGTLRYGALQKRPLWIIFARSMIIRLSKELM  176

Query  649  MQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTM  828
            +   KTID RG+ VHI+ GAG+++QF +NVIIHG+ IH+++   GG++RD  +H GLRT+
Sbjct  177  VTSHKTIDARGSNVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTV  236

Query  829  SDGDGIS  849
            SDGDGIS
Sbjct  237  SDGDGIS  243



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 170/245 (69%), Gaps = 8/245 (3%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+  F++ +F   + +   + A+I  FD+ W+ R  EA++ A   Y  +P  VT +FN+E
Sbjct  8    KLNVFILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKE  67

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            V    +      S + TRR L+ K YKGPC ATNPIDRCWRC  NWE+NRK+LA C  GF
Sbjct  68   VHNTFD------SMNNTRRNLKEK-YKGPCLATNPIDRCWRCDPNWETNRKKLADCAQGF  120

Query  478  GRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            G K TGGK G IYVVTD+SDN   +PKPGTLRHAVIQ  PLWIIF  DM I+L +EL++ 
Sbjct  121  GHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMKIKLSEELMVT  180

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
             DKTID RGA VHI  G  ITLQFVKNVIIH ++IH+   G+GG++RD+ +H+G RT SD
Sbjct  181  SDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSD  240

Query  835  GDGIS  849
            GDGIS
Sbjct  241  GDGIS  245



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 171/247 (69%), Gaps = 9/247 (4%)
 Frame = +1

Query  121  MKGFMIILFFTCVAMA---PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            M G  I +    V+MA   P L A I +FDD   ++  EA++ +L  +  DP NVT  FN
Sbjct  2    MTGCKIKVVMVLVSMAVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFN  61

Query  292  REVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            + V   LE  E   SNST R L +   Y GPC ATNPIDRCWRC  NW  NRK+LA C L
Sbjct  62   QHVHLALEGIEG--SNSTRRSLSK---YNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVL  116

Query  472  GFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELI  648
            GFGRK TGGK GRIYVVTD SDN   +P+PGTLR+  +QKKPLWIIF R MIIRL +EL+
Sbjct  117  GFGRKTTGGKKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELM  176

Query  649  MQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTM  828
            +   KTID RGA VHI+ GAG+++QF +NVIIHG+ IH+++   GG++RD  +H GLRT+
Sbjct  177  ITSHKTIDARGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTV  236

Query  829  SDGDGIS  849
            SDGDGIS
Sbjct  237  SDGDGIS  243



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 170/245 (69%), Gaps = 8/245 (3%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K+  F++ +F   + +   + A+I  FD+ W+ R  EA++ A   Y  +P  VT +FN+E
Sbjct  8    KLFVFILCIFIVAITIPATVTANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKE  67

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            V    +      S + TRR L+ K YKGPC ATNPIDRCWRC  NWE+NRK+LA C  GF
Sbjct  68   VHNTFD------SMNNTRRNLKEK-YKGPCVATNPIDRCWRCDPNWETNRKKLADCAKGF  120

Query  478  GRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            G K TGGK G IYVVTD+SDN   +PKPGTLRHAVIQ  PLWIIF  DM I+L +EL++ 
Sbjct  121  GHKTTGGKAGEIYVVTDNSDNDLVNPKPGTLRHAVIQTGPLWIIFAHDMKIKLSEELMVT  180

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
             DKTID RGA VHI  G  ITLQFVKNVIIH ++IH+   G+GG++RD+ +H+G RT SD
Sbjct  181  SDKTIDARGANVHIQDGGQITLQFVKNVIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSD  240

Query  835  GDGIS  849
            GDGIS
Sbjct  241  GDGIS  245



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 160/227 (70%), Gaps = 9/227 (4%)
 Frame = +1

Query  172  VLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTR  351
             L A I +FD+ W++R  EA+E +   YE +P  V   FN EV K LE       NST R
Sbjct  5    TLKAGIANFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKSLE-----GGNSTRR  59

Query  352  RLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS  531
             L +   YKGPC ATNPIDRCWRC  NW  NRK+L  C LGFGRK  GGKNG+ Y VTD 
Sbjct  60   NLGK---YKGPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKNGKYYRVTDP  116

Query  532  SDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGA  708
            SDN   +PKPGTLR+ VIQ KPLWIIF  DM+IRL +EL++  +KTIDGRG  VHI  GA
Sbjct  117  SDNDMVNPKPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHIYNGA  176

Query  709  GITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             ITLQFVKNVIIHGI+IH+   G+GG++RD+ DH+G R+ SDGDGIS
Sbjct  177  QITLQFVKNVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGIS  223



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/252 (54%), Positives = 178/252 (71%), Gaps = 12/252 (5%)
 Frame = +1

Query  121  MKGFMIILFFTCVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            + G++ + F + +A+ AP + A++  FD  W +R  +A +  + +Y+ +P NVT  FN  
Sbjct  8    LGGYVFVFFSSFLAIVAPQVRANVAVFDSYWTQRQSDALKQTMGSYDPNPINVTNHFNYH  67

Query  298  VQKVLEIREAIASNSTTRRLL-------RSKHYKGPCNATNPIDRCWRCHSNWESNRKRL  456
            V   +++ E   SN+ TRR L       ++K + G C A NPID+CWRC  NW  NRK+L
Sbjct  68   VNIAVDVSE---SNNDTRRELTQVRSGRKTKKHSGKCLAYNPIDKCWRCDRNWAKNRKKL  124

Query  457  AACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRL  633
            A C LGFGR+ TGGK+G IYVV D+SD+   +PKPGTLRHAV +  PLWIIF R MII+L
Sbjct  125  ADCVLGFGRRTTGGKDGPIYVVKDASDDDLINPKPGTLRHAVTRNGPLWIIFARSMIIKL  184

Query  634  HQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHF  813
             QEL++  DKTIDGRGARV+I  GAG+TLQ+V NVIIH IY+ +IV G+GGL+RD+EDH 
Sbjct  185  QQELMITSDKTIDGRGARVYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEDHI  244

Query  814  GLRTMSDGDGIS  849
            GLRT SDGDGIS
Sbjct  245  GLRTKSDGDGIS  256



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 174/240 (73%), Gaps = 10/240 (4%)
 Frame = +1

Query  136  IILFFTCVAMA-PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            ++  F  +A+A PVL A+I DFD+VW++R  EA++  +  YE DP  V   FN  V + +
Sbjct  8    LVFAFAFLAVAVPVLRANIADFDEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVHEDM  67

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
            +      SN+T R L R+K   G C ATNPIDRCWRC  +W S+RKRLA C LGFGR  T
Sbjct  68   Q-----RSNNTRRSLKRTK---GGCLATNPIDRCWRCRKDWASHRKRLANCALGFGRGTT  119

Query  493  GGKNGRIYVVTD-SSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGK G+IY VTD S DN  +PKPGTLRHAVIQ +PLWIIF  +M+IRL +ELI+  +KTI
Sbjct  120  GGKAGKIYKVTDPSDDNLMNPKPGTLRHAVIQPEPLWIIFAHNMVIRLSEELIVTDNKTI  179

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            DGRGA VHI  GA ITLQFV+NVIIHG++IH+   G+GGL+RD+ +H+G RT SDGDGIS
Sbjct  180  DGRGANVHICDGAQITLQFVRNVIIHGLHIHDTHPGNGGLIRDSLEHYGFRTGSDGDGIS  239



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 178/256 (70%), Gaps = 14/256 (5%)
 Frame = +1

Query  118  KMKG-FMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            K+ G F++   F+ ++ +A  + AH+  FD+ W +R   A    L  Y+ +PFNVT  FN
Sbjct  8    KLAGNFVLCFLFSSISDVAQPVKAHVAVFDEYWTQRQAHALRQTLRFYDPNPFNVTDHFN  67

Query  292  REVQKVLEIREAI-ASNSTTRRLLR----SKHYK----GPCNATNPIDRCWRCHSNWESN  444
              V   L + EA  ASN T R L +     KH K    G C A NPIDRCWRC  NW  +
Sbjct  68   HHVN--LAVEEATEASNGTRRELWQVGSGGKHLKRRNTGKCVAYNPIDRCWRCQPNWAKD  125

Query  445  RKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDM  621
            RK+LA C LGFGR+ TGGK GR YVVTD+SD    +P+PGTLRHAV + +PLWI+F+R M
Sbjct  126  RKKLADCVLGFGRRTTGGKAGRYYVVTDASDTDLINPRPGTLRHAVTRDEPLWIVFERSM  185

Query  622  IIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDA  801
            +IRL QELI+  +KTIDGRG RVHI+GGAG+T+QFV NVIIH IYI +IV G+GGL+RD+
Sbjct  186  VIRLAQELIITSNKTIDGRGVRVHITGGAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDS  245

Query  802  EDHFGLRTMSDGDGIS  849
            E HFGLRT SDGDGI+
Sbjct  246  ETHFGLRTRSDGDGIN  261



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 167/250 (67%), Gaps = 11/250 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            ++ILF      +  +  H+  FD+ W +R  +A    L  Y+ +PFNVT  FN  V   +
Sbjct  9    LVILFAISSWASSSVRGHVAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYHVNLAV  68

Query  313  EIREAIASNSTTRRLL-----RSKHYK-----GPCNATNPIDRCWRCHSNWESNRKRLAA  462
            E      +N T R LL     R +H K     G C A NPIDRCWRC   W  NRK+LA 
Sbjct  69   EETMKTGNNGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWSKNRKKLAD  128

Query  463  CGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQ  639
            C LGFGRK TGGK G  YVVTD+SD+   +PK GTLRHAV +++PLWI+F + M+I+L Q
Sbjct  129  CALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAKSMVIKLQQ  188

Query  640  ELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGL  819
            ELIM  DKTIDGRG RVHI+GGAG TLQFV NVIIH IYI NIV G+GGL+RD+E HFGL
Sbjct  189  ELIMTSDKTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGL  248

Query  820  RTMSDGDGIS  849
            RT SDGDGI+
Sbjct  249  RTRSDGDGIN  258



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +1

Query  307  VLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
            V E+   ++ N T RR L +K Y GPC  TNPID+CWRC  NW  NRK+L  C +GFG K
Sbjct  10   VKELSTVVSKNETIRRALGTKKYDGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYK  69

Query  487  ATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
             TGG++G  YVVTD SD+ T PKPGTLRHAVIQK+PLWIIF+++M I+LHQELIMQGDKT
Sbjct  70   TTGGRDGEFYVVTDPSDDYTTPKPGTLRHAVIQKEPLWIIFEKNMKIKLHQELIMQGDKT  129

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRGA VHI+GGA I +Q+ KNVIIHG++IH+IV GSGG+VRDA DH GLRT SDGDGI
Sbjct  130  IDGRGATVHITGGASIMIQYTKNVIIHGLHIHDIVEGSGGMVRDAVDHIGLRTKSDGDGI  189

Query  847  S  849
            S
Sbjct  190  S  190



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 167/238 (70%), Gaps = 6/238 (3%)
 Frame = +1

Query  139  ILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEI  318
            ++  +   + P L A I +FDD   ++  EA++ +L  +  DP NVT  FN+ V   LE 
Sbjct  1    MVLVSMAVLMPTLRAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLALEG  60

Query  319  REAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGG  498
             E   SNST R L +   Y GPC ATNPIDRCWRC  NW  NRK+LA C LGFGRK TGG
Sbjct  61   IEG--SNSTRRSLSK---YNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTTGG  115

Query  499  KNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDG  675
            K GRIYVVTD SDN   +P+PGTLR+  +QKKPLWIIF R MIIRL +EL++   KTID 
Sbjct  116  KKGRIYVVTDPSDNDVINPRPGTLRYGALQKKPLWIIFARSMIIRLSKELMITSHKTIDA  175

Query  676  RGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            RGA VHI+ GAG+++QF +NVIIHG+ IH+++   GG++RD  +H GLRT+SDGDGIS
Sbjct  176  RGANVHIAYGAGLSIQFARNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGIS  233



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   270 bits (690),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 167/240 (70%), Gaps = 7/240 (3%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            +++  F   +++P+L A+I DFD+VW++R   AR HAL  Y  +P  V  +FN+ V  + 
Sbjct  8    ILLTLFGLASISPILKANIHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMF  67

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
            E      + ++TRR LR + Y G C ATNPID+CWRC  NW +NRKRLA C  GFGR   
Sbjct  68   E------NGNSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTI  121

Query  493  GGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGKNG  YVVT+ +D+   +PKPGTLRHAVIQ++PLWI F  DM+IRL +EL++  DKTI
Sbjct  122  GGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTI  181

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RG+ V I  GA IT+QFVKN+IIHG++I     G GG++RD+  H+G R+ SDGDGIS
Sbjct  182  DARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHYGFRSSSDGDGIS  241



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 169/245 (69%), Gaps = 8/245 (3%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
             + L  +   +AP + A+I  FDD W +R  +A +  L +++  P NVT   N  V   L
Sbjct  13   FVFLLSSFATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALAL  72

Query  313  EIREAIASNSTTRRLLRSK-----HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            +  E+I  NST R L +++       +G C A NPID+CWRC  +WE NRK+LA C LGF
Sbjct  73   DTTESI--NSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKKLAVCALGF  130

Query  478  GRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            GR+ TGGK+G IYVVTD+SD+    P+PGTLRHAV +  PLWIIF R M+I+L QEL+M 
Sbjct  131  GRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQELMMT  190

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
             DKTIDGRGARV+I GG+G+TLQFV NVIIH IYI  IV  +GGL+RD+E H GLRT SD
Sbjct  191  SDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSD  250

Query  835  GDGIS  849
            GDGI+
Sbjct  251  GDGIN  255



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 171/244 (70%), Gaps = 10/244 (4%)
 Frame = +1

Query  142  LFFTCVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEI  318
             F + +A+ AP + AH+  FD  W +R  +A +    +Y+ +P NVT  FN  V   ++ 
Sbjct  11   FFLSLLAIVAPQVGAHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHFNYHVNLAVDA  70

Query  319  REAIASNSTTRRL--LRSKH----YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFG  480
             E+I  N T R L  +RS+     + G C A NPID+CWRC  NW +NRK+LA C LGFG
Sbjct  71   TESI--NDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLAECALGFG  128

Query  481  RKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQG  657
            RK TGGK+G IYVVTD+SDN   +PKPGTLR+AV +  PLWIIF R MII+L QEL++  
Sbjct  129  RKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMITS  188

Query  658  DKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDG  837
            DKTIDGRGARV+I  GAG+TLQFV NVIIH IY+  IV G+GGL+RD+E H GLRT SDG
Sbjct  189  DKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHIGLRTKSDG  248

Query  838  DGIS  849
            DGIS
Sbjct  249  DGIS  252



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 167/228 (73%), Gaps = 9/228 (4%)
 Frame = +1

Query  169  PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTT  348
            P + AHI ++DD W+ R  EA+  A++ ++  P +V   FN+ V+K      +I   + T
Sbjct  22   PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEK------SIFGKNGT  75

Query  349  RRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTD  528
            RR L+    KGPC ATNPIDRCWRC  NW  +R+RLA C LGFGR+  GGK+GR+Y+VTD
Sbjct  76   RRNLKVN--KGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRLYIVTD  133

Query  529  SSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGG  705
             SDN   +PKPGTLR+AVIQ +PLWI+F R MII+L QEL++  DKTIDGRG  VHI+ G
Sbjct  134  PSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHIAYG  193

Query  706  AGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            AGIT+QF +NVIIHG++IH+IV   GGL+RD+  HFGLRT SDGDGIS
Sbjct  194  AGITIQFARNVIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGIS  241



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 167/228 (73%), Gaps = 9/228 (4%)
 Frame = +1

Query  169  PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTT  348
            P + AHI ++DD W+ R  EA+  A++ ++  P +V   FN+ V+K      +I   + T
Sbjct  22   PTIRAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEK------SIFGKNGT  75

Query  349  RRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTD  528
            RR L+    KGPC ATNPIDRCWRC  NW  +R+RLA C LGFGR+  GGK+GR+Y+VTD
Sbjct  76   RRNLKVN--KGPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRLYIVTD  133

Query  529  SSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGG  705
             SDN   +PKPGTLR+AVIQ +PLWI+F R MII+L QEL++  DKTIDGRG  VHI+ G
Sbjct  134  PSDNDMLNPKPGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHIAYG  193

Query  706  AGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            AGIT+QF +NVIIHG++IH+IV   GGL+RD+  HFGLRT SDGDGIS
Sbjct  194  AGITIQFARNVIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGIS  241



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 170/250 (68%), Gaps = 10/250 (4%)
 Frame = +1

Query  121  MKGFMIILFFTCVAMA-PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            +  ++I+     +A+A P + AH+ ++D+ W +R  EA    L +Y+ +P NVT  FN  
Sbjct  4    LGSYVIVFVSLSLAVAVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYH  63

Query  298  VQKVLEIREAIASNSTTRRLLRS-----KHYKGPCNATNPIDRCWRCHSNWESNRKRLAA  462
                +E      + + TRR LR      K   G   + N ID+CWR   NW+ NRK+LA 
Sbjct  64   AALAME---TTGTANETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLAD  120

Query  463  CGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQ  639
            C LGFGRK TGGKNG IYVVTD SDN   DPKPGTLRHAV + +PLWIIF R MII+L Q
Sbjct  121  CVLGFGRKTTGGKNGPIYVVTDPSDNDLLDPKPGTLRHAVTRDRPLWIIFARHMIIKLQQ  180

Query  640  ELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGL  819
            ELI+  DKTIDGRG  V+I+GGAG+TLQ+V+NVIIH IYI  I RG GGL+RD+E HFGL
Sbjct  181  ELIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKRGPGGLIRDSEHHFGL  240

Query  820  RTMSDGDGIS  849
            RTMSDGDGI+
Sbjct  241  RTMSDGDGIN  250



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 175/247 (71%), Gaps = 8/247 (3%)
 Frame = +1

Query  112  SNKMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            + K+   ++ +F T + +   + A+I DFD+ W++R  EA++ A   Y  DP  VT  FN
Sbjct  3    AEKLNVVILCVFVTAITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFN  62

Query  292  REVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            ++V    +      +N+T R L  ++ YKGPC ATNPIDRCWRC  NWE NRKRLA C L
Sbjct  63   KQVLDTFDY-----ANNTRRNL--NQKYKGPCMATNPIDRCWRCDPNWEKNRKRLADCAL  115

Query  472  GFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELI  648
            GFGRKATGGK G IYVVTD++D +  +PKPGTLRHAVIQ  PLWIIF RDM I+L +EL+
Sbjct  116  GFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIKLTEELL  175

Query  649  MQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTM  828
            +  DKTID RGA VHI  GA I+LQFVKNVII  ++IHN   G+GGL+RD+ +HFG RT 
Sbjct  176  VASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGLIRDSINHFGQRTR  235

Query  829  SDGDGIS  849
            SDGDGIS
Sbjct  236  SDGDGIS  242



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 169/245 (69%), Gaps = 8/245 (3%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
             + L  +   +AP + A+I  FDD W +R  +A +  L +++  P NVT   N  V   L
Sbjct  13   FVFLLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALAL  72

Query  313  EIREAIASNSTTRRLLRSK-----HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            +  E+  +NST R L +++       +G C A NPID+CWRC  +WE NRK+LA C LGF
Sbjct  73   DTTES--TNSTRRELSQARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKKLAVCALGF  130

Query  478  GRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            GR+ TGGK+G IYVVTD+SD+    P+PGTLRHAV +  PLWIIF R M+I+L QEL+M 
Sbjct  131  GRRTTGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQELMMT  190

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
             DKTIDGRGARV+I GG+G+TLQFV NVIIH IYI  IV  +GGL+RD+E H GLRT SD
Sbjct  191  SDKTIDGRGARVYIMGGSGLTLQFVNNVIIHNIYIKQIVPANGGLIRDSEQHIGLRTRSD  250

Query  835  GDGIS  849
            GDGI+
Sbjct  251  GDGIN  255



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 165/240 (69%), Gaps = 7/240 (3%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            +++  F   +++P+L A+  DFD+VW++R   AR HAL  Y  +P  V  +FN+ V  + 
Sbjct  8    ILLTLFGLASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMF  67

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
            E      + S+TRR LR + Y G C ATNPID+CWRC  NW +NRKRLA C  GFGR   
Sbjct  68   E------NGSSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTI  121

Query  493  GGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGKNG  YVVT+ +D+   +PKPGTLRHAVIQ++PLWI F  DM+IRL +EL++  DKTI
Sbjct  122  GGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTI  181

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RG+ V I  GA IT+QFVKN+IIHG++I     G GG++RD+  H G R+ SDGDGIS
Sbjct  182  DARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGIS  241



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 165/240 (69%), Gaps = 7/240 (3%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            +++  F   +++P+L A+  DFD+VW++R   AR HAL  Y  +P  V  +FN+ V  + 
Sbjct  8    ILLTLFGLASISPILKANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMF  67

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
            E      + S+TRR LR + Y G C ATNPID+CWRC  NW +NRKRLA C  GFGR   
Sbjct  68   E------NGSSTRRYLRGRPYTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTI  121

Query  493  GGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGKNG  YVVT+ +D+   +PKPGTLRHAVIQ++PLWI F  DM+IRL +EL++  DKTI
Sbjct  122  GGKNGPFYVVTNPADDDLVNPKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTI  181

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RG+ V I  GA IT+QFVKN+IIHG++I     G GG++RD+  H G R+ SDGDGIS
Sbjct  182  DARGSNVQIYNGAQITMQFVKNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGIS  241



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 172/244 (70%), Gaps = 10/244 (4%)
 Frame = +1

Query  142  LFFTCVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEI  318
             F + +A+ AP + AH+  FD  W +R  +A +    +Y+ +P NVT  FN  V   ++ 
Sbjct  11   FFLSLLAIVAPQVGAHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHFNYHVNLAVDA  70

Query  319  REAIASNSTTRRL--LRSKH----YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFG  480
             E+I  N T R L  +RS+     + G C A NPID+CWRC  NW +NRK+LA C LGFG
Sbjct  71   TESI--NDTRRELTQVRSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLADCALGFG  128

Query  481  RKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQG  657
            RK TGGK+G IYVVTD+SDN   +PKPGTLR+AV +  PLWIIF R MII+L QEL++  
Sbjct  129  RKTTGGKDGPIYVVTDASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMITS  188

Query  658  DKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDG  837
            DKTIDGRGARV+I  GAG+TLQFV NVIIH IY+ +IV G+GGL+RD+E H GLRT SDG
Sbjct  189  DKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHIGLRTKSDG  248

Query  838  DGIS  849
            DGIS
Sbjct  249  DGIS  252



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 169/249 (68%), Gaps = 11/249 (4%)
 Frame = +1

Query  127  GFMIILF--FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            G  +I+F   +   + P + AH+ ++D+ W +R  EA    L +Y+ +P NVT  FN   
Sbjct  5    GSYVIVFVSLSLAVVVPTVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHA  64

Query  301  QKVLEIREAIASNSTTRRLLRS-----KHYKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
               +E    IA+   TRR LR      K   G   + N ID+CWR   NW+ NRK+LA C
Sbjct  65   ALAMET-TGIANE--TRRDLRQVKSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLADC  121

Query  466  GLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
             LGFGRK TGGKNG IYVVTD SDN   +PKPGTLRHAV + +PLWIIF R MII+L QE
Sbjct  122  VLGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRHAVTRDRPLWIIFARHMIIKLQQE  181

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            LI+  DKTIDGRG  V+I+GGAG+TLQ+V+NVIIH IYI  I +G GGL+RD+E HFGLR
Sbjct  182  LIITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLR  241

Query  823  TMSDGDGIS  849
            TMSDGDGIS
Sbjct  242  TMSDGDGIS  250



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 164/240 (68%), Gaps = 12/240 (5%)
 Frame = +1

Query  142  LFFTCV---AMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            L F CV   A+ P+  A+I  FD  W+ R  +A++ A   Y+ +P  +T   N  V K L
Sbjct  8    LLFGCVFFLAIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKAL  67

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
                   SNST R L +   YKGPC+ATNPID CWRC  NWE NRK+LA C LGFG   T
Sbjct  68   S-----GSNSTRRELAK---YKGPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGHGTT  119

Query  493  GGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGK G+IYVVTDSSDN    PKPGTLR A IQK+PLWIIFK +M I+L  EL++  DKTI
Sbjct  120  GGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSDKTI  179

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VHIS GA ITLQ+VKN+IIHG++IH+  + SGG +RD+ DH+G R+ SDGD IS
Sbjct  180  DARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAIS  239



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 171/246 (70%), Gaps = 6/246 (2%)
 Frame = +1

Query  130  FMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            ++ + F + +A +AP + A+I  FDD W +R  +A +  L +++  P NVT   N  V  
Sbjct  11   YVFVFFLSSLATLAPQVQANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVAL  70

Query  307  VLEIREAIASN----STTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLG  474
             L+   +I S     S  RR  + ++ +G C A NPID+CWRC  +WE NRK+LA C LG
Sbjct  71   ALDTTGSINSTRRELSQARRGRKMQNRRGKCVAHNPIDKCWRCDRDWEKNRKKLAVCALG  130

Query  475  FGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            FGR+ +GGK+G IYVVTD+SD+    P+PGTLRHAV +  PLWIIF R M+I+L QEL+M
Sbjct  131  FGRRTSGGKDGPIYVVTDASDDELISPRPGTLRHAVTRDGPLWIIFARSMVIKLQQELMM  190

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
              DKTIDGRGARV+I GG+G+TLQFV NVI+H IYI  IV  +GGL+RD+E H GLRT S
Sbjct  191  TSDKTIDGRGARVYIMGGSGLTLQFVNNVIVHNIYIKQIVPANGGLIRDSEQHIGLRTRS  250

Query  832  DGDGIS  849
            DGDGI+
Sbjct  251  DGDGIN  256



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 174/246 (71%), Gaps = 10/246 (4%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            ++ ILFF   ++ PVL A+I ++D+VWRRR  EA    L  YE DP  V + FN  V + 
Sbjct  8    WLPILFFVVASILPVLRANIAEYDEVWRRRAAEAYNRTLQAYEPDPLKVVMHFNENVHR-  66

Query  310  LEIREA-----IASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLG  474
              I+E+     +  NST RRL   K Y+GPC  TNPID CWRC  NW  NR +LA C LG
Sbjct  67   -HIKESGGVDMMMLNSTRRRL--GKKYRGPCKVTNPIDACWRCDPNWHLNRFKLADCSLG  123

Query  475  FGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            FGRKATGGK GRIYVVTD SD+    PKPGTLRHAVIQ++PLWI FKR M+I L QELIM
Sbjct  124  FGRKATGGKGGRIYVVTDPSDDDILTPKPGTLRHAVIQEEPLWITFKRSMVITLAQELIM  183

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
              DKTIDGRG +V I+ GAGIT+Q+V+N+IIH I IHNIV   GG++RD+  H GLRT S
Sbjct  184  TSDKTIDGRGVKVQIAHGAGITVQYVRNIIIHNIKIHNIVEKKGGIIRDSTTHSGLRTQS  243

Query  832  DGDGIS  849
            DGDGIS
Sbjct  244  DGDGIS  249



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 164/240 (68%), Gaps = 12/240 (5%)
 Frame = +1

Query  142  LFFTCV---AMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            L F CV   A+ P+  A+I  FD  W+ R  +A++ A   Y+ +P  +T   N  V K L
Sbjct  8    LLFGCVFFLAIVPIFEANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKAL  67

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
                   SNST R L +   YKGPC+ATNPID CWRC  NWE NRK+LA C LGFG   T
Sbjct  68   S-----GSNSTRRELAK---YKGPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGHGTT  119

Query  493  GGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGK G+IYVVTDSSDN    PKPGTLR A IQK+PLWIIFK +M I+L  EL++  DKTI
Sbjct  120  GGKAGKIYVVTDSSDNDLVTPKPGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSDKTI  179

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VHIS GA ITLQ+VKN+IIHG++IH+  + SGG +RD+ DH+G R+ SDGD IS
Sbjct  180  DARGANVHISEGAQITLQYVKNIIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAIS  239



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 171/247 (69%), Gaps = 11/247 (4%)
 Frame = +1

Query  112  SNKMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            +NK++     +F+  +A+ P L A I      W+ R  EA++ A   Y+ +P ++ + FN
Sbjct  3    ANKLRLLCFCVFY--LALFPTLRASIAHDAQFWQTRAREAKQAAQKAYKPNPHDIALTFN  60

Query  292  REVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            + V K  +     +SN T R L +   Y GPC ATNPID+CWRC  NWE NRK+LA C L
Sbjct  61   KHVDKSFK-----SSNGTRRGLSK---YTGPCLATNPIDKCWRCDPNWEKNRKKLANCAL  112

Query  472  GFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELI  648
            GFG   TGGKNG+IYVVTDSSD+   +PKPGTLRHAVIQ +PLWIIFK  M I+L  ELI
Sbjct  113  GFGHGTTGGKNGKIYVVTDSSDHDLINPKPGTLRHAVIQNEPLWIIFKHSMNIKLSSELI  172

Query  649  MQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTM  828
               +KTID RGA VHIS GA +TLQ+VKN+IIHG++IH+I +G GGL+RD+ +H+G R+ 
Sbjct  173  FTDNKTIDARGANVHISNGAQMTLQYVKNIIIHGLHIHDIKKGGGGLIRDSVNHYGYRSS  232

Query  829  SDGDGIS  849
            SDGD IS
Sbjct  233  SDGDAIS  239



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 161/225 (72%), Gaps = 9/225 (4%)
 Frame = +1

Query  178  MAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRL  357
             A IGDFDD W+ R   A + A + Y+ DP  V  + N       EI  A +  ++TRR 
Sbjct  18   FADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVN------AEIAHASSGRNSTRRN  71

Query  358  LRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD  537
            L  K Y GPC ATNPIDRCWRC  NW  NRK+LA C LGFGRK TGGK G  YVV DSSD
Sbjct  72   L--KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVNDSSD  129

Query  538  NP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGI  714
            +   +PKPGTLRHAVIQK PLWIIF  +M IRL QELIM  DKTID RGA V I+ GAGI
Sbjct  130  SDLMNPKPGTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARGANVQIAYGAGI  189

Query  715  TLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            TLQ+++NVIIHG+ IH+IV GSGG++RDA DH GLRTMSDGDGIS
Sbjct  190  TLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGIS  234



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 161/225 (72%), Gaps = 9/225 (4%)
 Frame = +1

Query  178  MAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRL  357
             A IGDFDD W+ R   A + A + Y+ DP  V  + N       EI  A +  ++TRR 
Sbjct  18   FADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVN------AEIAHASSGRNSTRRN  71

Query  358  LRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD  537
            L  K Y GPC ATNPIDRCWRC  NW  NRK+LA C LGFGRK TGGK G  YVV DSSD
Sbjct  72   L--KKYAGPCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVNDSSD  129

Query  538  NP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGI  714
            +   +PKPGTLRHAVIQK PLWIIF  +M IRL QELIM  DKTID RGA V I+ GAGI
Sbjct  130  SDLMNPKPGTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARGANVQIAYGAGI  189

Query  715  TLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            TLQ+++NVIIHG+ IH+IV GSGG++RDA DH GLRTMSDGDGIS
Sbjct  190  TLQYIRNVIIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGIS  234



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 169/248 (68%), Gaps = 9/248 (4%)
 Frame = +1

Query  127  GFMIILF--FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            G  +I+F   +   + P + AH+ ++D+ W +R  EA    L +Y+ +P NVT  FN   
Sbjct  5    GSYVIVFVSLSLAVVVPSVHAHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFN--Y  62

Query  301  QKVLEIREAIASNSTTRRLLRSKHYK----GPCNATNPIDRCWRCHSNWESNRKRLAACG  468
               L +     SN T R L + K  K    G   + N ID+CWR + NW+ NRK+LA C 
Sbjct  63   HAALAMETTGISNETRRDLRQVKSGKKRRGGRYESLNAIDKCWRGNKNWDKNRKKLADCV  122

Query  469  LGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQEL  645
            LGFGRK TGGKNG IYVVTD SDN   +PKPGTLR+AV + +PLWIIF R MII+L QEL
Sbjct  123  LGFGRKTTGGKNGPIYVVTDPSDNDLLNPKPGTLRYAVTRDRPLWIIFARHMIIKLQQEL  182

Query  646  IMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            I+  DKTIDGRG  V+I+GGAG+TLQ+V+NVIIH IYI  I +G GGL+RD+E HFGLRT
Sbjct  183  IITNDKTIDGRGVSVYITGGAGLTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRT  242

Query  826  MSDGDGIS  849
            MSDGDGIS
Sbjct  243  MSDGDGIS  250



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 174/247 (70%), Gaps = 8/247 (3%)
 Frame = +1

Query  112  SNKMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            + K+   ++ +F   + +   + A+I DFD+ W++R  EA++ A   Y  DP  VT  FN
Sbjct  5    AEKLNVVILCVFVIAITIPTTVRANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFN  64

Query  292  REVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            ++V    +      +N+T R L  ++ YKGPC ATNPIDRCWRC  NWE NRKRLA C L
Sbjct  65   KQVLDTFDY-----ANNTRRNL--NQKYKGPCMATNPIDRCWRCDPNWEKNRKRLADCAL  117

Query  472  GFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELI  648
            GFGRKATGGK G IYVVTD++D +  +PKPGTLRHAVIQ  PLWIIF RDM I+L +EL+
Sbjct  118  GFGRKATGGKLGPIYVVTDNTDADLVNPKPGTLRHAVIQNGPLWIIFARDMRIKLTEELL  177

Query  649  MQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTM  828
            +  DKTID RGA VHI  GA I+LQFVKNVII  ++IHN   G+GG++RD+ +HFG RT 
Sbjct  178  VASDKTIDARGANVHILDGAQISLQFVKNVIITNLHIHNNKPGNGGMIRDSINHFGQRTR  237

Query  829  SDGDGIS  849
            SDGDGIS
Sbjct  238  SDGDGIS  244



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 175/238 (74%), Gaps = 7/238 (3%)
 Frame = +1

Query  139  ILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEI  318
            +L F   A+ P L  HIG++D+ W++R LEA+E+    Y  +P  VT   N  V + L  
Sbjct  11   LLLFLFAAIIPALQGHIGEYDENWKQRELEAKENTEQAYNPNPEEVTQHVNHLVSRSL--  68

Query  319  REAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGG  498
               +  NST RR LR++   GPC+ TNPID+CWRC  NWE NR+RLA C +GF R   GG
Sbjct  69   ---MGLNST-RRHLRARKKGGPCDPTNPIDQCWRCDRNWEKNRQRLADCAIGFARGTIGG  124

Query  499  KNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDG  675
            K GRIYVVTD SD+   +PKPGTLRHAVIQK+PLWIIF R MIIRL +ELIM G+KTID 
Sbjct  125  KYGRIYVVTDPSDDDLLNPKPGTLRHAVIQKEPLWIIFARAMIIRLKEELIMSGNKTIDA  184

Query  676  RGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            RGA VH++ GAGIT+Q+V+NVIIHG++IH+IV G+GG++RD+ +H+G RT SDGDGIS
Sbjct  185  RGANVHVAYGAGITIQYVRNVIIHGLHIHHIVPGNGGMIRDSVNHYGFRTKSDGDGIS  242



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 174/249 (70%), Gaps = 12/249 (5%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL-  312
            ++  F+  A+ P L A I +FD+VW++R  +A ++AL  YE  P NVT   N  V K L 
Sbjct  8    LVFLFSFAALIPSLWADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNKALL  67

Query  313  -------EIREAIASNSTTRRLLRSKH--YKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
                      E + +NST RR LR  H  Y GPC ATNPIDRCWRC  NW  NRK+LA C
Sbjct  68   KGRANKTRAFEGVTTNST-RRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQLANC  126

Query  466  GLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
             LGFG K  GGK G  Y+VTD+SD N  +P+PGTLRHAVIQK+PLWIIF  DM I+L QE
Sbjct  127  VLGFGHKTEGGKQGGYYLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIKLSQE  186

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            LI+Q  KTIDGRGA VHI+ GAGITLQFV NVIIH ++IH+I + SGGL+RD+ DH+G R
Sbjct  187  LIVQSKKTIDGRGANVHIAYGAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGFR  246

Query  823  TMSDGDGIS  849
            T+ DGDGIS
Sbjct  247  TVGDGDGIS  255



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 168/242 (69%), Gaps = 10/242 (4%)
 Frame = +1

Query  130  FMIILFFTC-VAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            F ++ F+   +A+ P L A+IG FD VW RR  EARE A   Y+ +P  VT  FN  V +
Sbjct  6    FSLLFFYVIFLAILPTLQANIGQFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVMR  65

Query  307  VLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
             ++      SNST R L +       C A NPID+CWRC  +WE NRK+LA C +GFG  
Sbjct  66   AMK-----GSNSTRRGLGKKN---DECEAANPIDKCWRCDPDWEKNRKKLADCAIGFGHG  117

Query  487  ATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
             TGGK+G+IYVV D+SD +  +PKPGTLRHAVIQ +PLWIIF R+M IRL  EL++  +K
Sbjct  118  TTGGKDGKIYVVGDNSDKDLVNPKPGTLRHAVIQTEPLWIIFSRNMNIRLTAELLITDNK  177

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            TID RGA VHI  GA +T+QFVKN+IIHG++IH+I   SGGL+RD+  H+G+R MSDGDG
Sbjct  178  TIDARGANVHILDGAQMTIQFVKNIIIHGLHIHDIQPISGGLIRDSMSHYGVRAMSDGDG  237

Query  844  IS  849
            IS
Sbjct  238  IS  239



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 168/242 (69%), Gaps = 16/242 (7%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            M+I  FT   + P L+A IG FDDVW++R  +A++  L  Y  DP   T AFN EV    
Sbjct  7    MLIFVFTLATLIPSLLADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAFNVEV----  62

Query  313  EIREAIASNSTTRRLLRS--KHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
                     + TRR LR   K Y GPC  TNPIDRCWRC  NW  NRK+LA C LGFGR+
Sbjct  63   ---------NNTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNRKQLAKCALGFGRR  113

Query  487  ATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
             TGG  GRIYVVTDSSDN    PKPGTLRHAVIQK+PLWIIF ++M I+L +ELIM   K
Sbjct  114  TTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWIIFSKNMNIKLSKELIMSSHK  173

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            TIDGRG  VHIS G GIT+QF+ NVIIHGI IH+I+  SGG +RD+ DH+G+RT SDGDG
Sbjct  174  TIDGRGHHVHISYGGGITIQFIHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGDG  233

Query  844  IS  849
            IS
Sbjct  234  IS  235



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 171/245 (70%), Gaps = 10/245 (4%)
 Frame = +1

Query  139  ILFFTCVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            + F + +A+ AP + AH+  FD  W +R  +A +  + +Y+ +P NVT   N  V   ++
Sbjct  10   VFFLSLLAIVAPQVKAHVAVFDSYWTQRQSDALKRTMGSYDPNPLNVTNHLNYHVNLAVD  69

Query  316  IREAIASNSTTRRL--LRSKHYK----GPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
              E+   N T R L  +RS H K    G C A NPID+CWRC  NW +NRK+LA C LGF
Sbjct  70   AAESF--NDTRRELTQVRSGHRKLKRSGKCLAYNPIDKCWRCDRNWANNRKKLADCVLGF  127

Query  478  GRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            GRK TGGK+G IYVV D+SDN   +PKPGTLR+AV +  PLWIIF R MII+L QEL++ 
Sbjct  128  GRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMIA  187

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
             DKTIDGRGA+V+I  GAG+T+Q+V NVIIH IY+ +IV G+GGL+RD+E H GLRT SD
Sbjct  188  SDKTIDGRGAKVYIMEGAGLTMQYVNNVIIHSIYVKHIVPGNGGLIRDSEHHVGLRTKSD  247

Query  835  GDGIS  849
            GDGIS
Sbjct  248  GDGIS  252



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 169/251 (67%), Gaps = 13/251 (5%)
 Frame = +1

Query  127  GFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQ  303
            G++ + F + +A   P   AH+  FD+ W +R  +A    +N+Y+ +P NVT  FN  V 
Sbjct  10   GYVFVFFLSFIATFPPESRAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTDHFNHHVS  69

Query  304  KVLEIREAIASNSTTRRLL-------RSKH-YKGPCNATNPIDRCWRCHSNWESNRKRLA  459
              ++  E   SN+ TRR L       R  H   G C A N ID+CWRC  NW  NRK+L 
Sbjct  70   LAMDATE---SNNGTRRELTQVRKSGRKIHKSSGKCLAYNAIDKCWRCDRNWAKNRKKLT  126

Query  460  ACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLH  636
             C LGFGRK TGGK+G IYVV D+SDN   +PKPGTLR+AV +  PLWIIF R MII+L 
Sbjct  127  DCVLGFGRKTTGGKDGPIYVVNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQ  186

Query  637  QELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFG  816
            QEL++  DKTIDGRGAR++I  GAG+TLQ+V NVIIH IY+ +IV G+GGL+RD+E H G
Sbjct  187  QELMITSDKTIDGRGARIYIMEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEHHLG  246

Query  817  LRTMSDGDGIS  849
            LRT SDGDGIS
Sbjct  247  LRTKSDGDGIS  257



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 166/229 (72%), Gaps = 4/229 (2%)
 Frame = +1

Query  166  APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNST  345
            A  L A+I +FD+ W +R LEA ++    Y  +P+NVT  FN +V   L  R     NST
Sbjct  22   ALTLNANIAEFDEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVH--LHARNMKKLNST  79

Query  346  TRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVT  525
             R LL   H  GPC ATNPID CWRC  NW  NRKRLA C +GFG+  TGGK+GRIYVVT
Sbjct  80   RRGLLGKGHI-GPCVATNPIDACWRCQPNWAENRKRLADCAIGFGKGTTGGKDGRIYVVT  138

Query  526  DSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISG  702
            DSSDN   +PKPGTLRHAVIQ +PLWIIF R M IRL QELIM GDKTID RGA VHI+ 
Sbjct  139  DSSDNDMQNPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARGANVHIAH  198

Query  703  GAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GAGIT+QF+KNVIIHG++IH I  G GGL+RD+ +HFGLRT SDGD IS
Sbjct  199  GAGITIQFIKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAIS  247



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 166/226 (73%), Gaps = 10/226 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            AHI D+D+ W+++   AR HA N Y  +P +VT  FN  V + L      ASNST RR L
Sbjct  23   AHIADYDEYWQKKAALARSHANNAYNPNPESVTHHFNEAVMRDL------ASNST-RRGL  75

Query  361  RSK--HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSS  534
            R K  +  G C ATNPIDRC+RC SNW  +RK+LA C  GFGR ATGGKNG  YVVTDSS
Sbjct  76   RGKMRNEDGACQATNPIDRCFRCQSNWVHHRKKLATCAKGFGRHATGGKNGDFYVVTDSS  135

Query  535  D-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAG  711
            D +  +P+ GTLRHAVIQ +PLWI+F  DM+IRL +ELI+  +KTIDGRGA V I+ GAG
Sbjct  136  DADLVNPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDGRGANVQIAYGAG  195

Query  712  ITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            +T+QFV NVI+H I IH+I  G+GG++RD+E+H+GLRT SDGDGIS
Sbjct  196  LTIQFVHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGIS  241



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 172/242 (71%), Gaps = 8/242 (3%)
 Frame = +1

Query  142  LFFTCVAMA---PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            L F  +A A   P + A+  D D+ W +R ++A  + L +YE  P  +    N    + L
Sbjct  7    LLFLSIAFAYALPSISANFLDSDEYWVKRSVQAWNNTLESYEPHPAKIVSHLNLHSTRAL  66

Query  313  E-IRE-AIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
            E I++  + SNS+ R L     Y GPC ATNPIDRCWRC +NW  NR RLA CGLGFG K
Sbjct  67   EEIKDLELVSNSSRRHLAHG--YDGPCMATNPIDRCWRCQANWADNRFRLADCGLGFGYK  124

Query  487  ATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
            A GGK GRIYVV DSSD+   +P PGTLRHAVIQ +PLWIIF R M+IRL QELIMQ DK
Sbjct  125  AKGGKGGRIYVVNDSSDSDMVNPIPGTLRHAVIQTEPLWIIFSRSMVIRLSQELIMQSDK  184

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            TIDGRG RVHI+GGAGIT+QFVKN+IIHG+ IH+IV G GG++RD+ DH+G RT SDGDG
Sbjct  185  TIDGRGVRVHITGGAGITIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDHYGFRTRSDGDG  244

Query  844  IS  849
            IS
Sbjct  245  IS  246



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 156/219 (71%), Gaps = 6/219 (3%)
 Frame = +1

Query  196  FDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHY  375
             D  W++R  EA++ A+ ++E+DP  VT  FN  V ++L     +  N T R L  +K Y
Sbjct  36   LDIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELL-----MKQNGTRRHLRGNKKY  90

Query  376  KGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDP  552
             GPC ATNP+D CWRC  NW  NRKRLA C  GFG+K TGGK G IYVVTD SD +  +P
Sbjct  91   NGPCMATNPMDACWRCDKNWAKNRKRLADCVQGFGKKTTGGKAGPIYVVTDPSDLDLVNP  150

Query  553  KPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVK  732
            KPGTLRHAVIQK PLWIIF R+M+IRL QEL++  DKTIDGRGA V+I  GAGITLQFVK
Sbjct  151  KPGTLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRGANVNIHNGAGITLQFVK  210

Query  733  NVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            NVII  ++I  IV   GG++RD+ DH G RT SDGDGIS
Sbjct  211  NVIITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGIS  249



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 160/232 (69%), Gaps = 7/232 (3%)
 Frame = +1

Query  157  VAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIAS  336
            +A A    AHI +FD+ W+++   AR +  N Y  +P +VT  FN  V K LE       
Sbjct  1    MAAAAFCNAHIAEFDEYWQKKEAMARANVQNAYNPNPESVTKHFNDAVLKDLE------K  54

Query  337  NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            N+T R L   + Y GPC ATNPIDRCWRC  NW  +RKRLA C  GFGR  TGGKNG  Y
Sbjct  55   NNTRRGLRGKRRYDGPCMATNPIDRCWRCQENWAHHRKRLATCAKGFGRHVTGGKNGDFY  114

Query  517  VVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            VVTD SD +  +P+ GTLR+ VIQ +PLWI+F RDM+IRL +ELI+  +KTIDGRG  V 
Sbjct  115  VVTDPSDLDLVNPRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIVNSNKTIDGRGVDVQ  174

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I  GAGIT+Q+V N+IIH + IH+I  G+GG++RD+E H+GLRT SDGDGIS
Sbjct  175  IMNGAGITIQYVDNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGDGIS  226



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 171/252 (68%), Gaps = 12/252 (5%)
 Frame = +1

Query  121  MKGFMIILFFTCVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            + G++ + F + +A+ AP +  ++  FD  W +R  +A +  + +Y+  P NVT  FN  
Sbjct  8    LGGYVFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYH  67

Query  298  VQKVLEIREAIASNSTTRRLL-------RSKHYKGPCNATNPIDRCWRCHSNWESNRKRL  456
            V   ++  E   S + TRR L       ++    G C A NPID CWRC  NW +NRK+L
Sbjct  68   VNIAVDASE---SRNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKL  124

Query  457  AACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRL  633
            A C LGFGR+ TGGK+G IYVV D+SDN   +PKPGTLRHAV +  PLWIIF R MII+L
Sbjct  125  ADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKL  184

Query  634  HQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHF  813
             QEL++  DKTIDGRGARV+I  GAG+TLQFV NVIIH IY+ +IV G+GGL+RD+E H 
Sbjct  185  QQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHI  244

Query  814  GLRTMSDGDGIS  849
            GLRT SDGDGIS
Sbjct  245  GLRTKSDGDGIS  256



>ref|XP_002517472.1| pectate lyase, putative [Ricinus communis]
 gb|EEF45014.1| pectate lyase, putative [Ricinus communis]
Length=431

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 182/293 (62%), Gaps = 49/293 (17%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            +++  ++I      ++ P+L A IG +D+VW++R  EA+++ ++ Y ++P  VT  FN +
Sbjct  2    EVEKLVVIFVLAFASIIPILNADIGYYDEVWKKRAEEAKKNMMDAYVANPLEVTTEFNNQ  61

Query  298  VQKVLEIREAIAS-----------------------------------------------  336
              +  E    + S                                               
Sbjct  62   TNEGKEKNGTVGSGKGEVNTTSSFSEAENTNDDNNEENEDDNDEWNETKGNFTKEFEKET  121

Query  337  NSTTRRLLRSKH-YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRI  513
            NST R L + K  YKGPC+ TNPIDRCWRC  NW  NRKRLA C LGFGR+ TGGK G+ 
Sbjct  122  NSTRRNLRQGKRLYKGPCHTTNPIDRCWRCRKNWAKNRKRLARCALGFGRRTTGGKAGKF  181

Query  514  YVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARV  690
            YVVTD++D N  DPKPGTLRHAVIQK PLWI F RDM I+L +ELI+  DKTIDGRGA V
Sbjct  182  YVVTDNTDANVVDPKPGTLRHAVIQKAPLWIYFARDMNIKLQKELIINNDKTIDGRGANV  241

Query  691  HISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            HI+ GAGIT+QFVKNVIIHG++IH+I   SGG++RD+ DHFG+RT SDGDGIS
Sbjct  242  HIAYGAGITIQFVKNVIIHGLHIHHISAASGGMIRDSIDHFGIRTNSDGDGIS  294



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/252 (53%), Positives = 171/252 (68%), Gaps = 12/252 (5%)
 Frame = +1

Query  121  MKGFMIILFFTCVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            + G++ + F + +A+ AP +  ++  FD  W +R  +A +  + +Y+  P NVT  FN  
Sbjct  8    LGGYVFVFFSSFLAIVAPQVRGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYH  67

Query  298  VQKVLEIREAIASNSTTRRLL-------RSKHYKGPCNATNPIDRCWRCHSNWESNRKRL  456
            V   ++  E   S + TRR L       ++    G C A NPID CWRC  NW +NRK+L
Sbjct  68   VNIAVDASE---SRNDTRRELTQVRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKL  124

Query  457  AACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRL  633
            A C LGFGR+ TGGK+G IYVV D+SDN   +PKPGTLRHAV +  PLWIIF R MII+L
Sbjct  125  ADCVLGFGRRTTGGKDGPIYVVKDASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKL  184

Query  634  HQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHF  813
             QEL++  DKTIDGRGARV+I  GAG+TLQFV NVIIH IY+ +IV G+GGL+RD+E H 
Sbjct  185  QQELMITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHI  244

Query  814  GLRTMSDGDGIS  849
            GLRT SDGDGIS
Sbjct  245  GLRTKSDGDGIS  256



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 175/276 (63%), Gaps = 42/276 (15%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            M+I  FT   + P L+A +G FDDVWR+R  EA++  L  Y  DP   T AFN EV K  
Sbjct  7    MLIFVFTLATLIPSLLADLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEVNKY-  65

Query  313  EIREAIASNST----------------------------------TRRLLRS--KHYKGP  384
                ++A NS+                                  TRR LR   K Y GP
Sbjct  66   ----SLAKNSSSLYGAFGSTNITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGP  121

Query  385  CNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPG  561
            C  TNPIDRCWRC  NW  NRK+LA C LGFGR+ TGG  GRIYVVTDSSDN    PKPG
Sbjct  122  CQVTNPIDRCWRCQRNWAKNRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPG  181

Query  562  TLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVI  741
            TLRHAVIQK+PLWIIF ++M I+L +ELIM   KTIDGRG  VHIS GAGIT+QF+ NVI
Sbjct  182  TLRHAVIQKEPLWIIFSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGAGITIQFIHNVI  241

Query  742  IHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            IHGI IH+I+  SGG +RD+ DH+G+RT SDGDGIS
Sbjct  242  IHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGDGIS  277



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   259 bits (663),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 173/243 (71%), Gaps = 6/243 (2%)
 Frame = +1

Query  124  KGFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            + F +IL+F C+  + P L AHI ++DD WR R L+A+E+    Y  +P  VT  FN  V
Sbjct  7    RSFSLILYFLCLGVIIPSLEAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQHFNDHV  66

Query  301  QKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFG  480
             ++L       +NST RR+L+ K   GPC ATNPID+CWRC  NWE NRK+LA C LGFG
Sbjct  67   ARILM---GFRTNST-RRMLK-KRKGGPCEATNPIDQCWRCDRNWEKNRKKLADCALGFG  121

Query  481  RKATGGKNGRIYVVTDSSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGD  660
            R  TGGK+G IYVVTD +D+  +P  GTLRHAVIQ +PLWI F R MIIRL +EL+M  +
Sbjct  122  RGTTGGKDGPIYVVTDPTDDVLNPSRGTLRHAVIQNRPLWITFARGMIIRLKEELLMTSN  181

Query  661  KTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGD  840
            KTIDGRGA VHI+ GAGIT+QF KNVIIH I+IHNI    GG ++D E+H GLRT SDGD
Sbjct  182  KTIDGRGANVHIAYGAGITIQFAKNVIIHNIHIHNIFPSKGGKIKDGENHLGLRTRSDGD  241

Query  841  GIS  849
            GIS
Sbjct  242  GIS  244



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 170/246 (69%), Gaps = 12/246 (5%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGD----FDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            LF  C+++   L  H+G     FD+ W +R  +A +  + +++ +P NVT   N  V   
Sbjct  12   LFVFCLSLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALA  71

Query  310  LEIREAIASNSTTRRLLRSKHYK-----GPCNATNPIDRCWRCHSNWESNRKRLAACGLG  474
            ++  E+I  NST R L + ++ +     G C A NPIDRCWRC+ +WE NRK+LA C LG
Sbjct  72   VDATESI--NSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLADCVLG  129

Query  475  FGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            FGR+ TGGK+G IYVV D+SD+   +PKPGTLRHAV +  PLWIIF   MII L QELI+
Sbjct  130  FGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELII  189

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
              DKTIDGRGARV+I  GAG+TLQFV NVIIH IY+ ++V  SGGL+RD+E H GLRT+S
Sbjct  190  TSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVS  249

Query  832  DGDGIS  849
            DGDGIS
Sbjct  250  DGDGIS  255



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 170/246 (69%), Gaps = 12/246 (5%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGD----FDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            LF  C+++   L  H+G     FD+ W +R  +A +  + +++ +P NVT   N  V   
Sbjct  12   LFVFCLSLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALA  71

Query  310  LEIREAIASNSTTRRLLRSKHYK-----GPCNATNPIDRCWRCHSNWESNRKRLAACGLG  474
            ++  E+  +NST R L + ++ +     G C A NPIDRCWRC+ +WE NRK+LA C LG
Sbjct  72   VDATES--TNSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLADCVLG  129

Query  475  FGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            FGR+ TGGK+G IYVV D+SD+   +PKPGTLRHAV +  PLWIIF   MII L QELI+
Sbjct  130  FGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELII  189

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
              DKTIDGRGARV+I  GAG+TLQFV NVIIH IY+ ++V  SGGL+RD+E H GLRT+S
Sbjct  190  TSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVS  249

Query  832  DGDGIS  849
            DGDGIS
Sbjct  250  DGDGIS  255



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 160/225 (71%), Gaps = 9/225 (4%)
 Frame = +1

Query  178  MAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRL  357
             A IGDFDD W+ R  EA + A + YE +P  +  + N EV + L       SNST R L
Sbjct  18   FADIGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQALS-----GSNSTRRNL  72

Query  358  LRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD  537
               K Y GPC ATNPIDRCWRC  NW  NRK+LA C LGFGRK  GGK G  YVV DSSD
Sbjct  73   ---KKYTGPCRATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTIGGKLGPYYVVNDSSD  129

Query  538  NP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGI  714
            +   +PKPGTLRHAVIQK PLWI F  +M IRL QELI+  DKTID RGA V I+ GAGI
Sbjct  130  SDLMNPKPGTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARGANVQIAYGAGI  189

Query  715  TLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            TLQ+V+NVIIHG+ IH+IV G+GG++RDA DH GLRTMSDGDGIS
Sbjct  190  TLQYVRNVIIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGIS  234



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 172/249 (69%), Gaps = 11/249 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHI------GDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR  294
            +++   +   + P L A I      G FD VW+ R L+A + AL  Y+ +P  VT  FN 
Sbjct  7    LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKTALKAYQRNPEKVTDDFNE  66

Query  295  EVQKVLEIR---EAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
             VQ+V ++    +   SN T R LL  K YKGPC ATNPIDRCWRC  +W ++RK+LA C
Sbjct  67   SVQEVDDLNFEDDDQVSNITGRHLL-GKKYKGPCKATNPIDRCWRCRKDWANDRKKLANC  125

Query  466  GLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
              GFGR+  GGK G  YVVTD SD N  +PKPGTLRHAVIQ +PLWIIF R M IRL QE
Sbjct  126  VKGFGRRTRGGKRGEFYVVTDPSDSNVVEPKPGTLRHAVIQPQPLWIIFARSMTIRLTQE  185

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            LIM   KTID RGA VHI+ GAG+TLQFV+NVIIHG++IH+IV GSGG +RD+ DHFG R
Sbjct  186  LIMTSHKTIDARGANVHIAHGAGLTLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTR  245

Query  823  TMSDGDGIS  849
            T SDGDGIS
Sbjct  246  TQSDGDGIS  254



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 168/239 (70%), Gaps = 5/239 (2%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L F  V + P + A++  FD+ W++R  +A +  + +Y+ +P NVT   N  V   ++  
Sbjct  13   LVFLSVILVPHVQANVAIFDNYWKQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDAT  72

Query  322  EAIASNSTTRRLL--RSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
            E+  +N+T R L+   ++   G C A NPID+CWRC  NWE NRK+L  C LGFGRK TG
Sbjct  73   ES--TNNTRRELIGRETQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLVECVLGFGRKTTG  130

Query  496  GKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK+G IYVV DSSD +  +PKPGTLRHAV +  PLWIIF   M+I+L QEL++  +KTID
Sbjct  131  GKDGPIYVVNDSSDEDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTID  190

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGARV+I  GAG+T QFV NVII+ IY+ +I+ G+GGL+RD+E+H GLRT SDGDGIS
Sbjct  191  GRGARVYIMEGAGLTQQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGIS  249



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 171/248 (69%), Gaps = 9/248 (4%)
 Frame = +1

Query  127  GFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQ  303
            G++ +     +A + P + A++  FD+ W +R  +A +  + +++ +P NVT   N  V 
Sbjct  10   GYLFVFSLLLLATLTPHVGANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVA  69

Query  304  KVLEIREAIASNSTTRRLLRSKHYK-----GPCNATNPIDRCWRCHSNWESNRKRLAACG  468
              +   E+I  NST R L + ++ +     G C A NPIDRCWRCH +WE NRK+LA C 
Sbjct  70   LAVGATESI--NSTRRELSQVRNGRKLKRSGKCVAYNPIDRCWRCHGDWEKNRKKLADCV  127

Query  469  LGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQEL  645
            LGFGR+ TGGK+G IYVV D+SD+   +PKPGTLRHAV +  PLWIIF   MII L QEL
Sbjct  128  LGFGRRTTGGKDGPIYVVNDASDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQEL  187

Query  646  IMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            I+  DKTIDGRGARV+I  GAG+TLQFV NVIIH IYI ++V  SGGL+RD+E H GLRT
Sbjct  188  IITSDKTIDGRGARVYIMEGAGLTLQFVNNVIIHNIYIKHVVPKSGGLIRDSEQHIGLRT  247

Query  826  MSDGDGIS  849
            +SDGDGIS
Sbjct  248  VSDGDGIS  255



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 164/240 (68%), Gaps = 9/240 (4%)
 Frame = +1

Query  139  ILFFTCVAMAPVLMA--HIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            + FF+ V +A    A  HI DFD+ W+++   A+  A N+Y  DP +VT  FN  V    
Sbjct  7    LFFFSLVFLASAAFANAHIADFDEYWQKKAEVAQSKARNSYNPDPESVTRHFNEAVY---  63

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
               E   +N T R L   K   GPC ATNPIDRCWRC+ NW  +RK+LA C  GFGR   
Sbjct  64   ---EDAQTNVTRRGLRGQKRSHGPCLATNPIDRCWRCNENWIHHRKQLATCAKGFGRHTI  120

Query  493  GGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGKNG+ YVVTD+SD+   +PK GTLR+ VIQ +PLWI+F  DM+IRL +ELI+   KTI
Sbjct  121  GGKNGKFYVVTDASDDDLVNPKKGTLRYGVIQDRPLWIVFAHDMVIRLTEELIVNSYKTI  180

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            DGRGA V I GGAG+T+Q+V NVI+H ++I +I  G+GG++RD+E H+GLRT SDGDGIS
Sbjct  181  DGRGANVQIMGGAGVTIQYVHNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRTRSDGDGIS  240



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 166/241 (69%), Gaps = 6/241 (2%)
 Frame = +1

Query  136  IILFFTCVAMAPV--LMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            ++LFF  V++  +  + A+IG++DD W++R   A+ +A   Y +DP  +T   N+ V  +
Sbjct  8    LMLFFMLVSIIFLQHVEANIGNYDDHWKQREQAAKANAARAYNTDPHGITHQTNQRVHNM  67

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
               R    +N   R L +   Y+GPC A NPIDRCWRC  NW  +R++LA C +GFG K 
Sbjct  68   GMNRTNRTNNYARRGLGK---YEGPCQADNPIDRCWRCDDNWSKDRQKLADCVVGFGHKT  124

Query  490  TGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGGK G IYVVTD SDN   DPKPGTLRHAVIQ  PLWIIFK  M+I+L +EL++  +KT
Sbjct  125  TGGKKGNIYVVTDDSDNELLDPKPGTLRHAVIQDGPLWIIFKHGMVIKLKEELLVSSNKT  184

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRG  VHI+GGAGI LQFV NVIIH ++IH+I  G GG +RD+  HFG RT SDGDGI
Sbjct  185  IDGRGGHVHIAGGAGIMLQFVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTASDGDGI  244

Query  847  S  849
            S
Sbjct  245  S  245



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 163/240 (68%), Gaps = 10/240 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            ++ILF    ++ P + A I +FD    ++ LE    +L  Y  +P  VT AFN+EV    
Sbjct  10   LLILFIWLASLVPHIHARIAEFDAYLEKQALEDLNSSLEAYTHNPEEVTNAFNKEVGN--  67

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
                A+    + RR L+ K+    C ATNPIDRCWRC  NW  NR  L  C  GFG K T
Sbjct  68   ----ALLKYKSLRRNLKEKN---KCMATNPIDRCWRCDKNWAENRMDLEECARGFGHKTT  120

Query  493  GGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGKNG+ YVVTD SD N  +PKPGTLRHAVIQ++PLWIIF++ M+I+L QEL++  DKTI
Sbjct  121  GGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLQQELMITSDKTI  180

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            DGRG  VHI+ GAG+T+QFV NVIIH I I NI+  +GG++RD+ +H GLRT+SDGDGIS
Sbjct  181  DGRGVAVHIANGAGLTIQFVHNVIIHNIRIQNIISTNGGMIRDSVNHIGLRTVSDGDGIS  240



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 165/241 (68%), Gaps = 14/241 (6%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F+  L F  VA A V      D D+ W+ R  EA++ A   + ++P  VT   N  V + 
Sbjct  8    FVCSLLFFVVANANV------DEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRT  61

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            +        +++TRR LR K Y+GPC ATNPIDRCWRC  NW  NR++LA C LGFG + 
Sbjct  62   M------LGHNSTRRSLRKK-YRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQT  114

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
             GGK G IYVVTD+SD+   +PKPGTLRH VIQK PLWIIF R M+IRL QEL++   KT
Sbjct  115  IGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKT  174

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            ID RGA VHI+ GAG+T+QFV NVIIH ++IH+IV  SGG++RD+ DH+G RT SDGDGI
Sbjct  175  IDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGI  234

Query  847  S  849
            S
Sbjct  235  S  235



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 167/249 (67%), Gaps = 15/249 (6%)
 Frame = +1

Query  139  ILFFTCVAMA---PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            +L F  +A+A   P + AHI  +D+ W +R  EA    L +YE DP NVT  FN      
Sbjct  12   VLAFVSLALAIIAPSVQAHIAVYDEYWTQRQTEALRRTLESYEPDPLNVTDHFNYHSALA  71

Query  310  LEIREAIASNSTTRRLLRS--------KHYKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
            +E  EA+   + TRR LR         K   G   + N ID+CWR   NW  NRK+LA C
Sbjct  72   METTEAV---NGTRRELRVVGGGRKTIKKRGGRFQSLNAIDKCWRGDKNWAKNRKKLADC  128

Query  466  GLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
             LGFGRK TGGK G IY VTD+SDN   +P+PGTLRHAV + +PLWIIF + M+I+L QE
Sbjct  129  VLGFGRKTTGGKAGPIYEVTDASDNDVMNPRPGTLRHAVTRDRPLWIIFAKSMVIKLQQE  188

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            LI+  DKTIDGRG  VHI+GGAG+T+QFVKNVIIH I++  I R +GG++RD+E+HFGLR
Sbjct  189  LIITNDKTIDGRGVSVHITGGAGLTIQFVKNVIIHNIHMKFIERRAGGMIRDSENHFGLR  248

Query  823  TMSDGDGIS  849
            T SDGDGI+
Sbjct  249  TESDGDGIN  257



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 172/239 (72%), Gaps = 9/239 (4%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            +++    + + P + A+IGDFD+VW+ R  EAR+ AL  Y   P  VT  FN++V K  +
Sbjct  8    LVILIPFLVIVPAVTANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHKSFD  67

Query  316  IREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                 ++N T R L +   + G C ATNPIDRCWRC S+W SNR +LA C LGFG+K TG
Sbjct  68   -----STNHTRRNLSK---FSGLCMATNPIDRCWRCRSDWASNRMKLADCVLGFGQKTTG  119

Query  496  GKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK G+IYVVTD SDN   +PKPGTLRHA IQ++PLWIIF   M IRL++ELIM  +KTID
Sbjct  120  GKGGKIYVVTDPSDNDMVNPKPGTLRHAAIQEEPLWIIFAHSMAIRLNEELIMTSNKTID  179

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             RGA VHI+ GAG+TLQFV N+IIHG++IH+I  G+GGL+RD+  H+G RT SDGDGIS
Sbjct  180  ARGANVHIANGAGLTLQFVHNIIIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGIS  238



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 165/248 (67%), Gaps = 9/248 (4%)
 Frame = +1

Query  127  GFMIILF--FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            G  +I+F   +   +AP + AHI  FDD W +R   A    + +YE +P NVT  FN   
Sbjct  9    GSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFN--Y  66

Query  301  QKVLEIREAIASNSTTRRLLRSKHYK----GPCNATNPIDRCWRCHSNWESNRKRLAACG  468
               L +    A N T R L + K  +    G   + N IDRCWR   NW  NRK+LA C 
Sbjct  67   HAALAMETTGADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLADCV  126

Query  469  LGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQEL  645
            LGFG K TGGKNG IYVVTD+SD+    PKPGTLRHAV + +PLWIIF R M+I+L QEL
Sbjct  127  LGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQEL  186

Query  646  IMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            ++  DKTIDGRG  V+I+GGAG TLQFVKNVIIH I++  I RG GGL+RD+E+HFGLRT
Sbjct  187  MITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRT  246

Query  826  MSDGDGIS  849
            +SDGDGI+
Sbjct  247  ISDGDGIN  254



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 165/248 (67%), Gaps = 9/248 (4%)
 Frame = +1

Query  127  GFMIILF--FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            G  +I+F   +   +AP + AHI  FDD W +R   A    + +YE +P NVT  FN   
Sbjct  9    GSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFN--Y  66

Query  301  QKVLEIREAIASNSTTRRLLRSKHYK----GPCNATNPIDRCWRCHSNWESNRKRLAACG  468
               L +    A N T R L + K  +    G   + N IDRCWR   NW  NRK+LA C 
Sbjct  67   HAALAMETTGADNGTRRELGQVKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLADCV  126

Query  469  LGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQEL  645
            LGFG K TGGKNG IYVVTD+SD+    PKPGTLRHAV + +PLWIIF R M+I+L QEL
Sbjct  127  LGFGLKTTGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQEL  186

Query  646  IMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            ++  DKTIDGRG  V+I+GGAG TLQFVKNVIIH I++  I RG GGL+RD+E+HFGLRT
Sbjct  187  MITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRT  246

Query  826  MSDGDGIS  849
            +SDGDGI+
Sbjct  247  ISDGDGIN  254



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 165/241 (68%), Gaps = 14/241 (6%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F+  L F  VA A V      D D+ W+ R  EA++ A   + ++P  VT   N  V + 
Sbjct  15   FVCSLLFFVVANANV------DEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRT  68

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            +        +++TRR LR K Y+GPC ATNPIDRCWRC  NW  NR++LA C LGFG + 
Sbjct  69   M------LGHNSTRRSLRKK-YRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQT  121

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
             GGK G IYVVTD+SD+   +PKPGTLRH VIQK PLWIIF R M+IRL QEL++   KT
Sbjct  122  IGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKT  181

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            ID RGA VHI+ GAG+T+QFV NVIIH ++IH+IV  SGG++RD+ DH+G RT SDGDGI
Sbjct  182  IDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGI  241

Query  847  S  849
            S
Sbjct  242  S  242



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 174/265 (66%), Gaps = 28/265 (11%)
 Frame = +1

Query  139  ILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR-------  294
            ++F  C+A + P +  +I + D+ W +R  EARE  L  Y SDP+ +   F+        
Sbjct  9    LMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNST  68

Query  295  EVQKVLEIREAI-------------ASNSTTRRLLRSK------HYKGPCNATNPIDRCW  417
            +V    E  +A              +S ++TRR LR K        KGPC A+NPID+CW
Sbjct  69   DVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCW  128

Query  418  RCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKP  594
            RC S+W   RK+L  C  GFG + TGGK GRIYVVT + D +  +PKPGTLRHAVIQK+P
Sbjct  129  RCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEP  188

Query  595  LWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVR  774
            LWIIFK DM IRL+QEL++   KTID RGA VH++ GAGIT+QFVKNV+IHG++IH+I  
Sbjct  189  LWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHISE  248

Query  775  GSGGLVRDAEDHFGLRTMSDGDGIS  849
             SGG++RD+ DHFG+RT +DGDG+S
Sbjct  249  SSGGMIRDSVDHFGMRTRADGDGLS  273



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 164/241 (68%), Gaps = 14/241 (6%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F+  L F  VA A V      D D+ W  R  EA++ A   + ++P  VT   N  V + 
Sbjct  8    FVCSLLFFVVANANV------DEDEYWETRATEAKKVAQGAFNANPEIVTDTLNAAVSRT  61

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            +        +++TRR LR K Y+GPC ATNPIDRCWRC  NW  NR++LA C LGFG + 
Sbjct  62   M------LGHNSTRRSLRKK-YRGPCLATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQT  114

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
             GGK G IYVVTD+SD+   +PKPGTLRH VIQK PLWIIF R M+IRL QEL++   KT
Sbjct  115  IGGKRGPIYVVTDASDDDLVNPKPGTLRHGVIQKGPLWIIFGRSMVIRLSQELMISSHKT  174

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            ID RGA VHI+ GAG+T+QFV NVIIH ++IH+IV  SGG++RD+ DH+G RT SDGDGI
Sbjct  175  IDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGI  234

Query  847  S  849
            S
Sbjct  235  S  235



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 164/244 (67%), Gaps = 11/244 (5%)
 Frame = +1

Query  121  MKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            M GF  +  F C  +  V+     D D+ W  R  EA++ A + +  +P  VT   N  V
Sbjct  1    MAGFSTL--FVCSLLFFVVANANVDEDEYWNTRATEAKKVAKSAFNPNPEIVTDNLNAAV  58

Query  301  QKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFG  480
             + +     +  NST R L   K Y+GPC ATNPIDRCWRC  NW  NRK+LA C LGFG
Sbjct  59   SRAM-----VGRNSTRRSL---KKYRGPCLATNPIDRCWRCDRNWAKNRKKLAECPLGFG  110

Query  481  RKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQG  657
             +  GGK G IYVVTD+SD+   +PKPGTLR+ VIQK PLWIIF R MIIRL QEL++  
Sbjct  111  HQTIGGKRGPIYVVTDASDDDLVNPKPGTLRYGVIQKGPLWIIFGRSMIIRLSQELMISS  170

Query  658  DKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDG  837
            DKTID RGA VHI+ GAG+T+QFV NVIIH ++IH+I+  SGG++RD+ DH+G RT SDG
Sbjct  171  DKTIDARGANVHIAFGAGLTIQFVNNVIIHNLHIHDIISKSGGMIRDSVDHYGFRTQSDG  230

Query  838  DGIS  849
            DGIS
Sbjct  231  DGIS  234



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 174/265 (66%), Gaps = 28/265 (11%)
 Frame = +1

Query  139  ILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR-------  294
            ++F  C+A + P +  +I + D+ W +R  EARE  L  Y SDP+ +   F+        
Sbjct  9    LMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNST  68

Query  295  EVQKVLEIREAI-------------ASNSTTRRLLRSK------HYKGPCNATNPIDRCW  417
            +V    E  +A              +S ++TRR LR K        KGPC A+NPID+CW
Sbjct  69   DVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCW  128

Query  418  RCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKP  594
            RC S+W   RK+L  C  GFG + TGGK GRIYVVT + D +  +PKPGTLRHAVIQK+P
Sbjct  129  RCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEP  188

Query  595  LWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVR  774
            LWIIFK DM IRL+QEL++   KTID RGA VH++ GAGIT+QFVKNV+IHG++IH+I  
Sbjct  189  LWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHISE  248

Query  775  GSGGLVRDAEDHFGLRTMSDGDGIS  849
             SGG++RD+ DHFG+RT +DGDG+S
Sbjct  249  SSGGMIRDSVDHFGMRTRADGDGLS  273



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 165/226 (73%), Gaps = 9/226 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            AHI +FDD W+ R  +A++ AL  Y   P  VT   N +V++ L ++      ++TRR+L
Sbjct  4    AHIAEFDDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDVEEALTVK------NSTRRVL  57

Query  361  RSKHYK--GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSS  534
            R K  K  GPC ATNPIDRCWRC  NW SNRKRLA C  GFGR + GGK GR YVVTDSS
Sbjct  58   RGKKNKKGGPCMATNPIDRCWRCDPNWASNRKRLADCARGFGRNSVGGKFGRYYVVTDSS  117

Query  535  DNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAG  711
            D    +PKPGTLRHAVIQK PLWIIF R MIIRL +ELIM GDKTIDGRGA V I+ GAG
Sbjct  118  DTDLVNPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDGRGANVRIAYGAG  177

Query  712  ITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            IT+QFVKNVIIH I+IH+I  GSGG +RD+ +H G RT SDGDGIS
Sbjct  178  ITIQFVKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGDGIS  223



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 163/240 (68%), Gaps = 10/240 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            +++LF    ++ P L A I +FD    ++ LEA   +L  Y ++P  +T AFN+EV    
Sbjct  10   LLVLFIWLASLVPHLHARIAEFDPYLEKQALEALNSSLEAYTNNPEEITNAFNKEVGN--  67

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
                A+    + RR L+ K     C ATNPIDRCWRC  NW  NR  L  C  GFG K T
Sbjct  68   ----ALLKYKSLRRHLKEK---DKCMATNPIDRCWRCDKNWAENRMDLEECARGFGHKTT  120

Query  493  GGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGKNG+ YVVTD SD N  +PKPGTLRHAVIQ++PLWIIF++ M+I+L QEL++  DKTI
Sbjct  121  GGKNGKYYVVTDESDDNVQEPKPGTLRHAVIQEEPLWIIFEKSMVIKLRQELMITSDKTI  180

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            DGRG  VHI+ GAG+ +QFV NVIIH I I NI+  +GG++RD+ +H GLRT+SDGDGIS
Sbjct  181  DGRGVAVHIAYGAGLMIQFVHNVIIHNIRIQNIISTNGGMIRDSINHIGLRTVSDGDGIS  240



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 171/250 (68%), Gaps = 11/250 (4%)
 Frame = +1

Query  127  GFMIILFFT-CVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            G  +  F + C+A+ AP + AH+  FD+ W +R  +A    + +Y+ +PFNVT   N   
Sbjct  9    GSHVFAFLSLCLAVVAPSVQAHVAVFDEYWTQRQSDALRQTIESYDPNPFNVTDHLN--Y  66

Query  301  QKVLEIREAIASNSTTRRL------LRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAA  462
               L +    A N T R+L       ++K   G  ++ N ID+CWR H NW  NRK+LA 
Sbjct  67   HAALAMETTGADNGTRRKLGQVGDGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLAD  126

Query  463  CGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQ  639
            C LGFGRK TGGK G IYVVTD++D+   +PKPGTLR+AV + +PLWIIF R MII+L Q
Sbjct  127  CVLGFGRKTTGGKKGPIYVVTDAADDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQ  186

Query  640  ELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGL  819
            ELI+  DKTIDGRGA VHI+GGAG+TLQFVKNVIIH I+I  I+ G+GG++RD+E HFG 
Sbjct  187  ELIINSDKTIDGRGANVHITGGAGLTLQFVKNVIIHNIHIKTIIPGNGGMIRDSEHHFGH  246

Query  820  RTMSDGDGIS  849
            RT SDGDGI+
Sbjct  247  RTTSDGDGIN  256



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 168/239 (70%), Gaps = 5/239 (2%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L F    + P + +++  FD+ W +R  +A +  + +Y+ +P NVT   N  V   ++  
Sbjct  13   LVFLLAILVPHVQSNVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDAT  72

Query  322  EAIASNSTTRRLL--RSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
            E+  +N+T R L+  +++   G C A NPID+CWRC  NWE NRK+LA C LGFGRK TG
Sbjct  73   ES--TNNTRRELIGRKTQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLAECVLGFGRKTTG  130

Query  496  GKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK+G IYVV DSSD+   +PKPGTLRHAV +  PLWIIF   M+I+L QEL++  +KTID
Sbjct  131  GKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTID  190

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA+V+I  G G+TLQFV NVII+ IY+ +I+ G+GGL+RD+E+H G+RT SDGDGIS
Sbjct  191  GRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGIRTKSDGDGIS  249



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 168/239 (70%), Gaps = 5/239 (2%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L F    + P + A++  FD+ W +R  +A +  + +Y+ +P NVT   N  V   ++  
Sbjct  13   LVFLLAILVPHVQANVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDAT  72

Query  322  EAIASNSTTRRLL--RSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
            E+  +N+T R L+  +++   G C A NPID+CWRC  NWE NRK+LA C LGFGRK TG
Sbjct  73   ES--TNNTRRELIGRKTQEGSGKCIAHNPIDKCWRCDPNWEKNRKKLAECVLGFGRKTTG  130

Query  496  GKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK+G IYVV DSSD+   +PKPGTLRHAV +  PLWIIF   M+I+L QEL++  +KTID
Sbjct  131  GKDGPIYVVNDSSDDDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTID  190

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA+V+I  G G+TLQFV NVII+ IY+ +I+ G+GGL+RD+E+H GLRT SDGDGIS
Sbjct  191  GRGAKVYIMEGVGLTLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGIS  249



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 163/251 (65%), Gaps = 19/251 (8%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
             + +  +   + P + AHI   D+ W +R  EA +  L  Y+ +P NVT  FN +    +
Sbjct  9    FVFVSLSLAVVVPSVQAHIAVHDEYWTQRQTEALQQTLEAYDPEPLNVTDHFNHQAALAM  68

Query  313  -----------EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLA  459
                       E+R+    N   RR  R +       + N ID+CWR   NW+ NRK+LA
Sbjct  69   VPTGIVNETRRELRQVGRGNKKPRRGRRYE-------SLNAIDKCWRGDKNWDKNRKKLA  121

Query  460  ACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLH  636
             C LGFGRK TGGKNG  YVVTD SD    +PKPGTLR+AV + +PLWIIF R MII+L 
Sbjct  122  DCVLGFGRKTTGGKNGPFYVVTDPSDTDLMNPKPGTLRYAVTRDRPLWIIFARSMIIKLQ  181

Query  637  QELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFG  816
            QELI+  DKTIDGRGA VHI+GGAG+TLQFV+NVIIH IYI  I +G+GGL+RD+E HFG
Sbjct  182  QELIITNDKTIDGRGANVHITGGAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEHHFG  241

Query  817  LRTMSDGDGIS  849
            LRT+SDGDGI+
Sbjct  242  LRTVSDGDGIN  252



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 165/247 (67%), Gaps = 11/247 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
             + +  +   + P + AHI ++D+ W +R   A    L +Y+ +P NVT  FN      +
Sbjct  9    FVFVALSLTVVVPSVQAHIAEYDEYWTQRQTNALRETLESYDPNPENVTDHFNYHAALAM  68

Query  313  EIREAIASNSTTRRLLR-------SKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            E    +   + TRR LR       +    G   + N ID+CWR   NW+ NRK+LA C L
Sbjct  69   ETTGIV---NETRRDLRQVGRGKKTTRRGGRFESLNAIDKCWRGDKNWDKNRKKLADCVL  125

Query  472  GFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELI  648
            GFGRK TGGKNG IYVVTD SDN    PKPGT+RHAV + +PLWIIF R MII+L QELI
Sbjct  126  GFGRKTTGGKNGPIYVVTDPSDNDLLKPKPGTIRHAVTRDRPLWIIFARSMIIKLQQELI  185

Query  649  MQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTM  828
            +  DKTIDGRGA+++I+GGAG+TLQFV+NVIIH I+I  I RG+GGL+ D+E HFGLRT+
Sbjct  186  ITNDKTIDGRGAKIYITGGAGLTLQFVRNVIIHNIHIKQIKRGAGGLIIDSEQHFGLRTV  245

Query  829  SDGDGIS  849
            SDGDGI+
Sbjct  246  SDGDGIN  252



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 169/250 (68%), Gaps = 11/250 (4%)
 Frame = +1

Query  127  GFMIILFFT-CVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            G  +  F + C+A+ AP + AH+  FD+ W +R   A    + +Y+ +PFNVT   N   
Sbjct  9    GSHVFAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLN--Y  66

Query  301  QKVLEIREAIASNSTTRRL------LRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAA  462
               L +    A N T R L       ++K   G  ++ N ID+CWR H NW  NRK+LA 
Sbjct  67   HAALAMETTGADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLAD  126

Query  463  CGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQ  639
            C LGFGRK TGGK G +YVVTD+SD+   +PKPGTLR+AV + +PLWIIF R MII+L Q
Sbjct  127  CVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQ  186

Query  640  ELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGL  819
            ELI+  DKTIDGRGA +HI+GGAG+TLQFVKNVIIH I+I  IV G+GG++RD+E HFG 
Sbjct  187  ELIINSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGH  246

Query  820  RTMSDGDGIS  849
            RT SDGDGI+
Sbjct  247  RTTSDGDGIN  256



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 169/250 (68%), Gaps = 11/250 (4%)
 Frame = +1

Query  127  GFMIILFFT-CVAM-APVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            G  +  F + C+A+ AP + AH+  FD+ W +R   A    + +Y+ +PFNVT   N   
Sbjct  9    GSHVFAFLSLCLAVVAPSIQAHVAVFDEYWTQRQAAALRQTIESYDPNPFNVTDHLN--Y  66

Query  301  QKVLEIREAIASNSTTRRL------LRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAA  462
               L +    A N T R L       ++K   G  ++ N ID+CWR H NW  NRK+LA 
Sbjct  67   HAALAMETTGADNGTRRELGQVGGGRKTKRRGGRYHSLNAIDKCWRGHRNWHKNRKKLAD  126

Query  463  CGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQ  639
            C LGFGRK TGGK G +YVVTD+SD+   +PKPGTLR+AV + +PLWIIF R MII+L Q
Sbjct  127  CVLGFGRKTTGGKKGPMYVVTDASDDDLMNPKPGTLRYAVTRDRPLWIIFGRSMIIKLQQ  186

Query  640  ELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGL  819
            ELI+  DKTIDGRGA +HI+GGAG+TLQFVKNVIIH I+I  IV G+GG++RD+E HFG 
Sbjct  187  ELIINSDKTIDGRGANIHITGGAGLTLQFVKNVIIHNIHIKTIVPGNGGMIRDSEHHFGH  246

Query  820  RTMSDGDGIS  849
            RT SDGDGI+
Sbjct  247  RTTSDGDGIN  256



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 155/221 (70%), Gaps = 8/221 (4%)
 Frame = +1

Query  193  DFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLR-SK  369
            D D  W+ R  EA + A+ +Y  +P  VT  FN  V ++L      +  +TTRR LR +K
Sbjct  41   DLDAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAELL------SKENTTRRNLRGNK  94

Query  370  HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVT-DSSDNPT  546
             Y GPC ATNPID CWRC  NW  NRK++  C  GFG+KATGGK+G IYVVT  + D+  
Sbjct  95   GYNGPCMATNPIDACWRCDPNWADNRKKIVGCAQGFGKKATGGKDGPIYVVTVGTDDDVQ  154

Query  547  DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQF  726
            +PKPGTLRHAVIQK PLWIIF R M+IRL QEL++  DKTIDGRGA V I  G GITLQF
Sbjct  155  NPKPGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRGANVVIEEGGGITLQF  214

Query  727  VKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VKNVI+  ++I  IV  +GG++RD+ DH GLRT SDGDGIS
Sbjct  215  VKNVILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGIS  255



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 168/242 (69%), Gaps = 8/242 (3%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            + ++FF   A APV  A+IGDFD+ W++R   AR  A   Y+SDP  V  + NR V +  
Sbjct  15   LYVVFFFLSASAPVSQANIGDFDEHWQQRKAAARAAAEAIYQSDPLEVANSLNRAVHRAT  74

Query  313  EIREAIASNSTTRRLLRSKH--YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
            +       ++ TRR +  KH  + GPC ATNPIDRCWRC  +W ++RKRLA C  GFGR 
Sbjct  75   K-----EDDAGTRRSMLGKHKKFAGPCRATNPIDRCWRCRKDWATDRKRLARCAQGFGRN  129

Query  487  ATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
            ATGG  G+ Y+VTD SD+    P+PGTLR AVIQ +PLWIIF R M+I+L +EL++  DK
Sbjct  130  ATGGLAGKFYIVTDGSDDDVLAPRPGTLRWAVIQAEPLWIIFARSMLIKLKEELLIGSDK  189

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            TIDGRGA+V I+ GA +T+Q+  NVIIH I+I++++ G GG++RD+  HFG RT SDGDG
Sbjct  190  TIDGRGAQVRIADGAQVTVQYAHNVIIHNIHINDLIVGKGGMIRDSPAHFGFRTQSDGDG  249

Query  844  IS  849
            ++
Sbjct  250  VN  251



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 166/249 (67%), Gaps = 12/249 (5%)
 Frame = +1

Query  106  ICSNKMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVA  285
            + ++K    ++I+  + V + P   A I  +D+  ++R   + E +   +  +P  +   
Sbjct  5    LSNHKFSILVLIIILSFVLLLPKSGAAIAKYDEYLKKRAQASLEESRKAFNPNPEELADD  64

Query  286  FNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
             N +V + L  RE        +R LR    +G C ATNPIDRCWRC  NW+ NRK+LA C
Sbjct  65   LNDQVSETL-TREG------GKRNLR----QGGCKATNPIDRCWRCDPNWDKNRKQLAEC  113

Query  466  GLGFGRKATGGKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
              GFG +ATGGK+GR YVVTD SDN  D PKPGTLRHAVIQ +PLWIIF R+M+I L +E
Sbjct  114  ARGFGHRATGGKSGRYYVVTDPSDNDMDKPKPGTLRHAVIQPQPLWIIFGRNMVITLKEE  173

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            LI   DKT+DGRGA VHI+ GAGITLQFV NVIIH I+IH+IV   GG++RDA DH GLR
Sbjct  174  LIFASDKTVDGRGAEVHIAYGAGITLQFVHNVIIHNIWIHDIVPEPGGMIRDAVDHIGLR  233

Query  823  TMSDGDGIS  849
            T SDGDGIS
Sbjct  234  TQSDGDGIS  242



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 154/221 (70%), Gaps = 8/221 (4%)
 Frame = +1

Query  193  DFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLR-SK  369
            D D  W+ R  EA + A+ +Y  +P  VT  FN EV K++      +  +TTRR LR +K
Sbjct  41   DLDAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGKLM------SKENTTRRNLRGNK  94

Query  370  HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVT-DSSDNPT  546
             Y GPC ATNP+D CWRC  NW +NRK++  C  GFG+K TGGK+G  YVVT  + D+  
Sbjct  95   AYTGPCMATNPMDACWRCDPNWANNRKKIVGCAQGFGKKTTGGKDGPFYVVTMGTDDDVQ  154

Query  547  DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQF  726
            +PKPGTLRHAVIQK PLWIIF + M+IRL QEL++  DKTID RGA V I  GAGITLQF
Sbjct  155  NPKPGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDARGANVVIEEGAGITLQF  214

Query  727  VKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VKNVII  ++I  IV   GGL+RD+ DH GLRT SDGDGIS
Sbjct  215  VKNVIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGIS  255



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 159/251 (63%), Gaps = 21/251 (8%)
 Frame = +1

Query  136  IILFFTCVA-MAPVLMA-----------HIGDFDDVWRRRHLEAREHALNTYESDPFNVT  279
            IILF  C+A + P L A           H+ +FD  W+ R   A+E     Y  DP+ V+
Sbjct  7    IILFLLCLAVLTPTLNANPLEKNEYWEEHVPEFDSYWQERAKVAKEANQAAYFVDPYAVS  66

Query  280  VAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLA  459
              F   V +++  + A       RR LR  +  G C ATNPIDRCWRC  NW +NR++LA
Sbjct  67   GNFTATVSEIIAAKSA-------RRSLRGNN-NGTCMATNPIDRCWRCDPNWANNRQKLA  118

Query  460  ACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLH  636
             C  GFGR   GGK G  YVVTD SDN   DPKPGTLRHAV +  PLWI F R M+I L 
Sbjct  119  DCVQGFGRNTRGGKGGPFYVVTDPSDNELLDPKPGTLRHAVTRNGPLWITFARSMVITLQ  178

Query  637  QELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFG  816
            QELIM  DKTIDGRG  V+I+ GAGIT+QFVKN+IIHGI I+NI    GG++RD+E H+G
Sbjct  179  QELIMSSDKTIDGRGVEVYIANGAGITVQFVKNIIIHGIKIYNIKVKEGGMIRDSESHYG  238

Query  817  LRTMSDGDGIS  849
             RT SDGDGIS
Sbjct  239  FRTKSDGDGIS  249



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 174/248 (70%), Gaps = 10/248 (4%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL-  312
            +I   T   + P L+A I  FD+VW++R  EA++  LN+Y  +P + T  FN EV   L 
Sbjct  8    LIFAITLATLIPALLADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNNTLV  67

Query  313  -------EIREAIASNSTTRRLLR-SKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACG  468
                   +    + +NST R L +  K Y GPC  TNPID+CWRC  NW  NRKRLA C 
Sbjct  68   DFDDDGNDAGFELLANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCA  127

Query  469  LGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQEL  645
            LGFGR+ATGG  GR+YVVT++SD+   +PKPGTLRHAVIQK+PLWIIF ++M IRL +EL
Sbjct  128  LGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNIRLSKEL  187

Query  646  IMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            IM   KTIDGRG  +HI+ GAGIT+QF++NVIIHGI IH+IV  SGG +RD+  H+G+RT
Sbjct  188  IMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVGHYGIRT  247

Query  826  MSDGDGIS  849
             SDGDGIS
Sbjct  248  NSDGDGIS  255



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 166/247 (67%), Gaps = 5/247 (2%)
 Frame = +1

Query  112  SNKMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            S    G +++     ++ A    A+IGD+D+ W++R L A   A  TY+ DPF VT  FN
Sbjct  7    SKPAAGSLVLYAVFLLSAAATSEANIGDYDEHWQKRKLMADAAAEATYKRDPFEVTNDFN  66

Query  292  REVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            R V +  E   A  S   ++R    K + GPC ATNPIDRCWRC  +W ++RKRLA C  
Sbjct  67   RAVHRSEEKETARRSLMLSKR----KKFAGPCKATNPIDRCWRCRDDWATDRKRLARCAQ  122

Query  472  GFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELI  648
            GFGR  TGG  G+ YVVTD +D+   +P+PGTLR  VIQ +PLWIIF ++MII L +EL+
Sbjct  123  GFGRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQDEPLWIIFGKNMIINLKEELM  182

Query  649  MQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTM  828
            +  DKT+DGRGA+V I+ GA +T+Q   NVIIH I++H+IV G GG++RD+ +HFG RT 
Sbjct  183  IGNDKTVDGRGAQVRITNGAQVTVQNSNNVIIHNIHVHDIVLGKGGMIRDSPEHFGFRTQ  242

Query  829  SDGDGIS  849
            SDGDGI+
Sbjct  243  SDGDGIT  249



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 170/249 (68%), Gaps = 11/249 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHI------GDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR  294
            +++   +   + P L A I      G FD VW+ R L+A + AL  Y+ +P  VT  FN 
Sbjct  7    LVLFMISFCILVPSLRASIANDSNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDDFNE  66

Query  295  EVQKVLEIR---EAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
             VQ+  ++    +   SN T R LL  K YKGPC ATNPIDRCWRC  +W ++RK+LA C
Sbjct  67   SVQEFDDLNFEDDDQVSNITGRHLL-GKKYKGPCKATNPIDRCWRCRKDWANDRKKLANC  125

Query  466  GLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
              GFGR+  GGK G  YVVTD SD N  DPKPGTLRHAVIQ +PLWIIF R M IRL QE
Sbjct  126  VKGFGRRTRGGKRGGFYVVTDPSDSNVVDPKPGTLRHAVIQPQPLWIIFARSMTIRLTQE  185

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            LI+   KTID RGA V I+ GAGITLQFV+NVIIHG++IH+IV GSGG +RD+ DHFG R
Sbjct  186  LILTSHKTIDARGANVRIAHGAGITLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTR  245

Query  823  TMSDGDGIS  849
            T SDGDGIS
Sbjct  246  TQSDGDGIS  254



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 167/247 (68%), Gaps = 14/247 (6%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F ++LF +    +    A+IGDFDD WR+R L A   A  TY+ DP  VT   NR V + 
Sbjct  17   FYLVLFLSAAVSSE---ANIGDFDDYWRQRKLMADAAAEATYKHDPLEVTNQLNRAVHRS  73

Query  310  LEIREAIASNSTTRRLL----RSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            +E  +     ST RR +    + K   GPC ATNPIDRCWRC  +W ++RKRLA C  GF
Sbjct  74   VEKEDM----STRRRAMMGHKKGKLNNGPCEATNPIDRCWRCRQDWATDRKRLARCAQGF  129

Query  478  GRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            GR  TGG  G+ YVVTD +D+   +P+PGTLR AVIQ +PLWI F R MII L +ELI+Q
Sbjct  130  GRNTTGGLAGKFYVVTDGTDDDVVNPRPGTLRWAVIQIEPLWITFARTMIITLKEELIIQ  189

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRG--SGGLVRDAEDHFGLRTM  828
            GDKTIDGRGA+V I+ GA +T+QF  NVIIH ++I++I+    +GG +RD+ DHFG RT+
Sbjct  190  GDKTIDGRGAQVRIANGAQLTVQFANNVIIHNVHINDIMSSNKNGGNIRDSPDHFGWRTV  249

Query  829  SDGDGIS  849
            SDGDGI+
Sbjct  250  SDGDGIT  256



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = +1

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
            ++ +  ++ ++TRR LR K YKGPC ATNPIDRCWRC +NW +NRK+LA+C  GFGRK  
Sbjct  19   DLEDDQSAGNSTRRNLRGKQYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTR  78

Query  493  GGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGK G  Y+VTDSSD N  DPKPGTLRHAVIQ +PLWIIF R M+IRL QELI+   KTI
Sbjct  79   GGKKGAYYIVTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTI  138

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            D RGA VHI+ GAGITLQFV+NVIIHG+ IH+ V GSGG++RD+  H G+RT SDGDGIS
Sbjct  139  DARGANVHIAHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGIS  198



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 162/244 (66%), Gaps = 5/244 (2%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
             + +  +   + P + AHI  +DD W +R   A    L +Y+ +P NVT  FN      +
Sbjct  9    FVFVSLSLTVVVPSVQAHIAVYDDYWTQRQTIALRQTLESYDPNPDNVTDHFNYHAALAM  68

Query  313  EIREAIASNSTTRRLLRSKHYK----GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFG  480
            E    +       R +RS   K    G   + N ID+CWR   NW+ NRK+LA C LGFG
Sbjct  69   ETTGIVNETRRDLRQVRSGKKKPRRGGRFESLNAIDKCWRGDKNWDKNRKKLADCVLGFG  128

Query  481  RKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQG  657
            RK TGGKNG IYVVTD SDN   +PKPGT+RHAV + +PLWI+F R MII+L QELI+  
Sbjct  129  RKTTGGKNGPIYVVTDPSDNDLLNPKPGTIRHAVTRDRPLWIVFARSMIIKLQQELIITN  188

Query  658  DKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDG  837
            DKTIDGRGAR++I+GGAG+TLQFV+NVIIH ++I  I +G GG++RD+E H+G RTMSDG
Sbjct  189  DKTIDGRGARIYITGGAGLTLQFVRNVIIHNVHIKLIKKGVGGVIRDSEHHYGHRTMSDG  248

Query  838  DGIS  849
            DGI+
Sbjct  249  DGIN  252



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 165/241 (68%), Gaps = 10/241 (4%)
 Frame = +1

Query  139  ILFFTCVAMA---PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            + F   VA A   P L A I +FDD  + +  EA E AL +YE DP NVT  FN  V + 
Sbjct  8    VTFIFLVAFAISIPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRA  67

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            L     +  ++ TRR L+ K Y+GPC ATNPIDRCWRC  +W  +R RLA+CG GFGR+A
Sbjct  68   L-----MEESNDTRRELKQK-YRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKGFGRRA  121

Query  490  TGGKNGRIYVVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
             GG +G+IYVVTDSSD+ P +P+PGTLR+ V+Q++PLWIIF + M+I L  EL++  DKT
Sbjct  122  VGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLISSDKT  181

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRGA V I GGAG+ +QFV N+IIHGI I+ I    G ++RD  +H G+RT  DGD +
Sbjct  182  IDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAV  241

Query  847  S  849
            S
Sbjct  242  S  242



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 154/221 (70%), Gaps = 8/221 (4%)
 Frame = +1

Query  193  DFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLR-SK  369
            D D  W+ R  EA + A+ +Y  +P      F+  V ++L      +  +TTRR LR +K
Sbjct  41   DLDAYWKERAQEALKEAMESYHKNPEQAAEEFHTGVAELL------SKENTTRRNLRGNK  94

Query  370  HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-  546
             Y GPC ATNPID CWRC +NW +NRK++  C  GFG+KATGGK+G IYVVT  +DN   
Sbjct  95   GYNGPCMATNPIDACWRCDANWANNRKKIVGCAQGFGKKATGGKDGPIYVVTVGTDNDVQ  154

Query  547  DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQF  726
            +PKPGTLRHAVIQK PLWIIF R M+IRL QEL++  DKTIDGRGA V I  G GITLQF
Sbjct  155  NPKPGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRGANVVIEEGGGITLQF  214

Query  727  VKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VKNVII  ++I  IV   GG++RD+ DH GLRT SDGDGIS
Sbjct  215  VKNVIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGIS  255



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 165/241 (68%), Gaps = 10/241 (4%)
 Frame = +1

Query  139  ILFFTCVAMA---PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            + F   VA A   P L A I +FDD  + +  EA E AL +YE DP NVT  FN  V + 
Sbjct  8    VTFIFLVAFAISIPCLEAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRA  67

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            L     +  ++ TRR L+ K Y+GPC ATNPIDRCWRC  +W  +R RLA+CG GFGR+A
Sbjct  68   L-----MEESNDTRRELKQK-YRGPCLATNPIDRCWRCRKDWAQDRYRLASCGKGFGRRA  121

Query  490  TGGKNGRIYVVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
             GG +G+IYVVTDSSD+ P +P+PGTLR+ V+Q++PLWIIF + M+I L  EL++  DKT
Sbjct  122  VGGLHGKIYVVTDSSDDEPINPRPGTLRYGVLQREPLWIIFAQSMVITLKFELLISSDKT  181

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRGA V I GGAG+ +QFV N+IIHGI I+ I    G ++RD  +H G+RT  DGD +
Sbjct  182  IDGRGANVVIKGGAGLAMQFVNNIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAV  241

Query  847  S  849
            S
Sbjct  242  S  242



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 174/248 (70%), Gaps = 10/248 (4%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL-  312
            +I   T   + P L+A I  FD+VW++R  EA++  LN+Y  +P + T  FN EV   L 
Sbjct  8    LIFAITLATLIPGLLADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNNTLV  67

Query  313  -------EIREAIASNSTTRRLLR-SKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACG  468
                   +    + +NST R L +  K Y GPC  TNPID+CWRC  NW  NRKRLA C 
Sbjct  68   DFDDDRNDAGFELHANSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCA  127

Query  469  LGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQEL  645
            LGFGR+ATGG  GR+YVVT++SD+   +PKPGTLRHAVIQK PLWIIF ++M IRL +EL
Sbjct  128  LGFGRRATGGLKGRVYVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNIRLSKEL  187

Query  646  IMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            IM   KTIDGRG  +HI+ GAGIT+QF++NVIIHGI IH+IV  SGG +RD+ +H+G+RT
Sbjct  188  IMTSHKTIDGRGHHIHIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVEHYGIRT  247

Query  826  MSDGDGIS  849
             SDGDGIS
Sbjct  248  NSDGDGIS  255



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   252 bits (643),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 164/243 (67%), Gaps = 17/243 (7%)
 Frame = +1

Query  130  FMIILF--FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQ  303
            F+I LF  FT VA       +IG  D VW+ R   A++ A   Y+ +P  V    N  V 
Sbjct  10   FLISLFVVFTTVA------GNIGVHDAVWQERREAAKKAARQAYQPNPGEVLDHLNENVH  63

Query  304  KVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGR  483
            K +E      SN+  R L +   YKG C ATNPID+CWRC  NW +NRK+L  C LGFGR
Sbjct  64   KSVE-----GSNNQRRGLSK---YKGSCLATNPIDQCWRCQPNWANNRKKLVDCALGFGR  115

Query  484  KATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGD  660
              TGGK G++YVVTD SD+    PK GTLRHAVIQ +PLWIIFK +M IRL +ELIM  +
Sbjct  116  HTTGGKAGKMYVVTDPSDSDLVSPKKGTLRHAVIQPEPLWIIFKNNMNIRLSEELIMTSN  175

Query  661  KTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGD  840
            KTIDGRGA+VHI+ GAGITLQ++ NVIIH I +H+I  G+GG++RD+  H+G RT SDGD
Sbjct  176  KTIDGRGAQVHIANGAGITLQYIHNVIIHNIRVHDIKTGNGGMIRDSATHYGFRTRSDGD  235

Query  841  GIS  849
            GIS
Sbjct  236  GIS  238



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 163/248 (66%), Gaps = 9/248 (4%)
 Frame = +1

Query  127  GFMIILF--FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREV  300
            G  +I+F   +   +AP + AHI  FDD W +R   A    + +YE +P NVT  FN   
Sbjct  9    GSYVIVFVSLSIAIVAPSVQAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFN--Y  66

Query  301  QKVLEIREAIASNSTTRRLLRSKHYK----GPCNATNPIDRCWRCHSNWESNRKRLAACG  468
               L +    A N   R L + K  +    G   + N IDRCWR   NW  NRK+LA C 
Sbjct  67   HAALAMETTGADNGPRRELGQVKAGQKTRGGRFRSLNAIDRCWRGDKNWAKNRKKLADCV  126

Query  469  LGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQEL  645
            LGFG K  GGKNG IYVVTD+SD+    PKPGTLRHAV + +PLWIIF R M+I+L QEL
Sbjct  127  LGFGLKTIGGKNGPIYVVTDASDDDLLSPKPGTLRHAVTRDRPLWIIFARTMVIKLQQEL  186

Query  646  IMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            ++  DKTIDGRG  V+I+GGAG TLQFVKNVIIH I++  I RG GGL+RD+E+HFGLRT
Sbjct  187  MITNDKTIDGRGVSVYITGGAGFTLQFVKNVIIHNIHMKFIKRGFGGLIRDSEEHFGLRT  246

Query  826  MSDGDGIS  849
            +SDGDGI+
Sbjct  247  ISDGDGIN  254



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   253 bits (645),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 172/260 (66%), Gaps = 21/260 (8%)
 Frame = +1

Query  127  GFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
             FM + +F  +   P LMA +  +D VW+ R  EAR++ +  Y+ DP  VT   N +V  
Sbjct  7    AFMFVFWFGFIT--PNLMADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNEQVNH  64

Query  307  VLEIR----------------EAIASNSTTRRLLRSKH--YKGPCNATNPIDRCWRCHSN  432
             ++                  E  A  + TRR L+ K   Y GPC A NPID+CWRC  N
Sbjct  65   QIDGNAKTNSTINHTKGTNNFETGAEANNTRRSLKQKKQKYNGPCQANNPIDKCWRCRKN  124

Query  433  WESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIF  609
            W  +R+RLA+C LGFGR+ TGGK G+IYVVTD+SD+   +PKPGTLRHAVIQK+PLWIIF
Sbjct  125  WVKDRQRLASCALGFGRRTTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPLWIIF  184

Query  610  KRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGL  789
              DM I+L QELIM  +KTIDGRG  VHIS GAGIT+QFV N+IIHG+ IH+I    GG+
Sbjct  185  ACDMNIKLSQELIMAHNKTIDGRGFNVHISHGAGITIQFVSNIIIHGLRIHHICSTCGGM  244

Query  790  VRDAEDHFGLRTMSDGDGIS  849
            +RD+ DH GLRT SDGDGIS
Sbjct  245  IRDSVDHVGLRTASDGDGIS  264



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 170/245 (69%), Gaps = 9/245 (4%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            ++ G  +I  F+   + P L AHI + ++VWRRR  EA +     Y+ +P  V    N +
Sbjct  2    ELAGLRLIFLFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMK  61

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            VQ +   ++AIA     R LL ++   G C ATNPID+CWRC  NW  +R+ LA C LGF
Sbjct  62   VQDL--SKQAIAK----RGLLNAE--SGQCEATNPIDKCWRCKENWAEDRQALAGCALGF  113

Query  478  GRKATGGKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            G KATGGK G+IY VTD SDN  + PK GTLRHAVIQK+PLWIIF +DM I+L QELI+Q
Sbjct  114  GSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQ  173

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
            G KTIDGRGA+VHI+ GAGI LQFVKNVIIHGI+IHNI   SGG++RD+ DH G R  SD
Sbjct  174  GSKTIDGRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSD  233

Query  835  GDGIS  849
            GD +S
Sbjct  234  GDAVS  238



>gb|KDO49230.1| hypothetical protein CISIN_1g036607mg [Citrus sinensis]
Length=436

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 170/245 (69%), Gaps = 9/245 (4%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            ++ G  +I  F+   + P L AHI + ++VWRRR  EA +     Y+ +P  V    N +
Sbjct  2    ELAGLRLIFLFSFATLMPCLSAHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMK  61

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
            VQ +   ++AIA     R LL ++   G C ATNPID+CWRC  NW  +R+ LA C LGF
Sbjct  62   VQDL--SKQAIAK----RGLLNAE--SGQCAATNPIDKCWRCKENWAEDRQALAGCALGF  113

Query  478  GRKATGGKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            G KATGGK G+IY VTD SDN  + PK GTLRHAVIQK+PLWIIF +DM I+L QELI+Q
Sbjct  114  GSKATGGKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQ  173

Query  655  GDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSD  834
            G KTIDGRGA+VHI+ GAGI LQFVKNVIIHGI+IHNI   SGG++RD+ DH G R  SD
Sbjct  174  GSKTIDGRGAKVHIANGAGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSD  233

Query  835  GDGIS  849
            GD +S
Sbjct  234  GDAVS  238



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 165/243 (68%), Gaps = 13/243 (5%)
 Frame = +1

Query  145  FFTC----VAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            FF C    +A A +  A I + DD W+++  EA   +   Y  DP  VT  FN+ V   L
Sbjct  10   FFLCSLIFLASAALSGADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLAL  69

Query  313  EIREAIASNSTTRRLLRS---KHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGR  483
                A A NST RR LR+   K +KG C ATNPIDRCWRC  NW  +RK+LA CG GFGR
Sbjct  70   ----AEARNST-RRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKKLATCGKGFGR  124

Query  484  KATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGD  660
             ATGGK G  YVVTD SD+   +PK GTLR  VIQ +PLWI+F RDMIIRL +EL++  +
Sbjct  125  HATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIRLSEELMINSN  184

Query  661  KTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGD  840
            KTID RGA VHI+ GA IT+QFV NVIIHG++IH+I   +GG++RD+  HFGLRT SDGD
Sbjct  185  KTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGD  244

Query  841  GIS  849
            GIS
Sbjct  245  GIS  247



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 169/254 (67%), Gaps = 10/254 (4%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMA---HIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAF  288
            K+    ++  F+   + P L     +I DFDDVW+RR  +A ++ L  YE  P NVT  F
Sbjct  2    KITKAQLVFLFSFATLIPTLWGGGGNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSKF  61

Query  289  NREVQKVLEIREAIASN----STTRRLLRSKH--YKGPCNATNPIDRCWRCHSNWESNRK  450
            N  V K L   ++  +     S  RR LR KH  Y GPC ATNPIDRCWRC  +W  NRK
Sbjct  62   NENVHKALVANKSNKTKDLEGSEDRRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRK  121

Query  451  RLAACGLGFGRKATGGKNGRIYVVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMII  627
            RL  C +GFG +  GG+ G+ Y VTD+SD+ P +PKPGTLR AVIQK+PLWIIF  DM I
Sbjct  122  RLTQCVIGFGHRTEGGEKGKYYEVTDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMHI  181

Query  628  RLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAED  807
            +L +ELI+Q  KTIDGRGA VHI+ GAGITLQFV +VIIH I+IH+I     GL+RD+ D
Sbjct  182  KLSRELIVQSKKTIDGRGANVHIAHGAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSVD  241

Query  808  HFGLRTMSDGDGIS  849
            H GLRT  DGDGI+
Sbjct  242  HIGLRTTGDGDGIN  255



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 165/243 (68%), Gaps = 13/243 (5%)
 Frame = +1

Query  145  FFTC----VAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            FF C    +A A +  A I + DD W+++  EA   +   Y  DP  VT  FN+ V   L
Sbjct  10   FFLCSLIFLASAALSGADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLAL  69

Query  313  EIREAIASNSTTRRLLRS---KHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGR  483
                A A NST RR LR+   K +KG C ATNPIDRCWRC  NW  +RK+LA CG GFGR
Sbjct  70   ----AEARNST-RRSLRAVGVKKFKGKCVATNPIDRCWRCQKNWIKHRKKLATCGKGFGR  124

Query  484  KATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGD  660
             ATGGK G  YVVTD SD+   +PK GTLR  VIQ +PLWI+F RDMIIRL +EL++  +
Sbjct  125  HATGGKAGDFYVVTDPSDDDLVNPKFGTLRWGVIQDRPLWIVFARDMIIRLSEELMINSN  184

Query  661  KTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGD  840
            KTID RGA VHI+ GA IT+QFV NVIIHG++IH+I   +GG++RD+  HFGLRT SDGD
Sbjct  185  KTIDARGANVHIAYGAQITIQFVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGD  244

Query  841  GIS  849
            GIS
Sbjct  245  GIS  247



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 141/183 (77%), Gaps = 5/183 (3%)
 Frame = +1

Query  310  LEIREAIASNSTTRRLLRSKH--YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGR  483
            LE ++ I +  +TRR LR KH  Y GPC A NPIDRCWRC  NW  NRKRLA C LGFG 
Sbjct  6    LEFKDVITN--STRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAKNRKRLAKCVLGFGH  63

Query  484  KATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGD  660
            K  GGK G  Y+VTD+SD+   +PKPGTLRHAVIQK+PLWIIF  DM I+L QEL++Q  
Sbjct  64   KTRGGKKGEYYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQELMVQSH  123

Query  661  KTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGD  840
            KTIDGRGA VHI+ G GITLQFV NVIIH I+IH +VR SGGL+RD+EDH+G RT+ DGD
Sbjct  124  KTIDGRGANVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGD  183

Query  841  GIS  849
            GIS
Sbjct  184  GIS  186



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   248 bits (633),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 154/220 (70%), Gaps = 6/220 (3%)
 Frame = +1

Query  193  DFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKH  372
            D D  W++R  EA + AL +Y  +P  VT  FN EV K++     +  N+T R L  +K 
Sbjct  41   DLDAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLM-----LKENTTRRNLRGNKA  95

Query  373  YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVT-DSSDNPTD  549
            YKGPC ATNPID CWRC   W +NRK++  C  GFG+KATGGK+G  YVVT  + D+  +
Sbjct  96   YKGPCMATNPIDACWRCDPYWANNRKKIVGCAQGFGKKATGGKDGPFYVVTMGTDDDVQN  155

Query  550  PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFV  729
            PKPGTLRHAVIQK PLWIIF + M+IRL QEL++  DKTID RGA V I  GAGITLQFV
Sbjct  156  PKPGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDARGANVVIEEGAGITLQFV  215

Query  730  KNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            KNVII  ++I  IV   GG++RD+ DH GLRT SDGDGIS
Sbjct  216  KNVIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGIS  255



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 168/263 (64%), Gaps = 33/263 (13%)
 Frame = +1

Query  154  CVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR------------  294
            C+A + P + A++ + D+ W  +  EAR+H L  Y  DP+++   F+             
Sbjct  14   CIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGT  73

Query  295  ---------EVQKVLEIREAIASNSTTRRLLRSKH--------YKGPCNATNPIDRCWRC  423
                     E + V+E+  +    ++TRR L  K          KGPC A+NPID+CWRC
Sbjct  74   EEDKAVDSAEDEDVIEMTSS--PTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRC  131

Query  424  HSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLW  600
              +W   RKRL  C  GFG + TGGK GRIYVVT   D+ T +P+PGTLRHAVIQK+PLW
Sbjct  132  QPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLW  191

Query  601  IIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGS  780
            IIFK DM IRL QEL++   KTID RGA VHI+ GAGIT+Q+VKN+IIHG+++H+IV  S
Sbjct  192  IIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVKNIIIHGLHVHHIVTSS  251

Query  781  GGLVRDAEDHFGLRTMSDGDGIS  849
            GGL+RD+ DHFG R  +DGDGIS
Sbjct  252  GGLIRDSIDHFGQRGQADGDGIS  274



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 149/218 (68%), Gaps = 7/218 (3%)
 Frame = +1

Query  199  DDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYK  378
            D  W+ +   A +     Y  DP+ V+            I E I      RR LR +   
Sbjct  41   DSYWKEKAEIAAKANEEAYTPDPYAVSGNLTST------ISEMIIGGKKGRRNLRGRKTA  94

Query  379  GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPK  555
            GPC ATNPIDRCWRC  NW +NRK+LA C  GFGRK TGGK G  YVVTD SD+   +P+
Sbjct  95   GPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTDPSDSDMVNPR  154

Query  556  PGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKN  735
            PGTLRHAV +  PLWIIF R M IRL+QELIM  DKTIDGRGA + I+ GAGIT+Q+++N
Sbjct  155  PGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANGAGITIQYIRN  214

Query  736  VIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VIIHGI + +IV GSGGLVRD+E+H+GLRTMSDGDGIS
Sbjct  215  VIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGIS  252



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 166/238 (70%), Gaps = 9/238 (4%)
 Frame = +1

Query  139  ILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEI  318
            ++FF  V +   + A+I +FD+VW+ R  +A++ A ++Y   P  V    N+ V K  E 
Sbjct  8    LIFFVLVTLVLSIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHKWEE-  66

Query  319  REAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGG  498
                 SNST R L +   Y GPC +TNPIDRCWRC  NW  NR +LA C LGFG   TGG
Sbjct  67   ----GSNSTRRDLHK---YDGPCMSTNPIDRCWRCDPNWVKNRMKLADCVLGFGHHTTGG  119

Query  499  KNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDG  675
            K G+IYVVTD SD+   +PKPGTLRHAVIQ +PLWIIFK  M+IRL+QELIM  +KTID 
Sbjct  120  KGGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSNKTIDA  179

Query  676  RGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            RG +VHI+ GA   LQF+ NVIIHG++IH+I  G+GGL+RD+ +H+G R+ SDGDGIS
Sbjct  180  RGQKVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGIS  237



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   248 bits (632),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 171/273 (63%), Gaps = 29/273 (11%)
 Frame = +1

Query  118  KMKGFMIILF-FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN-  291
            +M   + ++F F    + P + A++ + D+ W +R  EARE  L  Y S+P+ V   F+ 
Sbjct  2    EMTRLLKLMFTFYIAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHE  61

Query  292  REVQKVLEIREAIASN--------------------STTRRLLRSKH------YKGPCNA  393
            R      +++E    +                    ++TRR+LR K        KGPC A
Sbjct  62   RHYDNSTDVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKGPCTA  121

Query  394  TNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLR  570
            +NPID+CWRC SNW   RK L  C  GFG    GGK GRIYVVT + D +  +PKPGTLR
Sbjct  122  SNPIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLR  181

Query  571  HAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHG  750
            HAVIQK+PLWIIFK DM IRL QEL++   KTID RG  VHI+ GAGIT+QFV++VIIHG
Sbjct  182  HAVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGTDVHIAHGAGITIQFVRHVIIHG  241

Query  751  IYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            + IH+I + +GG++RD+ DHFG+RT +DGDGIS
Sbjct  242  LRIHHICQSNGGMIRDSTDHFGMRTKADGDGIS  274



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 168/263 (64%), Gaps = 33/263 (13%)
 Frame = +1

Query  154  CVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR------------  294
            C+A + P ++A++ + D+ W  +  EAR+H L  Y  DP+++   F+             
Sbjct  14   CIASLIPTILANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGT  73

Query  295  ---------EVQKVLEIREAIASNSTTRRLLRSKH--------YKGPCNATNPIDRCWRC  423
                     E + V+E+  +    ++TRR L  K          KGPC A+NPID+CWRC
Sbjct  74   EEDKAVDSTEDEDVIEMTSS--PTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRC  131

Query  424  HSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLW  600
              +W   RKRL  C  GFG + TGGK GRIYVVT   D+ T +P+PGTLRHAVIQK+PLW
Sbjct  132  QPDWARRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLW  191

Query  601  IIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGS  780
            IIFK DM IRL QEL++   KTID RGA VHI+ GAGIT+Q+V N+IIHG+++H+IV  S
Sbjct  192  IIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVSSS  251

Query  781  GGLVRDAEDHFGLRTMSDGDGIS  849
            GGL+RD+ DHFG R  +DGDGIS
Sbjct  252  GGLIRDSIDHFGQRGQADGDGIS  274



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 163/237 (69%), Gaps = 9/237 (4%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
             F     +   + A+IG+FD+VWR R  +A ++A  +Y   P  V    N+ V +  E  
Sbjct  10   FFVILCTLVFSIEANIGEFDEVWRTRATQANKNAKESYNPHPEKVAANLNKHVHRSEE--  67

Query  322  EAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGK  501
                SNST R L +   Y GPC ATNPIDRCWRC  +W  NR++LA C LGFG   TGGK
Sbjct  68   ---GSNSTRRDLHK---YNGPCVATNPIDRCWRCDPHWAKNRQKLADCVLGFGHHTTGGK  121

Query  502  NGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGR  678
             G+IY+VTD  DN   +PKPGTLRHAVIQ  PLWIIF   M+I+L+QELIM GDKTID R
Sbjct  122  GGKIYIVTDPGDNDMVNPKPGTLRHAVIQPGPLWIIFAHHMVIKLNQELIMTGDKTIDAR  181

Query  679  GARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            G +VHI+GGA + LQ++ NVIIHG++IH+I  G+GGL+RD+ +H+G RT SDGDGIS
Sbjct  182  GQQVHITGGASLMLQYINNVIIHGLHIHDIKSGNGGLIRDSINHYGFRTRSDGDGIS  238



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 154/239 (64%), Gaps = 3/239 (1%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            II+        P L   IG+FDD  + + LEA E AL +Y  DP N+T   N  V   L 
Sbjct  10   IIILVAFAITIPCLEGGIGEFDDFLKGQALEAHEIALESYVPDPVNMTDDLNINVHGALT  69

Query  316  IREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                  SN T R L   + Y GPC A NPIDRCWRC   W  NR +LA C  GFGRKATG
Sbjct  70   EVFKEESNHTRREL--KQKYGGPCLALNPIDRCWRCKKGWAKNRFKLAHCAKGFGRKATG  127

Query  496  GKNGRIYVVTD-SSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            G  G++Y+V D S D+P +PKPGTLR  V+QK+PLWIIF R MII+L+ EL++  DKTID
Sbjct  128  GLEGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPLWIIFARSMIIKLNYELLISSDKTID  187

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA V I  G+G+T+QFV NVIIHG+ + NI    GG +RD+ +H G+RT +DGD IS
Sbjct  188  GRGANVMIKDGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVGIRTKADGDAIS  246



>ref|XP_010322971.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=302

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 173/262 (66%), Gaps = 27/262 (10%)
 Frame = +1

Query  115  NKMKGFMII--LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAF  288
            N+   F+I+  LFF+       + A+IG+FD+VWR R  +A ++A  +Y  +P  V   F
Sbjct  6    NRSSFFVILCTLFFS-------IEANIGEFDEVWRTRATQANKNAKESYNPNPEKVAANF  58

Query  289  NREVQK--------------VLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCH  426
            N+ V +              +L  R    SNST R L +   Y GPC ATNPIDRCWRC 
Sbjct  59   NKHVHRQVFSWYSQPSHFHLILICRSEEGSNSTRRDLHK---YNGPCVATNPIDRCWRCD  115

Query  427  SNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWI  603
             +W  NR++LA C LGFG   TGGK G+IY VTD  D +  +PK GTLRHAVIQ  PLWI
Sbjct  116  PHWAKNRQKLADCVLGFGHHTTGGKGGKIYEVTDPGDTDMVNPKQGTLRHAVIQPGPLWI  175

Query  604  IFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSG  783
            IF   M+I+L+QELIM GDKTID RG +VHI+GGA + LQ++ NVIIHG++IH+I  G+G
Sbjct  176  IFAHHMVIKLNQELIMTGDKTIDARGQQVHITGGASLMLQYINNVIIHGLHIHDIKAGNG  235

Query  784  GLVRDAEDHFGLRTMSDGDGIS  849
            GL+RD+ +H+G RT SDGDGIS
Sbjct  236  GLIRDSINHYGFRTKSDGDGIS  257



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 158/242 (65%), Gaps = 4/242 (2%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDV-WRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
             + LFF   A  P   A+  D  DV W+ R   AR   L  Y  +P  +   FN++ ++ 
Sbjct  26   FLFLFFISAAFIPTSGANYTDSHDVYWQERAALARARILQAYNPNPEAIVTDFNQKTKEA  85

Query  310  LEIREAI-ASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
            LE  +   A ++ TRR L  K Y GPC ATNPIDRCWRC+ NW  NR++LA C  GFG  
Sbjct  86   LEHSQVNRAPHNGTRRNLGRK-YMGPCVATNPIDRCWRCNPNWALNRQKLADCAQGFGAA  144

Query  487  ATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
            ATGGK G IYVV D SDN   +PKPGTLRHAVIQ  PLWIIF   M I+L+QELIM  DK
Sbjct  145  ATGGKFGPIYVVRDPSDNDMMNPKPGTLRHAVIQPGPLWIIFSHSMNIKLNQELIMTSDK  204

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            TIDGRGA + I+GGAG+T+QFV N+II  + I NIV   GG +RD+ +HFG RT SDGD 
Sbjct  205  TIDGRGALIQITGGAGLTIQFVHNIIITNLKITNIVPSPGGTIRDSVNHFGFRTGSDGDA  264

Query  844  IS  849
            I+
Sbjct  265  IN  266



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 164/249 (66%), Gaps = 9/249 (4%)
 Frame = +1

Query  121  MKGFMIILFFTCVAMA---PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN  291
            M G    + F  + +A   P L A I +FDD  + +   AR+ AL +Y  +P N+T   N
Sbjct  1    MAGITRKITFIVLILAITIPCLEAGIAEFDDYLKEQADLARQIALKSYVPNPENITTELN  60

Query  292  REVQKVLEIREAIASNSTTRRLLRSKHYKGP--CNATNPIDRCWRCHSNWESNRKRLAAC  465
              V   +E  EA  SNST R L + + + G   C ++NPID CWRC  +W  NR++LA C
Sbjct  61   LHVNMAME--EAY-SNSTRRELRQRQKHGGSSACMSSNPIDNCWRCKKDWAQNRQQLAQC  117

Query  466  GLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
            G GFGRKA GG  G+ YVVTD SDN    PK GTLR+  +QK PLWIIF R MIIRL+QE
Sbjct  118  GKGFGRKAVGGLGGKFYVVTDESDNDLVTPKFGTLRYGAVQKGPLWIIFARSMIIRLNQE  177

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            L++  DKTIDGRGA VHI  GAGIT+QFV NVIIHG++I NI   SGG++RD+ +H GLR
Sbjct  178  LLVSSDKTIDGRGANVHIRDGAGITMQFVNNVIIHGLHIRNIKARSGGMIRDSYNHVGLR  237

Query  823  TMSDGDGIS  849
            T SDGD +S
Sbjct  238  TRSDGDALS  246



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 163/240 (68%), Gaps = 12/240 (5%)
 Frame = +1

Query  139  ILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEI  318
            +LF +  A++    A+IG+FD+ W+RR LEAR  A  TY  +P  V  + NR V + L  
Sbjct  17   VLFLSAAAVSE---ANIGEFDEHWQRRKLEARARAEATYHPNPIEVANSLNRAVHRSLR-  72

Query  319  REAIASNSTTRRLLRSKHYK--GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
                   S +RR L   H K  GPC ATNPIDRCWRC  +W ++R RLA C  GFGR AT
Sbjct  73   -----DESGSRRKLLGLHKKFAGPCTATNPIDRCWRCRKDWATDRMRLARCAQGFGRNAT  127

Query  493  GGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GG  G+IY+VTD +D+   +P+PGTLR  VIQ +PLWIIF R M+I+L +EL++  DKTI
Sbjct  128  GGLGGKIYIVTDGTDDDVLEPRPGTLRWGVIQNEPLWIIFARPMLIKLKEELLVGSDKTI  187

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            DGRGA+V I+ GA +T+Q+  NVIIH I++++++ G GG +RD+  H G RT SDGDG+S
Sbjct  188  DGRGAQVRIADGAQVTVQYSHNVIIHNIHVNDLIVGKGGRIRDSPQHAGFRTQSDGDGVS  247



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 167/263 (63%), Gaps = 33/263 (13%)
 Frame = +1

Query  154  CVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR------------  294
            C+A + P + A++ + D+ W  +  EAR+H L  Y  DP+++   F+             
Sbjct  14   CIASLIPTIRANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGT  73

Query  295  ---------EVQKVLEIREAIASNSTTRRLLRSKH--------YKGPCNATNPIDRCWRC  423
                     E + V+E+  +    ++TRR L  K          KGPC A+NPID+CWRC
Sbjct  74   EEDTAVDSAEDEDVIEMTSS--PTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRC  131

Query  424  HSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLW  600
              +W   RKRL  C  GFG + TGGK GRIYVVT   D+ T +P+PGTLRHAVIQK+PLW
Sbjct  132  QPDWAKRRKRLVRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLW  191

Query  601  IIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGS  780
            IIFK DM IRL QEL++   KTID RGA VHI+ GAGIT+Q+V N+IIHG+++H+IV  S
Sbjct  192  IIFKHDMSIRLSQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVTSS  251

Query  781  GGLVRDAEDHFGLRTMSDGDGIS  849
            GGL+RD+ DHFG R  +DGDGIS
Sbjct  252  GGLIRDSIDHFGQRGQADGDGIS  274



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 146/193 (76%), Gaps = 9/193 (5%)
 Frame = +1

Query  274  VTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKR  453
            VT  FN++V + L+      +N+T R L   + Y GPC ATNPIDRCWRC  NW  NRK+
Sbjct  1    VTNNFNKQVHRSLD-----GANNTRRHL---RKYTGPCLATNPIDRCWRCDRNWARNRKK  52

Query  454  LAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIR  630
            LA C LGFGR  TGGK+G+IYVV DSSDN   +PKPGTLRHAVIQ++PLWIIF  DM+IR
Sbjct  53   LADCALGFGRGTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIR  112

Query  631  LHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDH  810
            L +ELIM  +KT+DGRGA VHI+ G  ITLQFV+N+IIH ++IH+I  G+GG +RD+  H
Sbjct  113  LSEELIMTDNKTLDGRGANVHIANGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSH  172

Query  811  FGLRTMSDGDGIS  849
            +G RT SDGDGIS
Sbjct  173  YGYRTQSDGDGIS  185



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 160/239 (67%), Gaps = 11/239 (5%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L  T   + P L A I +FDD  + +  EA + AL++Y  +P +V    N  V   LE  
Sbjct  16   LLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMALE--  73

Query  322  EAIASNSTTRRLLRSKHYKG--PCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                  ++TRR LR +  +G   C A+NPID CWRC+ +W ++R RLA CG GFGR+ATG
Sbjct  74   ------NSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRATG  127

Query  496  GKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            G  G IYVVTD+SD+   +PKPGT+RHAV QK PLWIIF   MII L QEL++  DKTID
Sbjct  128  GLGGPIYVVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKTID  187

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA V   GGAG+T+QFV NVIIHG+ I +IV   GG++RD+ DH+GLRT SDGD IS
Sbjct  188  GRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAIS  246



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 140/183 (77%), Gaps = 5/183 (3%)
 Frame = +1

Query  310  LEIREAIASNSTTRRLLRSKH--YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGR  483
            LE ++ I +  +TRR LR KH  Y GPC A NPIDRCWRC  NW  NRKRLA C LGFG 
Sbjct  6    LEFKDVITN--STRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAKNRKRLAKCVLGFGH  63

Query  484  KATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGD  660
            K  GGK G  Y+VTD+SD+   +PKPGTLRHAVIQK+PLWIIF  DM I+L +EL++Q  
Sbjct  64   KTRGGKKGEYYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKELMVQSH  123

Query  661  KTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGD  840
            KTIDGRG  VHI+ G GITLQFV NVIIH I+IH +VR SGGL+RD+EDH+G RT+ DGD
Sbjct  124  KTIDGRGVNVHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGD  183

Query  841  GIS  849
            GIS
Sbjct  184  GIS  186



>ref|XP_006579282.1| PREDICTED: probable pectate lyase P59-like [Glycine max]
Length=420

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = +1

Query  331  ASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGR  510
             SN++ R L  S  Y GPC ATNPID+CWRC  NWE NRKRLA C LGFG   TGGK+G+
Sbjct  3    GSNNSRRGL--SNQYDGPCKATNPIDKCWRCDPNWEKNRKRLADCALGFGHGTTGGKDGK  60

Query  511  IYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGAR  687
            IYVV DSSDN   +PKPGTLRHA IQ++PLWIIF R+M I+LH EL++  +KTID RGA 
Sbjct  61   IYVVNDSSDNDLVNPKPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNKTIDARGAN  120

Query  688  VHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VHIS GA ITLQ+VKN+IIHG++IH+I + SGGL+RD+ DH+G+R MSDGD IS
Sbjct  121  VHISEGAQITLQYVKNIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDAIS  174



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 157/215 (73%), Gaps = 13/215 (6%)
 Frame = +1

Query  223  LEAREH-----ALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPC  387
            LEAR H     A   YE DP     A +R +  ++ + E  + N   R+L R  H  GPC
Sbjct  78   LEARAHQSWLEAQAAYEPDP----EAVSRNLTHLVHM-ELPSGNHMRRQLGRRWH--GPC  130

Query  388  NATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGT  564
             ATNPIDRCWRC   W +NRK+LA C +GFG++A GGK GR YVVTD SDN   +PKPGT
Sbjct  131  VATNPIDRCWRCDQKWHTNRKKLADCAMGFGQQALGGKYGRYYVVTDPSDNDLLNPKPGT  190

Query  565  LRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVII  744
            LRHAVIQ +PLWIIF+RDM+I+L +EL++   KT+DGRGA VHI+ GA IT+Q+VKNVII
Sbjct  191  LRHAVIQNEPLWIIFQRDMVIKLTEELMVNSFKTVDGRGANVHIAYGACITIQYVKNVII  250

Query  745  HGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            HG++IH+   G+GG++RD+EDHFG+RT SDGDGIS
Sbjct  251  HGLHIHDCKAGNGGMIRDSEDHFGIRTRSDGDGIS  285



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 153/224 (68%), Gaps = 7/224 (3%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            A+I DFD+ W++R   A      TY  DP+NVT +FN  V +   +R       T R + 
Sbjct  32   ANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHRATSLRR------TMREMP  85

Query  361  RSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-  537
            R    KGPC ATNPID+CWRC ++W ++R RLA C  GFG+  TGG  G IY+VTD SD 
Sbjct  86   RKHKKKGPCRATNPIDKCWRCKNDWATDRFRLARCARGFGQATTGGLGGPIYIVTDPSDG  145

Query  538  NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGIT  717
            +  +P+PGTLR  VIQ  PLWIIF + MII+L QEL++  DKTIDGRGA+VHI+ GAGIT
Sbjct  146  DVVNPRPGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDGRGAQVHIANGAGIT  205

Query  718  LQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            +Q  +NVIIH +++H+++   GGL+RD+  H G RT +DGDGIS
Sbjct  206  VQLARNVIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGDGIS  249



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 162/228 (71%), Gaps = 9/228 (4%)
 Frame = +1

Query  169  PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTT  348
            P L AHI + D+VWRRR  EA +     Y+ +P  V    N +VQ +   ++AIA     
Sbjct  2    PCLSAHIAEVDEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQDLS--KQAIAK----  55

Query  349  RRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTD  528
            R LL ++   G C ATNPID+CWRC  NW  +R+ LA C LGFG KATGGK G+IY VTD
Sbjct  56   RGLLNAE--SGQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKATGGKGGKIYEVTD  113

Query  529  SSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGG  705
             SDN  + PK GTLRHAVIQK+PLWIIF +DM I+L QELI+QG KTIDGRGA+VHI+ G
Sbjct  114  PSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGSKTIDGRGAKVHIANG  173

Query  706  AGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            AGI LQFVKNVIIHGI+IHNI   SGG++RD+ DH G R  SDGD +S
Sbjct  174  AGIMLQFVKNVIIHGIHIHNISPCSGGMIRDSVDHVGKRGQSDGDAVS  221



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 154/222 (69%), Gaps = 13/222 (6%)
 Frame = +1

Query  193  DFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKH  372
            D+D+ W++R   A   A   Y+ DPFNVT +FN  V +          +++ RR +R K 
Sbjct  33   DWDEHWQKRRELAEASAREAYKPDPFNVTNSFNAAVHR----------STSPRREMREKK  82

Query  373  YK--GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NP  543
             K  GPC ATNPID+CWRC  NW ++R+RLA C  GFGR ATGG  G+IYVVTD +D + 
Sbjct  83   KKSNGPCRATNPIDKCWRCRKNWATDRQRLARCARGFGRAATGGLGGKIYVVTDPTDADV  142

Query  544  TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQ  723
             +P+PGTLR   IQ  PLWIIF R MII+L QEL++  DKTIDGRGA+VHI+ G GIT+Q
Sbjct  143  VNPRPGTLRWGAIQPGPLWIIFARSMIIQLSQELLVSSDKTIDGRGAQVHIANGGGITVQ  202

Query  724  FVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            F +NVIIHG+++H++    GGL+RD+  H G RT +DGDGIS
Sbjct  203  FARNVIIHGLHVHDVKHTDGGLMRDSPTHMGPRTKADGDGIS  244



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 159/239 (67%), Gaps = 11/239 (5%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L  T   + P L A I +FDD  + +  EA + AL++Y  +P +V    N  V   LE  
Sbjct  16   LLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMALE--  73

Query  322  EAIASNSTTRRLLRSKHYKG--PCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                  ++TRR LR +  +G   C A+NPID CWRC+ +W ++R RLA CG GFGR+ATG
Sbjct  74   ------NSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRATG  127

Query  496  GKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            G  G IY VTD+SD+   +PKPGT+RHAV QK PLWIIF   MII L QEL++  DKTID
Sbjct  128  GLGGPIYAVTDNSDDDMVNPKPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKTID  187

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA V   GGAG+T+QFV NVIIHG+ I +IV   GG++RD+ DH+GLRT SDGD IS
Sbjct  188  GRGANVQFRGGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAIS  246



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 163/237 (69%), Gaps = 9/237 (4%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            +FF  V +   + A+I +FD+VW+ R  +A++ A ++Y   P  V    N+ V    E  
Sbjct  9    IFFVSVTLVLSIEANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHVHTSEE--  66

Query  322  EAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGK  501
                SNST R L +   Y GPC +TNPIDRCWRC  NW   R +LA C LGFG   TGGK
Sbjct  67   ---GSNSTRRDLHK---YNGPCMSTNPIDRCWRCDPNWAKTRMKLADCVLGFGHHTTGGK  120

Query  502  NGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGR  678
             G+IYVVTD SD+   +PKPGTLRHAVIQ +PLWIIFK  M+IRL+QELIM  +KTID R
Sbjct  121  GGKIYVVTDPSDDDMVNPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSNKTIDAR  180

Query  679  GARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            G +VHI+ GA   LQF+ NVIIHG++IH+I  G+GGL+RD+ +H+G R+ SDGDGIS
Sbjct  181  GQQVHIAFGASFMLQFINNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGIS  237



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 163/246 (66%), Gaps = 14/246 (6%)
 Frame = +1

Query  133  MIILF-FTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            +I L+   C+A + P L A+I +FD    ++  EA + +L  Y  +P  +T  FN+EV +
Sbjct  9    VIFLYSLLCIASLIPNLHANIAEFDPYLEKKAEEALKSSLAAYNENPEELTDTFNKEVGE  68

Query  307  VLEIREAIASNSTTRRLLRSKHYKGP----CNATNPIDRCWRCHSNWESNRKRLAACGLG  474
             +        N T R L             C A NPID+CWRC  NW +NRK LA C  G
Sbjct  69   TI-------FNGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKNWANNRKALADCARG  121

Query  475  FGRKATGGKNGRIYVVTD-SSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            FG   TGGK+G+ YVVTD S DN  +PKPGTLRHAVIQ++PLWIIF++ MII+L QEL++
Sbjct  122  FGHGTTGGKDGKFYVVTDPSDDNVEEPKPGTLRHAVIQEEPLWIIFEKSMIIKLQQELMI  181

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
              DKTIDGRG  VH++ GAG+T+QFV NVI+H I +H+I+  SGG++RD+ DH GLRT+S
Sbjct  182  NNDKTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHIGLRTVS  241

Query  832  DGDGIS  849
            DGD IS
Sbjct  242  DGDAIS  247



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 164/239 (69%), Gaps = 10/239 (4%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            +I  F+ + + P L A I + D+VWRRR  EA +     Y+ DP  V    N +VQ    
Sbjct  8    LIFLFSFIILIPCLSA-IAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQD---  63

Query  316  IREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                ++  +  RR L +    G C ATNPID+CWRC  NW  +R+ LA C LGFG KATG
Sbjct  64   ----LSKQTAARRGLLNAE-SGQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKATG  118

Query  496  GKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK G+IY VTDSSDN  + PK GTLRHAVIQK+PLWIIF +DM I+L QEL++QG+KTID
Sbjct  119  GKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELVVQGNKTID  178

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA VHI+ GAGI LQFV+NVIIHGI+IHNI   SGG++RD+ DH G R  SDGD +S
Sbjct  179  GRGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVGNRGPSDGDAVS  237



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 162/246 (66%), Gaps = 14/246 (6%)
 Frame = +1

Query  133  MIILF-FTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            +I LF   C+A + P L A+I +FD    ++  EA + +L  Y  +P  +T  FN+EV +
Sbjct  9    VIFLFSLLCIASLIPNLHANIAEFDPYLEKKAEEALKSSLAAYNENPEELTDTFNKEVGE  68

Query  307  VLEIREAIASNSTTRRLLRSKHYKGP----CNATNPIDRCWRCHSNWESNRKRLAACGLG  474
             +        N T R L             C A NPID+CWRC  NW +NRK LA C  G
Sbjct  69   TI-------FNGTRRHLKEEDKDDKDDNDGCKAYNPIDKCWRCDKNWANNRKALADCARG  121

Query  475  FGRKATGGKNGRIYVVTD-SSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            FG   TGGK+G+ YVVTD S DN  +P PGTLRHAVIQ++PLWIIF++ MIIRL QEL++
Sbjct  122  FGHGTTGGKDGKFYVVTDPSDDNVEEPNPGTLRHAVIQEEPLWIIFEKSMIIRLKQELMI  181

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
              DKTIDGRG  VH++ GAG+T+QFV NVI+H I +H+I+  SGG++RD+ DH GLRT+S
Sbjct  182  NNDKTIDGRGVSVHVAYGAGLTIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHIGLRTVS  241

Query  832  DGDGIS  849
            DGD IS
Sbjct  242  DGDAIS  247



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 164/239 (69%), Gaps = 10/239 (4%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            +I  F+ + + P L A I + D+VWRRR  EA +     Y+ DP  V    N +VQ    
Sbjct  8    LIFLFSFIILIPCLSA-IAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQD---  63

Query  316  IREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                ++  +  RR L +    G C ATNPID+CWRC  NW  +R+ LA C LGFG KATG
Sbjct  64   ----LSKQTAARRGLLNAE-SGQCEATNPIDKCWRCKENWAEDRQALAGCALGFGSKATG  118

Query  496  GKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK G+IY VTDSSDN  + PK GTLRHAVIQK+PLWIIF +DM I+L QEL++QG+KTID
Sbjct  119  GKGGKIYEVTDSSDNNMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELVVQGNKTID  178

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA VHI+ GAGI LQFV+NVIIHGI+IHNI   SGG++RD+ DH G R  SDGD +S
Sbjct  179  GRGANVHIANGAGIRLQFVQNVIIHGIHIHNISPASGGMIRDSVDHVGNRGPSDGDAVS  237



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   243 bits (619),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 163/267 (61%), Gaps = 27/267 (10%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN-REVQK  306
            F ++      ++ P L A++ + DD W  +  EAR+  L+ Y  DP+ +   F+ R    
Sbjct  7    FKLVCVVCIASLIPTLRANVAETDDYWVNKANEARKRTLSVYHPDPYAIVDHFHERHYDN  66

Query  307  VLEIRE-------AIASNSTTRRLL------------------RSKHYKGPCNATNPIDR  411
              ++ E       A A    T  +                   +    KGPC A+NPID+
Sbjct  67   STDVEEREEHEATAFAEEDDTEMISSSTNSTRRSLSGNRGKRGKWSKLKGPCTASNPIDK  126

Query  412  CWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQK  588
            CWRC ++W   RK+L  C  GFG + TGGK GRIYVVT   D+   +PKPGTLRHAVIQK
Sbjct  127  CWRCQADWAKRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDVVNPKPGTLRHAVIQK  186

Query  589  KPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNI  768
            +PLWIIFK DM IRL QEL++   KTID RGA VH++ GAGIT+Q+V N+IIHG+++H+I
Sbjct  187  EPLWIIFKHDMSIRLKQELMINSHKTIDARGANVHVAYGAGITMQYVHNIIIHGLHVHHI  246

Query  769  VRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            + GSGG+VR++ DHFG R  +DGDGIS
Sbjct  247  IEGSGGMVRNSVDHFGFRGKADGDGIS  273



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 166/266 (62%), Gaps = 26/266 (10%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE----  297
            F ++      ++ P L A++ + DD W +   EAR+  L  Y  DP+ +   F+      
Sbjct  7    FKLVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDN  66

Query  298  -----------VQKVLEIREAIASNSTTRRLLRS----------KHYKGPCNATNPIDRC  414
                        ++  +I  + +  ++TRR LR              KGPC A+NPID+C
Sbjct  67   STDVEETEEHASEEEDDIEMSSSPTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKC  126

Query  415  WRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKK  591
            WRC  +W   RK+L  C  GFG + TGGK GRIYVVT + D+ T +P+PGTLRHAVIQ +
Sbjct  127  WRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNE  186

Query  592  PLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIV  771
            PLWIIFK DM IRL QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+++H+IV
Sbjct  187  PLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIV  246

Query  772  RGSGGLVRDAEDHFGLRTMSDGDGIS  849
             GSGG++R++ DHFG R  +DGDGIS
Sbjct  247  PGSGGMIRNSNDHFGFRGQADGDGIS  272



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 160/224 (71%), Gaps = 11/224 (5%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            AHIG+FDD  R+R  +A + +L  Y  DP  VT  F R+V K+LE        + TRR L
Sbjct  34   AHIGEFDDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVGKMLE------GGNETRRQL  87

Query  361  RSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTD-SSD  537
            ++    G C ATNPIDRCWRC  NW  NRKRLA C  GFGR+  GG +G+ YVV D S D
Sbjct  88   KA----GGCVATNPIDRCWRCDPNWAKNRKRLAKCARGFGRQTKGGMHGKYYVVVDPSDD  143

Query  538  NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGIT  717
            N  DP+PGTLRHAVIQ++PLWIIF   M+I+L+QEL++  DKTIDGRG  VHI+ GAG++
Sbjct  144  NVQDPEPGTLRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRGVEVHIAYGAGLS  203

Query  718  LQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            +QFV+NVIIH I IH+IV  +GGLVRD+  H GLRT SDGDGIS
Sbjct  204  IQFVQNVIIHNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGDGIS  247



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   241 bits (616),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 159/238 (67%), Gaps = 9/238 (4%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L  T   + P L A I +FDD  + +  EA++ AL  Y   P +VT   N  V   LE  
Sbjct  16   LLVTFAIVIPCLEAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVHLSLE--  73

Query  322  EAIASNSTTRRLLRSKHYKGP-CNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGG  498
                 NST R L + K   G  C A+NPID CWRC+ NW ++R RLA CG GFGR+ATGG
Sbjct  74   -----NSTRRELRQRKGRSGKKCVASNPIDTCWRCNKNWANDRYRLAKCGKGFGRRATGG  128

Query  499  KNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDG  675
              G IYVVTD+SD+   +PKPGT+RHAV Q+ PLWIIF+R M+I+L+QEL++  DKTIDG
Sbjct  129  LGGPIYVVTDNSDDDMVNPKPGTIRHAVTQRGPLWIIFQRSMMIKLNQELMISSDKTIDG  188

Query  676  RGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            RGA V    GAG+T+QFV NVIIHG+ I NIV   GG++RD+ +H GLRT SDGD IS
Sbjct  189  RGANVVFRDGAGLTIQFVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGDAIS  246



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   242 bits (618),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 174/272 (64%), Gaps = 28/272 (10%)
 Frame = +1

Query  118  KMKGFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN-  291
            +M   + ++F  C+A + P +  +I + D+ W RR  EARE  L  Y SDP+ +   F+ 
Sbjct  2    EMARLLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHE  61

Query  292  REVQKVLEIREA-----------------IASNST--TRRLLRSK------HYKGPCNAT  396
            R      +  E                  +  NST  TRR LR K        KGPC A+
Sbjct  62   RHYDNSTDATETEEDGGAKPEEEEEEGIKMVGNSTKSTRRSLRGKGKGKWSKLKGPCTAS  121

Query  397  NPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRH  573
            NPID+CWRC +NW   RK+L  C  GFG + TGGK GRIYVVT + D +  +PKPGTLRH
Sbjct  122  NPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRH  181

Query  574  AVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGI  753
            AVIQK+PLWIIFK DM IRL QEL++   KTID RGA VHI+ GAGIT+QFVKNVIIHG+
Sbjct  182  AVIQKEPLWIIFKNDMSIRLSQELLINSHKTIDARGANVHIAHGAGITMQFVKNVIIHGL  241

Query  754  YIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            +IH+I   SGG++RD+ DHFG+RT +DGDG+S
Sbjct  242  HIHHISESSGGMIRDSVDHFGMRTRADGDGLS  273



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 176/272 (65%), Gaps = 28/272 (10%)
 Frame = +1

Query  118  KMKGFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR  294
            +M     ++F  C+A + P +  +I + D+ W +R  EARE  L  Y SDP+ +   F+ 
Sbjct  2    EMARLSKLMFMFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHE  61

Query  295  -------EVQKVLEIREAI-------------ASNSTTRRLLRSK------HYKGPCNAT  396
                   +V    E  +A              +S ++TRR LR K        KGPC A+
Sbjct  62   RHYDNSTDVTTTEEEGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTAS  121

Query  397  NPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS-SDNPTDPKPGTLRH  573
            NPID+CWRC S+W   RKRL  C  GFG + TGGK GRIYVVT +  D+  +PKPGTLRH
Sbjct  122  NPIDKCWRCRSDWAKRRKRLTRCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPKPGTLRH  181

Query  574  AVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGI  753
            AVIQK+PLWIIFK DM IRL+QEL++   KTID RGA VH++ GAGIT+QFVKNVIIHG+
Sbjct  182  AVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGL  241

Query  754  YIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            +IH+I   SGG++RD+ DHFG+RT +DGDG+S
Sbjct  242  HIHHISESSGGMIRDSVDHFGMRTRADGDGLS  273



>ref|XP_010320663.1| PREDICTED: probable pectate lyase 3 [Solanum lycopersicum]
Length=386

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 161/257 (63%), Gaps = 26/257 (10%)
 Frame = +1

Query  133  MIILF--FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            +I LF  F   ++ P L A+I DFD    +R  EA + +L  Y  +P  VT  FN+EV +
Sbjct  10   VIFLFSLFCFSSIIPKLYANIADFDPYLEKRAEEALQSSLAAYNENPEGVTQIFNKEVGE  69

Query  307  VLEIREAIASNSTTRRLLR---------------SKHYKGPCNATNPIDRCWRCHSNWES  441
             L        N T R L                  K   G C A NPID+CWRC  NW +
Sbjct  70   TL-------LNGTRRHLKEKDKEDKNDKDDKEGDEKSVDG-CKAYNPIDKCWRCDKNWAN  121

Query  442  NRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRD  618
            NRK LA C  GFG   TGGK+GR YVVTD SDN  + P PGTLRHAVIQ++PLWIIF++ 
Sbjct  122  NRKALADCARGFGHGTTGGKDGRFYVVTDPSDNNVEEPVPGTLRHAVIQEEPLWIIFEKS  181

Query  619  MIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRD  798
            MIIRL QEL++  +KTIDGRG  VH++ G G+TLQFV NVI+H I +H+I+  +GG++RD
Sbjct  182  MIIRLKQELMINSNKTIDGRGVSVHVAYGGGLTLQFVHNVIVHNIRVHHILSKNGGMIRD  241

Query  799  AEDHFGLRTMSDGDGIS  849
            +  H GLRT+SDGD IS
Sbjct  242  SVKHIGLRTVSDGDAIS  258



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 151/223 (68%), Gaps = 8/223 (4%)
 Frame = +1

Query  184  HIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLR  363
            H  +FD  W+ R   A       Y  DP++V+   +  V +++  ++        RR L+
Sbjct  34   HENEFDPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVSELIVGKDK-------RRNLK  86

Query  364  SKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTD-SSDN  540
             + Y GPC ATNPIDRCWRC  NW +NR++LA C  GFGR   GGK G  YVVTD S DN
Sbjct  87   GQRYTGPCMATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDN  146

Query  541  PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITL  720
              D KPGTLRHAV +  PLWIIF+R M+I+L QELIM  DKTIDGRG  V+I+ GAGIT+
Sbjct  147  MVDLKPGTLRHAVTRTGPLWIIFERSMMIKLKQELIMTSDKTIDGRGVEVYIASGAGITV  206

Query  721  QFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            QF++NVIIHGI +++I    GG++RD+E H+GLRT SDGDGIS
Sbjct  207  QFIRNVIIHGIKVYDIQVHGGGMIRDSETHYGLRTQSDGDGIS  249



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/281 (46%), Positives = 171/281 (61%), Gaps = 37/281 (13%)
 Frame = +1

Query  118  KMKGFMIILF-FTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFN-  291
            +M   + ++F F    + P + A++ + D+ W +R  EARE  L  Y S+P+ V   F+ 
Sbjct  2    EMTRLLKLMFTFYIAGLIPTIRANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHE  61

Query  292  REVQKVLEIREAIASN--------------------STTRRLLRS--------------K  369
            R      +++E    +                    ++TRR+LR                
Sbjct  62   RHYDNSTDVKETEEDSDDEKPEEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRKGKWS  121

Query  370  HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPT  546
              KGPC A+NPID+CWRC SNW   RK L  C  GFG    GGK GRIYVVT + D +  
Sbjct  122  KLKGPCTASNPIDKCWRCRSNWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMV  181

Query  547  DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQF  726
            +PKPGTLRHAVIQK+PLWIIFK DM IRL QEL++   KTID RGA VHI+ GAGIT+QF
Sbjct  182  NPKPGTLRHAVIQKEPLWIIFKNDMHIRLSQELMICSFKTIDARGADVHIAHGAGITIQF  241

Query  727  VKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            V++VIIHG+ IH+I + +GG++RD+ DHFG+RT +DGDGIS
Sbjct  242  VRHVIIHGLRIHHICQSNGGMIRDSTDHFGMRTKADGDGIS  282



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 166/266 (62%), Gaps = 26/266 (10%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE----  297
            F ++      ++ P L A++ + DD W +   EAR+  L  Y  DP+ +   F+      
Sbjct  7    FKLVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDN  66

Query  298  -----------VQKVLEIREAIASNSTTRRLLRS----------KHYKGPCNATNPIDRC  414
                        ++  +I  + +  ++TRR LR              KGPC A+NPID+C
Sbjct  67   STDVEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKC  126

Query  415  WRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKK  591
            WRC  +W   RK+L  C  GFG + TGGK GRIYVVT + D+ T +P+PGTLRHAVIQ +
Sbjct  127  WRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNE  186

Query  592  PLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIV  771
            PLWIIFK DM IRL QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+++H+IV
Sbjct  187  PLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIV  246

Query  772  RGSGGLVRDAEDHFGLRTMSDGDGIS  849
             GSGG++R++ DHFG R  +DGDGIS
Sbjct  247  PGSGGMIRNSNDHFGFRGQADGDGIS  272



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 166/266 (62%), Gaps = 26/266 (10%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE----  297
            F ++      ++ P L A++ + DD W +   EAR+  L  Y  DP+ +   F+      
Sbjct  7    FKLVCVICIASLIPTLRANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDN  66

Query  298  -----------VQKVLEIREAIASNSTTRRLLRS----------KHYKGPCNATNPIDRC  414
                        ++  +I  + +  ++TRR LR              KGPC A+NPID+C
Sbjct  67   STDVEETEEHASEEEDDIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKC  126

Query  415  WRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKK  591
            WRC  +W   RK+L  C  GFG + TGGK GRIYVVT + D+ T +P+PGTLRHAVIQ +
Sbjct  127  WRCQPDWARRRKKLVKCVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNE  186

Query  592  PLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIV  771
            PLWIIFK DM IRL QEL++   KTID RG  VHI+ GAGIT+Q+V+N+IIHG+++H+IV
Sbjct  187  PLWIIFKHDMSIRLSQELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIV  246

Query  772  RGSGGLVRDAEDHFGLRTMSDGDGIS  849
             GSGG++R++ DHFG R  +DGDGIS
Sbjct  247  PGSGGMIRNSNDHFGFRGQADGDGIS  272



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 148/225 (66%), Gaps = 8/225 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            +H+ +FD  W+ R   A+  +   Y  DP++V+  F   V       E        RR L
Sbjct  34   SHVYEFDSYWQERAKAAKVDSQAAYFEDPYSVSSNFTSSVS------ELTIGKKDLRRNL  87

Query  361  RSKHY-KGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD  537
            + K+   GPC ATNPIDRCWRC  NW +NR++LA C  GFGR   GGK G  YVVTD SD
Sbjct  88   KGKYRGDGPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSD  147

Query  538  NP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGI  714
            +   +PKPGTLRHAV +  PLWIIF R M I L QELIM  +KTIDGRG  V+I+ GAGI
Sbjct  148  DDMVNPKPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGI  207

Query  715  TLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            T+QFVKN+IIHGI + +IV   GG++RD+E H+G RT SDGDGIS
Sbjct  208  TVQFVKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGIS  252



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 160/239 (67%), Gaps = 9/239 (4%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            +   F+  A+ P L A+I + D+VWRRR  EA +     Y+ +P  +    N +VQ    
Sbjct  10   LFFLFSFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQD---  66

Query  316  IREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                ++  +  RR L +    G C ATNPID CWRC  NW  NR+ LA C LGFG KATG
Sbjct  67   ----LSKQTAARRGLLNAE-SGQCEATNPIDNCWRCKENWAENRQALAGCALGFGIKATG  121

Query  496  GKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK G+IY VTD SDN  + PK GTLRHAVIQK+PLWIIF +DM I+L QELI+QG KTID
Sbjct  122  GKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGKKTID  181

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA VHI+ GAG  LQFV+NVIIHGI+IHNI   SGG++RD+ DH G R  SDGD +S
Sbjct  182  GRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVGKRGQSDGDAVS  240



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 160/239 (67%), Gaps = 9/239 (4%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            +   F+  A+ P L A+I + D+VWRRR  EA +     Y+ +P  +    N +VQ    
Sbjct  8    LFFLFSFAALIPCLSANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQD---  64

Query  316  IREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                ++  +  RR L +    G C ATNPID CWRC  NW  NR+ LA C LGFG KATG
Sbjct  65   ----LSKQTAARRGLLNAE-SGQCEATNPIDNCWRCKENWAENRQALAGCALGFGIKATG  119

Query  496  GKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK G+IY VTD SDN  + PK GTLRHAVIQK+PLWIIF +DM I+L QELI+QG KTID
Sbjct  120  GKGGKIYEVTDPSDNDMENPKVGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGKKTID  179

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GRGA VHI+ GAG  LQFV+NVIIHGI+IHNI   SGG++RD+ DH G R  SDGD +S
Sbjct  180  GRGANVHIANGAGFMLQFVQNVIIHGIHIHNISPRSGGMIRDSVDHVGKRGQSDGDAVS  238



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 167/241 (69%), Gaps = 12/241 (5%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
             ++I F T +   P L A+I  FD VW++R  EA   AL  Y  +P ++   FN+EV K 
Sbjct  9    LLVIAFATII---PTLKANIAHFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEVAKS  65

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            L        +ST+ +L     +K PC+ATNPIDRCWRC +NW SNRK+LA C LGFGR  
Sbjct  66   LN-----DFSSTSSQL---SQHKRPCHATNPIDRCWRCDANWASNRKKLAGCALGFGRMT  117

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGGK+G  YVVTD SD+   +P+ GTLR+ VIQ +PLWI F  DM+I L QELI+  +KT
Sbjct  118  TGGKDGDYYVVTDPSDDDLVNPREGTLRYGVIQDRPLWITFAGDMVITLSQELIINSNKT  177

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRGA VHIS GA IT+Q+ +N+IIHGI+IH+I  GSGG +RD+E HFG RT SDGDGI
Sbjct  178  IDGRGANVHISCGAQITIQYARNIIIHGIHIHDIRGGSGGKIRDSETHFGKRTASDGDGI  237

Query  847  S  849
            S
Sbjct  238  S  238



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 166/240 (69%), Gaps = 12/240 (5%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAH--IGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLE  315
            LF++ + +A    ++  I D+D+ W +R  EA  + +  Y S+P +V   FN     + +
Sbjct  8    LFYSLLFLASAASSNTNITDYDEYWVKREAEALSNIMQAYVSEPESVVNHFN--TPDIFQ  65

Query  316  IREAIASNSTTRRLLRSKHYKG-PCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
            +       ++TRR LR    KG  C ATNPIDRCWRC S+W SNRK LA C  GFGR A 
Sbjct  66   VF------NSTRRSLRHGKGKGRKCVATNPIDRCWRCRSDWASNRKLLAKCAKGFGRHAE  119

Query  493  GGKNGRIYVVTD-SSDNPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GG +G IYVVT+ S DN  DP+PGTLR+ V + +PLWIIF RDM+I+L QEL++   KTI
Sbjct  120  GGLSGSIYVVTNPSDDNLLDPRPGTLRYGVTRDRPLWIIFARDMVIKLQQELMINNYKTI  179

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            DGRGA VHI+ GAG+T+QFVK+VI+H ++IH+I  G+GG +RD+E H+G+RT SDGDG+S
Sbjct  180  DGRGANVHIAYGAGLTIQFVKHVIVHNLHIHDIKPGAGGNIRDSEGHWGIRTRSDGDGVS  239



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   240 bits (613),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 160/227 (70%), Gaps = 8/227 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRL-  357
            A++ + DD W+++  EA   +   Y  DP  VT  FN+ V   L    A A NST R L 
Sbjct  48   ANVAELDDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVHLAL----AQARNSTRRGLK  103

Query  358  -LRSKHYK-GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS  531
             +R+  ++ G C A+NPIDRCWRC  +W  +RK+LA+CG GFGR A GG++G  YVVTD 
Sbjct  104  AVRADKFRQGQCVASNPIDRCWRCQKDWIKDRKKLASCGKGFGRNAVGGRDGDFYVVTDP  163

Query  532  SDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGA  708
            SDN   +PK GTLR  VIQ +PLWIIF RDMIIRL +ELI+  +KTID RGA VHI+ GA
Sbjct  164  SDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELIINSNKTIDARGANVHIAFGA  223

Query  709  GITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             I++QFV+NVIIHG++IH+I  G+GG++RD+  H+G RT SDGDGIS
Sbjct  224  QISIQFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGDGIS  270



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 177/290 (61%), Gaps = 46/290 (16%)
 Frame = +1

Query  118  KMKGFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPF--------  270
            +M   + ++F  C+A + P +  +I + D+ W RR  EARE  L  Y SDP+        
Sbjct  2    EMATLLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHE  61

Query  271  ----NVTVAFNREVQKVLEIREA------------------------IASNST--TRRLL  360
                N T A   E    +++ E                         +  NST  TRR L
Sbjct  62   RHYDNSTDATETEEDGAVQLEEEHVGAQVEEEHGGAKPEEEEEEGIKMVGNSTNSTRRSL  121

Query  361  RSK------HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVV  522
            R K        KGPC A+NPID+CWRC SNW   RK+L  C  GFG + TGGK GRIYVV
Sbjct  122  RGKGKGKWSKLKGPCTASNPIDKCWRCRSNWAKRRKKLTRCVRGFGHRTTGGKRGRIYVV  181

Query  523  TDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHIS  699
            T + D +  +PKPGTLRHAVIQK+PLWIIFK DM IRL+QEL++   KTID RGA VHI+
Sbjct  182  TSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTIDARGANVHIA  241

Query  700  GGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             GAGIT+QFVKNVIIHG++IH+I   SGG++RD+ DHFG+RT +DGDG+S
Sbjct  242  HGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLS  291



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   240 bits (613),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 170/270 (63%), Gaps = 30/270 (11%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGD-FDDVWRRRHLEAREHALNTYESDPFNVTVAFNR----  294
            F ++      ++ P + A++ D  D+ W  +  EAR+H L  Y  DP+ +   F+     
Sbjct  7    FKLVCVICIASLIPTIRANVADETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYD  66

Query  295  --------EVQKVL-----EIREAIAS-NSTTRRLLRSK----------HYKGPCNATNP  402
                    E +K +     ++ E I+S  ++TRR L  +             GPC A+NP
Sbjct  67   NSTDVEGTEEEKAVASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNP  126

Query  403  IDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAV  579
            ID+CWRC  +W   RK+L  C  GFG + TGGK GRIYVVT   D+   +P+PGTLRHAV
Sbjct  127  IDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAV  186

Query  580  IQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYI  759
            IQK+PLWI+FK DM IRL QEL++  DKTID RGA VHI+ GAGIT+Q+V N+IIHG+++
Sbjct  187  IQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHV  246

Query  760  HNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            H+IV+ SGGL+RD+ +HFG R  +DGDGIS
Sbjct  247  HHIVKSSGGLIRDSINHFGHRGEADGDGIS  276



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   237 bits (605),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 1/168 (1%)
 Frame = +1

Query  349  RRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTD  528
            RR LR +   GPC ATNPIDRCWRC  NW +NRK+LA C  GFGRK TGGK G  YVVTD
Sbjct  11   RRNLRGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTD  70

Query  529  SSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGG  705
             SD+   +P+PGTLRHAV +  PLWIIF R M IRL+QELIM  DKTIDGRGA + I+ G
Sbjct  71   PSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANG  130

Query  706  AGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            AGIT+Q+++NVIIHGI + +IV GSGGLVRD+E+H+GLRTMSDGDGIS
Sbjct  131  AGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGIS  178



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 162/255 (64%), Gaps = 10/255 (4%)
 Frame = +1

Query  91   LGKNIICSNKMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPF  270
            +GK ++ S+     ++++ FT     P L A I +FDD  R +  EA + AL +Y   P 
Sbjct  3    MGKIMVESSTKIALILLVTFTITI--PCLEAGIAEFDDFLRAQAEEAHKLALASYVPIPG  60

Query  271  NVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKG-PCNATNPIDRCWRCHSNWESNR  447
            +V    N  V   LE        + TRR L+ KH  G  C ATNPID CWRC  +W ++R
Sbjct  61   DVAHDLNFHVHLALE------GANDTRRELKQKHAAGEACEATNPIDSCWRCQKDWANDR  114

Query  448  KRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMI  624
             +LA C  GFGR+ATGG  G IYVVTD SDN   +PKPGTLR+  +QK PLWI F+R MI
Sbjct  115  FKLAKCSKGFGRRATGGLGGPIYVVTDESDNDMQNPKPGTLRYGAVQKGPLWITFQRSMI  174

Query  625  IRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAE  804
            IRL+QEL++  DKTIDGRGA V I  G GIT+QFV NVIIHG++I NI    G ++RD+ 
Sbjct  175  IRLNQELLVSSDKTIDGRGANVQIRDGGGITMQFVNNVIIHGLHISNIKSKPGAMIRDSY  234

Query  805  DHFGLRTMSDGDGIS  849
            +H G RT SDGD +S
Sbjct  235  NHVGQRTRSDGDALS  249



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 153/219 (70%), Gaps = 6/219 (3%)
 Frame = +1

Query  196  FDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHY  375
             D  W++R  EA + A+ ++++DP  VT  FN  V ++L     +  N T R L   K Y
Sbjct  33   LDAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELL-----MKLNGTRRNLRGVKKY  87

Query  376  KGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDP  552
             GPC ATNPID CWRC  NW  NRKRLA C  GFGRK TGGK G IYVVTD SD +  +P
Sbjct  88   NGPCMATNPIDACWRCDKNWAKNRKRLANCVQGFGRKTTGGKGGPIYVVTDPSDLDLVNP  147

Query  553  KPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVK  732
            KPGTLRHAVIQK PLWIIF R M+IRL QELI+  DKTIDGRGA V+I  GAGITLQFVK
Sbjct  148  KPGTLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRGANVNIHDGAGITLQFVK  207

Query  733  NVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            NVII  ++I  IV   GG++RD+ DH G RT SDGDGIS
Sbjct  208  NVIITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGIS  246



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 170/270 (63%), Gaps = 30/270 (11%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGD-FDDVWRRRHLEAREHALNTYESDPFNVTVAFNR----  294
            F ++      ++ P + A++ +  D+ W  +  EAR+H L  Y  DP+ +   F+     
Sbjct  7    FKLVCVICIASLIPTIRANVAEETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYD  66

Query  295  --------EVQKVL-----EIREAIAS-NSTTRRLLRSK----------HYKGPCNATNP  402
                    E +K +     ++ E I+S  ++TRR L  +             GPC A+NP
Sbjct  67   NSTDVEGTEEEKAIASEEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNP  126

Query  403  IDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAV  579
            ID+CWRC  +W   RK+L  C  GFG + TGGK GRIYVVT   D+   +P+PGTLRHAV
Sbjct  127  IDKCWRCQPDWARRRKKLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAV  186

Query  580  IQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYI  759
            IQK+PLWI+FK DM IRL QEL++  DKTID RGA VHI+ GAGIT+Q+V N+IIHG+++
Sbjct  187  IQKEPLWIVFKHDMSIRLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHV  246

Query  760  HNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            H+IV+ SGGL+RD+ +HFG R  +DGDGIS
Sbjct  247  HHIVKSSGGLIRDSINHFGHRGEADGDGIS  276



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 159/257 (62%), Gaps = 11/257 (4%)
 Frame = +1

Query  97   KNIICSNKMKGFMIILFFTCVAMAPVLMAHI---GDFDDVWRRRHLEAREHALNTYESDP  267
            + I+  +  K   I+L    + +  +  AH+    + DD  + R  EA + A+ TY   P
Sbjct  4    EKIMVESSTKIAFILLVTFAITIPCLEAAHVLSPAEIDDFVKARAEEAHKVAVETYVPIP  63

Query  268  FNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYK--GPCNATNPIDRCWRCHSNWES  441
              V    N  V   +E  E     + TRR +R K  K  GPC ATNPID CWRC ++W +
Sbjct  64   EGVAHDLNVAVHMSMEAEE-----NNTRREMRQKGKKHDGPCEATNPIDSCWRCKADWAA  118

Query  442  NRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRD  618
            NR +LA C  GFGRK TGG  G IYVVTD SDN   +PKPGTLR   +QK PLWI F R 
Sbjct  119  NRFQLAKCSKGFGRKTTGGLGGPIYVVTDESDNDMVNPKPGTLRFGAVQKGPLWITFARS  178

Query  619  MIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRD  798
            M+IRL+QEL++  DKTIDGRGA V I  GAGIT+QFV NVIIHG++I NI    GGL+RD
Sbjct  179  MVIRLNQELMVSSDKTIDGRGANVQIRDGAGITMQFVNNVIIHGLHIQNIKAKPGGLIRD  238

Query  799  AEDHFGLRTMSDGDGIS  849
            + DH G RT SDGD IS
Sbjct  239  SFDHTGQRTRSDGDAIS  255



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 161/252 (64%), Gaps = 14/252 (6%)
 Frame = +1

Query  136  IILFFTC---VAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            +I  F+    +++ P L A+I DFD    +R  EA + +L  Y  +P  VT  FN+EV +
Sbjct  10   VIFLFSLLCFISIIPKLYANIADFDPYLEKRAEEALQSSLAAYNENPEAVTQIFNKEVGE  69

Query  307  V--------LEIREAIASNSTTRRLLRSKHYKGP--CNATNPIDRCWRCHSNWESNRKRL  456
                     L+  +    N    +  +    K    C A NPID+CWRC  NW +NRK L
Sbjct  70   TILNGTRRHLKEEDKEDKNEKVEKDDKEGDEKSVDICKAYNPIDKCWRCDKNWANNRKAL  129

Query  457  AACGLGFGRKATGGKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRL  633
            A C  GFG   TGGK+G+ YVVTD SDN  + P PGTLRHAVIQ++PLWIIF++ MII+L
Sbjct  130  ADCARGFGHGTTGGKDGKFYVVTDPSDNNVEEPVPGTLRHAVIQEEPLWIIFEKSMIIKL  189

Query  634  HQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHF  813
             QEL++  DKTIDGRG  VH++ GAG+TLQFV NVI+H I +H+I+   GG++RD+  H 
Sbjct  190  KQELMINNDKTIDGRGISVHVAYGAGLTLQFVHNVIVHNIRVHHILSKDGGMIRDSVKHI  249

Query  814  GLRTMSDGDGIS  849
            GLRT+SDGD IS
Sbjct  250  GLRTVSDGDAIS  261



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 174/265 (66%), Gaps = 28/265 (11%)
 Frame = +1

Query  139  ILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR-------  294
            ++F  C+A + P +  +I + D+ W +R  EARE  L  Y SDP+ +   F+        
Sbjct  9    LMFTFCIAVLIPTIRGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNST  68

Query  295  EVQKVLEIREAI-------------ASNSTTRRLLRSK------HYKGPCNATNPIDRCW  417
            +V    E  +A              +S ++TRR LR K        KGPC A+NPID+CW
Sbjct  69   DVTTPEEDGDAKPEEEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCW  128

Query  418  RCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKP  594
            RC S+W   RK+L  C  GFG + TGGK GRIYVVT + D +  +PKPGTLRHAVIQK+P
Sbjct  129  RCRSDWAKRRKKLTRCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEP  188

Query  595  LWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVR  774
            LWIIFK DM IRL+QEL++   KTID RGA VH++ GAGIT+QFVKNVIIHG++IH+I  
Sbjct  189  LWIIFKNDMSIRLNQELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHIHHISE  248

Query  775  GSGGLVRDAEDHFGLRTMSDGDGIS  849
             SGG++RD+ DHFG+RT +DGDG+S
Sbjct  249  SSGGMIRDSVDHFGMRTRADGDGLS  273



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 150/215 (70%), Gaps = 8/215 (4%)
 Frame = +1

Query  208  WRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPC  387
            W+++   A +     Y  DP+ V+   +  V       E I      RR L        C
Sbjct  44   WQKKASIAAKANDKAYTPDPYAVSGNLSSTVS------EMIIGGINGRRNLVGLG-NSSC  96

Query  388  NATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGT  564
             ATNPIDRCWRC  NW +NRK+LA C  GFGRK TGGK+G IYVVTD SD+   +P+PGT
Sbjct  97   MATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKDGPIYVVTDPSDSDLVNPRPGT  156

Query  565  LRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVII  744
            LRHAV +  PLWIIF R M IRL+QELIM G+KTIDGRGA V I+ GAGIT+QF++NVII
Sbjct  157  LRHAVTRNGPLWIIFARSMKIRLNQELIMAGNKTIDGRGADVTIANGAGITIQFIENVII  216

Query  745  HGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            HGI I++I+ GSGGLVRD+EDH+GLRT+SDGDGIS
Sbjct  217  HGIKIYDIMVGSGGLVRDSEDHYGLRTISDGDGIS  251



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 134/169 (79%), Gaps = 2/169 (1%)
 Frame = +1

Query  346  TRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVT  525
            TRR L+ K YKGPC ATNPIDRCWRC  NWE+NRK+LA C  GFG K TGGK G+IYVVT
Sbjct  116  TRRNLKQK-YKGPCLATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGGKAGKIYVVT  174

Query  526  DSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISG  702
            D+SDN   +PKPGTLRHAVIQ  PLWIIF RDM I+L +EL++  DKTID RGA VHI  
Sbjct  175  DNSDNDMVNPKPGTLRHAVIQTGPLWIIFARDMRIKLREELMVTSDKTIDARGANVHIED  234

Query  703  GAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GA ITLQFV NVIIH ++IH+   G+GG++RD+ +H+G RT SDGDGIS
Sbjct  235  GAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGIS  283



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 141/197 (72%), Gaps = 11/197 (6%)
 Frame = +1

Query  292  REVQKVLEIREAIASNSTTRRLL-----RSKHYK-----GPCNATNPIDRCWRCHSNWES  441
            R V K +E      +N T R LL     R +H K     G C A NPIDRCWRC   W  
Sbjct  310  RHVNKAVEETMKTGNNGTRRELLQVGQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWSK  369

Query  442  NRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRD  618
            NRK+LA C LGFGRK TGGK G  YVVTD+SD+   +PK GTLRHAV +++PLWI+F + 
Sbjct  370  NRKKLADCALGFGRKTTGGKAGPYYVVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAKS  429

Query  619  MIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRD  798
            M+I+L QELIM  DKTIDGRG RVHI+GGAG TLQFV NVIIH IYI NIV G+GGL+RD
Sbjct  430  MVIKLQQELIMTSDKTIDGRGVRVHITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRD  489

Query  799  AEDHFGLRTMSDGDGIS  849
            +E HFGLRT SDGDGI+
Sbjct  490  SETHFGLRTRSDGDGIN  506



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 161/258 (62%), Gaps = 25/258 (10%)
 Frame = +1

Query  118  KMKGFMIILFFTC-VAMAPVLMAHIGD------------FDDVWRRRHLEAREHALNTYE  258
            KM  F ++   TC + + P L A++ +             D  W+++   A +     Y 
Sbjct  3    KMHNFFLL---TCLIVIIPTLHANVKEDEIYWKRQSQILNDSYWKQKASVAEKENKQAYT  59

Query  259  SDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWE  438
            SDP+++T      V       E I      RR L+ K   G C ATNPIDRCWRC  NW 
Sbjct  60   SDPYSLTKNLTYSVS------EIIVGEQNGRRNLKGK--GGNCMATNPIDRCWRCDPNWA  111

Query  439  SNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKR  615
            +NRK+LA C  GFGR   GGKNG  YVVT + DN   +P PGTLRHAV +  PLWIIF  
Sbjct  112  NNRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHAVTRTGPLWIIFAH  171

Query  616  DMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVR  795
             M IRL+QELIM  DKTIDGRG  V+++GGAGIT+QF+KNVIIHG+ I +I  G+GGL+ 
Sbjct  172  SMKIRLNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKNVIIHGVKIFDIQVGNGGLII  231

Query  796  DAEDHFGLRTMSDGDGIS  849
            D+E+H+GLRTMSDGDGIS
Sbjct  232  DSENHYGLRTMSDGDGIS  249



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 154/227 (68%), Gaps = 14/227 (6%)
 Frame = +1

Query  184  HIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLR  363
            ++G FDD  ++R   A   A   Y  DP+NVT +FN  V + +         S++RR +R
Sbjct  32   NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAV---------SSSRREMR  82

Query  364  S---KHYK-GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS  531
                KH K GPC ATNPID+CWRC  +W ++R+RLA C  GFG   TGG  G+IYVVTD 
Sbjct  83   ERPRKHKKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTDP  142

Query  532  SD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGA  708
            +D +  +P+PGTLR  VIQ  PLWIIF R MII+L QEL+M  DKTIDGRGA+VHI+ GA
Sbjct  143  TDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANGA  202

Query  709  GITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GIT+Q  +NVIIH +++H++    GGL+RD+  H G RT +DGDGIS
Sbjct  203  GITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGIS  249



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 167/241 (69%), Gaps = 13/241 (5%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F+ ++F   +++     AHIG+FD+VWR+R  +A++ A + Y  +P  V    N +V K 
Sbjct  9    FLFVMFVLVLSIE----AHIGEFDEVWRKRAQQAKKAARHAYHPNPKIVADHLNNQVDKA  64

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            +       SNS  R L R   Y G C ATNPID+CWRC  NW  NR +LA C LGFGRK 
Sbjct  65   VR-----GSNSRRRDLHR---YNGQCKATNPIDQCWRCDPNWARNRMKLADCVLGFGRKT  116

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGGK G+ YVVTD+SDN   +PKPGTLRHAVIQ +PLWIIF ++M+IRL++ELIM  +KT
Sbjct  117  TGGKGGKSYVVTDNSDNDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEELIMTSNKT  176

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            ID RG +VHI+ G G+ LQF+ NVII  + IH+   G+GGL+RD+ +H+G RT SDGDGI
Sbjct  177  IDARGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVNHYGYRTKSDGDGI  236

Query  847  S  849
            S
Sbjct  237  S  237



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 146/218 (67%), Gaps = 9/218 (4%)
 Frame = +1

Query  199  DDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYK  378
            D  W+++   A +     Y SDP+++T      V       E I      RR L+ K   
Sbjct  37   DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVS------EIIVGEQNGRRNLKGK--G  88

Query  379  GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPK  555
            G C ATNPIDRCWRC  NW +NRK+LA C  GFGR   GGKNG  YVVT + DN   +P 
Sbjct  89   GNCMATNPIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPV  148

Query  556  PGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKN  735
            PGTLRHAV +  PLWIIF   M IRL+QELIM  DKTIDGRG  V+++GGAGIT+QF+KN
Sbjct  149  PGTLRHAVTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKN  208

Query  736  VIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VIIHG+ I +I  G+GGL+ D+E+H+GLRTMSDGDGIS
Sbjct  209  VIIHGVKIFDIQVGNGGLIIDSENHYGLRTMSDGDGIS  246



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 156/251 (62%), Gaps = 20/251 (8%)
 Frame = +1

Query  136  IILFFTCVA-MAPVLMAHI-----------GDFDDVWRRRHLEAREHALNTYESDPFNVT  279
            IILF  C+A + P L A+             +FD  W+ R   A++     Y  DP+ ++
Sbjct  7    IILFVLCLAILTPTLNANKLENNEYWTEQRPEFDSYWQERAKVAKQENKAAYFKDPYAIS  66

Query  280  VAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLA  459
              F   + +++ ++E         R L      G C ATNPIDRCWRC  NW +NR++LA
Sbjct  67   GNFTASISEIIAVKEK-------GRNLGGLKDDGTCLATNPIDRCWRCDPNWANNRQKLA  119

Query  460  ACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLH  636
             C  GFGR   GG+ G IYVVTD SD+   +PKPGTLR+AV +   LWI F R M I L 
Sbjct  120  DCVQGFGRNTRGGQGGPIYVVTDPSDDDMMNPKPGTLRYAVTRNGSLWITFARSMAITLQ  179

Query  637  QELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFG  816
            QELIM GDKTIDGRG  V+IS GAGIT+QFVKNVIIHGI I++I    GG++RD+E H+G
Sbjct  180  QELIMSGDKTIDGRGVDVYISNGAGITIQFVKNVIIHGIKIYDIQVRDGGMIRDSEAHYG  239

Query  817  LRTMSDGDGIS  849
             RT SDGDGIS
Sbjct  240  FRTKSDGDGIS  250



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 159/248 (64%), Gaps = 11/248 (4%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K   F+++      A A V  A IG+FD+ W +R   A   A   Y+ DPFNVT  FN  
Sbjct  10   KPGSFLLVAGVFLAAAAAVSNAGIGEFDEHWEKRRAAAEAAAEEVYKPDPFNVTNEFNHA  69

Query  298  VQKVLEIREAIASNSTTRRLLRSKH--YKGPCNATNPIDRCWRCHSNWESNRKRLAACGL  471
            V +  E           RR L  K+  YKGPC ATNPIDRCWRC  +W ++RKRLA C +
Sbjct  70   VIRSTE-------RGVLRRELSGKNSKYKGPCLATNPIDRCWRCRKDWATDRKRLARCAM  122

Query  472  GFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELI  648
            GFGR ATGG  G+IYVVTD  D +  +P+ GTLR   +Q  PLWI F + M+IRL QEL+
Sbjct  123  GFGRGATGGVRGKIYVVTDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELL  182

Query  649  MQGDKTIDGRGARVHIS-GGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRT  825
            +  DKTIDGRGA+VHI+ GGAGIT+QF +NVII  +++H++    GG VRD+  H G RT
Sbjct  183  VASDKTIDGRGAQVHIARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRT  242

Query  826  MSDGDGIS  849
             +DGDGIS
Sbjct  243  RADGDGIS  250



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 175/299 (59%), Gaps = 55/299 (18%)
 Frame = +1

Query  118  KMKGFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAF--  288
            +M   + ++F  C+A + P +  +I + D+ W RR  EARE  L  Y SDP+ +   F  
Sbjct  2    EMARLLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHE  61

Query  289  ---NREVQKVLEIREAIA------------------------------------------  333
               +       E  + +A                                          
Sbjct  62   RHYDNSTDDATETEDGVAQLEEEHGGAKPEEEHGGVQLEEEHGGAKPEEEEEEGIKMVGN  121

Query  334  SNSTTRRLLRSK------HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
            S ++TRR LR K        KGPC A+NPID+CWRC +NW   RK+L  C  GFG + TG
Sbjct  122  STNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTG  181

Query  496  GKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK GRIYVVT + D +  +PKPGTLRHAVIQK+PLWIIFK DM IRL+QEL++   KTID
Sbjct  182  GKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLNQELLINSHKTID  241

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             RGA VHI+ GAGIT+QFVKNVIIHG++IH+I   SGG++RD+ DHFG+RT +DGDG+S
Sbjct  242  ARGANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLS  300



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   234 bits (597),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 158/250 (63%), Gaps = 20/250 (8%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMA----HIG-------DFDDVWRRRHLEAREHALNTYESDPFNVTV  282
            I +F T     P + A    H+G       + D+ ++R+  EA   +L  Y  DP  V  
Sbjct  12   IFIFATIFVAIPTIQANTIGHVGNHTTKDTEHDEWFQRKLAEAYNASLLAYHHDPIEVMN  71

Query  283  AFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAA  462
             FN  V + LE      +NST R L +   Y+G C A NPIDRCWRC ++W  +RK+LA 
Sbjct  72   HFNYHVHRALE-----GTNSTRRGLNK---YQGECKAQNPIDRCWRCKADWAVDRKKLAD  123

Query  463  CGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQ  639
            C  GFGR+ TGGK G  Y VTD SDN   +PKPGTLR AV+Q +PLWIIF +DM I+L  
Sbjct  124  CVKGFGRQTTGGKKGAYYTVTDPSDNDVVNPKPGTLRFAVLQPQPLWIIFAKDMTIKLKA  183

Query  640  ELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGL  819
            EL++  DKTIDGRGA+V I+ GAGIT+QF  NVIIH I IH+IV  +GG++RD  +H G+
Sbjct  184  ELMITSDKTIDGRGAQVQIADGAGITIQFANNVIIHNIKIHDIVPSTGGMIRDTNNHVGI  243

Query  820  RTMSDGDGIS  849
            R   DGDGI+
Sbjct  244  RGADDGDGIN  253



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 159/246 (65%), Gaps = 18/246 (7%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L  T   + P L A I +FDD  + +  EA + AL++Y  +P +V    N  V   LE  
Sbjct  12   LLATFAIVIPCLEAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVHMALE--  69

Query  322  EAIASNSTTRRLLRSKHYKG--PCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
                  ++TRR LR +  +G   C A+NPID CWRC+ +W ++R RLA CG GFGR+ATG
Sbjct  70   ------NSTRRELRQRKLRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRATG  123

Query  496  GKNGRIYVVTDSSDNP-TDPKPGTLRHA-------VIQKKPLWIIFKRDMIIRLHQELIM  651
            G  G IYVVTD+SD+   +PKPGT+RHA       V QK PLWIIF   MII L QEL++
Sbjct  124  GLGGPIYVVTDNSDDDMVNPKPGTIRHAPGTIRHAVTQKGPLWIIFGHSMIISLRQELMI  183

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
              DKTIDGRGA V    GAG+T+QFV NVIIHG+ I +IV   GG++RD+ DH+GLRT S
Sbjct  184  SSDKTIDGRGANVVFRDGAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRS  243

Query  832  DGDGIS  849
            DGD IS
Sbjct  244  DGDAIS  249



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 152/227 (67%), Gaps = 14/227 (6%)
 Frame = +1

Query  184  HIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL-  360
            ++G FDD  ++R   A   A   Y  DP+NVT +FN  V + +         S++RR + 
Sbjct  32   NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAV---------SSSRREMW  82

Query  361  ---RSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS  531
               R    +GPC ATNPID+CWRC  +W ++R+RLA C  GFG   TGG  G+IYVVTD 
Sbjct  83   ERPRKHKKRGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTDP  142

Query  532  SD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGA  708
            +D +  +P+PGTLR  VIQ  PLWIIF R MII+L QEL+M  DKTIDGRGA+VHI+ GA
Sbjct  143  TDLDVVNPRPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANGA  202

Query  709  GITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            GIT+Q  +NVIIH +++H++    GGL+RD+  H G RT +DGDGIS
Sbjct  203  GITVQLAQNVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGIS  249



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 176/299 (59%), Gaps = 55/299 (18%)
 Frame = +1

Query  118  KMKGFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPF--------  270
            +M   + ++F  C+A + P +  +I + D+ W RR  EARE  L  Y SDP+        
Sbjct  2    EMARLLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHE  61

Query  271  ----NVTVAFNREVQKVLEIREA---------------------------------IASN  339
                N T A   E    +++ E                                  +  N
Sbjct  62   RHYDNSTDATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGN  121

Query  340  ST--TRRLLRSK------HYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATG  495
            ST  TRR LR K        KGPC A+NPID+CWRC +NW   RK+L  C  GFG + TG
Sbjct  122  STKSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRGFGHRTTG  181

Query  496  GKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTID  672
            GK GRIYVVT + D +  +PKPGTLRHAVIQK+PLWIIFK DM IRL QEL++   KTID
Sbjct  182  GKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLINSHKTID  241

Query  673  GRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             RGA VHI+ GAGIT+QFVKNVIIHG++IH+I   SGG++RD+ DHFG+RT +DGDG+S
Sbjct  242  ARGANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRADGDGLS  300



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 165/241 (68%), Gaps = 6/241 (2%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
             ++   F  ++ A    A+IG++D+ W++R L A   A  TY+ DPF VT +FNR V + 
Sbjct  16   LVLYAVFLLLSAAATSEANIGEYDEYWQKRKLMADAAAEATYKRDPFEVTNSFNRAVHRS  75

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
             E      S      + + K + GPC ATNPIDRCWRC ++W ++RKRLA C  GFGR  
Sbjct  76   EE-----ESGRRELAMTKRKKFAGPCKATNPIDRCWRCRADWVTDRKRLARCAQGFGRNT  130

Query  490  TGGKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGG  G+ Y+VTD +D+  + P+PGTLR  VIQ +PLWIIF +DMII L +E+++  DKT
Sbjct  131  TGGLAGKFYLVTDGTDDDVENPRPGTLRWGVIQDEPLWIIFAKDMIINLKEEMMINSDKT  190

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRGA+V I+ GA +T+Q   NVIIH I+IH+I++G GG++RD+ +HFG RT SDGDGI
Sbjct  191  IDGRGAQVRITNGAQVTVQNSNNVIIHNIHIHDILQGKGGMIRDSPEHFGFRTQSDGDGI  250

Query  847  S  849
            S
Sbjct  251  S  251



>gb|EYU22437.1| hypothetical protein MIMGU_mgv1a006496mg [Erythranthe guttata]
Length=442

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 159/242 (66%), Gaps = 15/242 (6%)
 Frame = +1

Query  142  LFFTCVAMA-----PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQK  306
            L F C+A+A     P   A     D+  +++  EA + +L  Y   P  +T  FN  V +
Sbjct  10   LLFFCIALALAVTLPRAHAQNATMDEYLQKKAEEAYQESLQAYNPHPEELTEEFNELVGE  69

Query  307  VLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRK  486
             L     I  N+T R+L ++    G C ATNPIDRCWRC  NW  NRK+LA C  GFG +
Sbjct  70   TL-----IGQNATRRQLKQT----GECMATNPIDRCWRCDRNWAKNRKKLADCARGFGHQ  120

Query  487  ATGGKNGRIYVVTDSSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDK  663
             TGGK GR Y+VTD SDN  D PKPGTLRHAVIQ +PLWIIF   M+IRL QELI   DK
Sbjct  121  TTGGKKGRYYLVTDPSDNDMDHPKPGTLRHAVIQTEPLWIIFAHSMVIRLKQELIFTSDK  180

Query  664  TIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDG  843
            T+DGRG +VHI+ GAG+TLQFV NVIIH I+IHNI+  +GGL+RDA +H G RT SDGD 
Sbjct  181  TVDGRGVQVHIAYGAGLTLQFVHNVIIHNIWIHNIIPRNGGLIRDAINHLGFRTQSDGDA  240

Query  844  IS  849
            IS
Sbjct  241  IS  242



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 160/243 (66%), Gaps = 6/243 (2%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
              ++ FF   A++    A+IGDFD+ W++R L A   A  TY+ DP  V    NR V + 
Sbjct  15   LYLVFFFLSAALSE---ANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRS  71

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            +E  +            R   + GPC ATNPIDRCWRC  +W ++RKRLA C  GFGR  
Sbjct  72   VEKEDIGTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRKRLARCAKGFGRNT  131

Query  490  TGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGG  G+ YVVTD +D+   +P+PGTLR  VIQ +PLWI F + MII L +ELI++GDKT
Sbjct  132  TGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIITLKEELIIRGDKT  191

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGS--GGLVRDAEDHFGLRTMSDGD  840
            IDGRG +V I+ GA +TLQFV NVIIH I+I++IV  +  GG VRD+ DHFG RT+SDGD
Sbjct  192  IDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSPDHFGWRTVSDGD  251

Query  841  GIS  849
            GI+
Sbjct  252  GIT  254



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 160/243 (66%), Gaps = 6/243 (2%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
              ++ FF   A++    A+IGDFD+ W++R L A   A  TY+ DP  V    NR V + 
Sbjct  15   LYLVFFFLSAALSE---ANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRS  71

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
            +E  +            R   + GPC ATNPIDRCWRC  +W ++RKRLA C  GFGR  
Sbjct  72   VEKDDIGTRREMMGTTTRKSKFSGPCRATNPIDRCWRCRQDWATDRKRLARCAKGFGRNT  131

Query  490  TGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGG  G+ YVVTD +D+   +P+PGTLR  VIQ +PLWI F + MII L +ELI++GDKT
Sbjct  132  TGGLAGKFYVVTDGTDDDVVNPRPGTLRWGVIQIEPLWITFAKTMIITLKEELIIRGDKT  191

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGS--GGLVRDAEDHFGLRTMSDGD  840
            IDGRG +V I+ GA +TLQFV NVIIH I+I++IV  +  GG VRD+ DHFG RT+SDGD
Sbjct  192  IDGRGVQVRITNGAQLTLQFVNNVIIHNIHINDIVSSNKDGGYVRDSPDHFGWRTVSDGD  251

Query  841  GIS  849
            GI+
Sbjct  252  GIT  254



>gb|ACN96319.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96324.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96326.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96328.1| hypothetical protein, partial [Zea mays subsp. mays]
Length=278

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 147/218 (67%), Gaps = 15/218 (7%)
 Frame = +1

Query  199  DDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYK  378
            +D W  R   AR   L  Y SDP   T  FN +V +           +TTRR L    Y 
Sbjct  9    EDYWAERAEVARSRNLAAYVSDPVAATNCFNADVLR-----------ATTRRAL--ARYD  55

Query  379  GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPK  555
            GPC ATNPIDRCWRC ++W ++RKRLA C  GFG ++ GG  G++YVV D SD+    P+
Sbjct  56   GPCMATNPIDRCWRCRADWATDRKRLAQCARGFGHRSVGGAAGKLYVVRDPSDDEMIIPR  115

Query  556  PGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKN  735
             GTLRHAVIQ +PLWI+F RDM+I L QELI+  +KTIDGRGA+VHI   A ITLQ V+N
Sbjct  116  KGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRGAQVHIM-FAQITLQNVQN  174

Query  736  VIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VI+H ++IH+    SGG++RD++ H+GLRT SDGDG+S
Sbjct  175  VILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVS  212



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 148/256 (58%), Gaps = 19/256 (7%)
 Frame = +1

Query  121  MKGFMIILFFTC-VAMAPVLMAHIGD-----------FDDVWRRRHLEAREHALNTYESD  264
            M     I   TC V   P   A++ +           FD  W+ R   A +     Y +D
Sbjct  1    MTKLCSIFLLTCLVVTIPTFYANVLEDEEFLDNQTKSFDGYWKGRKQVAEKQNQEAYITD  60

Query  265  PFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESN  444
            P++ T+           I + I      RR L  K  +  C ATNPIDRCWRC   W  N
Sbjct  61   PYSFTINMTNN------ISDLITGEEKGRRNLAGKQSQDSCLATNPIDRCWRCDPKWSEN  114

Query  445  RKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDM  621
            RK+LA C  GFGR   GGK G  YVVT + DN   +P PGTLRHAV +  PLWIIF   M
Sbjct  115  RKKLADCVQGFGRDTIGGKKGPFYVVTSNLDNDMVNPVPGTLRHAVTRNGPLWIIFAHSM  174

Query  622  IIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDA  801
             IRL QELI+ GDKTIDGRGA ++I  GAG T+QFVKNVIIHGI I +I  G GGL+RD+
Sbjct  175  NIRLSQELIVAGDKTIDGRGADIYIVNGAGFTIQFVKNVIIHGIKIFDINAGQGGLIRDS  234

Query  802  EDHFGLRTMSDGDGIS  849
            E H+GLRT SDGDGIS
Sbjct  235  ESHYGLRTQSDGDGIS  250



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 152/252 (60%), Gaps = 23/252 (9%)
 Frame = +1

Query  139  ILFFTC-VAMAPVLMAHIGD-------------FDDVWRRRHLEAREHALNTYESDPFNV  276
                TC V M P L A++ +              D  W+ R   A +     Y SDP+++
Sbjct  7    FYLLTCLVVMIPTLYANVKEDEAYWKRQSEVLLVDSYWQERASIAEKENQQAYTSDPYSL  66

Query  277  TVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRL  456
            T            + E I    + RR LR +  K  C ATNPIDRCWRC  NW +NRK+L
Sbjct  67   TKNL------TFSVSEIIIGEKSGRRNLRGRGGK--CMATNPIDRCWRCDPNWANNRKKL  118

Query  457  AACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRL  633
            A C  GFGR   GGKNG  YVV  S DN   +P PGTLRHAV +  PLWIIF R M IRL
Sbjct  119  ADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPAPGTLRHAVTRSGPLWIIFARSMNIRL  178

Query  634  HQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHF  813
             QELIM  DKTIDGRG  V+I+ GAGIT+QF+KNVIIHGI I NI  G+GGL+RD+E H+
Sbjct  179  SQELIMTSDKTIDGRGVDVYIANGAGITIQFIKNVIIHGIKIFNIQVGNGGLIRDSETHY  238

Query  814  GLRTMSDGDGIS  849
            G RT SDGDGIS
Sbjct  239  GFRTYSDGDGIS  250



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 160/227 (70%), Gaps = 9/227 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            A++ +FDD W+++  EA   +   Y  DP  VT  FN+ V   L + +A    ++TRR L
Sbjct  28   ANMAEFDDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVH--LAVSQA---RNSTRRAL  82

Query  361  RS---KHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS  531
            RS     +KGPC ATNPIDRCWRC  NW  NRK+LA C  GFGR A GGK+G  YVVTD 
Sbjct  83   RSAGVNKFKGPCVATNPIDRCWRCRENWMENRKKLAGCAKGFGRNAVGGKDGDFYVVTDP  142

Query  532  SDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGA  708
            SDN   +PK GTLR  VIQ +PLWIIF RDMIIRL +EL++  +KTIDGRGA V I+ GA
Sbjct  143  SDNDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVRIAYGA  202

Query  709  GITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             ITLQFV NVIIHGI+IH+I   +GG++RD+  HFG+RT SDGDGIS
Sbjct  203  QITLQFVHNVIIHGIHIHDIKPSNGGIIRDSLQHFGIRTKSDGDGIS  249



>gb|ACN96320.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96321.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96323.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96325.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96329.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96334.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96335.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96340.1| hypothetical protein, partial [Zea mays subsp. mays]
Length=278

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 147/218 (67%), Gaps = 15/218 (7%)
 Frame = +1

Query  199  DDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYK  378
            +D W  R   AR   L  Y SDP   T  FN +V +           +TTRR L    Y 
Sbjct  9    EDYWAERAEVARSRNLAAYVSDPVAATNRFNADVLR-----------ATTRRAL--ARYD  55

Query  379  GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPK  555
            GPC ATNPIDRCWRC ++W ++RKRLA C  GFG ++ GG  G++YVV D SD+    P+
Sbjct  56   GPCMATNPIDRCWRCRADWATDRKRLAQCARGFGHRSVGGAAGKLYVVRDPSDDEMIIPR  115

Query  556  PGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKN  735
             GTLRHAVIQ +PLWI+F RDM+I L QELI+  +KTIDGRGA+VHI   A ITLQ V+N
Sbjct  116  KGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRGAQVHIM-FAQITLQNVQN  174

Query  736  VIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VI+H ++IH+    SGG++RD++ H+GLRT SDGDG+S
Sbjct  175  VILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVS  212



>gb|EPS73633.1| hypothetical protein M569_01123, partial [Genlisea aurea]
Length=455

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 159/240 (66%), Gaps = 9/240 (4%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            + +L F  +  +     +    D+  + R  EAR  +L  Y+ +P +V   FN+ V   L
Sbjct  1    LSLLLFLFIVGSSAGDEYGAQLDEYMKSRAEEARRESLKAYKDNPEDVAEQFNQLVSDSL  60

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
                 I +NST R L   +   G C ATNPIDRCWRC ++W  NRK+LA C  GFG   T
Sbjct  61   -----IGANSTRRDL---RGVGGGCRATNPIDRCWRCDNDWAKNRKKLADCVRGFGHDTT  112

Query  493  GGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGKNGR Y+VTD SDN   +PKPGTLRHAVIQK+PLWIIF   MIIRL+QELI    KTI
Sbjct  113  GGKNGRYYLVTDPSDNDMANPKPGTLRHAVIQKEPLWIIFAHSMIIRLNQELIFTSHKTI  172

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            DGRG +VHI+ GAG+T+QFV NVIIH I+IHNI    GG++RD+ DH GLRTMSDGD IS
Sbjct  173  DGRGVQVHIANGAGLTIQFVTNVIIHNIWIHNIAPAGGGMIRDSIDHIGLRTMSDGDAIS  232



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 157/246 (64%), Gaps = 14/246 (6%)
 Frame = +1

Query  118  KMKGFMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNRE  297
            K   F+++      A A V  A IG+FD+ W +R   A   A   Y+ DPFNVT   N  
Sbjct  10   KPGSFLLVAGVFLAAAAAVSNAGIGEFDEHWEKRRAAAEAAAEEVYKPDPFNVT---NES  66

Query  298  VQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGF  477
             ++ +  RE    NS          YKGPC ATNPIDRCWRC  +W ++RKRLA C +GF
Sbjct  67   TERGVLRRELSGKNS---------KYKGPCLATNPIDRCWRCRKDWATDRKRLARCAMGF  117

Query  478  GRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQ  654
            GR ATGG  G+IYVVTD  D +  +P+ GTLR   +Q  PLWI F + M+IRL QEL++ 
Sbjct  118  GRGATGGVRGKIYVVTDPGDGDAANPRYGTLRWGAMQAAPLWITFAKSMVIRLTQELLVA  177

Query  655  GDKTIDGRGARVHIS-GGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
             DKTIDGRGA+VHI+ GGAGIT+QF +NVII  +++H++    GG VRD+  H G RT +
Sbjct  178  SDKTIDGRGAQVHIARGGAGITVQFARNVIITSLHVHDVKHSDGGAVRDSPTHIGPRTRA  237

Query  832  DGDGIS  849
            DGDGIS
Sbjct  238  DGDGIS  243



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 151/219 (69%), Gaps = 6/219 (3%)
 Frame = +1

Query  196  FDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHY  375
             D+ W++R  +A  + + +YE +P  VT  FN EV +++     +  N T R L   K Y
Sbjct  33   LDEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELI-----MGKNETRRNLKGQKKY  87

Query  376  KGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDP  552
             GPC  TNPID CWRC  NW +NR ++  C  GFGRK TGGK G IYVVTD SD +  +P
Sbjct  88   VGPCKVTNPIDSCWRCDPNWANNRMKIVDCIQGFGRKTTGGKGGPIYVVTDPSDGDLVNP  147

Query  553  KPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVK  732
            +PGTLRHAVIQK PLWI F R+M+I+L QEL++  DKTIDGRGA V+I  GAGIT+QFVK
Sbjct  148  RPGTLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGANVNIFDGAGITIQFVK  207

Query  733  NVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            NVII  ++I  I    GG++RD+ DHFG RT SDGDGIS
Sbjct  208  NVIITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGDGIS  246



>gb|ACN96380.1| hypothetical protein, partial [Tripsacum sp. JRI-2009]
Length=262

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 143/208 (69%), Gaps = 15/208 (7%)
 Frame = +1

Query  229  AREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPID  408
            AR   L  Y SDP   T  FN +V +           +TTRR L    Y+GPC ATNPID
Sbjct  3    ARSRNLAAYVSDPVAATNRFNADVLR-----------ATTRRAL--ARYEGPCMATNPID  49

Query  409  RCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQ  585
            RCWRC ++W  +RKRLA C  GFG K  GG  G++YVVTD SD+    P+ GTLRHAVIQ
Sbjct  50   RCWRCRADWAQDRKRLAQCARGFGHKTVGGAAGKLYVVTDPSDDEMIIPRKGTLRHAVIQ  109

Query  586  KKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHN  765
             +PLWI+F RDM+I L QELI+  +KTIDGRGA+VHI   A ITLQ V+NVI+H ++IH+
Sbjct  110  DRPLWIVFARDMVIELRQELIVNHNKTIDGRGAQVHII-FAQITLQNVQNVILHNLHIHD  168

Query  766  IVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
                SGG++RD++ H+GLRT SDGDGIS
Sbjct  169  SKAHSGGMIRDSKRHYGLRTRSDGDGIS  196



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 141/218 (65%), Gaps = 9/218 (4%)
 Frame = +1

Query  199  DDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYK  378
            D  W+ R   A +     Y SDP+++T      V +++ I E     +   R  +     
Sbjct  26   DSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEII-IGEKNGRRNLRGRGGK-----  79

Query  379  GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPK  555
              C ATNPIDRCWRC  NW +NRK+LA C  GFGR   GGKNG  YVV  S DN   +P 
Sbjct  80   --CMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPA  137

Query  556  PGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKN  735
            PGTLRHAV +  PLWIIF R M IRL QELIM  DKTIDGRG  V+I+ GAGIT+QF+KN
Sbjct  138  PGTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITIQFIKN  197

Query  736  VIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VIIHGI I NI  G+GGL+RD+E H+G RT SDGDGIS
Sbjct  198  VIIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGIS  235



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 158/241 (66%), Gaps = 15/241 (6%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKV  309
            F  +L     A A    +++   ++ W  R  EAR +    Y SDP      FN E  + 
Sbjct  15   FYYVLATAVAAAAAAAASNVTSDEEYWAERAEEARANNRAAYVSDPIAAMNRFNTETLR-  73

Query  310  LEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKA  489
                      +TTRR LR   Y+GPC ATNPID CWRC ++W ++R+RLA C  GFG K 
Sbjct  74   ----------ATTRRSLR--RYQGPCAATNPIDSCWRCRADWATDRQRLALCARGFGHKT  121

Query  490  TGGKNGRIYVVTDSSDNPT-DPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKT  666
            TGG  G+IY+VTD+SD+    P+ GTLR+ VIQ +PLWI+F RDM++RL QELI+  +KT
Sbjct  122  TGGAGGKIYIVTDASDDEMIIPRKGTLRYGVIQGRPLWIVFARDMVVRLRQELIVSDNKT  181

Query  667  IDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGI  846
            IDGRGA+VHI+ GA ITLQ V +VIIH ++IH+    SGG++RD++ H+GLRT SDGDGI
Sbjct  182  IDGRGAQVHIT-GAQITLQSVSHVIIHNVHIHHSAPHSGGIIRDSKRHYGLRTRSDGDGI  240

Query  847  S  849
            S
Sbjct  241  S  241



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 150/238 (63%), Gaps = 9/238 (4%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L  T     P L A I +FD+  R +  +A E AL +Y   P  VT   N  V   ++  
Sbjct  14   LLATLAITIPCLEAGIAEFDEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHVHLSMQ--  71

Query  322  EAIASNSTTRRLLRSKHYKG-PCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGG  498
                 N T R L    +  G PC ++NPID CWRC+ +W  +R RLA CG GFGR+A GG
Sbjct  72   -----NVTRRGLKEGNNAIGKPCESSNPIDNCWRCNKDWAKDRYRLAKCGKGFGRRAVGG  126

Query  499  KNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDG  675
              G IYVVTD+SD +  +PKPGTLR+AV QK PLWI F+R MII L QEL++  DKTIDG
Sbjct  127  LGGPIYVVTDNSDEDMINPKPGTLRYAVTQKGPLWITFERSMIISLQQELMISSDKTIDG  186

Query  676  RGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            RGA V I  G G+T+QFV NVIIHGI + +IV   GGL+RD+ +H G RT SDGD IS
Sbjct  187  RGANVQIRDGGGLTMQFVNNVIIHGIRVKDIVPKEGGLIRDSYNHIGQRTRSDGDAIS  244



>gb|ACN96322.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96327.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96330.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96331.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96332.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96333.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96336.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96337.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96338.1| hypothetical protein, partial [Zea mays subsp. mays]
 gb|ACN96339.1| hypothetical protein, partial [Zea mays subsp. mays]
Length=278

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 146/218 (67%), Gaps = 15/218 (7%)
 Frame = +1

Query  199  DDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYK  378
            ++ W  R   AR   L  Y SDP   T  FN +V +           +TTRR L    Y 
Sbjct  9    EEYWAERAEVARSRNLAAYVSDPVAATNRFNADVLR-----------ATTRRAL--ARYD  55

Query  379  GPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPK  555
            GPC ATNPIDRCWRC ++W ++RKRLA C  GFG +  GG  G++YVV D SD+    P+
Sbjct  56   GPCMATNPIDRCWRCRADWATDRKRLAQCARGFGHRTVGGAAGKLYVVRDPSDDEMIIPR  115

Query  556  PGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKN  735
             GTLRHAVIQ +PLWI+F RDM+I L QELI+  +KTIDGRGA+VHI   A ITLQ V+N
Sbjct  116  KGTLRHAVIQDRPLWIVFARDMVIELRQELIVNHNKTIDGRGAQVHIM-FAQITLQNVQN  174

Query  736  VIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            VI+H ++IH+    SGG++RD++ H+GLRT SDGDG+S
Sbjct  175  VILHNLHIHDSKAHSGGMIRDSKRHYGLRTRSDGDGVS  212



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 150/238 (63%), Gaps = 9/238 (4%)
 Frame = +1

Query  142  LFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIR  321
            L  T     P L A I +FDD  + +  +A + AL +Y   P  V    N  V   +   
Sbjct  12   LLVTLAITIPCLEAGIAEFDDFLKAQSEKAHKIALESYVPTPEFVASELNYHVHLSML--  69

Query  322  EAIASNSTTRRLLRSKHYKG-PCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGG  498
                 NST R L    +  G PC+++NPID CWRC+ +W ++R RLA CG GFGR+A GG
Sbjct  70   -----NSTRRGLKAGNNDAGAPCDSSNPIDNCWRCNKDWANDRYRLAKCGKGFGRRAVGG  124

Query  499  KNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDG  675
              G IYVVTD+SD +  +PK GTLR+ V QK PLWI F R MII L QEL++  DKTIDG
Sbjct  125  LGGPIYVVTDNSDEDMVNPKEGTLRYGVTQKGPLWITFARSMIITLQQELLISSDKTIDG  184

Query  676  RGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            RGA V I  GAG+T+QFV NVIIHGI + NIV   GG++RD+ +H GLRT SDGD IS
Sbjct  185  RGANVQIRDGAGLTMQFVNNVIIHGIRVKNIVSKEGGMIRDSYNHVGLRTRSDGDAIS  242



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 163/227 (72%), Gaps = 9/227 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            A+I +FDD W+++  EA   +   Y  DP  VT  FN+ V   L + EA    ++TRR L
Sbjct  26   ANIVEFDDHWQKKAEEALARSRAAYNPDPEAVTHDFNKAVH--LALSEA---RNSTRRTL  80

Query  361  RSKH---YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS  531
            RS H   +KGPC ATNPIDRCWRC  NW ++RK+LA C  GFGR A GGKNG  YVVTD 
Sbjct  81   RSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVVTDP  140

Query  532  SDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGA  708
            SD+   +PK GTLR  VIQ +PLWIIF RDMIIRL +EL++  +KTIDGRGA VHI+ GA
Sbjct  141  SDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVHIAFGA  200

Query  709  GITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             IT+QFV +VIIHGI+IH+I   +GG++RD+  HFG+RT SDGDGIS
Sbjct  201  QITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGIS  247



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 163/227 (72%), Gaps = 9/227 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            A+I +FDD W+++  EA   +   Y  DP  VT  FN+ V   L + EA    ++TRR L
Sbjct  26   ANIVEFDDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVH--LALSEA---RNSTRRTL  80

Query  361  RSKH---YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDS  531
            RS H   +KGPC ATNPIDRCWRC  NW ++RK+LA C  GFGR A GGKNG  YVVTD 
Sbjct  81   RSVHRNKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVVTDP  140

Query  532  SDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGA  708
            SD+   +PK GTLR  VIQ +PLWIIF RDMIIRL +EL++  +KTIDGRGA VHI+ GA
Sbjct  141  SDDDLVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVHIAFGA  200

Query  709  GITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
             IT+QFV +VIIHGI+IH+I   +GG++RD+  HFG+RT SDGDGIS
Sbjct  201  QITIQFVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGIS  247



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   230 bits (587),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 176/306 (58%), Gaps = 62/306 (20%)
 Frame = +1

Query  118  KMKGFMIILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPF--------  270
            +M   + ++F  C+A + P +  +I + D+ W RR  EARE  L  Y SDP+        
Sbjct  2    EMARLLKLMFMFCIAGLIPTIRGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHE  61

Query  271  ----NVTVAFNREVQKVLEIREA---------------------------------IASN  339
                N T A   E    +++ E                                  +  N
Sbjct  62   RHYDNSTDATETEEDGAVQLEEEHGGAQPEEEHSGAQLEEEHGGAKPEEEEEEGIKMVGN  121

Query  340  ST--TRRLLRSKH-------------YKGPCNATNPIDRCWRCHSNWESNRKRLAACGLG  474
            ST  TRR LR K               KGPC A+NPID+CWRC +NW   RK+L  C  G
Sbjct  122  STKSTRRSLRGKGKGKWSKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKLTRCVRG  181

Query  475  FGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIM  651
            FG + TGGK GRIYVVT + D +  +PKPGTLRHAVIQK+PLWIIFK DM IRL QEL++
Sbjct  182  FGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLSQELLI  241

Query  652  QGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMS  831
               KTID RGA VHI+ GAGIT+QFVKNVIIHG++IH+I   SGG++RD+ DHFG+RT +
Sbjct  242  NSHKTIDARGANVHIAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFGMRTRA  301

Query  832  DGDGIS  849
            DGDG+S
Sbjct  302  DGDGLS  307



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   229 bits (585),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 173/268 (65%), Gaps = 30/268 (11%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAF---------  288
            ++L F    + P + A + + D+ W +R  EARE  L  Y SDP+ +   F         
Sbjct  9    LMLVFCIAGLIPTIQADMSELDEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYDNST  68

Query  289  ---------NREVQKVL-EIREAIAS--NST--TRRLLRSK------HYKGPCNATNPID  408
                     N + ++V  E+ E + S  NST  TRR LR K        KGPC A+NPID
Sbjct  69   DITPTEEASNAKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPID  128

Query  409  RCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQ  585
            +CWRC  NW   RK+L  C  GFG    GGK+GRIYVVT + D +  +P+PGTLRHAVIQ
Sbjct  129  KCWRCRKNWAKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDVVNPEPGTLRHAVIQ  188

Query  586  KKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHN  765
            ++PLWIIFK DM IRL+QEL++   KTID RGA VHI+ GAG+T+QFV++VIIHG++IH+
Sbjct  189  EEPLWIIFKNDMSIRLNQELMINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIHH  248

Query  766  IVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I   SGG++RD+ DHFG+RT +DGDG+S
Sbjct  249  ISESSGGMIRDSADHFGMRTRADGDGLS  276



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 167/257 (65%), Gaps = 13/257 (5%)
 Frame = +1

Query  118  KMKGFMIILFFTC-VAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR  294
            K K     +F  C V+  P L   IG++DD  R++  EA+E AL  Y+ +       F+ 
Sbjct  3    KTKMIACYVFLVCFVSQIPNLRGKIGEYDDYLRKQEAEAQEQALRAYDPEFDQTVKKFDH  62

Query  295  E----VQKVLEIREAIASN---STTRRLLRS----KHYKGPCNATNPIDRCWRCHSNWES  441
                     + I+     N   ++TRR LR     K   GPC ATNP+D+CWRC ++W  
Sbjct  63   NDPSHQNATISIKGGYRPNKNTTSTRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWAQ  122

Query  442  NRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRD  618
            NRKRL +C  GFG K TGG +G+ Y VTD SD+   +PKPGT+RHAVIQK PLWIIF R 
Sbjct  123  NRKRLVSCVRGFGHKTTGGFSGKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIFARS  182

Query  619  MIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRD  798
            M IRL QEL++  +KTID RGA VHI+ GAGIT+QF +NVIIHG++IH+IV  +GG++RD
Sbjct  183  MHIRLKQELMITSNKTIDARGANVHIAFGAGITIQFAQNVIIHGLHIHHIVTSNGGMIRD  242

Query  799  AEDHFGLRTMSDGDGIS  849
            + DH G+RT +DGDGIS
Sbjct  243  SVDHIGIRTQADGDGIS  259



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 165/238 (69%), Gaps = 9/238 (4%)
 Frame = +1

Query  139  ILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEI  318
            +  F  V +   + AHIG+FD+VWR+R  +A++ A + Y  +P  V    N +V K +  
Sbjct  8    LFLFVMVVLVLSIEAHIGEFDEVWRKRAEKAKKAARHAYHPNPKIVADHLNNQVDKAVR-  66

Query  319  REAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGG  498
                 SNS  R L R   Y G C ATNPID+CWRC  NW  NR +LA C LGFGRK TGG
Sbjct  67   ----GSNSRRRDLHR---YNGQCKATNPIDQCWRCDPNWARNRMKLADCVLGFGRKTTGG  119

Query  499  KNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDG  675
            K G+IYVVTD+SD+   +PKPGTLRHAVIQ +PLWIIF ++M+IRL++ELIM  +KTID 
Sbjct  120  KGGKIYVVTDNSDSDLVNPKPGTLRHAVIQPQPLWIIFAKNMVIRLNEELIMTSNKTIDA  179

Query  676  RGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            RG +VHI+ G G+ LQF+ NVII  + IH+   G+GGL+RD+ DH+G RT SDGDGIS
Sbjct  180  RGKQVHIAHGGGLMLQFIHNVIISNLRIHDTKAGNGGLIRDSVDHYGYRTKSDGDGIS  237



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 157/224 (70%), Gaps = 9/224 (4%)
 Frame = +1

Query  181  AHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLL  360
            AHI +FD+VW++R  +A++ A + Y  +P  V    N +V K +       SNS  R L 
Sbjct  23   AHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQVDKAVR-----GSNSRRRDLH  77

Query  361  RSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDN  540
            R   Y G C ATNPID+CWRC  NW  NR +L  C LGFGRK TGGK G+IYVV D+SDN
Sbjct  78   R---YSGKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMDNSDN  134

Query  541  P-TDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGIT  717
               +PKPGTLRHAVIQ +PLWIIF ++M+IRL+QELIM  +KTID RG +VHI+ G G+ 
Sbjct  135  ELVNPKPGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARGRQVHIAHGGGLM  194

Query  718  LQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            LQFV NV+I  ++IH+   GSGGL+RD+  H+G R+ SDGDGIS
Sbjct  195  LQFVHNVLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGIS  238



>ref|XP_004171543.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
Length=444

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = +1

Query  337  NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            NST RR L        C   NPID CWRC SNW  NRKRLA CG+GFGR A GG++GR Y
Sbjct  80   NSTERRKLGFF----SCGTGNPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFY  135

Query  517  VVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            VVTDSSDN P +PKPGTLRHAVIQ+KPLWI+FKRDM+IRL QELIM   KTID RG  VH
Sbjct  136  VVTDSSDNDPVNPKPGTLRHAVIQEKPLWIVFKRDMVIRLKQELIMNSFKTIDARGVNVH  195

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I+ GA IT+QFV N+IIHG++IH+       +VR +  HFG RTM+DGD IS
Sbjct  196  IANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAIS  247



>ref|XP_008460728.1| PREDICTED: probable pectate lyase 1 isoform X3 [Cucumis melo]
Length=369

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = +1

Query  337  NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            NST RR L        C   NPID CWRC SNW  NRKRLA CG+GFGR A GG++GR Y
Sbjct  5    NSTERRKLGFF----SCGTGNPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFY  60

Query  517  VVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            VVTDSSDN P +PKPGTLRHAVIQ+KPLWI+FKRDM+IRL QELIM   KTID RG  VH
Sbjct  61   VVTDSSDNDPVNPKPGTLRHAVIQEKPLWIVFKRDMVIRLKQELIMNSFKTIDARGVNVH  120

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I+ GA IT+QFV N+IIHG++IH+       +VR +  HFG RTM+DGD IS
Sbjct  121  IANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAIS  172



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 146/219 (67%), Gaps = 7/219 (3%)
 Frame = +1

Query  202  DVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKG  381
            + W  R   A  +    YESDP  V   FN  V++ +E      S S   R L  K   G
Sbjct  54   EYWAERAEVAHAYNRAAYESDPVGVMDRFNDGVRRAMETSTPTRSRS---RSLAHKARGG  110

Query  382  PCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPTD---P  552
            PC ATNPID+CWRC  +W  NRKRLA CG+GFG + TGG  GRIYVVTD SD P +   P
Sbjct  111  PCTATNPIDQCWRCRGDWARNRKRLARCGMGFGHRTTGGLAGRIYVVTDPSDEPANLVVP  170

Query  553  KPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVK  732
            + GTLR+AVIQ +PLWI F RDM+I L +EL++  DKTIDGRGA+VH+  GA ITLQ V+
Sbjct  171  RKGTLRYAVIQDRPLWITFARDMVINLCRELLVTSDKTIDGRGAQVHVV-GAQITLQNVR  229

Query  733  NVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            NVI+H ++IH+     GG++RD++ H+GLR  SDGDG+S
Sbjct  230  NVILHNLHIHDAAPRGGGVIRDSKHHWGLRGESDGDGVS  268



>ref|XP_004301165.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=445

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 162/240 (68%), Gaps = 8/240 (3%)
 Frame = +1

Query  133  MIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVL  312
            ++IL        PVL A+IG FDDVW +R  EA + A   Y+ DP    V  N++V K  
Sbjct  11   LVILCLLMSIAIPVLKANIGMFDDVWEQRQKEAEQAAKAAYQHDPLKHVVHLNKQVHK--  68

Query  313  EIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKAT  492
                A+  ++ TRR LR  H  GPC A NPID+CWRC  NW  NR++LA C LGFG   T
Sbjct  69   ----AMKGHNDTRRNLR-HHVDGPCEAINPIDKCWRCDPNWHENRQKLADCALGFGHGTT  123

Query  493  GGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTI  669
            GGK G+IYVVTD +D +  +PK GTLR+AV + +PLWIIF+ DM I L QEL+M  DKTI
Sbjct  124  GGKGGKIYVVTDDTDEDMVNPKEGTLRYAVTRPEPLWIIFEEDMKIELKQELMMASDKTI  183

Query  670  DGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            DGRG  VHI GG  ITLQ+V+N+II  I++ + +  +GG++RD+ +H+GLRT SDGDGIS
Sbjct  184  DGRGVNVHIQGGGQITLQYVRNIIISNIHVRDTIPKNGGMIRDSINHYGLRTESDGDGIS  243



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 145/215 (67%), Gaps = 15/215 (7%)
 Frame = +1

Query  208  WRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTTRRLLRSKHYKGPC  387
            W  R   AR      Y SDP      FN +V +           +TTRR L    Y GPC
Sbjct  47   WAERAEAARSRNRAAYVSDPVAAMNRFNADVLR-----------ATTRRAL--ARYSGPC  93

Query  388  NATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNPT-DPKPGT  564
             ATNPIDRCWRC S+W ++RKRLA C  GFG + TGG  G++YVVTD SD+    P+ GT
Sbjct  94   MATNPIDRCWRCRSDWAADRKRLARCARGFGHRTTGGAAGKLYVVTDPSDDEMIVPRKGT  153

Query  565  LRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVII  744
            LRHAVIQ +PLWI+F RDM+IRL QELI+  DKTIDGRGA+VH+  GA +TLQ V +VI+
Sbjct  154  LRHAVIQDRPLWIVFARDMVIRLRQELIVTSDKTIDGRGAQVHVV-GAQVTLQSVHDVIL  212

Query  745  HGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            H ++IH+ V  SGG++RD++ H G+RT SDGDGIS
Sbjct  213  HNLHIHDAVAHSGGMIRDSKRHTGMRTRSDGDGIS  247



>ref|XP_004138973.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN61525.1| hypothetical protein Csa_2G155600 [Cucumis sativus]
Length=449

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = +1

Query  337  NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            NST RR L        C   NPID CWRC SNW  NRKRLA CG+GFGR A GG++GR Y
Sbjct  85   NSTERRKLGFF----SCGTGNPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFY  140

Query  517  VVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            VVTDSSDN P +PKPGTLRHAVIQ+KPLWI+FKRDM+IRL QELIM   KTID RG  VH
Sbjct  141  VVTDSSDNDPVNPKPGTLRHAVIQEKPLWIVFKRDMVIRLKQELIMNSFKTIDARGVNVH  200

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I+ GA IT+QFV N+IIHG++IH+       +VR +  HFG RTM+DGD IS
Sbjct  201  IANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAIS  252



>ref|XP_002297822.1| pectate lyase family protein [Populus trichocarpa]
 gb|ABK96205.1| unknown [Populus trichocarpa]
 gb|EEE82627.1| pectate lyase family protein [Populus trichocarpa]
Length=450

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 153/249 (61%), Gaps = 15/249 (6%)
 Frame = +1

Query  130  FMIILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTY-------ESDPFNV-TVA  285
            F  +L    V + P      G    + R    E  + + NT        E+D  N   VA
Sbjct  11   FSAVLLLLFVGVMPTTSGTNGGISALTRSVETEKVQSSSNTTMAARSQEEADALNEKAVA  70

Query  286  FNREVQKVLEIREAIASNSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAAC  465
             N E  +V+ + E    NST RR  R  ++   C   NPID CWRC  NW+ NRKRLA C
Sbjct  71   DNPE--EVVSMVEMSIRNSTERR--RLGYFS--CGTGNPIDDCWRCDPNWQKNRKRLADC  124

Query  466  GLGFGRKATGGKNGRIYVVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQE  642
            G+GFGR A GG++GR YVVTD SDN P +P+PGTLRHAVIQ  PLWI+FKRDM+I+L QE
Sbjct  125  GIGFGRNAIGGRDGRFYVVTDPSDNDPVNPRPGTLRHAVIQDAPLWIVFKRDMVIQLKQE  184

Query  643  LIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLR  822
            LIM   KTIDGRG  VHI+ G  IT+QFV NVIIHG++IH+       +VR +  H+G R
Sbjct  185  LIMNSFKTIDGRGVNVHIANGGCITIQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHYGWR  244

Query  823  TMSDGDGIS  849
            TM+DGD +S
Sbjct  245  TMADGDAVS  253



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 144/228 (63%), Gaps = 23/228 (10%)
 Frame = +1

Query  169  PVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNREVQKVLEIREAIASNSTT  348
            P   A I  +D+  +++   A E AL  ++ +P  +    N +V +              
Sbjct  26   PESRAAIAKYDEYLQKKAEVASEEALKAFDPNPEKLADDLNYQVSET-------------  72

Query  349  RRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTD  528
                     +    ATNPIDRCWRC  NW  NR++LA C  GFG +ATGGK GR YVVTD
Sbjct  73   ---------EDDFKATNPIDRCWRCDRNWAQNRQKLADCARGFGHRATGGKGGRYYVVTD  123

Query  529  SSDNPTD-PKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGG  705
             SD+  D PKPGTLRHA IQK+PLWIIF   M+I+L +EL+   +KT+DGRGA+VHI+ G
Sbjct  124  PSDDDMDKPKPGTLRHAAIQKEPLWIIFANHMVIKLKEELLFASNKTLDGRGAKVHIAYG  183

Query  706  AGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            AGITLQFV NVIIH I IH+I    GG++RDA DH GLRT SDGDGIS
Sbjct  184  AGITLQFVHNVIIHNIRIHDIHPAPGGMIRDAVDHIGLRTRSDGDGIS  231



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 172/268 (64%), Gaps = 30/268 (11%)
 Frame = +1

Query  136  IILFFTCVAMAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAF---------  288
            ++L    V + P + A + + D+ W  R  EARE  L  Y SDP+ +   F         
Sbjct  9    LMLVLCIVGLIPTIRADMSELDEYWSGRADEAREFTLQAYHSDPYEIIDHFHERHYDNST  68

Query  289  ---------NREVQKVL-EIREAIAS--NST--TRRLLRSK------HYKGPCNATNPID  408
                     N + ++V  E+ E + S  NST  TRR LR K        KGPC A+NPID
Sbjct  69   DVTPTEEDNNTKPEEVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPID  128

Query  409  RCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSD-NPTDPKPGTLRHAVIQ  585
            +CWRC  NW   RK+L  C  GFG    GGK+GRIYVVT + D +  +P+PGTLRHAVIQ
Sbjct  129  KCWRCRKNWSKRRKKLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDMVNPEPGTLRHAVIQ  188

Query  586  KKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHN  765
            K+PLWIIFK DM IRL+QEL++   KTID RGA VHI+ GAG+T+QFV++VIIHG++IH+
Sbjct  189  KEPLWIIFKNDMSIRLNQELLINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIHH  248

Query  766  IVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I   SGG++RD+ DHFG+RT +DGDG+S
Sbjct  249  ISESSGGMIRDSADHFGMRTRADGDGLS  276



>ref|XP_008460726.1| PREDICTED: probable pectate lyase 8 isoform X1 [Cucumis melo]
Length=449

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = +1

Query  337  NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            NST RR L        C   NPID CWRC SNW  NRKRLA CG+GFGR A GG++GR Y
Sbjct  85   NSTERRKLGFF----SCGTGNPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFY  140

Query  517  VVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            VVTDSSDN P +PKPGTLRHAVIQ+KPLWI+FKRDM+IRL QELIM   KTID RG  VH
Sbjct  141  VVTDSSDNDPVNPKPGTLRHAVIQEKPLWIVFKRDMVIRLKQELIMNSFKTIDARGVNVH  200

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I+ GA IT+QFV N+IIHG++IH+       +VR +  HFG RTM+DGD IS
Sbjct  201  IANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAIS  252



>ref|XP_008460727.1| PREDICTED: probable pectate lyase 1 isoform X2 [Cucumis melo]
Length=431

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = +1

Query  337  NSTTRRLLRSKHYKGPCNATNPIDRCWRCHSNWESNRKRLAACGLGFGRKATGGKNGRIY  516
            NST RR L        C   NPID CWRC SNW  NRKRLA CG+GFGR A GG++GR Y
Sbjct  67   NSTERRKLGFF----SCGTGNPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFY  122

Query  517  VVTDSSDN-PTDPKPGTLRHAVIQKKPLWIIFKRDMIIRLHQELIMQGDKTIDGRGARVH  693
            VVTDSSDN P +PKPGTLRHAVIQ+KPLWI+FKRDM+IRL QELIM   KTID RG  VH
Sbjct  123  VVTDSSDNDPVNPKPGTLRHAVIQEKPLWIVFKRDMVIRLKQELIMNSFKTIDARGVNVH  182

Query  694  ISGGAGITLQFVKNVIIHGIYIHNIVRGSGGLVRDAEDHFGLRTMSDGDGIS  849
            I+ GA IT+QFV N+IIHG++IH+       +VR +  HFG RTM+DGD IS
Sbjct  183  IANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAIS  234



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 173/262 (66%), Gaps = 25/262 (10%)
 Frame = +1

Query  139  ILFFTCVA-MAPVLMAHIGDFDDVWRRRHLEAREHALNTYESDPFNVTVAFNR-------  294
            ++   C+A + P + ++I + D+ W++R  EA +H+L  Y SDPF +   F+        
Sbjct  9    LICVVCIASLIPAIRSNIAELDEYWQQRSEEAEKHSLAAYHSDPFEIVDHFHERHYDNST  68

Query  295  ----EVQKVLEIREAIAS-----NSTTRRLL-------RSKHYKGPCNATNPIDRCWRCH  426
                E Q   E  ++IA      NST R L        +    KGPC+A+NPID+CWRC 
Sbjct  69   DIETERQDDQEEEDSIAMLTGSINSTRRSLRGGRRGRGKWSKLKGPCSASNPIDKCWRCM  128

Query  427  SNWESNRKRLAACGLGFGRKATGGKNGRIYVVTDSSDNP-TDPKPGTLRHAVIQKKPLWI  603
             +W   R++LA C  GFG K TGGK GRIYVVT + DN   +P+PGTLRHAVIQK+PLWI
Sbjct  129  PDWARRRQKLADCVRGFGYKTTGGKLGRIYVVTSNLDNDLINPRPGTLRHAVIQKEPLWI  188

Query  604  IFKRDMIIRLHQELIMQGDKTIDGRGARVHISGGAGITLQFVKNVIIHGIYIHNIVRGSG  783
            IFK DM IRL QEL++   KTID RGA VHI+ GAGIT+QFV N+IIHG++IH+IV  +G
Sbjct  189  IFKNDMNIRLQQELMINSHKTIDARGANVHIAYGAGITMQFVTNIIIHGLHIHHIVSSNG  248

Query  784  GLVRDAEDHFGLRTMSDGDGIS  849
            G++RD+ DH+G RT +DGDG+S
Sbjct  249  GMIRDSVDHYGFRTRADGDGLS  270



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1664082826224