BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6521_g1_i1 len=842 path=[881:0-841]

Length=842
                                                                      Score     E

ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         336   2e-109   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              334   2e-109   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              336   2e-109   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              335   3e-109   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              334   1e-108   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              332   6e-108   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              332   8e-108   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              332   9e-108   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         331   2e-107   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    328   1e-106   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    328   2e-106   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         327   8e-106   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              326   2e-105   
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    323   2e-104   Solanum lycopersicum
emb|CDP02198.1|  unnamed protein product                                319   2e-102   
gb|EPS66620.1|  hypothetical protein M569_08154                         314   6e-101   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                314   7e-101   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                308   1e-98    
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              305   2e-97    
gb|AAB69766.1|  putative pectate lyase Nt59                             283   1e-92    Nicotiana tabacum [American tobacco]
ref|XP_010925369.1|  PREDICTED: pectate lyase                           286   4e-90    
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               285   2e-89    
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      283   8e-89    
ref|XP_010112093.1|  putative pectate lyase 7                           282   1e-88    
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      283   1e-88    
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             281   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      281   4e-88    
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      281   4e-88    
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             281   5e-88    Populus trichocarpa [western balsam poplar]
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      279   8e-88    
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      280   1e-87    
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      280   2e-87    
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             279   2e-87    
gb|KHN13490.1|  Putative pectate lyase 3                                276   3e-87    
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              279   4e-87    
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    276   4e-87    
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           278   4e-87    
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       278   5e-87    
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    278   8e-87    
gb|KHN01171.1|  Putative pectate lyase 3                                277   1e-86    
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           277   1e-86    
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           277   2e-86    
ref|XP_002270089.1|  PREDICTED: pectate lyase                           276   2e-86    Vitis vinifera
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               277   2e-86    
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               276   3e-86    
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      276   3e-86    
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      277   3e-86    
ref|XP_002311599.2|  pectate lyase family protein                       276   5e-86    Populus trichocarpa [western balsam poplar]
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      273   8e-86    
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    275   8e-86    
emb|CDX70590.1|  BnaC03g06740D                                          276   1e-85    
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      275   1e-85    
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      275   1e-85    
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             275   2e-85    Elaeis guineensis
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               275   2e-85    
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              274   2e-85    
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               276   2e-85    
emb|CBI15265.3|  unnamed protein product                                273   2e-85    
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      274   2e-85    
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      273   3e-85    
emb|CAN77957.1|  hypothetical protein VITISV_021245                     272   4e-85    Vitis vinifera
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      273   6e-85    Vitis vinifera
emb|CAN79927.1|  hypothetical protein VITISV_042447                     273   7e-85    Vitis vinifera
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               274   7e-85    
ref|XP_002282500.3|  PREDICTED: pectate lyase                           273   7e-85    Vitis vinifera
ref|XP_010242445.1|  PREDICTED: pectate lyase                           273   8e-85    
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              272   9e-85    
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             272   9e-85    
ref|XP_010066949.1|  PREDICTED: pectate lyase                           272   1e-84    
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              272   1e-84    
emb|CBI22159.3|  unnamed protein product                                273   2e-84    
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         271   2e-84    
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      271   2e-84    
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    271   2e-84    
gb|ABK28696.1|  unknown                                                 272   2e-84    Arabidopsis thaliana [mouse-ear cress]
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    272   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197015.4|  putative pectate lyase 19                             272   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    273   2e-84    
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    272   3e-84    
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3    273   3e-84    
ref|XP_002871648.1|  pectate lyase family protein                       272   3e-84    
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             271   3e-84    
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              271   3e-84    
emb|CDY66593.1|  BnaCnng51570D                                          273   3e-84    
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19               271   4e-84    
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               272   4e-84    
ref|XP_002520133.1|  Pectate lyase precursor, putative                  271   4e-84    Ricinus communis
ref|XP_007037229.1|  Pectate lyase family protein                       270   5e-84    
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         270   5e-84    
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      269   8e-84    
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             270   1e-83    
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              269   1e-83    
gb|KHN08706.1|  Putative pectate lyase 3                                269   1e-83    
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           269   2e-83    
ref|XP_008230729.1|  PREDICTED: pectate lyase                           270   2e-83    
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg             271   2e-83    
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      268   4e-83    
ref|XP_007032453.1|  Pectate lyase family protein                       268   5e-83    
gb|EYU24412.1|  hypothetical protein MIMGU_mgv1a011674mg                262   6e-83    
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      268   6e-83    
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      268   7e-83    
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                    269   7e-83    
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         268   8e-83    
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             267   8e-83    
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                267   8e-83    
ref|NP_001057945.1|  Os06g0583900                                       267   9e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             267   9e-83    
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             268   1e-82    
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    266   1e-82    Lilium longiflorum [Easter lily]
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      266   1e-82    
ref|XP_010105747.1|  putative pectate lyase P59                         266   1e-82    
dbj|BAH20311.1|  AT3G01270                                              264   1e-82    Arabidopsis thaliana [mouse-ear cress]
emb|CDX74293.1|  BnaA03g27540D                                          267   2e-82    
emb|CDX91953.1|  BnaC03g32550D                                          267   2e-82    
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      266   2e-82    
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      265   2e-82    
ref|XP_002882189.1|  pectate lyase family protein                       267   3e-82    
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                267   3e-82    
ref|XP_007046218.1|  Pectate lyase family protein, putative             266   3e-82    
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      267   3e-82    
emb|CDP14850.1|  unnamed protein product                                265   3e-82    
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          265   5e-82    
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      265   7e-82    
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             265   8e-82    
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      265   9e-82    
ref|NP_186776.1|  putative pectate lyase 7                              265   1e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AAM60924.1|  putative pectate lyase                                  265   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                265   1e-81    
emb|CDX85564.1|  BnaA02g02490D                                          265   1e-81    
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               265   2e-81    
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     264   2e-81    
ref|XP_003613595.1|  Pectate lyase                                      264   2e-81    
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      263   2e-81    
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                265   2e-81    
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           264   3e-81    
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             263   3e-81    Elaeis guineensis
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                264   3e-81    
emb|CDY28691.1|  BnaCnng05770D                                          264   3e-81    
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    264   3e-81    
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                264   3e-81    
emb|CDY63769.1|  BnaCnng42620D                                          264   3e-81    
emb|CAN69904.1|  hypothetical protein VITISV_001006                     263   5e-81    Vitis vinifera
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         263   5e-81    
ref|XP_002270112.1|  PREDICTED: pectate lyase                           263   5e-81    Vitis vinifera
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         262   5e-81    
gb|KEH19822.1|  pectate lyase-like protein                              263   6e-81    
gb|AGT16685.1|  pectate lyase precursor                                 258   7e-81    
emb|CDP02199.1|  unnamed protein product                                259   7e-81    
gb|KHG16093.1|  hypothetical protein F383_07683                         262   1e-80    
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         261   3e-80    
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      261   4e-80    
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      260   4e-80    
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      259   7e-80    
gb|KHG08946.1|  Pectate lyase                                           259   7e-80    
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             260   7e-80    
gb|KHN13652.1|  Pectate lyase                                           259   7e-80    
ref|NP_001150425.1|  LOC100284055 precursor                             260   8e-80    Zea mays [maize]
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             259   1e-79    
gb|KHG05193.1|  hypothetical protein F383_30875                         257   1e-79    
ref|NP_172894.1|  putative pectate lyase 3                              259   1e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAB69759.1|  putative pectate lyase                                  259   1e-79    Arabidopsis thaliana [mouse-ear cress]
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    259   1e-79    
dbj|BAK06965.1|  predicted protein                                      259   2e-79    
gb|EEE56553.1|  hypothetical protein OsJ_05879                          258   2e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EAY85003.1|  hypothetical protein OsI_06363                          258   3e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      258   4e-79    
gb|KHN08855.1|  Putative pectate lyase P59                              257   5e-79    
ref|NP_001046281.1|  Os02g0214400                                       258   5e-79    Oryza sativa Japonica Group [Japonica rice]
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    258   1e-78    
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                257   1e-78    
emb|CDX96854.1|  BnaA08g23970D                                          257   2e-78    
gb|EMS65801.1|  hypothetical protein TRIUR3_32637                       251   2e-78    
gb|KHG23093.1|  hypothetical protein F383_29772                         254   2e-78    
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     256   2e-78    
emb|CDY68729.1|  BnaCnng60280D                                          256   2e-78    
emb|CDY53552.1|  BnaA09g57110D                                          257   2e-78    
ref|XP_003621115.1|  Pectate lyase                                      256   3e-78    
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                256   3e-78    
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    256   4e-78    
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                256   4e-78    
gb|EAY99626.1|  hypothetical protein OsI_21605                          255   4e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              255   5e-78    
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             254   6e-78    
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                255   6e-78    
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                255   7e-78    
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080          255   7e-78    Sorghum bicolor [broomcorn]
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      254   8e-78    
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              254   9e-78    
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                254   9e-78    
gb|AAA16476.1|  pectate lyase homolog                                   254   1e-77    Zea mays [maize]
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             254   1e-77    
gb|AAA86241.1|  pectate lyase homolog                                   254   1e-77    Medicago sativa [alfalfa]
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      253   1e-77    
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      253   2e-77    
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                254   2e-77    
dbj|BAJ99909.1|  predicted protein                                      249   2e-77    
gb|AGT16687.1|  pectate lyase                                           253   2e-77    
emb|CDX81636.1|  BnaC08g39650D                                          254   3e-77    
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      253   3e-77    
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                253   3e-77    
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          253   3e-77    Sorghum bicolor [broomcorn]
emb|CDY09356.1|  BnaA02g26540D                                          253   4e-77    
emb|CDY04133.1|  BnaA09g19110D                                          253   4e-77    
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                253   5e-77    
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                253   5e-77    
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                252   6e-77    
ref|XP_006655782.1|  PREDICTED: pectate lyase-like                      249   7e-77    
emb|CDY41679.1|  BnaC02g34750D                                          252   8e-77    
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     258   9e-77    
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      251   9e-77    
gb|EPS62426.1|  hypothetical protein M569_12361                         251   9e-77    
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      252   1e-76    
gb|EAY99621.1|  hypothetical protein OsI_21600                          251   1e-76    Oryza sativa Indica Group [Indian rice]
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                251   1e-76    
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      253   1e-76    
ref|NP_001056784.1|  Os06g0144900                                       251   2e-76    Oryza sativa Japonica Group [Japonica rice]
gb|KHG08055.1|  putative pectate lyase P59                              251   2e-76    
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                251   2e-76    
emb|CDY39314.1|  BnaC05g10650D                                          251   3e-76    
ref|XP_003613596.1|  Pectate lyase                                      251   3e-76    
emb|CDY45254.1|  BnaA06g09240D                                          251   3e-76    
gb|EAZ35814.1|  hypothetical protein OsJ_20107                          242   3e-76    Oryza sativa Japonica Group [Japonica rice]
gb|KEH24975.1|  pectate lyase P59-like protein                          250   4e-76    
emb|CDY17432.1|  BnaC09g21050D                                          250   5e-76    
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             250   6e-76    
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    249   6e-76    
ref|XP_002875142.1|  pectate lyase family protein                       249   7e-76    
ref|NP_178375.1|  putative pectate lyase 6                              249   8e-76    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK05605.1|  predicted protein                                      249   9e-76    
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          249   1e-75    Sorghum bicolor [broomcorn]
gb|AES91206.2|  pectate lyase P59-like protein                          248   1e-75    
emb|CDY03043.1|  BnaC07g21840D                                          248   3e-75    
ref|XP_002511525.1|  Pectate lyase precursor, putative                  248   3e-75    Ricinus communis
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          248   3e-75    Sorghum bicolor [broomcorn]
gb|EAY99627.1|  hypothetical protein OsI_21606                          246   5e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           247   5e-75    
ref|XP_003543726.1|  PREDICTED: pectate lyase                           247   7e-75    
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6                247   7e-75    
gb|ACU23277.1|  unknown                                                 247   7e-75    Glycine max [soybeans]
gb|KHN13240.1|  Putative pectate lyase 3                                247   8e-75    
emb|CDY45202.1|  BnaA06g34060D                                          247   1e-74    
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    247   1e-74    
ref|NP_001056786.1|  Os06g0145100                                       243   1e-74    Oryza sativa Japonica Group [Japonica rice]
dbj|BAC42832.1|  putative pectate lyase                                 240   2e-74    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD68402.1|  putative pectate lyase homolog                         244   4e-74    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150723.1|  pectate lyase precursor                            245   4e-74    Zea mays [maize]
gb|AFW87059.1|  pectate lyase                                           245   4e-74    
gb|EMT25421.1|  Pectate lyase                                           241   6e-74    
ref|NP_001056781.1|  Os06g0144200                                       244   7e-74    Oryza sativa Japonica Group [Japonica rice]
gb|EMS45831.1|  Pectate lyase                                           247   7e-74    
dbj|BAF01663.1|  pectate lyase like protein                             239   9e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      243   2e-73    
ref|XP_010488478.1|  PREDICTED: probable pectate lyase 9                243   2e-73    
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         242   2e-73    
ref|XP_008679844.1|  PREDICTED: pectate lyase                           243   3e-73    
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               243   3e-73    
gb|ACF87417.1|  unknown                                                 243   3e-73    Zea mays [maize]
emb|CDP00293.1|  unnamed protein product                                243   3e-73    
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         242   3e-73    
gb|KHG07401.1|  putative pectate lyase P59                              241   7e-73    
emb|CDY46471.1|  BnaC07g03950D                                          241   8e-73    
ref|XP_003638493.1|  Pectate lyase                                      234   1e-72    
ref|XP_009102476.1|  PREDICTED: probable pectate lyase 10               241   1e-72    
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      241   2e-72    
dbj|BAD95093.1|  pectate lyase like protein                             232   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             240   2e-72    
ref|XP_003609009.1|  Pectate lyase                                      240   2e-72    
gb|KFK39788.1|  hypothetical protein AALP_AA3G287800                    240   2e-72    
ref|XP_009789922.1|  PREDICTED: pectate lyase-like                      239   2e-72    
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         240   3e-72    
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      240   3e-72    
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               238   3e-72    
ref|XP_011087066.1|  PREDICTED: pectate lyase                           239   3e-72    
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               240   4e-72    
ref|XP_002885665.1|  pectate lyase family protein                       239   4e-72    
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             239   5e-72    
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    240   5e-72    
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                238   5e-72    
ref|NP_189110.1|  probable pectate lyase 10                             239   6e-72    Arabidopsis thaliana [mouse-ear cress]
gb|KFK39766.1|  hypothetical protein AALP_AA3G285000                    238   7e-72    
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    239   7e-72    
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    239   7e-72    
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               239   8e-72    
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    239   8e-72    
ref|XP_006297684.1|  hypothetical protein CARUB_v10013715mg             239   1e-71    
ref|XP_009587688.1|  PREDICTED: pectate lyase-like                      237   1e-71    
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                237   1e-71    
gb|KHG12411.1|  hypothetical protein F383_06737                         236   2e-71    
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      238   2e-71    
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                238   2e-71    
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               238   2e-71    
gb|EMT27253.1|  hypothetical protein F775_20306                         235   2e-71    
emb|CDY01151.1|  BnaA04g06680D                                          238   2e-71    
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          238   2e-71    
ref|NP_567409.1|  probable pectate lyase 15                             238   2e-71    
ref|NP_001190720.1|  probable pectate lyase 15                          238   2e-71    
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               238   2e-71    
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  236   2e-71    
emb|CDY56668.1|  BnaCnng30870D                                          237   2e-71    
ref|XP_002884619.1|  pectate lyase family protein                       237   2e-71    
ref|XP_010109687.1|  hypothetical protein L484_015172                   238   2e-71    
ref|XP_002870357.1|  pectate lyase family protein                       239   3e-71    
ref|XP_002863927.1|  pectate lyase family protein                       236   3e-71    
ref|NP_187357.1|  putative pectate lyase 8                              237   3e-71    
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                    236   3e-71    
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              238   4e-71    
gb|ACF84425.1|  unknown                                                 232   4e-71    
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                236   4e-71    
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                236   4e-71    
ref|XP_010466894.1|  PREDICTED: probable pectate lyase 10               237   4e-71    
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                236   4e-71    
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     235   5e-71    
ref|XP_010488576.1|  PREDICTED: probable pectate lyase 10               237   5e-71    
gb|AAM61584.1|  putative pectate lyase                                  236   5e-71    
gb|KHG06252.1|  hypothetical protein F383_10745                         236   5e-71    
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             237   5e-71    
gb|AAM63307.1|  pectate lyase                                           236   5e-71    
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              237   6e-71    
ref|NP_568705.1|  putative pectate lyase 20                             236   6e-71    
ref|XP_010513666.1|  PREDICTED: probable pectate lyase 10               236   7e-71    
gb|KHF99208.1|  hypothetical protein F383_08934                         236   7e-71    
gb|ABO28478.1|  pectate lyase precursor                                 229   7e-71    
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          236   7e-71    
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             237   8e-71    
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     236   8e-71    
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                236   8e-71    
ref|XP_006285259.1|  hypothetical protein CARUB_v10006630mg             234   8e-71    
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                236   8e-71    
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          236   8e-71    
ref|XP_007037816.1|  Pectin lyase-like superfamily protein isoform 2    233   8e-71    
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               235   9e-71    
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     236   1e-70    
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           236   1e-70    
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20               235   1e-70    
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20               235   1e-70    
gb|KHG30349.1|  hypothetical protein F383_15991                         237   1e-70    
emb|CDY18738.1|  BnaC08g08780D                                          237   1e-70    
emb|CDX77400.1|  BnaA07g05380D                                          237   1e-70    
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             234   1e-70    
gb|AAX88800.1|  ripening-related pectate lyase                          235   1e-70    
ref|XP_002321242.2|  pectate lyase family protein                       233   1e-70    
gb|ACN35280.1|  unknown                                                 230   2e-70    
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                235   2e-70    
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8                234   2e-70    
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          234   2e-70    
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          236   2e-70    
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                235   2e-70    
ref|XP_010106682.1|  hypothetical protein L484_004616                   234   2e-70    
emb|CDY19932.1|  BnaA09g03190D                                          234   2e-70    
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             234   3e-70    
emb|CDY53564.1|  BnaC04g55760D                                          235   3e-70    
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   234   3e-70    
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          235   3e-70    
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      234   3e-70    
dbj|BAI94495.1|  pectate lyase                                          233   4e-70    
ref|XP_004228388.1|  PREDICTED: pectate lyase                           234   4e-70    
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      234   5e-70    
gb|KDO82123.1|  hypothetical protein CISIN_1g015702mg                   229   5e-70    
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                234   6e-70    
ref|XP_011042354.1|  PREDICTED: probable pectate lyase 5                233   6e-70    
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                234   7e-70    
ref|XP_009129753.1|  PREDICTED: probable pectate lyase 20               233   7e-70    
ref|XP_002863264.1|  pectate lyase family protein                       233   7e-70    
ref|XP_010100325.1|  hypothetical protein L484_027633                   233   7e-70    
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                234   7e-70    
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    233   7e-70    
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    233   7e-70    
emb|CDY33938.1|  BnaA02g30490D                                          233   7e-70    
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         233   7e-70    
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg                233   8e-70    
dbj|BAB01216.1|  pectate lyase                                          234   8e-70    
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                234   8e-70    
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                      233   9e-70    
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     233   1e-69    
ref|XP_004515913.1|  PREDICTED: probable pectate lyase 12-like          234   1e-69    
gb|AAK66161.1|  pectate lyase                                           231   1e-69    
emb|CDY05655.1|  BnaC02g38820D                                          233   1e-69    
ref|XP_002964286.1|  hypothetical protein SELMODRAFT_81909              231   1e-69    
ref|XP_010450305.1|  PREDICTED: putative pectate lyase 14               233   1e-69    
ref|XP_010440665.1|  PREDICTED: putative pectate lyase 14               233   1e-69    
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               233   1e-69    
emb|CDO99404.1|  unnamed protein product                                233   1e-69    
ref|XP_002966799.1|  hypothetical protein SELMODRAFT_85792              230   1e-69    
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                233   1e-69    
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     233   1e-69    
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11               232   1e-69    
emb|CDY05305.1|  BnaC05g44980D                                          232   1e-69    
gb|AAF19196.1|AF206320_1  pectate lyase 2                               233   1e-69    
emb|CDY24654.1|  BnaA05g30530D                                          232   1e-69    
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                232   1e-69    
emb|CDP16631.1|  unnamed protein product                                232   1e-69    
ref|XP_009147117.1|  PREDICTED: probable pectate lyase 8                232   1e-69    
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           232   2e-69    
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      233   2e-69    
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1    232   2e-69    
ref|XP_010502717.1|  PREDICTED: putative pectate lyase 11               232   2e-69    
ref|XP_002314576.1|  pectate lyase 5 precursor family protein           231   2e-69    
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     233   2e-69    
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             231   2e-69    
gb|KEH41255.1|  pectate lyase family protein                            233   2e-69    
gb|AEN70985.1|  pectate lyase                                           232   2e-69    
ref|XP_002875382.1|  predicted protein                                  232   2e-69    
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                231   2e-69    
ref|XP_006354410.1|  PREDICTED: probable pectate lyase 12-like          234   2e-69    
gb|ADB90475.1|  pectate lyase                                           231   2e-69    
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                233   2e-69    
ref|NP_189065.2|  putative pectate lyase 9                              233   2e-69    
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             232   2e-69    
emb|CDY47327.1|  BnaCnng14640D                                          232   3e-69    
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                231   3e-69    
gb|AEN70984.1|  pectate lyase                                           231   3e-69    
gb|EMT28700.1|  hypothetical protein F775_17439                         231   3e-69    
emb|CAN71915.1|  hypothetical protein VITISV_007917                     231   3e-69    
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   232   3e-69    
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           232   3e-69    
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                232   4e-69    
ref|XP_002885608.1|  pectate lyase family protein                       232   4e-69    
gb|AEN70981.1|  pectate lyase                                           231   4e-69    
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                231   4e-69    
ref|NP_193057.4|  putative pectate lyase 14                             231   4e-69    
emb|CAB41931.1|  pectate lyase like protein                             231   4e-69    
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     233   4e-69    
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg             232   4e-69    
gb|AEN70964.1|  pectate lyase                                           231   4e-69    
gb|AEN70963.1|  pectate lyase                                           231   4e-69    
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      231   4e-69    
ref|NP_189376.1|  putative pectate lyase 11                             231   4e-69    
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     232   4e-69    
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     232   5e-69    
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                232   5e-69    
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          232   5e-69    
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          231   5e-69    
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          231   5e-69    
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     231   5e-69    
ref|XP_002521130.1|  Pectate lyase precursor, putative                  231   5e-69    
ref|XP_010528200.1|  PREDICTED: putative pectate lyase 11               231   5e-69    
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         230   5e-69    
ref|XP_002297822.1|  pectate lyase family protein                       232   5e-69    
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     231   5e-69    
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                230   5e-69    
ref|NP_001190715.1|  putative pectate lyase 14                          231   5e-69    
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg             231   5e-69    
emb|CDY65626.1|  BnaC03g74840D                                          232   6e-69    
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     231   6e-69    
gb|KHG19997.1|  hypothetical protein F383_02891                         230   6e-69    
ref|XP_004246611.1|  PREDICTED: probable pectate lyase 12               232   7e-69    
dbj|BAK06362.1|  predicted protein                                      232   7e-69    
gb|EPS68938.1|  hypothetical protein M569_05827                         230   7e-69    
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             231   7e-69    
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           233   7e-69    
ref|XP_002515037.1|  Pectate lyase precursor, putative                  230   7e-69    
sp|O24554.1|PLY_ZINVI  RecName: Full=Pectate lyase; AltName: Full...    230   7e-69    
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             231   7e-69    
dbj|BAA95715.1|  pectate lyase-like protein                             230   7e-69    
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                231   8e-69    
ref|XP_003541430.1|  PREDICTED: probable pectate lyase 12               232   8e-69    
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     231   8e-69    
gb|EEE60442.1|  hypothetical protein OsJ_13660                          231   8e-69    
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         231   8e-69    
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      230   8e-69    
emb|CAN76500.1|  hypothetical protein VITISV_004734                     230   8e-69    
emb|CAN78491.1|  hypothetical protein VITISV_004934                     230   8e-69    
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                230   8e-69    
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                230   9e-69    
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                230   9e-69    
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               230   9e-69    
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      231   9e-69    
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         231   9e-69    
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           229   1e-68    
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                229   1e-68    
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     230   1e-68    
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                231   1e-68    
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               230   1e-68    
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             230   1e-68    
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                230   1e-68    
gb|KHG22755.1|  hypothetical protein F383_29653                         229   1e-68    
emb|CBI33346.3|  unnamed protein product                                230   1e-68    
gb|ABK92535.1|  unknown                                                 225   1e-68    
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     229   1e-68    
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                231   1e-68    
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                230   1e-68    
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      230   1e-68    
emb|CDY41506.1|  BnaA06g22590D                                          229   1e-68    
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5                229   1e-68    
ref|XP_007044917.1|  Pectate lyase family protein                       229   2e-68    
emb|CAE02420.2|  OSJNBa0095E20.8                                        231   2e-68    
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               229   2e-68    
gb|ABM68553.1|  pectate lyase                                           224   2e-68    
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      230   2e-68    
ref|XP_002311747.2|  pectate lyase 5 precursor family protein           229   2e-68    
gb|ADB90476.1|  pectate lyase                                           229   2e-68    
gb|EEC76710.1|  hypothetical protein OsI_14719                          231   2e-68    
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     230   2e-68    
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                230   2e-68    
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   228   2e-68    
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                229   2e-68    
emb|CDX77470.1|  BnaA07g06080D                                          230   2e-68    
gb|KHN15224.1|  Putative pectate lyase 15                               224   2e-68    
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5-like           229   2e-68    
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                230   2e-68    



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC DG+IDA+EGSTGITISN H+TDHNEVMLFGA+DS+SID+ MQIT
Sbjct  252  GSSNIWIDHMSMENCYDGIIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNR+IAPP D F
Sbjct  312  LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPP-DIF  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK+ITKR Y+ E  W QWTWRS+GD++MNGA+FV++GDP++  KH  LYDGI A   ++V
Sbjct  371  KKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAAAPADQV  430

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL+CK G+ C
Sbjct  431  TWMTRFAGALNCKVGKAC  448



>ref|XP_010317101.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=389

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 175/198 (88%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC DGLIDA+EGSTGITISN H+TDHNEVMLFGA+DS+SID+ MQIT
Sbjct  193  GSSNIWIDHMSMENCYDGLIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQIT  252

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNR+IAPP D F
Sbjct  253  LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPP-DIF  311

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KKEITKR Y+ E  W QWTWRS+GD++MNGA+FV++GDP++  KH  LYDGI     ++V
Sbjct  312  KKEITKREYSPESVWMQWTWRSEGDLYMNGAYFVQAGDPDWSKKHQNLYDGIAPAPADQV  371

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL+CK G  C
Sbjct  372  TWITRFAGALNCKVGLPC  389



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 176/198 (89%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM  C DGLIDA+EGST ITISN HFTDHNEVMLFGA+DS+SID+ MQIT
Sbjct  255  GSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPRCRWG+IHVVNNDYTHWNMYAIGGS++PTIISQGNR+IAPP D F
Sbjct  315  VAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPP-DMF  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KKEITKR YA E  W QWTWRSQGD+FMNGAFFVESGDP++  KH  L+DGI++  GE+V
Sbjct  374  KKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFDGISSAPGEQV  433

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL+C+ G  C
Sbjct  434  TWITRFAGALNCRPGHAC  451



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 176/198 (89%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM  C DGLIDA+EGST ITISN HFTDHNEVMLFGA+DS+SID+ MQIT
Sbjct  255  GSSNIWIDHVSMWRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPRCRWG+IHVVNNDYTHWNMYAIGGS++PTIISQGNR+IAPP + F
Sbjct  315  VAFNHFGKRLVQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPP-EMF  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KKEITKR YA E  W QWTWRSQGD+FMNGAFFVESGDP++  KH  L+DGI++  GE+V
Sbjct  374  KKEITKRDYAPESVWKQWTWRSQGDLFMNGAFFVESGDPDWTKKHQNLFDGISSAPGEQV  433

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL+CK G  C
Sbjct  434  TWITRFAGALNCKQGHAC  451



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SM NC DG+IDA+EGSTGITISN HFTDHNEVMLFGA+DS+SID+ MQIT
Sbjct  251  GASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQIT  310

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNR+IAPP D F
Sbjct  311  LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPP-DIF  369

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK+ITKR Y+ E  W QWTWRS+GD++MNGA+FV+SGDP++  KH  LYDGI+A   ++V
Sbjct  370  KKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPADQV  429

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL CK G+ C
Sbjct  430  TWITRFAGALGCKVGQAC  447



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   332 bits (851),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SM+ C DG+IDA+EGSTGITISN HFTDHNEVMLFGA+DS+SID++MQIT
Sbjct  251  GASNIWIDHVSMKKCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQIT  310

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS +PTII+QGNR+IAPP D F
Sbjct  311  LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPP-DIF  369

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK++TKR Y  E  W QWTWRS+G++FMNGA+F+ESGDP++  KH +LYDGI+A   EEV
Sbjct  370  KKQVTKREYNPEEVWKQWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAASAEEV  429

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL CK G+ C
Sbjct  430  TWITRFAGALGCKEGKAC  447



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   332 bits (850),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 176/198 (89%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SM NC DG+IDA+EGSTGITISN HFTDHNEVMLFGA+DS+SID+ MQIT
Sbjct  251  GASNIWIDHVSMWNCYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQIT  310

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNR+IAPP D F
Sbjct  311  LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPP-DIF  369

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK+ITKR Y+ E  W QWTWRS+GD++MNGA+FV+SGDP++  KH  LYDGI+A   ++V
Sbjct  370  KKQITKREYSPESVWMQWTWRSEGDLYMNGAYFVQSGDPDWSKKHQNLYDGISAAPADQV  429

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL C  G+ C
Sbjct  430  TWITRFAGALGCMVGQAC  447



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   332 bits (850),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 178/198 (90%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM +C DGL+DAIEGST +TISNSHFTDHNEVMLFGA+DS+SID+ MQIT
Sbjct  250  GSSNIWVDHVSMWSCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQIT  309

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGKRL+QRMPRCRWG+IHVVNNDYTHWNMYAIGGS++PTIISQGNR+IAPP D F
Sbjct  310  VAYNHFGKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPP-DMF  368

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KKE+TKR Y+ E  W QW+WRSQGD+FMNGAFFVESGDP++  KH QL+DG+ +  G++V
Sbjct  369  KKEVTKRDYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTQKHIQLFDGVVSASGDQV  428

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRF+GAL+CK G  C
Sbjct  429  TWITRFSGALNCKPGEAC  446



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 178/198 (90%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM +C DGL+DA+EGST +TISNSHFTDHNEVMLFGA+DS+SID+ MQIT
Sbjct  250  GSSNIWVDHVSMWSCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQIT  309

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGKRL+QRMPRCRWG+IHVVNNDYTHWNMYAIGGS++PTIISQGNR+IAPP D F
Sbjct  310  VAYNHFGKRLIQRMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPP-DMF  368

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KKE+TKR Y+ E  W QW+WRSQGD+FMNGAFFVESGDP++  KH +L+DGI +  G++V
Sbjct  369  KKEVTKRDYSPESVWKQWSWRSQGDLFMNGAFFVESGDPDWTKKHTELFDGIVSASGDQV  428

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRF+GAL+CK G  C
Sbjct  429  TWITRFSGALNCKPGEAC  446



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 175/198 (88%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SMR C DG+IDA+EGST ITISN HFTDHNEVMLFGA+DS+SID++MQIT
Sbjct  249  GASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS +PTII+QGNR+IAPP D F
Sbjct  309  LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPP-DIF  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK++TKR Y  E  W  WTWRS+G++FMNGA+F+ESGDP++  KH +LYDGI+A   EEV
Sbjct  368  KKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEV  427

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL CK G+ C
Sbjct  428  TWITRFAGALGCKKGKAC  445



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 175/198 (88%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SMR C DG+IDA+EGST ITISN HFTDHNEVMLFGA+DS+SID++MQIT
Sbjct  248  GASNIWIDHVSMRKCYDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQIT  307

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS +PTII+QGNR+IAPP D F
Sbjct  308  LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPP-DIF  366

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK++TKR Y  E  W  WTWRS+G++FMNGA+F+ESGDP++  KH +LYDGI+A   EEV
Sbjct  367  KKQVTKREYNPEEVWKHWTWRSEGNLFMNGAYFIESGDPDWSKKHKELYDGISAAPAEEV  426

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAGAL CK G+ C
Sbjct  427  TWITRFAGALGCKKGKAC  444



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   327 bits (837),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 174/198 (88%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SM+ C DGLIDA+EGSTGITISN HFTDHNEVMLFGA+DS+SID++MQIT
Sbjct  251  GASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQIT  310

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGS +PTII+QGNR+IAPP D F
Sbjct  311  LAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPP-DIF  369

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK++TKR Y  E  W QWTWRS+G++FMNGA+F ESGDP++  KH  LYDGI+A   E+V
Sbjct  370  KKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPDWSKKHKDLYDGISAAPAEDV  429

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAG L CK G+ C
Sbjct  430  TWMTRFAGVLACKPGKPC  447



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 174/198 (88%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SM+ C DGLIDA+EGSTGITISN HFTDHNEVMLFGA+DS+SID++MQIT
Sbjct  253  GASNIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRL+QRMPRCRWGYIHVVNNDYTHWNMYAIGGS +PTII+QGNR+IAPP D F
Sbjct  313  LAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPP-DIF  371

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK++TKR Y  E  W QWTWRS+G++FMNGA+F ESGDP + +KH  LYDGI+A   E+V
Sbjct  372  KKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAEDV  431

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAG L CK G+ C
Sbjct  432  TWMTRFAGVLGCKPGKPC  449



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S IWIDH+SM+ C DGLIDA+EGSTGITISN HFTDHNEVMLFGA+DS+SID++MQIT
Sbjct  253  GASYIWIDHVSMQRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRL+QRMPRCRWGYIHVVNNDYTHWNMYAIGGS +PTII QGNR+IAPP D F
Sbjct  313  LAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIIHQGNRFIAPP-DIF  371

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            KK++TKR Y  E  W QWTWRS+G++FMNGA+F ESGDP + +KH  LYDGI+A   E+V
Sbjct  372  KKQVTKREYNPESVWMQWTWRSEGNLFMNGAYFTESGDPEWSSKHKDLYDGISAAPAEDV  431

Query  300  TWLTRFAGALHCKAGRKC  247
            TW+TRFAG L CK G+ C
Sbjct  432  TWMTRFAGVLGCKPGKPC  449



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 169/202 (84%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SM  C DGLIDA+E ST ITISNSHFTDHNEVMLFGA+DS S D +MQIT
Sbjct  276  GSSNVWIDHVSMWKCYDGLIDAVEASTAITISNSHFTDHNEVMLFGASDSQSKDAVMQIT  335

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL+QRMPRCRWG+IHVVNNDYTHW MYAIGGS++P IISQGNR+IAPP D F
Sbjct  336  VAFNHFGKRLIQRMPRCRWGFIHVVNNDYTHWEMYAIGGSQHPIIISQGNRFIAPP-DIF  394

Query  480  KKE----ITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFK  313
            KKE    +TKR YA E  W +WTWRS+GD+FMNGAFFV+SGDP+F  KHP+++DGI    
Sbjct  395  KKEVRRTVTKRDYAEEARWKEWTWRSEGDLFMNGAFFVQSGDPDFTKKHPEIFDGIAPAD  454

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
              EVTW+TRFAGAL C+ G  C
Sbjct  455  SSEVTWITRFAGALMCRPGSPC  476



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   314 bits (805),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 162/200 (81%), Gaps = 2/200 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS D+WIDH+SMR C DGLIDAI GSTGITISNSHFTDHNEVMLFGA+D  S D  MQ+T
Sbjct  252  GSQDLWIDHVSMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASDGYSPDAKMQMT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDT-  484
            VAFNHFGKRL+QRMPRCRWGYIHVVNNDYTHWNMYAIGGS  PTIISQGNRYIAPP D  
Sbjct  312  VAFNHFGKRLIQRMPRCRWGYIHVVNNDYTHWNMYAIGGSSAPTIISQGNRYIAPPDDVN  371

Query  483  -FKKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGE  307
             + KE+TKR YA E  W  WTWRS GDVFM GA+F +SGDPN+++KHP+ YD + A  G 
Sbjct  372  MYAKEVTKRDYAPESVWQSWTWRSDGDVFMRGAYFTQSGDPNYMSKHPERYDLMQAADGS  431

Query  306  EVTWLTRFAGALHCKAGRKC  247
             V  +TRFAGAL CK G  C
Sbjct  432  NVAAITRFAGALLCKVGAPC  451



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   314 bits (804),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+ DIWIDH+SM NC DGLIDAI GSTGITISN HFTDHNE MLFGA+DS + D  MQIT
Sbjct  249  GAQDIWIDHVSMTNCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPRCR+GYIHVVNNDYTHWNMYAIGGSKNP IISQGNR+IAPP + F
Sbjct  309  VAFNHFGKRLVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPF  368

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  WSQW WRS+GD+F+ GAFFV+SGDP + +KHP+ YD I A    +V
Sbjct  369  AKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDPTYTSKHPEKYDLIQAASATQV  428

Query  300  TWLTRFAGALHCKAGRKC  247
              +T+FAGAL CK G+ C
Sbjct  429  EIMTKFAGALGCKIGQVC  446



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+ DIWIDH+SM  C DGLIDAI GSTGITISN HFTDHNE MLFGA+DS + D  MQIT
Sbjct  249  GAQDIWIDHVSMTKCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKR+VQRMPRCR+GYIHVVNNDYTHWNMYAIGGSKNP IISQGNR+IAPP + F
Sbjct  309  VAFNHFGKRMVQRMPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPF  368

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  WSQW WRS+GD+F+ GAFFV+SGD  + +KHP+ YD I A    +V
Sbjct  369  AKEVTKREYSPESVWSQWIWRSEGDIFLRGAFFVQSGDATYTSKHPEKYDLIQAASATQV  428

Query  300  TWLTRFAGALHCKAGRKC  247
              +T+FAGAL CK G+ C
Sbjct  429  GIMTKFAGALGCKVGQPC  446



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS DIWIDH+SM NC DGLID I GSTG+T+SNSHFTDHNE MLFGA+DS + D  MQ+T
Sbjct  252  GSQDIWIDHVSMLNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFGASDSHTQDVKMQVT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKR+VQRMPR R+GYIHVVNNDYTHWNMYA+GGSKNP IISQGNRYIAPP + +
Sbjct  312  VAFNHFGKRMVQRMPRARYGYIHVVNNDYTHWNMYAVGGSKNPIIISQGNRYIAPPTNPY  371

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  W WRS+GD+F  GAFFV+SGDP + +KHP+ YD I A   + V
Sbjct  372  AKEVTKREYSPESVWKSWVWRSEGDIFQGGAFFVQSGDPTYTSKHPEKYDLIQAAPAQNV  431

Query  300  TWLTRFAGALHCKAGRKC  247
              +T+FAGAL CK G  C
Sbjct  432  AEITKFAGALGCKVGVPC  449



>gb|AAB69766.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=171

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = -3

Query  762  TGITISNSHFTDHNEVMLFGAADSTSIDKMMQITVAFNHFGKRLVQRMPRCRWGYIHVVN  583
            T ITISN HFTDHNEVMLFGA+DS+SID++MQIT+AFNHFGKRLVQRMPRCRWGYIHVVN
Sbjct  1    TAITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRMPRCRWGYIHVVN  60

Query  582  NDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFKKEITKRLYATEGEWSQWTWRSQGDV  403
            NDYTHWNMYAIGGS +PTII+QGNR+IAPP D FK+++TKR Y  E  W  WTWRS+G++
Sbjct  61   NDYTHWNMYAIGGSMHPTIITQGNRFIAPP-DIFKEQVTKREYNPEEVWKHWTWRSEGNL  119

Query  402  FMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVTWLTRFAGALHCKAGRKC  247
            FMNGA+F+ESGDP++  KH +LYDGI+A   EEVTW+TRFAGAL CK G+ C
Sbjct  120  FMNGAYFIESGDPDWSKKHKELYDGISAAPAEEVTWITRFAGALGCKKGKAC  171



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSD+WIDH SMRNC DGLIDAIEGST ITISN HFT HN+V+LFGA+DS   D +MQ T
Sbjct  250  GSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQAT  309

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK+PTIISQGNR+IAPP   F
Sbjct  310  VAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPL-RF  368

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YATE  W QWTWRS+GD+  NGAFF ESG PN    H +  D I A  G  V
Sbjct  369  AKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESGTPNTRTFHRK--DFIRAKPGTWV  426

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAG L CKAGR C
Sbjct  427  RRLTRFAGPLGCKAGRAC  444



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++W+DHLSM  C+DGLID I+GST ITISN HFT HN+V+L GA+D  S D +MQ+T
Sbjct  262  GSSNVWLDHLSMSRCQDGLIDVIQGSTAITISNCHFTHHNDVILLGASDQFSGDSIMQVT  321

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +A+NHFGK LVQRMPRCRWG++HVVNNDYTHW MYAIGGS++PTI+SQGNR+IAPPH ++
Sbjct  322  IAYNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAIGGSQHPTILSQGNRFIAPPHISW  381

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TKR YA   EW +WTW+S+ DVFMNGA+FVESGDPNF +K  +  D I A  G   
Sbjct  382  AKQVTKRDYAQPSEWKRWTWQSEMDVFMNGAYFVESGDPNFKHKFTR-QDIIRAKHGMAA  440

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTR+AG+LHC AG+ C
Sbjct  441  SMLTRYAGSLHCFAGKPC  458



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC DGLIDAIEGST ITISNSHFT HNE MLFGA+D+ S D +MQIT
Sbjct  243  GSSNIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTRHNEAMLFGASDAYSPDAIMQIT  302

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG++HVVNNDYTHW MYA+GGS++PTIISQGNRYIAP  + F
Sbjct  303  VAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAVGGSQHPTIISQGNRYIAPS-NPF  361

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YATE  W QWTWRS+GD+ +NGAFFV+SG    + K+ +  D I A  G  V
Sbjct  362  AKEVTKRDYATESVWKQWTWRSEGDLMLNGAFFVKSGGGGGLQKYDKT-DIIKAKPGSFV  420

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTR++GAL C   R C
Sbjct  421  TRLTRYSGALDCFPQRPC  438



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IW+DH+SM NC+DGLIDAI+GST ITISN HFT HN+VMLFGA+DS   DK+MQ+T
Sbjct  242  GSTNIWLDHISMSNCQDGLIDAIQGSTAITISNCHFTHHNDVMLFGASDSFEGDKIMQVT  301

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS +PTIISQGNR+IAPP++  
Sbjct  302  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNNA-  360

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             K++TKR YA E EW +WTWRS+GD+ MNGAFFV+SG  N   K P   +D I A  G  
Sbjct  361  AKQVTKRDYAAEWEWKRWTWRSEGDLMMNGAFFVQSG--NRSKKRPFTRHDMIKAKPGTF  418

Query  303  VTWLTRFAGALHCKAGRKC  247
            VT LTRFAGAL+C AG+KC
Sbjct  419  VTRLTRFAGALNCYAGKKC  437



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DHLSM NC DGLIDAI+GST ITISN HFT HN+VMLFGA+D+ + D +MQIT
Sbjct  259  GSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTRHNDVMLFGASDAFAGDAIMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCRWG++HVVNNDYTHW MYAIGGS +PTIISQGNR+IAPP+   
Sbjct  319  VAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQA-  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W WRS+GD+ MNGAFFV+SG PN  +   +L D I A  G  V
Sbjct  378  AKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNRKHGFGKL-DMIKAKPGTFV  436

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG+L+CK G+KC
Sbjct  437  TRLTRFAGSLNCKVGKKC  454



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+D+WIDH+SM  C DGLIDAI GST ITISN HFT HN+ +L GA+DS S D +MQ+T
Sbjct  238  GSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDHLMQVT  297

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW +YAIGGSK+PTIISQGNR+IAPP ++ 
Sbjct  298  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPP-ESH  356

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TKR YAT+GEWS+WTWRS+ D+ MNGAFFV+SG P    K P     I A  G   
Sbjct  357  LKQVTKRDYATKGEWSKWTWRSENDLMMNGAFFVQSGQPR--TKKPNRKFMIKAKPGAVA  414

Query  300  TWLTRFAGALHCKAGRKC  247
            T +TRFAGAL CK GRKC
Sbjct  415  TRMTRFAGALDCKPGRKC  432



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 156/198 (79%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSDIWIDH S+RNC DGLIDAIEGST ITISN HFT HN+V+LFGA+DS   D +MQIT
Sbjct  252  GSSDIWIDHCSLRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNEHDSIMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG++HVVNNDYT W MYAIGGS++PTIISQGNR+IAP    F
Sbjct  312  VAFNHFGKGLVQRMPRCRWGFVHVVNNDYTQWIMYAIGGSQHPTIISQGNRFIAPLMQ-F  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YATE  W QWTWRS+GD+  NGAFF ESG PN  + H +  D I A  G  V
Sbjct  371  AKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESGSPNTKSFHRK--DFIKAKPGTWV  428

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAG L C+AGR C
Sbjct  429  RRLTRFAGPLGCRAGRPC  446



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC DGLID I+GST ITISNSHFT HN+VMLFGA+DS   D MMQIT
Sbjct  243  GSSNIWIDHVSMSNCMDGLIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQIT  302

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG++HVVNNDYTHW MYA+GGS++PTI+SQGNRYIA PH   
Sbjct  303  VAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWLMYAVGGSQHPTILSQGNRYIA-PHSLA  361

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA +  W  WTWRS+GD+  NGAFFVESG PN +  + +  D I A  G  V
Sbjct  362  AKEVTKRDYAPQAVWKDWTWRSEGDLMQNGAFFVESGPPNRMKFNTK--DLIKAKPGSFV  419

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRF+GAL+C  GR C
Sbjct  420  TRLTRFSGALNCFPGRPC  437



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 156/198 (79%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM  C DGLIDAI GST ITISNSHFT HN+ +L GA+DS S D++MQ+T
Sbjct  258  GSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDELMQVT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK+PTIISQGNR+IAPP +  
Sbjct  318  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIISQGNRFIAPP-ELH  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TKR YATE EW  WTWRS+ D+ MNGAFF+ESG P    K P     ITA  G   
Sbjct  377  LKQVTKRDYATESEWKTWTWRSENDLMMNGAFFIESGKPR--TKRPHKKFMITAKPGSLA  434

Query  300  TWLTRFAGALHCKAGRKC  247
            T +T FAGAL CK+GRKC
Sbjct  435  TRMTLFAGALDCKSGRKC  452



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DHLSM NC DGLIDAI+GST ITISN HFT HN+VMLFGA+D+ + D +MQIT
Sbjct  201  GSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQIT  260

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCRWG++HVVNNDYTHW MYAIGGS +PTIISQGNR+IAPP+   
Sbjct  261  VAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQA-  319

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W WRS+GD+ MNGAFFV+SG PN  +   +L D I A  G  V
Sbjct  320  AKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGFGKL-DMIKAKPGTFV  378

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAG+L+CK G+KC
Sbjct  379  RRLTRFAGSLNCKVGKKC  396



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DHLSM NC DGLIDAI+GST ITISN HFT HN+VMLFGA+D+ + D +MQIT
Sbjct  264  GSSNIWLDHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQIT  323

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCRWG++HVVNNDYTHW MYAIGGS +PTIISQGNR+IAPP+   
Sbjct  324  VAFNHFGKGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQA-  382

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W WRS+GD+ MNGAFFV+SG PN  +   +L D I A  G  V
Sbjct  383  AKEVTKRDYAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGFGKL-DMIKAKPGTFV  441

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAG+L+CK G+KC
Sbjct  442  RRLTRFAGSLNCKVGKKC  459



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+D+WIDH+SM  C DGLIDAI GST ITISN HFT HN+ +L GA+DS S D +MQ+T
Sbjct  280  GSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDHLMQVT  339

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW +YAIGGSK+PTIISQGNR+IAPP ++ 
Sbjct  340  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPP-ESH  398

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TKR YAT+GEWS+WTWRS+ D+ MNGAFFV+SG P    K P     I A  G   
Sbjct  399  LKQVTKRDYATKGEWSKWTWRSENDLMMNGAFFVQSGQPR--TKKPNRKFMIKAKPGAVA  456

Query  300  TWLTRFAGALHCKAGRKC  247
            T +TRFAGAL CK GR+C
Sbjct  457  TRMTRFAGALDCKPGREC  474



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SMRNC DGLIDAI GST ITISNSHFTDHNE MLFGA+DS   DK+MQIT
Sbjct  252  GSSNIWIDHVSMRNCYDGLIDAIMGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCR+G++HVVNNDYTHW MYAIGGSK+PTIIS+GNR+I  P +  
Sbjct  312  LAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIG-PDNVH  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR Y+ E EWS W WRS  D +MNGAFFV+SG P  +++     D I A  G  V
Sbjct  371  AKEITKREYSPESEWSSWQWRSINDEYMNGAFFVQSG-PELVDRPFSRQDMIKAKPGSYV  429

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AG+L C+ G  C
Sbjct  430  GRLTRYAGSLSCRVGLPC  447



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SMRNC DGLIDAI GST ITISNSHFTDHNEVMLFGA+DS S DK+MQIT
Sbjct  168  GSSNIWIDHVSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQIT  227

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPR R+G++H VNNDYTHW MYAIGGSKNPTIIS+GNR+IA P + F
Sbjct  228  LAFNHFGKRLVQRMPRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIA-PDNQF  286

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K+ITKR YA E  W+ W WRS  DV+MNGAFFV+SG P   ++     D ITA  G  V
Sbjct  287  AKQITKREYAPENVWANWQWRSINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYV  345

Query  300  TWLTRFAG-ALHCKAGRKC  247
              LTR++G  L C+ GR C
Sbjct  346  GRLTRYSGNLLKCRVGRPC  364



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM  C DGLIDAI GST ITISNSHFT HN+ +L GA+DS S D++MQ+T
Sbjct  258  GSSNIWIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDELMQVT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK+PTI+SQGNR+IAPP +  
Sbjct  318  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIVSQGNRFIAPP-ELH  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TKR YA E EW  WTWRS+ D+ MNGAFF+ESG P    K P     ITA  G   
Sbjct  377  LKQVTKRDYAPESEWKTWTWRSENDLMMNGAFFIESGKPR--TKRPHKKFMITAKPGSLA  434

Query  300  TWLTRFAGALHCKAGRKC  247
            T +T FAGAL CK+GRKC
Sbjct  435  TRMTLFAGALDCKSGRKC  452



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SMRNCRDGLIDAI GST ITISNSHFTDHNEVMLFGA+D    D+ MQIT
Sbjct  181  GSSNIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQIT  240

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL+QRMPRCR+G+IHVVNNDYTHW MYAIGGSK+PTIIS+GNR+IA P + +
Sbjct  241  VAFNHFGKRLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PDNGY  299

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR Y+ E EW  W WRS  DV+MNGAFF + G     N+     D ITA  G  V
Sbjct  300  AKEITKREYSPESEWKNWQWRSINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYV  358

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR++G+L C  G+ C
Sbjct  359  GRLTRYSGSLKCIVGKPC  376



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 160/198 (81%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IW+DHLSM NC+DGLIDAI+GST ITISNSHFT HN+VMLFGA+DS   D +MQ+T
Sbjct  236  GSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVT  295

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAPP+   
Sbjct  296  VAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPA-  354

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             ++IT R YATE  W  WTWRS+GD+ MNGA+FV+SG+P+    + + +D I A  G  V
Sbjct  355  ARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPYSR-FDMIKAKPGTFV  413

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRF+G+L+C  GR C
Sbjct  414  RRLTRFSGSLNCYVGRPC  431



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 160/198 (81%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IW+DHLSM NC+DGLIDAI+GST ITISNSHFT HN+VMLFGA+DS   D +MQ+T
Sbjct  246  GSTNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVT  305

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAPP+   
Sbjct  306  VAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPA-  364

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             ++IT R YATE  W  WTWRS+GD+ MNGA+FV+SG+P+    + + +D I A  G  V
Sbjct  365  ARQITNRNYATESVWKTWTWRSEGDLMMNGAYFVQSGNPSKRRPYSR-FDMIKAKPGTFV  423

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRF+G+L+C  GR C
Sbjct  424  RRLTRFSGSLNCYVGRPC  441



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SMRNCRDGLIDAI GST ITISNSHFTDHNEVMLFGA+D    D+ MQIT
Sbjct  255  GSSNIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL+QRMPRCR+G+IHVVNNDYTHW MYAIGGSK+PTIIS+GNR+IA P + +
Sbjct  315  VAFNHFGKRLIQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PDNGY  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR Y+ E EW  W WRS  DV+MNGAFF + G     N+     D ITA  G  V
Sbjct  374  AKEITKREYSPESEWKNWQWRSINDVYMNGAFFRQGGS-ELTNRPFSKKDMITAKPGAYV  432

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR++G+L C  G+ C
Sbjct  433  GRLTRYSGSLKCIVGKPC  450



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SMRNC+DGLIDAI+GST ITISN HFTDHNEVMLFGA+DS   DK+MQIT
Sbjct  238  GSSNVWIDHVSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQIT  297

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCR+G++HVVNNDYTHW MYAIGGSK+PTIIS+GNR+IA P++ +
Sbjct  298  LAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PNNVY  356

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR Y+ E EW  W WRS  D +MNGAFF E G     ++     D ITA  G  V
Sbjct  357  AKEITKREYSPEQEWKNWQWRSINDEYMNGAFFREGGS-QITDRPFSRQDMITAKPGSYV  415

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AG+L C  G+ C
Sbjct  416  GRLTRYAGSLRCIVGKPC  433



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SMRNC+DGLIDAI+GST ITISN HFTDHNEVMLFGA+DS   DK+MQIT
Sbjct  253  GSSNVWIDHVSMRNCKDGLIDAIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCR+G++HVVNNDYTHW MYAIGGSK+PTIIS+GNR+IA P++ +
Sbjct  313  LAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PNNVY  371

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR Y+ E EW  W WRS  D +MNGAFF E G     ++     D ITA  G  V
Sbjct  372  AKEITKREYSPEQEWKNWQWRSINDEYMNGAFFREGGS-QITDRPFSRQDMITAKPGSYV  430

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AG+L C  G+ C
Sbjct  431  GRLTRYAGSLRCIVGKPC  448



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SMRNC DGLIDAI GST ITISNSHFTDHNEVMLFGA+DS S DK+MQIT
Sbjct  255  GSSNVWIDHVSMRNCSDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPR R+G++H VNNDYTHW MYAIGGSKNPTIIS+GNR+IA P + F
Sbjct  315  LAFNHFGKRLVQRMPRVRYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIA-PDNQF  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K+ITKR YA E  W+ W WRS  DV+MNGAFFV+SG P   ++     D ITA  G  V
Sbjct  374  AKQITKREYAPENVWANWQWRSINDVYMNGAFFVQSG-PELASRPFSREDMITAKVGNYV  432

Query  300  TWLTRFAG-ALHCKAGRKC  247
              LTR++G  L C+ GR C
Sbjct  433  GRLTRYSGNLLKCRVGRPC  451



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 159/203 (78%), Gaps = 8/203 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +WIDH SM NC+DGLIDAI+GST ITISN+HFT HNEVMLFGA+DS S D++MQIT
Sbjct  244  GSSHVWIDHNSMSNCKDGLIDAIQGSTAITISNNHFTKHNEVMLFGASDSNSADEIMQIT  303

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIA-----P  496
            VAFNHFG+ L+QRMPRCRWG+ HVVNNDYTHWNMYAIGGS +PTIISQGNRY A     P
Sbjct  304  VAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAIGGSAHPTIISQGNRYTAPHLVDP  363

Query  495  PHDTFKKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAF  316
             HD   K++TKR YA E EW +WTWRS+GD+  NGAFFV SG+P+    + +L D I A 
Sbjct  364  KHDA--KQVTKRDYAMESEWKKWTWRSEGDLMRNGAFFVPSGNPSKRMPYSRL-DMIKAK  420

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V+ LTRF+GAL C+ G  C
Sbjct  421  PGTYVSRLTRFSGALTCRRGGPC  443



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA ++  +DK MQ+T
Sbjct  279  GSSNIWLDHVSMSQCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTYDLDKKMQVT  338

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS++PTI+SQGNR+IAPPH   
Sbjct  339  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSQGNRFIAPPHLPH  398

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS+ D+FMNGA+F +SGDPN+   H +  + I    G  V
Sbjct  399  YREVTKRDYAPEEEWKHWNWRSEKDIFMNGAYFRQSGDPNYETDHTR-RNMIKPKNGYAV  457

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ GR+C
Sbjct  458  SKLTKYAGALDCRVGRRC  475



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DHLSM NC+DGLIDAI+GST ITISNSHFT HN+VMLFGA+DS   D +MQ+T
Sbjct  246  GSSNIWLDHLSMSNCQDGLIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVT  305

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAPP+   
Sbjct  306  VAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPA-  364

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             ++IT R YA E  W  WTWRS+GD+ MNGA+F++SG+P+    + + +D I A  G  V
Sbjct  365  ARQITNRNYAPESVWKTWTWRSEGDLMMNGAYFIQSGNPSKRRPYSR-FDMIKAKPGTFV  423

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRF+G+L+C  GR C
Sbjct  424  RRLTRFSGSLNCFVGRPC  441



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 158/198 (80%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DHLSM NC DGLIDAI+GST ITISNSHFT HN+VMLFGA+D  S D +MQIT
Sbjct  259  GSSNIWLDHLSMWNCADGLIDAIQGSTAITISNSHFTRHNDVMLFGASDGFSGDAIMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCRWG+IHVVNNDYTHW MYAIGGS +PTIISQGNR+IAPP+   
Sbjct  319  VAFNHFGKGLIQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQA-  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W WRS+GD+ +NGAFFV+SG P+  +   +L D + A  G  V
Sbjct  378  AKEVTKRDYAPESVWKSWQWRSEGDLMINGAFFVQSGVPSKNHGFGRL-DVMKARPGTYV  436

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG+L+CK G  C
Sbjct  437  TRLTRFAGSLNCKVGHPC  454



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 153/201 (76%), Gaps = 9/201 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSDIWIDH SMRNC DGLIDAIE ST ITISN HF  HN+V+LFGA+DS   D +MQ+T
Sbjct  273  GSSDIWIDHCSMRNCADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDSIMQVT  332

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR++APP   F
Sbjct  333  VAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSQHPTIISQGNRFLAPPM-RF  391

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDP---NFINKHPQLYDGITAFKG  310
             KEITKR YATE  W  WTWRS+GD+  NGAFF ESG P   NF  K     D I A  G
Sbjct  392  AKEITKRDYATEDVWKHWTWRSEGDLMQNGAFFRESGAPAKNNFDKK-----DFIKAKPG  446

Query  309  EEVTWLTRFAGALHCKAGRKC  247
              V  LTR+AG L C+AGR C
Sbjct  447  TWVKRLTRYAGPLGCRAGRAC  467



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC+DGLID I GS  ITISNSHFT HNEVMLFGA+DS S D +MQIT
Sbjct  245  GSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQIT  304

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS NPTI+SQGNR+IA P++TF
Sbjct  305  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIA-PNNTF  363

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E EW  W WRS  D+ MNGAFFV+SG P   ++    +  + +  G  V
Sbjct  364  AKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISRFHVMKSKPGTFV  423

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRF+G+L C  G+ C
Sbjct  424  TRLTRFSGSLGCFKGKPC  441



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +WIDH+SM NC+DGLIDA+  ST ITISN HFT HN+V+L GA+DS S DK+MQ+T
Sbjct  188  GSSRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDSYSNDKIMQVT  247

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK LVQRMPRCRWG+IHVVNNDYTHW MYAIGGS NPTIISQGNR+IAPP+   
Sbjct  248  LAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPN-  306

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR+YA+E EW  W WRS+GD+ MNGAFF++SG+P  I ++ +  D I +  G  V
Sbjct  307  SKEVTKRVYASEREWRSWNWRSEGDLMMNGAFFIQSGNP--IRRYSK-KDVIHSKPGTFV  363

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG L CK  + C
Sbjct  364  TRLTRFAGPLKCKMNQPC  381



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   275 bits (704),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSDIWIDH S+RNC DGLIDAIE ST ITISN HFT HN+V+LFGA+DS   D MMQ T
Sbjct  250  GSSDIWIDHCSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQAT  309

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+ HVVNNDYT W MYAIGGS++PTIISQGNR++A P   F
Sbjct  310  VAFNHFGKGLVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVA-PRMLF  368

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YATE  W QWTWRS+GD+  NGAFF ESG+PN   +     D I A  G  V
Sbjct  369  SKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESGNPN--ARKFDRKDFIKAKPGTWV  426

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAG L C+AGR C
Sbjct  427  RRLTRFAGPLGCRAGRPC  444



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA ++  +DK MQ+T
Sbjct  279  GSSNIWLDHVSMSQCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTYDLDKKMQVT  338

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS++PTI+SQGNR+IAPPH   
Sbjct  339  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSQGNRFIAPPHLPH  398

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS+ D+FMNGA+F +SG+PN+   H +  + I    G  V
Sbjct  399  YREVTKRDYAPEEEWKHWNWRSEKDIFMNGAYFRQSGNPNYETDHTR-RNMIKPKNGYAV  457

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ GR+C
Sbjct  458  SKLTKYAGALDCRVGRRC  475



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 156/198 (79%), Gaps = 5/198 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SM NC DGLIDAIEGST ITISNSHFT HN+VMLFGA+D+ S D +MQIT
Sbjct  244  GASNIWIDHVSMSNCMDGLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQIT  303

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG++HVVNNDYTHW MYA+GGS++PTI+SQGNR+IAPP   F
Sbjct  304  VAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWMMYAVGGSQHPTILSQGNRFIAPP-TLF  362

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W QW+WRS+GD+  NGAFFVESG P  I K     D I A  G  V
Sbjct  363  AKEVTKREYSPEPVWKQWSWRSEGDLMANGAFFVESGAP--ITK--PYADLIKAKPGSFV  418

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG+  C   + C
Sbjct  419  TRLTRFAGSRPCIPNQPC  436



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC DGLID I GSTGITISNSHFT HNEVMLFGA++S + DKMMQIT
Sbjct  249  GSSNIWIDHVSMENCTDGLIDVIMGSTGITISNSHFTKHNEVMLFGASNSYTQDKMMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCR G+ HVVNNDYTHW MYAIGGS NPTIISQGNR+IA   ++ 
Sbjct  309  VAFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIA-GLNSA  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y  E EW  W W+S+GD+FMNGAFFVESG P   N      D I    G  V
Sbjct  368  AKEVTKREYTAEAEWKNWLWKSEGDLFMNGAFFVESGSP--ANLRADKLDMIPFKPGTYV  425

Query  300  TWLTRFAGALHCKAGRKC  247
            T LT+FAGAL C  G+ C
Sbjct  426  TKLTKFAGALDCFVGKPC  443



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 154/203 (76%), Gaps = 10/203 (5%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSD+WIDH SMRNC DGLIDAIEGST ITISN HFT HN+V+LFGA+DS   D +MQ T
Sbjct  250  GSSDVWIDHCSMRNCADGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQAT  309

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK+PTIISQGNR+IAPP    
Sbjct  310  VAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPLRFA  369

Query  480  K---KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLY--DGITAF  316
            K   KE+TKR YATE  W QWTWRS+GD+  NGAFF      + + KH  ++  D I A 
Sbjct  370  KEVTKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFA-----SLVLKHKDVHRKDFIRAK  424

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V  LTRFAG L CKAGR C
Sbjct  425  PGTWVRRLTRFAGPLGCKAGRAC  447



>ref|XP_010550068.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=469

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SM  C+DGLIDAI+GSTGITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  273  GASNIWIDHVSMSRCQDGLIDAIDGSTGITISNSHFTHHNDVMLLGAHNVIDKDKRMQVT  332

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS++PTI+S GNR+IAPPH   
Sbjct  333  VAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIPQ  392

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E EW  W WRS+ D+FMNGAFF +SG+PNF   H +    I    G  V
Sbjct  393  YKEVTKRDYAPEAEWKNWNWRSERDIFMNGAFFRQSGNPNFRCTHTR-QQMIKPKHGLAV  451

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL CK GR C
Sbjct  452  SMLTKYAGALDCKVGRPC  469



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC+DGLID I GS  ITISNSHFT HNEVMLFGA+DS S D +MQIT
Sbjct  245  GSSNIWIDHVSMSNCQDGLIDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQIT  304

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            V+FNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS NPTI+SQGNR+IAP  +TF
Sbjct  305  VSFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPG-NTF  363

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E EW  W WRS  D+ MNGAFFV+SG P   ++    +  + +  G  V
Sbjct  364  AKEVTKRDYAVESEWKNWNWRSDNDLMMNGAFFVQSGSPITSSRRISRFHVMKSKPGTFV  423

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRF+G+L C  G+ C
Sbjct  424  TRLTRFSGSLGCFKGKPC  441



>ref|XP_010492335.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=499

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  303  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  362

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  363  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  422

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  WTWRS+ DVFMNGA+F +SG+P+F + H +    I    G  V
Sbjct  423  YREVTKRDYAPEDEWKHWTWRSEKDVFMNGAYFRQSGNPHFKSAHTR-KQMIKPKNGMAV  481

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  482  SKLTKYAGALDCRVGKRC  499



>emb|CBI15265.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 152/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM NC DGLIDAI  ST ITISN HFT HNEVMLFGA+D  S D +MQIT
Sbjct  205  GATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQIT  264

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            + FNHFG+ L QRMPRCRWG+ HVVNNDYTHW MYAIGGS +PTI+SQGNR+IAPP D  
Sbjct  265  ITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPP-DIN  323

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  WTWRSQGD+ MNGAFFVESGDPNF   +  +   I A  G  V
Sbjct  324  CKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSNKYV---IRAKPGAFV  380

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRF+GAL C+ G  C
Sbjct  381  TRLTRFSGALSCREGMPC  398



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 157/202 (78%), Gaps = 10/202 (5%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+SM NC DGLIDAIE ST IT+SN HFTDHN+VMLFGA DS+S D++MQ+T
Sbjct  248  GSTNIWIDHVSMSNCMDGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSSQDEIMQVT  307

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRL+QRMPRCR+G+ HV+NNDYTHW MYAIGGS++PTII QGNR+IAPP + F
Sbjct  308  IAFNHFGKRLIQRMPRCRFGFFHVLNNDYTHWEMYAIGGSQHPTIICQGNRFIAPP-NIF  366

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGD----PNFINKHPQLYDGITAFK  313
             KE+TKR YA    W  W W S+ D+ MNGAFF +SGD    P++  K     D I A  
Sbjct  367  AKEVTKREYAPYSVWKDWLWTSEDDIMMNGAFFNQSGDTSKKPSYAKK-----DMIKAKP  421

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G EVT LTRFAGAL+CK G  C
Sbjct  422  GSEVTHLTRFAGALNCKEGTAC  443



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+SM+ C+DGLIDAIEGST ITISN H+T HN+VMLFGA+D    DK+MQ+T
Sbjct  241  GSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDVMLFGASDLYPRDKIMQVT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCRWG+ HVVNNDYTHW MYAIGGS  PTIISQGNR+IAPP +  
Sbjct  301  VAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPP-NLA  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YAT   W  WTWRSQGD+ +NGAFFV+SG P  + K     D I A  G  V
Sbjct  360  AKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQP--LKKKYGRKDMIKAKPGTFV  417

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRF+G L+CK  ++C
Sbjct  418  RRLTRFSGTLNCKPKKRC  435



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 152/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM NC DGLIDAI  ST ITISN HFT HNEVMLFGA+D  S D +MQIT
Sbjct  214  GATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQIT  273

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            + FNHFG+ L QRMPRCRWG+ HVVNNDYTHW MYAIGGS +PTI+SQGNR+IAPP D  
Sbjct  274  ITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPP-DIN  332

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  WTWRSQGD+ MNGAFFVESGDPNF   +  +   I A  G  V
Sbjct  333  CKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSNKYV---IRAKPGAFV  389

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRF+GAL C+ G  C
Sbjct  390  TRLTRFSGALSCREGMPC  407



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 152/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM NC DGLIDAI  ST ITISN HFT HNEVMLFGA+D  S D +MQIT
Sbjct  241  GATNIWIDHISMSNCADGLIDAIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQIT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            + FNHFG+ L QRMPRCRWG+ HVVNNDYTHW MYAIGGS +PTI+SQGNR+IAPP D  
Sbjct  301  ITFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPP-DIN  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  WTWRSQGD+ MNGAFFVESGDPNF   +  +   I A  G  V
Sbjct  360  CKEVTKRDYSPESVWKSWTWRSQGDLMMNGAFFVESGDPNFDFSNKYV---IRAKPGAFV  416

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRF+GAL C+ G  C
Sbjct  417  TRLTRFSGALSCREGMPC  434



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++W+DHLSM NC+DGL+D I  ST ITISN HFT+HNEVMLFG +++   DK+MQ+T
Sbjct  244  GSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVT  303

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNH+G+ LVQRMPRCR+G++HVVNNDYTHW MYAIGGS+NPTIISQGNR+IAPP +  
Sbjct  304  VAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPP-NMA  362

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             KE+TKR YA+  EW  WTW SQGD+  NGAFFV+SGDP    KHP   YD I A  G  
Sbjct  363  CKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTF  420

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  LTRF+G+L CK  + C
Sbjct  421  VNRLTRFSGSLGCKVNQPC  439



>ref|XP_009121613.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX69550.1| BnaA10g18990D [Brassica napus]
Length=499

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADS-TSIDKMMQI  664
            GSS+IWIDH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA ++    D+ MQ+
Sbjct  302  GSSNIWIDHVSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQV  361

Query  663  TVAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDT  484
            TVA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH  
Sbjct  362  TVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLP  421

Query  483  FKKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEE  304
            + KE+TKR YA+E EW  WTWRS+ D+FMNGAFF +SGDP++ + H +    I    G  
Sbjct  422  YYKEVTKRDYASEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTR-KQMIKPKNGYA  480

Query  303  VTWLTRFAGALHCKAGRKC  247
            V+ LT++AGAL C+ GR+C
Sbjct  481  VSKLTKYAGALDCRVGRRC  499



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++W+DHLSM NC+DGL+D I  ST ITISN HFT+HNEVMLFG +++   DK+MQ+T
Sbjct  248  GSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVT  307

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNH+G+ LVQRMPRCR+G++HVVNNDYTHW MYAIGGS+NPTIISQGNR+IAPP +  
Sbjct  308  VAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPP-NMA  366

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             KE+TKR YA+  EW  WTW SQGD+  NGAFFV+SGDP    KHP   YD I A  G  
Sbjct  367  CKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTF  424

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  LTRF+G+L CK  + C
Sbjct  425  VNRLTRFSGSLGCKVNQPC  443



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   273 bits (697),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 154/198 (78%), Gaps = 6/198 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH SM NC+DGL+DAI GST ITISN+H T HNEVMLFGA+DS   D  MQIT
Sbjct  252  GSTNVWIDHNSMSNCKDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDSKMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS NPTIISQGNR+IAPP +  
Sbjct  312  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRFIAPPTEA-  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++T R YA E  W  WTWRS+GD+ MNGA+F++SG P  I K     D ITA KG  V
Sbjct  371  AKQVTNRNYAPESVWKHWTWRSEGDLMMNGAYFIQSGKP--IKKK---RDMITAKKGTFV  425

Query  300  TWLTRFAGALHCKAGRKC  247
              L RF+GAL+CK G++C
Sbjct  426  KRLVRFSGALNCKVGKRC  443



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH+SM NC+DGLIDA+E ST ITISNSHFT HNEVMLFGA+DS+S D +MQIT
Sbjct  240  GSTNVWIDHVSMSNCQDGLIDAVEASTAITISNSHFTKHNEVMLFGASDSSSRDSIMQIT  299

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ L+QRMPR RWG++H VNNDYTHW MYAIGGS +PTI+SQGNR+IAPP+   
Sbjct  300  LAFNHFGQGLMQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPN-  358

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W W+SQGD+ MNGAFFVESG+PN  +   +  D I++  G  V
Sbjct  359  AKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPN--HAFLRSPDMISSKPGSFV  416

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTRF+G+L+C  G+ C
Sbjct  417  SSLTRFSGSLNCIEGKPC  434



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC DGLIDAI GSTGITISN HFT HNEV+LFGA++S + DKMMQIT
Sbjct  249  GSSNIWIDHVSMENCTDGLIDAIMGSTGITISNCHFTKHNEVLLFGASNSYTQDKMMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCR G+ HVVNNDYTHW MYAIGGS NPTIISQGNR+IA   ++ 
Sbjct  309  VAFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIA-GLNSA  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y  E EW  W W+S+GD+FMNGAFFVESG P   N      D I    G  V
Sbjct  368  TKEVTKREYTAEAEWKNWLWKSEGDLFMNGAFFVESGSP--ANLRADKLDMIPFKPGTYV  425

Query  300  TWLTRFAGALHCKAGRKC  247
            T +T+FAGAL C  G+ C
Sbjct  426  TKMTKFAGALDCFVGKPC  443



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 154/199 (77%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +WIDH+SM  C DGLIDAI+GST ITISN HFT HNEVMLFGA+D  S D++MQIT
Sbjct  241  GSSHLWIDHVSMSACSDGLIDAIQGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQIT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAPP +  
Sbjct  301  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPP-NIA  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             KE+TKR YATE +W  W W+S+GD+ MNGAFFV SG+P    + P    D I A  G  
Sbjct  360  AKEVTKRDYATEDQWKNWLWKSEGDLMMNGAFFVNSGNPR--ARFPFSRRDVIKAKPGTY  417

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  LTRFAG L C+ GR C
Sbjct  418  VRRLTRFAGKLGCRVGRPC  436



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 156/200 (78%), Gaps = 7/200 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH+SM NC+DGLIDA+EGST ITISN HFT HN+VMLFGA+D+ S D +MQIT
Sbjct  241  GSTNVWIDHISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQIT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG  L QRMPR RWG++HVVNNDYTHW MYAIGGS +PTI+SQGNR+IAPP+   
Sbjct  301  LAFNHFGHGLTQRMPRVRWGFVHVVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPN-  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLY--DGITAFKGE  307
             KE+TKR YA E  W  W W+SQGD+ MNGAFFVESGDP    KH  L   D IT+  G 
Sbjct  360  AKEVTKRDYAPENVWKNWVWKSQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGS  415

Query  306  EVTWLTRFAGALHCKAGRKC  247
             V+ LT+F+G+L C  GR C
Sbjct  416  SVSSLTQFSGSLKCIEGRPC  435



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++W+DHLSM NC+DGL+D I  ST ITISN HFT+HNEVMLFG +++   DK+MQ+T
Sbjct  273  GSSNVWVDHLSMSNCKDGLVDVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVT  332

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNH+G+ LVQRMPRCR+G++HVVNNDYTHW MYAIGGS+NPTIISQGNR+IAPP +  
Sbjct  333  VAFNHYGRGLVQRMPRCRYGFVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPP-NMA  391

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             KE+TKR YA+  EW  WTW SQGD+  NGAFFV+SGDP    KHP   YD I A  G  
Sbjct  392  CKEVTKRDYASPDEWKSWTWISQGDLLQNGAFFVQSGDPK--KKHPFTRYDMIKAKPGTF  449

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  LTRF+G+L CK  + C
Sbjct  450  VNRLTRFSGSLGCKVNQPC  468



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SM NC DGLIDAI GST ITISN HFT HNEVMLFGA+D  S D++MQIT
Sbjct  237  GSSNVWIDHVSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQIT  296

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTI+SQGNR+IAPP + +
Sbjct  297  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPP-NVY  355

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  WTWRS+GD+ MNGAFFV SGD +      ++ D I+   G  V
Sbjct  356  AKEVTKREYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRM-DMISYKPGTYV  414

Query  300  TWLTRFAGALHCKAGRKC  247
              +TRFAG+L C  GR C
Sbjct  415  KRMTRFAGSLACFVGRPC  432



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM NC+DGLIDAI  +T +T+SN HFT HNEVMLFGA+ S S D +MQIT
Sbjct  246  GATNVWIDHISMSNCKDGLIDAIMSTTAVTVSNCHFTHHNEVMLFGASGSYSGDAVMQIT  305

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAPP    
Sbjct  306  VAFNHFGRGLVQRMPRCRWGFAHVVNNDYTHWIMYAIGGSEHPTIISQGNRFIAPP-TLA  364

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             KE+TKR YA E EW  WTWRS+ D+ MNGAFFV+SG+P+   KHP    D I A  G  
Sbjct  365  AKEVTKRDYAPESEWKHWTWRSEDDLMMNGAFFVQSGNPS--RKHPFSKKDMIPAKPGTY  422

Query  303  VTWLTRFAGALHCKAGRKC  247
            V+ LTRF+GAL CK  + C
Sbjct  423  VSTLTRFSGALGCKINKPC  441



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SM NC DGLIDAI GST ITISN HFT HNEVMLFGA+D  S D++MQIT
Sbjct  237  GSSNVWIDHVSMSNCHDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQIT  296

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTI+SQGNR+IAPP + +
Sbjct  297  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPP-NVY  355

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  WTWRS+GD+ MNGAFFV SGD +      ++ D I+   G  V
Sbjct  356  AKEVTKREYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQSKRRPFSRM-DMISYKPGTYV  414

Query  300  TWLTRFAGALHCKAGRKC  247
              +TRFAG+L C  GR C
Sbjct  415  KRMTRFAGSLACFVGRPC  432



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  276  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  335

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  336  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  395

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS  DVFMNGA+F +SG+P +   H +    I    G  V
Sbjct  396  YREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCAHTR-QQMIKPKNGLAV  454

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ GR+C
Sbjct  455  SKLTKYAGALDCRVGRRC  472



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  276  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  335

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  336  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  395

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS  DVFMNGA+F +SG+P +   H +    I    G  V
Sbjct  396  YREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCAHTR-QQMIKPKNGLAV  454

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ GR+C
Sbjct  455  SKLTKYAGALDCRVGRRC  472



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  276  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  335

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  336  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  395

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS  DVFMNGA+F +SG+P +   H +    I    G  V
Sbjct  396  YREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQYKCAHTR-QQMIKPKNGLAV  454

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ GR+C
Sbjct  455  SKLTKYAGALDCRVGRRC  472



>ref|XP_010420163.1| PREDICTED: probable pectate lyase 19 isoform X1 [Camelina sativa]
Length=499

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  303  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  362

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  363  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  422

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS+ DVFMNGA+F +SG+P+F   H +    I    G  V
Sbjct  423  YREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTR-KQMIKPKNGMAV  481

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  482  SKLTKYAGALDCRVGKRC  499



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  276  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  335

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  336  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  395

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS+ DVFMNGA+F +SG+P+F   H +    I    G  V
Sbjct  396  YREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTR-KQMIKPKNGMAV  454

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  455  SKLTKYAGALDCRVGKRC  472



>ref|XP_010420165.1| PREDICTED: probable pectate lyase 19 isoform X3 [Camelina sativa]
Length=506

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  310  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  369

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  370  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  429

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS+ DVFMNGA+F +SG+P+F   H +    I    G  V
Sbjct  430  YREVTKRDYAPEDEWKHWIWRSEKDVFMNGAYFRQSGNPHFKCAHTR-KQMIKPKNGMAV  488

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  489  SKLTKYAGALDCRVGKRC  506



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  276  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  335

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  336  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  395

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS+ DVFMNGA+F +SG+P +   H +    I    G  V
Sbjct  396  YREVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGNPQYKCAHTR-QQMIKPKHGLAV  454

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  455  SKLTKYAGALDCRVGKRC  472



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IWIDH+SMRN RDGLIDAI+GST ITISNSHFTDHNEVMLFGA+DS   DK+MQIT
Sbjct  253  GSSYIWIDHVSMRNARDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSHEEDKIMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            + FNHFGKRLVQRMPRCR+G+IHVVNNDYTHW MYAIGGSK+PTIIS+GNR++AP     
Sbjct  313  LVFNHFGKRLVQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFVAPDSKD-  371

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K+ITKR Y+ E EW +W WRS  D  +NGAFF+ESG P+  N+     D I++  G  V
Sbjct  372  AKQITKREYSLEPEWKKWQWRSIKDEVINGAFFIESG-PDLTNRPFTRKDMISSRPGTYV  430

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR AG+L C  G+ C
Sbjct  431  GRLTRHAGSLRCIVGKPC  448



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SM NC+DGLIDAI GST ITISN HFT HNEVMLFGA+D  S D++MQ+T
Sbjct  237  GSSNVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQVT  296

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTI+SQGNR+IAPP + +
Sbjct  297  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPP-NVY  355

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFK-GEE  304
             KE+TKR Y+ E  W  WTWRS+GD+ MNGAFFV SGD     + P     + ++K G  
Sbjct  356  AKEVTKREYSPEQVWKSWTWRSEGDLMMNGAFFVTSGDQR--KRRPFSSKDMISYKPGTY  413

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  +TRF+GAL C  GR C
Sbjct  414  VKRMTRFSGALACFVGRPC  432



>emb|CDY66593.1| BnaCnng51570D [Brassica napus]
Length=499

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 156/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADS-TSIDKMMQI  664
            GSS+IWIDH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA ++    D+ MQ+
Sbjct  302  GSSNIWIDHVSMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNNMNEADQKMQV  361

Query  663  TVAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDT  484
            TVA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH  
Sbjct  362  TVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHLP  421

Query  483  FKKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEE  304
            + KE+TKR YA E EW  WTWRS+ D+FMNGAFF +SGDP++ + H +    I    G  
Sbjct  422  YYKEVTKRDYALEDEWKHWTWRSEKDIFMNGAFFRQSGDPHYKSAHTR-KQMIKPKNGYA  480

Query  303  VTWLTRFAGALHCKAGRKC  247
            V+ LT++AGAL C+ G++C
Sbjct  481  VSKLTKYAGALDCRVGKRC  499



>ref|XP_010551866.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=475

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S+IWIDH+SM  C+DGLIDAI+GSTGITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  279  GASNIWIDHVSMSRCQDGLIDAIDGSTGITISNSHFTHHNDVMLLGAHNVIDKDKRMQVT  338

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  339  VAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWQLYAIGGSQGPTILSHGNRFIAPPHIPQ  398

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E EW +W WRS+ DVFMNGAFF +SG+P F   H +    I    G  V
Sbjct  399  YKEVTKRDYAPESEWRKWNWRSEKDVFMNGAFFRQSGNPKFRCTHTR-QQMIRPKHGMAV  457

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AG+L CK GR C
Sbjct  458  SMLTKYAGSLDCKVGRPC  475



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  294  GSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  353

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  354  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  413

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS+ DVFMNGA+F +SG+P+F   H +    I    G  V
Sbjct  414  YREVTKRDYAPEDEWKHWNWRSEKDVFMNGAYFRQSGNPHFKCTHTR-KQMIKHKNGMAV  472

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  473  SKLTKYAGALDCRVGKRC  490



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC+DGLIDAI GST ITISN HFT+HNEVMLFGA+D  S D +MQIT
Sbjct  246  GSSNIWIDHVSMSNCQDGLIDAIMGSTSITISNCHFTNHNEVMLFGASDGYSADTIMQIT  305

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS+ PTIISQGNR+IA P++ F
Sbjct  306  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSRKPTIISQGNRFIA-PNNIF  364

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E EW  W WRS  D+ MNGA FVESG P  I         I A  G  V
Sbjct  365  SKEVTKREYSLESEWKNWNWRSDRDLMMNGAVFVESGKP--ITHDFSRLQLIKAKPGTFV  422

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTR++GAL C  G+ C
Sbjct  423  TRLTRYSGALDCFVGKPC  440



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS +IWIDH+SM  C DGLID I+ ST ITISN HFTDHN+VMLFGA+DS S DK+MQ+T
Sbjct  241  GSHNIWIDHVSMSRCSDGLIDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIMQVT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+IHVVNNDYTHW MYAIGGS  PTI+SQGNR+IAPP +  
Sbjct  301  VAFNHFGQGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSNQPTILSQGNRFIAPP-NIA  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E EW  W WRS+ D+ MNGAFFV+SG P  I +  +  D I A  G  V
Sbjct  360  CKEVTKREYAPESEWKSWNWRSENDLMMNGAFFVQSGSP--IGRGNR-QDVIKAKPGTFV  416

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRF+GALHC   + C
Sbjct  417  TRLTRFSGALHCFKNKPC  434



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 155/200 (78%), Gaps = 7/200 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH+SM NC+DGLIDA+EGST ITISN HFT HN+VMLFGA+D+ S D +MQIT
Sbjct  241  GSTNVWIDHISMSNCQDGLIDAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQIT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG  L QRMPR RWG++H VNNDYTHW MYAIGGS +PTI+SQGNR+IAPP+   
Sbjct  301  LAFNHFGHGLTQRMPRIRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPN-  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLY--DGITAFKGE  307
             KE+TKR YA E  W  W W+SQGD+ MNGAFFVESGDP    KH  L   D IT+  G 
Sbjct  360  AKEVTKRDYAPENVWKNWVWKSQGDLMMNGAFFVESGDP----KHAFLKGPDMITSKPGS  415

Query  306  EVTWLTRFAGALHCKAGRKC  247
             V+ LTRF+G+L C  GR C
Sbjct  416  FVSSLTRFSGSLKCIEGRPC  435



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   269 bits (688),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+SM NC DGLIDAI+GST ITISNSHFT HN+VMLFGA+D+ S D +MQIT
Sbjct  229  GASNVWIDHVSMSNCMDGLIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDAVMQIT  288

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG++HVVNNDYTHW MYAIGGS++PTI+SQGNR+IAPP   F
Sbjct  289  VAFNHFGKGLVQRMPRCRWGFVHVVNNDYTHWMMYAIGGSQHPTILSQGNRFIAPP-TLF  347

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  W WRS+GD+  NGAFFV SG     N      D I A  G  V
Sbjct  348  AKEVTKREYSPEEVWKSWQWRSEGDLLKNGAFFVPSGAGKLGNV--SYKDLIKAKPGTFV  405

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRF+GAL C   R C
Sbjct  406  TRLTRFSGALKCVPNRPC  423



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 155/199 (78%), Gaps = 6/199 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+DIWIDH+S+ NC DGLIDAI GS  ITISN HFT HN+VMLFGA+DS S D +MQIT
Sbjct  242  GSTDIWIDHISLSNCEDGLIDAIMGSNAITISNCHFTKHNDVMLFGASDSYSGDSVMQIT  301

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPR RWG++HVVNNDYTHW MYAIGGS++PTIISQGNR++APP D  
Sbjct  302  VAFNHFGRGLVQRMPRVRWGFVHVVNNDYTHWEMYAIGGSQHPTIISQGNRFVAPP-DPA  360

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDP-NFINKHPQLYDGITAFKGEE  304
             KE+TKR YA E  W  W WRS+GD+ +NGAFFV+SG+    +NK       I+A  G  
Sbjct  361  CKEVTKRDYAVESVWKSWNWRSEGDLMLNGAFFVQSGNAIKTMNKQAV----ISAKPGRY  416

Query  303  VTWLTRFAGALHCKAGRKC  247
            V+ LTRF+GAL+C  GR C
Sbjct  417  VSRLTRFSGALNCVRGRPC  435



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH+SM NC+DGLIDA+E ST ITISN HFT HNEVMLFGA+DS+S D +MQIT
Sbjct  240  GSTNVWIDHVSMSNCQDGLIDAVEASTAITISNCHFTKHNEVMLFGASDSSSRDSIMQIT  299

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ L QRMPR RWG++H VNNDYTHW MYAIGGS +PTI+SQGNR+IAPP+   
Sbjct  300  LAFNHFGQGLRQRMPRVRWGFVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPN-  358

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W W+SQGD+ MNGAFFVESG+PN  +   +  D I++  G  V
Sbjct  359  AKEVTKRDYAPESVWKNWVWKSQGDLMMNGAFFVESGNPN--HAFLRSPDMISSKPGSFV  416

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTRF+G+L+C  G+ C
Sbjct  417  SSLTRFSGSLNCIEGKPC  434



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SMR C+DGLIDAI+GST ITISNSHFTDHNEVMLFGA+DS   D +MQIT
Sbjct  249  GSSNIWIDHVSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCR+G++HVVNNDYTHW MYAIGGSK+PTIIS+GNR+IA P +  
Sbjct  309  LAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PDNIN  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR Y+ E EW  W WRS  D ++NG FF E G     ++    +D +TA  G  V
Sbjct  368  AKEITKREYSPEQEWKSWQWRSINDEYLNGGFFREGG-AQLTDRPYSRHDMMTARPGSYV  426

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AG+L C  G+ C
Sbjct  427  GRLTRYAGSLKCMVGKPC  444



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SMR C+DGLIDAI+GST ITISNSHFTDHNEVMLFGA+DS   D +MQIT
Sbjct  252  GSSNIWIDHVSMRKCKDGLIDAIQGSTAITISNSHFTDHNEVMLFGASDSYDGDTIMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPRCR+G++HVVNNDYTHW MYAIGGSK+PTIIS+GNR+IA P +  
Sbjct  312  LAFNHFGKRLVQRMPRCRYGFVHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIA-PDNIN  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR Y+ E EW  W WRS  D ++NG FF E G     ++    +D +TA  G  V
Sbjct  371  AKEITKREYSPEQEWKSWQWRSINDEYLNGGFFREGG-AQLTDRPYSRHDMMTARPGSYV  429

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AG+L C  G+ C
Sbjct  430  GRLTRYAGSLKCMVGKPC  447



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +W+DHLSM NC DGLID I+GST +TISN HFT HN+V+LFGA+DS + D +MQIT
Sbjct  257  GSSHVWLDHLSMWNCADGLIDVIQGSTAVTISNCHFTRHNDVLLFGASDSFAGDAIMQIT  316

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+IHVVNNDYTHW MYAIGGS +PTIISQGNR+IAPP+   
Sbjct  317  VAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQA-  375

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA  G W  W WRS+GD+ +NGAFFVESG     +   +L D +TA  G  V
Sbjct  376  AKEVTKRDYAPMGVWKNWQWRSEGDLMLNGAFFVESGVAKKNHGFGKL-DMMTAKPGTFV  434

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTRFAG L C+ G+KC
Sbjct  435  SRLTRFAGTLGCRVGQKC  452



>ref|XP_006286712.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
 gb|EOA19610.1| hypothetical protein CARUB_v10002862mg [Capsella rubella]
Length=512

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  316  GSSKIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNTNEADKHMQVT  375

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  376  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  435

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS+ DVFMNGA+F +SGDP +   H +    I    G  V
Sbjct  436  YREVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGDPKYKCAHTR-QQMIKPKHGLAV  494

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  495  SKLTKYAGALDCRVGKRC  512



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 157/199 (79%), Gaps = 5/199 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+SM NC DGLIDA++ ST ITISNSHFT+HN+VMLFGA+DS S D ++QIT
Sbjct  240  GSTNIWIDHVSMSNCDDGLIDAVQASTAITISNSHFTNHNDVMLFGASDSYSEDSILQIT  299

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ L+QRMPR RWG++H VNNDYTHW MYAIGGS++PTI+SQGNR+IAPP+   
Sbjct  300  LAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPN-  358

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFI-NKHPQLYDGITAFKGEE  304
             KE+TKR Y+ E  W  W WRSQGD+ MNGAFFVESG+PN I  K P   D I    G  
Sbjct  359  AKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMKGP---DMIHPRPGSY  415

Query  303  VTWLTRFAGALHCKAGRKC  247
             + LTRF+G+L+C  G+ C
Sbjct  416  ASRLTRFSGSLNCIEGKPC  434



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 155/202 (77%), Gaps = 9/202 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IW+DHLSM  C DGLIDAI+GST ITISN HFT HN+V+L GA+DS S DK+MQ+T
Sbjct  258  GSTNIWLDHLSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGASDSYSRDKLMQVT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IA P+D +
Sbjct  318  VAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSQHPTIISQGNRFIA-PNDPW  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQL-YDGITAFKGEE  304
             KEIT R YA E  W  W WRS+GD+FMNGAFF  SG P      P L Y+ +   K + 
Sbjct  377  AKEITNRNYAPESVWRHWVWRSEGDLFMNGAFFRTSGPP----APPHLKYNKLQMIKAKP  432

Query  303  VTW---LTRFAGALHCKAGRKC  247
             T+   LTRF+GAL+CK   KC
Sbjct  433  ATFVRRLTRFSGALNCKKRVKC  454



>gb|EYU24412.1| hypothetical protein MIMGU_mgv1a011674mg [Erythranthe guttata]
Length=274

 Score =   262 bits (669),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+S+  C DGLIDAIEGST ITISNSHFT HN+VMLFGA+DS S D++MQIT
Sbjct  80   GATNVWIDHVSLSKCVDGLIDAIEGSTAITISNSHFTHHNDVMLFGASDSYSGDQVMQIT  139

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPR RWG++H+VNNDYT W MYAIGGS++PTI+SQGN ++A P D F
Sbjct  140  VAFNHFGKGLIQRMPRVRWGFVHIVNNDYTRWEMYAIGGSQHPTILSQGNNFVA-PQDRF  198

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W W+S+GDV  NGAFF +SGDP   +K    Y  I    G  V
Sbjct  199  AKEVTKRDYAPESVWKNWVWKSEGDVMKNGAFFKQSGDPK--HKFALGYGTIAPKPGGYV  256

Query  300  TWLTRFAGALHCKAGRKC  247
              LT+FAG L C  GR C
Sbjct  257  PSLTKFAGPLKCIKGRPC  274



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+S  NC DGLIDAI+GST ITISN HFT+HN+VMLFG++DS S D++MQIT
Sbjct  248  GASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQIT  307

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ L QRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAP ++  
Sbjct  308  LAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLNEA-  366

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W WRS+ D+ MNGAFFVESG P  I   P+  D I A  G  V
Sbjct  367  SKEVTKREYAAENVWKSWNWRSENDLMMNGAFFVESGSP--IRNLPEA-DMIQAKPGTFV  423

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAG L C  G+ C
Sbjct  424  AKLTRFAGPLKCIKGKPC  441



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 156/198 (79%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S +WIDH+SM NC+DGLIDA+  ST ITISN HFT HN+V+L GA++  S D++MQ+T
Sbjct  246  GASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQVT  305

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK LVQRMPRCRWG+IHVVNNDYTHW MYAIGGS NPTIISQGNR+IAPP+   
Sbjct  306  LAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPNC  365

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR+YA E EW  W WRS+GD+ MNGAFF++SG+P  I ++ +  D I +  G  V
Sbjct  366  -KEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP--IKRYSK-KDVIHSKPGTFV  421

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG L CK  + C
Sbjct  422  TRLTRFAGPLKCKKNQPC  439



>gb|KFK25747.1| hypothetical protein AALP_AA8G154300 [Arabis alpina]
Length=504

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  308  GSSNIWLDHISMSKCQDGLIDAICGSTGITISNSHFTHHNDVMLLGAQNTNEEDKKMQVT  367

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  368  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  427

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS+ D+FMNGA+F +SG P +   H +    I    G  V
Sbjct  428  YREVTKRDYASEDEWKHWNWRSEKDIFMNGAYFRQSGTPGYKCAHTR-KQMIKPKNGMAV  486

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  487  SKLTKYAGALDCRVGKRC  504



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   268 bits (685),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH+SM NC+DGLIDAI+GST ITISN HF++HN+ +L GA+DS S D+ MQIT
Sbjct  267  GSTNVWIDHVSMSNCQDGLIDAIQGSTAITISNCHFSNHNDAILLGASDSFSGDQFMQIT  326

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW +YAIGGS +PTI+SQGN+++AP  D +
Sbjct  327  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLLYAIGGSMHPTIVSQGNQFVAPD-DKY  385

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA   EW +W WRS+GD+ +NGAFFVESG+P  ++  P     I A  G   
Sbjct  386  IKEVTKRDYAPMSEWKKWNWRSEGDLMVNGAFFVESGEPA-LHLRPSKKFMIKAKHGRFA  444

Query  300  TWLTRFAGALHCKAGRKC  247
            T +TRFAGAL CK G+KC
Sbjct  445  TQMTRFAGALDCKYGKKC  462



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SM NC DGLIDAI GST ITISNSHFT HN+VMLFGA++S + DK+MQIT
Sbjct  252  GSSNVWIDHVSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCR G+ HVVNNDYTHW MYAIGGS NPTIISQGNR+IAPP+   
Sbjct  312  VAFNHFGQGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQG-  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR +  E EW  W WRS+GD+ MNGA FV+SG     +KHP   D +    G  V
Sbjct  371  AKEVTKRDHTAEAEWKNWEWRSEGDLMMNGAVFVQSGSGK--SKHPAKMDLMPFKPGTYV  428

Query  300  TWLTRFAGALHCKAGRKC  247
              LT+F+GAL C  G+ C
Sbjct  429  AKLTKFSGALDCFVGKPC  446



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS++WIDH+SM NC DGLIDAI GST ITISNSHFT HN+VMLFGA++S + DK+MQIT
Sbjct  249  GSSNVWIDHVSMENCADGLIDAIMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCR G+ HVVNNDYTHW MYAIGGS NPTIISQGNR+IAPP+   
Sbjct  309  VAFNHFGQGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQG-  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR +  E EW +W WRS+GD+ MNGA FV+SG     + HP   D +    G  V
Sbjct  368  AKEVTKRDHTPEAEWKKWEWRSEGDLMMNGAIFVQSGSGK--SNHPAKMDLMPFKPGTYV  425

Query  300  TWLTRFAGALHCKAGRKC  247
              LT+FAGAL C  G+ C
Sbjct  426  AELTKFAGALDCFVGKPC  443



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++W+DHLS+ NC+DGLID I  STG+TISN H T+HN+VMLFG++DS S D++MQIT
Sbjct  254  GSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQIT  313

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSKNPTIISQGNRYIAPP+   
Sbjct  314  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAA  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
            K+ ITK+L ATE EW  W W S+ D+FM GA+F  SG P  I K     D I    G  V
Sbjct  374  KR-ITKQLGATEEEWKNWVWHSEEDLFMEGAYFTTSGGP--IQKQFSNKDLIKPKPGSYV  430

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG++ C AG+ C
Sbjct  431  TRLTRFAGSIPCVAGKPC  448



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IW+DHLSM NC DGLID I+GST ITISN HFT HN+V+LFGA+DS + D +MQIT
Sbjct  257  GSSHIWLDHLSMWNCGDGLIDVIQGSTAITISNCHFTRHNDVLLFGASDSFAGDAIMQIT  316

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+IHVVNNDYTHW MYAIGGS +PTIISQGNR+IAPP+   
Sbjct  317  VAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNHA-  375

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA    W  W WRS+GD+ +NGAFFVESG     +   +L D +TA  G  V
Sbjct  376  AKEVTKRDYAPVDVWKNWQWRSEGDLMLNGAFFVESGVAKKNHGFGKL-DMMTAKPGTFV  434

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG L C+ G+KC
Sbjct  435  TRLTRFAGTLGCRVGQKC  452



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA D+   DK MQ+T
Sbjct  276  GATNIWLDHISMSRCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDNNQDDKKMQVT  335

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  336  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKPH  395

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+EGEW  W WRS+ D F+NGA F ESG+P+F   H +    I    G  V
Sbjct  396  YREVTKRDYASEGEWKHWNWRSEKDYFLNGAHFRESGNPHFKCSHSR-QQMIKPKHGVAV  454

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  455  SKLTKYAGALDCRVGKAC  472



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+S+  C DGLID I GST ITISN H T+H++VML GA+D+ + D++MQ+T
Sbjct  240  GSSNIWIDHVSLARCSDGLIDVILGSTAITISNCHLTEHDDVMLLGASDTYTQDEIMQVT  299

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCR+G++HVVNNDYTHW MYA+GGS++PTIISQGNRYIA PH   
Sbjct  300  VAFNHFGRGLVQRMPRCRYGFVHVVNNDYTHWIMYAVGGSQHPTIISQGNRYIA-PHIEA  358

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA   EWS+WTW+SQGD+F++GAFFVESG P F NK+ +  D I A  G  V
Sbjct  359  AKEVTKRDYAEPAEWSKWTWKSQGDLFVSGAFFVESGGP-FENKYSK-KDLIKAKPGTFV  416

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRF+GAL+CK   +C
Sbjct  417  QRLTRFSGALNCKENMEC  434



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+SM NC DGLIDA++ ST ITISN HFT+HN+VMLFGA+DS S D ++QIT
Sbjct  240  GSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTNHNDVMLFGASDSYSEDSILQIT  299

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ L+QRMPR RWG++H VNNDYTHW MYAIGGS++PTI+SQGNR+IAPP+   
Sbjct  300  LAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPN-  358

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFI-NKHPQLYDGITAFKGEE  304
             KE+TKR Y+ E  W  W WRSQGD+ MNGAFFVESG+PN I  K P   D I    G  
Sbjct  359  AKEVTKREYSPESVWKNWVWRSQGDLMMNGAFFVESGNPNHIFMKGP---DMIHPRPGSY  415

Query  303  VTWLTRFAGALHCKAGRKC  247
             + LTRF+G+L+C  G+ C
Sbjct  416  ASRLTRFSGSLNCIEGKPC  434



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 154/199 (77%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IWIDH+SM NC+DGLIDAI GST ITISN HFT HNEVMLFGA+DS S D+ MQ+T
Sbjct  226  GSSHIWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQRMQVT  285

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAP  D  
Sbjct  286  VAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPL-DLN  344

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFK-GEE  304
             K++TKR YA E +W  W WRS+GD+ MNGAFFV+SG    ++K      G+  +K G  
Sbjct  345  AKQVTKRDYAPESDWKNWRWRSEGDLLMNGAFFVQSG--KRLSKRRYSRPGMIKYKPGTF  402

Query  303  VTWLTRFAGALHCKAGRKC  247
            VT LTR+AG L C  GR C
Sbjct  403  VTRLTRYAGTLVCGIGRPC  421



>dbj|BAH20311.1| AT3G01270 [Arabidopsis thaliana]
Length=365

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  169  GATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVT  228

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  229  VAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQH  288

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS+ DVFMN A+F +SG+P+F   H +    I    G  V
Sbjct  289  YREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSR-QQMIKPKNGMAV  347

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  348  SKLTKYAGALDCRVGKAC  365



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  275  GATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQVT  334

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS++PTI+S GNR+IAPPH   
Sbjct  335  VAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQH  394

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS  D+FMN A+F +SG+P F+  H +    I    G  V
Sbjct  395  YREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGSAV  453

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  454  SKLTKYAGALDCRVGKPC  471



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  275  GATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQVT  334

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS++PTI+S GNR+IAPPH   
Sbjct  335  VAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQH  394

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS  D+FMN A+F +SG+P F+  H +    I    G  V
Sbjct  395  YREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGSAV  453

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  454  SKLTKYAGALDCRVGKPC  471



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+S  NC DGLIDAI+GST ITISN HFT+HN+VMLFG++DS S D++MQIT
Sbjct  248  GASNVWIDHVSASNCEDGLIDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQIT  307

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ L QRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAP ++  
Sbjct  308  IAFNHFGQGLTQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPXNEA-  366

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W WRS+ D+ +NGAFF+ESG P  I   P+  D I A  G  V
Sbjct  367  SKEVTKREYAAENVWKSWNWRSENDLMVNGAFFIESGSP--IRNLPEA-DMIQAKPGTFV  423

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAG L C  G+ C
Sbjct  424  AKLTRFAGPLKCIKGKPC  441



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 151/199 (76%), Gaps = 6/199 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+DIWIDH+S+ NC DGLIDA+ GS  ITISN HFT HN+VMLFGA+D  S D +MQIT
Sbjct  226  GSTDIWIDHISLSNCEDGLIDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQIT  285

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPR RWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAPP D  
Sbjct  286  VAFNHFGRGLVQRMPRVRWGFAHVVNNDYTHWEMYAIGGSQHPTIISQGNRFIAPP-DLA  344

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDP-NFINKHPQLYDGITAFKGEE  304
             KE+TKR YA E  W  W WRS+GD+ +NGAFFV+SG+    +NK       I A  G  
Sbjct  345  CKEVTKRDYAVESVWKSWNWRSEGDLMLNGAFFVQSGNAIKTMNKQGV----INAMPGRH  400

Query  303  VTWLTRFAGALHCKAGRKC  247
            V+ LTRF+GAL C  GR C
Sbjct  401  VSRLTRFSGALDCVRGRPC  419



>ref|XP_002882189.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58448.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA D+   DK MQ+T
Sbjct  279  GATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDNNMDDKKMQVT  338

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  339  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQH  398

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS+ DVFMN A+F +SG+P+F   H +    I    G  V
Sbjct  399  YREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSR-QQMIKPKHGVAV  457

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  458  SKLTKYAGALDCRVGKAC  475



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++DIW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA D    DK MQ+T
Sbjct  277  GATDIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQVT  336

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  337  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQH  396

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS+ D F+NGA+F +SG+P+F   H +    I    G  V
Sbjct  397  YREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNPHFKCSHSR-QQMIKPKHGVAV  455

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  456  SKLTKYAGALDCRVGKAC  473



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DHLSM NC DGLIDAI+GST ITISN HFT+HNEVMLFGA+DS S D+ MQIT
Sbjct  246  GATNIWLDHLSMYNCYDGLIDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQKMQIT  305

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAF HFGK LVQRMPRCRWG+IHVVNNDYTHW MYAIGGS +PTIISQGNR++APP +  
Sbjct  306  VAFTHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFVAPP-NAA  364

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA    W  W+WRS+GD+ +NGAFF +SGDP    +    +  I+A  G+ V
Sbjct  365  AKEVTKRDYAPPEVWKNWSWRSEGDLMVNGAFFTQSGDPRASRRFLGNF-MISAKPGQMV  423

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTR++G+L C   R C
Sbjct  424  SLLTRYSGSLDCVRRRPC  441



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 154/198 (78%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+S  NC DGL+DAI+GST ITISN HFT+HN+VMLFG++DS S D++MQIT
Sbjct  286  GASNVWIDHVSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQIT  345

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ L+QRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAP ++  
Sbjct  346  LAFNHFGQGLIQRMPRCRWGFFHVVNNDYTHWIMYAIGGSQHPTIISQGNRFIAPSNNA-  404

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR    E EW  W WRS+ D+ MNGAFFVESG P  I   P+  D I A  G  V
Sbjct  405  SKEVTKRTSGAENEWKSWNWRSENDLMMNGAFFVESGSP--IRNLPKA-DMIKAKPGTFV  461

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG L C  G+ C
Sbjct  462  TRLTRFAGPLKCIKGKPC  479



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+SM NC DGLIDA++ ST ITISN HFT HNE MLFGA+DS S D +MQIT
Sbjct  241  GSTNIWIDHISMSNCNDGLIDAVQASTAITISNGHFTHHNEAMLFGASDSYSDDSIMQIT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ + QRMPR RWG++HVVNNDYTHW MYAIGGS++PTI+SQGNR+IA P + +
Sbjct  301  LAFNHFGQGIEQRMPRARWGFVHVVNNDYTHWLMYAIGGSQHPTILSQGNRFIA-PENPY  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W W+SQGD+ MNGAFFV+SGDPN  +      D I    GE  
Sbjct  360  AKEVTKRDYAPESVWKDWVWKSQGDLMMNGAFFVQSGDPN--HNFGSNADLIGPKPGEFA  417

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAGAL+C A R C
Sbjct  418  NRLTRFAGALNCIAKRPC  435



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
             SS +WIDH SM NC DGLIDAI GST ITISN+HFT+HNEV L GA+DS S DK+MQ+T
Sbjct  244  ASSFVWIDHNSMSNCMDGLIDAIMGSTAITISNNHFTNHNEVSLMGASDSFSDDKIMQVT  303

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
             AFNHFG+ L+QRMPRCRWG+ HVVNNDYTHW MYA+GGS++PTIISQGNRYIAP  + +
Sbjct  304  FAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWGMYAVGGSQHPTIISQGNRYIAPTAN-Y  362

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA+E  W QWTWRS+GDV  NGAFF ESG P+  +K+ +  D ITA  G  V
Sbjct  363  AKEVTKRDYASEDVWKQWTWRSEGDVMKNGAFFRESGPPS-TDKYTR-QDKITAKPGTFV  420

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAGAL CK    C
Sbjct  421  GRLTRFAGALVCKRKSPC  438



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +WIDH+SM NC DGLIDAI GST ITISN HFT HNEVMLFGA+DS + D++MQ+T
Sbjct  237  GSSHVWIDHVSMSNCEDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVT  296

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTI+SQGNR+IAPP+   
Sbjct  297  LAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPN-  355

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             K++TKR YA E EW  W+WRS+GD  MNGA F+ SGD     K     YD I+   G  
Sbjct  356  AKQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIPSGDQTKGKKKGLSRYDMISFKPGTY  415

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  L RF+G L C  G+ C
Sbjct  416  VRRLARFSGTLECTPGKPC  434



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+S+ NC DGLIDAI+GST ITISN H T+HN+VMLFG++DS S D++MQIT
Sbjct  247  GATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQIT  306

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAP +   
Sbjct  307  LAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQA-  365

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+T R  A EGEW  W WRS+ D+ MNGAFFV+SG P  I   P+  D I A  G  V
Sbjct  366  TKEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP--IRNLPK-ADMIQAKPGSFV  422

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG L C   + C
Sbjct  423  TRLTRFAGPLKCVKNKPC  440



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+S+ NC DGLIDAI+GST ITISN H T+HN+VMLFG++DS S D++MQIT
Sbjct  245  GATNVWIDHVSLSNCADGLIDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQIT  304

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTIISQGNR+IAP +   
Sbjct  305  LAFNHFGKGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQA-  363

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+T R  A EGEW  W WRS+ D+ MNGAFFV+SG P  I   P+  D I A  G  V
Sbjct  364  TKEVTHRNNAQEGEWRSWNWRSENDLMMNGAFFVQSGSP--IRNLPK-ADMIQAKPGSFV  420

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG L C   + C
Sbjct  421  TRLTRFAGPLKCIKNKPC  438



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  279  GATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVT  338

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  339  VAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQH  398

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS+ DVFMN A+F +SG+P+F   H +    I    G  V
Sbjct  399  YREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSR-QQMIKPKNGMAV  457

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  458  SKLTKYAGALDCRVGKAC  475



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA ++   DK MQ+T
Sbjct  279  GATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQNNNMDDKKMQVT  338

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  339  VAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQH  398

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS+ DVFMN A+F +SG+P+F   H +    I    G  V
Sbjct  399  YREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNPHFKCSHSR-QQMIKPKNGMAV  457

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  458  SKLTKYAGALDCRVGKAC  475



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA D    DK MQ+T
Sbjct  277  GATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQVT  336

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  337  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQH  396

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS+ D F+NGA+F +SG+P+F   H +    I    G  V
Sbjct  397  YREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNPHFKCSHSR-QQMIKPKHGVAV  455

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  456  SKLTKYAGALDCRVGKAC  473



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  277  GSSMIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVT  336

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  337  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPH  396

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS  D+FMNGA+F +SG+P+F   H +    I    G  V
Sbjct  397  YREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHFKCHHTR-KQMIKPKHGIAV  455

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  456  SMLTKYAGALDCRVGKRC  473



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  285  GSSMIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVT  344

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  345  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFIAPPHKPH  404

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS  D+FMNGA+F +SG+P+F   H +    I    G  V
Sbjct  405  YREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHFKCHHTR-KQMIKPKHGIAV  463

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  464  SMLTKYAGALDCRVGKRC  481



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 154/211 (73%), Gaps = 16/211 (8%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHN-------------EVMLFGA  700
            GS++IWIDH+SM+ C+DGLIDAIEGST ITISN H+T HN             +VMLFGA
Sbjct  244  GSTNIWIDHVSMKRCQDGLIDAIEGSTAITISNGHYTHHNDTLMFNLHPGTYVQVMLFGA  303

Query  699  ADSTSIDKMMQITVAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIIS  520
            +D    DK+MQ+TVAFNHFGK L+QRMPRCRWG+ HVVNNDYTHW MYAIGGS  PTIIS
Sbjct  304  SDLYPRDKIMQVTVAFNHFGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIIS  363

Query  519  QGNRYIAPPHDTFKKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ  340
            QGNR+IAPP +   KE+TKR YAT   W  WTWRSQGD+ +NGAFFV+SG P  + K   
Sbjct  364  QGNRFIAPP-NLAAKEVTKRDYATPDVWRSWTWRSQGDLLINGAFFVQSGQP--LKKKYG  420

Query  339  LYDGITAFKGEEVTWLTRFAGALHCKAGRKC  247
              D I A  G  V  LTRF+G L+CK  ++C
Sbjct  421  RKDMIKAKPGTFVRRLTRFSGTLNCKPKKRC  451



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SMRNCRDGL+DAI GST ITISNSHFTDHNEVMLFGA+D    D+ MQIT
Sbjct  254  GSSNIWIDHVSMRNCRDGLVDAIMGSTAITISNSHFTDHNEVMLFGASDGYGGDEKMQIT  313

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL+QRMPRCR+G+IHV+NNDYTHW MYAIGGS +PTIIS+GNR+IA P++  
Sbjct  314  VAFNHFGKRLIQRMPRCRFGFIHVLNNDYTHWEMYAIGGSMHPTIISEGNRFIA-PNNGH  372

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR Y  E  W  W WRS  DV++NGAFF + G P   ++     D I +  G  V
Sbjct  373  AKEITKREYVDESVWKSWQWRSINDVYLNGAFFRQGG-PELKDRPFSRKDMIKSRPGTYV  431

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR++G+L C  G+ C
Sbjct  432  GRLTRYSGSLRCIVGKPC  449



>ref|XP_004964534.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=438

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS++WIDH+SM  C DGLID + GSTGIT+SNSHFT H+ VMLFGA++    D+MMQ+TV
Sbjct  245  SSNVWIDHVSMYRCSDGLIDVVNGSTGITVSNSHFTKHDHVMLFGASNDNPQDRMMQVTV  304

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFGK LVQRMPRCR+G+ HVVNNDYTHW MYAIGG+KNPTIISQGNR+IA P D   
Sbjct  305  AFNHFGKGLVQRMPRCRYGFFHVVNNDYTHWQMYAIGGNKNPTIISQGNRFIA-PDDPNA  363

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    E+  W W+SQGDV MNGAFF ESG  N   K+ QL D I A  G  V 
Sbjct  364  KEVTKREYTPYSEYKDWVWKSQGDVMMNGAFFNESGGQNE-RKYDQL-DFIPARHGSYVG  421

Query  297  WLTRFAGALHCKAGRKC  247
             LT+FAG L+C+AG+ C
Sbjct  422  ELTKFAGTLNCRAGKPC  438



>ref|XP_009134622.1| PREDICTED: probable pectate lyase 7 [Brassica rapa]
Length=471

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GS GIT+SNSHFT HN+VML GA +    DK MQ+T
Sbjct  275  GATNIWLDHISMSKCQDGLIDAIMGSPGITLSNSHFTHHNDVMLLGAQNDNHADKKMQVT  334

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS++PTI+S GNR+IAPPH   
Sbjct  335  VAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHLQH  394

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS  D+FMN A+F +SG+P F+  H +    I    G  V
Sbjct  395  YREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGSAV  453

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  454  STLTKYAGALDCRVGKPC  471



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 152/204 (75%), Gaps = 7/204 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+SMRNC DGLIDAI GST ITISN HFTDHNEVMLFGA+D  S DK+MQIT
Sbjct  252  GASNVWIDHVSMRNCTDGLIDAIMGSTAITISNGHFTDHNEVMLFGASDDYSDDKIMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPR R+G++HVVNNDYTHW MYA+GGS+NPTIIS+GNR+I P +   
Sbjct  312  LAFNHFGKRLVQRMPRARFGFVHVVNNDYTHWEMYAMGGSQNPTIISEGNRFIGPDNVMV  371

Query  480  K------KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITA  319
                   KE+TKR Y  E  W  W WRS  D F+NGA+F++SG P   N+     D ITA
Sbjct  372  GGNQLNLKEVTKREYTDESVWKNWQWRSINDEFLNGAYFIQSG-PELKNRPFSKKDMITA  430

Query  318  FKGEEVTWLTRFAGALHCKAGRKC  247
              G  V  LTR++G L C+ G+ C
Sbjct  431  KPGSYVGRLTRYSGNLQCRVGKPC  454



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 149/198 (75%), Gaps = 5/198 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSDIWIDH S+RNC DGLIDAIE ST ITISN HFT HN+V+LFGA+DS   D MMQ T
Sbjct  250  GSSDIWIDHCSLRNCADGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQAT  309

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCRWG+ HVVNNDYT W MYAIGGS++PTIISQGNR++A P   F
Sbjct  310  VAFNHFGKGLVQRMPRCRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVA-PRMLF  368

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YATE  W QWTWRS+GD+  NGAFF ESG+PN   +     D I A  G  V
Sbjct  369  SKEVTKRDYATEDVWKQWTWRSEGDLMQNGAFFRESGNPN--ARKFDRKDFIKAKPGTWV  426

Query  300  TWLTRFAG--ALHCKAGR  253
              LTRFAG   LH +  R
Sbjct  427  RRLTRFAGPLGLHSRPAR  444



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 152/202 (75%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAIEGST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  252  GATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  312  VAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             KE+TKR Y +  +W  W W+S+GD F+NGA+FV+SG PN  +  P+        I    
Sbjct  371  AKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKP  430

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AGAL C+AG+ C
Sbjct  431  GTMVRELTMDAGALGCEAGKAC  452



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  273  GATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQVT  332

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS++PTI+S GNR+IAPPH   
Sbjct  333  VAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHLQH  392

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR  A E EW  W WRS+ D+FMN A+F +SG+P F+  H +    I    G  V
Sbjct  393  YREVTKRDSAPESEWKNWNWRSEKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGVAV  451

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  452  SKLTKYAGALDCRVGKPC  469



>ref|XP_009125036.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 7 [Brassica 
rapa]
Length=470

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  274  GATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQNDNHADKKMQVT  333

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS++PTI+S GNR+IAPPH   
Sbjct  334  VAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSHGNRFIAPPHIQH  393

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR  A E EW  W WRS+ D+FMN A+F +SG+P F+  H +    I    G  V
Sbjct  394  YREVTKRDSAPESEWKNWNWRSEKDIFMNNAYFRQSGNPKFMCSHSR-QQMIKPKHGVAV  452

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  453  SKLTKYAGALDCRVGKPC  470



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA D    DK MQ+T
Sbjct  277  GATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGAQDHNQDDKKMQVT  336

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IAPPH   
Sbjct  337  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIAPPHKQH  396

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA E EW  W WRS  D F+NGA+F +SG+P+F   H +    I    G  V
Sbjct  397  YREVTKRDYAPEAEWKNWNWRSDKDYFLNGAYFRQSGNPHFKCSHSR-QQMIKPKHGVAV  455

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  456  SKLTKYAGALDCRVGKAC  473



>emb|CDY63769.1| BnaCnng42620D [Brassica napus]
Length=479

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IW+DH+SM  C+DGLIDAI GST ITISNSHFT HN+VML GA +    DK MQ+T
Sbjct  283  GSSMIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLGAQNDNQGDKKMQVT  342

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR++APPH   
Sbjct  343  VAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTILSHGNRFVAPPHKPH  402

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             +E+TKR YA+E EW  W WRS  D+FMNGA+F +SG+P+F   H +    I    G  V
Sbjct  403  YREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHFKCHHTR-KQMIKPKHGIAV  461

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G++C
Sbjct  462  SMLTKYAGALDCRVGKRC  479



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 8/203 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +WIDH SM  C DGL+DAI+GST ITISN+HFT HNE ML GA+D  S D +MQ+T
Sbjct  244  GSSHVWIDHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVT  303

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPP----  493
            VAFNHFG+ L+QRMPRCRWG+ HVVNNDYTHWNMYA+GGS +PTI+SQGNRY+A P    
Sbjct  304  VAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDP  363

Query  492  -HDTFKKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAF  316
             HD   KE+TKR +AT+ EWS+WTWRS+GD+ +NGAFFV+SG P F  K    YD I A 
Sbjct  364  KHDA--KEVTKRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAK  420

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G+ V  LTR++GAL C     C
Sbjct  421  PGKFVPRLTRYSGALTCWRTSPC  443



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +WIDH+SM NC+DGLIDAI GST ITISN HFT HNEVMLFGA+DS + D++MQ+T
Sbjct  245  GSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVT  304

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTI+SQGNR+IAPP+   
Sbjct  305  LAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPN-  363

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             K+ITKR YA E EW  W+WRS+GD  MNGA F+ SGD     K     YD I+   G  
Sbjct  364  AKQITKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTY  423

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  L R +G + C  G+ C
Sbjct  424  VRRLVRLSGTIECTPGKPC  442



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 8/203 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +WIDH SM  C DGL+DAI+GST ITISN+HFT HNE ML GA+D  S D +MQ+T
Sbjct  244  GSSHVWIDHNSMSKCEDGLVDAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVT  303

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPP----  493
            VAFNHFG+ L+QRMPRCRWG+ HVVNNDYTHWNMYA+GGS +PTI+SQGNRY+A P    
Sbjct  304  VAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDP  363

Query  492  -HDTFKKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAF  316
             HD   KE+TKR +AT+ EWS+WTWRS+GD+ +NGAFFV+SG P F  K    YD I A 
Sbjct  364  KHDA--KEVTKRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP-FKKKPFSRYDMIKAK  420

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G+ V  LTR++GAL C     C
Sbjct  421  PGKFVPRLTRYSGALTCWRTSPC  443



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS +WIDH+SM NC+DGLIDAI GST ITISN HFT HNEVMLFGA+DS + D++MQ+T
Sbjct  238  GSSHVWIDHVSMSNCQDGLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVT  297

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS++PTI+SQGNR+IAPP+   
Sbjct  298  LAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPN-  356

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             K++TKR YA E EW  W+WRS+GD  MNGA F+ SGD     K     YD I+   G  
Sbjct  357  AKQVTKREYAMEDEWKHWSWRSEGDELMNGAVFIASGDQTKGKKKGLSRYDMISFKPGTY  416

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  L R +G + C  G+ C
Sbjct  417  VRRLVRLSGTIECTPGKPC  435



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 151/204 (74%), Gaps = 7/204 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+SMRNC DGLIDAI GST ITISNSHFTDHNEVMLFGA++  S DK+MQIT
Sbjct  253  GASNVWIDHVSMRNCTDGLIDAIMGSTAITISNSHFTDHNEVMLFGASNDYSEDKIMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGKRLVQRMPR R+G++H VNNDYTHW MYAIGGS+NPTIIS+GNR+I P +   
Sbjct  313  LAFNHFGKRLVQRMPRARFGFVHCVNNDYTHWEMYAIGGSQNPTIISEGNRFIGPYNKML  372

Query  480  ------KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITA  319
                   KEITKR Y  E EW  W WRS  D ++NGAFFV+SG P   ++     D I A
Sbjct  373  GNDLINSKEITKREYTEESEWKTWQWRSINDEYINGAFFVQSG-PELKDRPFSQKDMIKA  431

Query  318  FKGEEVTWLTRFAGALHCKAGRKC  247
              G  V  LTR++G L C+ G  C
Sbjct  432  KPGSFVGRLTRYSGNLRCRVGEPC  455



>gb|AGT16685.1| pectate lyase precursor [Saccharum hybrid cultivar R570]
Length=326

 Score =   258 bits (660),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSDIWIDH+SMR+C DGL+D ++GST +TISN HFT H+ VMLFGA+DS   DK+MQ+T
Sbjct  132  GSSDIWIDHVSMRSCADGLVDVVDGSTAVTISNGHFTKHDHVMLFGASDSAVKDKLMQVT  191

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCR+G+ HVVNNDYTHW MYAIGGS+NPTIISQGNR+ A     F
Sbjct  192  VAFNHFGKGLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGSQNPTIISQGNRFRAVDDRNF  251

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y    ++  W W+SQ D+F+NGAFF +SG  N   +     D I A  G+  
Sbjct  252  -KEVTKREYTPYSQYKDWVWKSQDDLFLNGAFFNQSGGQN--ERRFDRLDLIQAKGGQYA  308

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AGAL+C+ G+KC
Sbjct  309  ESLTRYAGALNCRVGKKC  326



>emb|CDP02199.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   259 bits (663),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 149/198 (75%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+ D+W+DHLSM  C DGLIDA++ ST ITISN HFTDH++V+LFGA+D T +DK MQ+T
Sbjct  158  GARDVWLDHLSMSKCSDGLIDAVQASTAITISNCHFTDHDKVLLFGASDVTEVDKNMQVT  217

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPRCR G+ H+VNNDYTHW MYAIGGS + TIISQGNR+IAPP   F
Sbjct  218  VAFNHFGKRLVQRMPRCRSGFFHLVNNDYTHWEMYAIGGSHDATIISQGNRFIAPPLSQF  277

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+T R  A    WS+WTW S GDVF+NGA FV SG+P+   +   L + I A  G EV
Sbjct  278  FKEVTHR-DAPVALWSKWTWVSDGDVFLNGARFVPSGNPDGARQFAAL-ELIKAAPGTEV  335

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRF+G L C  GR C
Sbjct  336  FTLTRFSGFLSCVIGRAC  353



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 9/202 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IW+DHLSM  C+DGLIDAI+GST ITISN HFT HN+V+L GA+D+   DK+MQ+T
Sbjct  258  GSTNIWLDHLSMSECQDGLIDAIQGSTAITISNCHFTHHNDVILLGASDTYERDKLMQVT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCRWG+ HVVNNDYTHW MYAIGGS +PTIISQGNR+IA P D  
Sbjct  318  VAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSMHPTIISQGNRFIA-PDDPK  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQL-YDGITAFKGEE  304
             KEIT R YA + EWS+W WRS+GD+ +NGA F +SG     +K PQ  +  +   K + 
Sbjct  377  AKEITNRNYAPQSEWSKWVWRSEGDLLLNGARFTKSGP----DKSPQFDFTKMQMIKAKP  432

Query  303  VTW---LTRFAGALHCKAGRKC  247
             T+   LTRFAGAL C+ G KC
Sbjct  433  ATFVRRLTRFAGALDCEKGNKC  454



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IW+DHLSM NC DGL D ++GST ITISN HFT HN+VMLFGA D    D++MQIT
Sbjct  250  GSSHIWLDHLSMWNCYDGLTDVVQGSTAITISNCHFTRHNDVMLFGANDLYERDQIMQIT  309

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTIISQGNRY+APP D  
Sbjct  310  VAFNHFGKGLIQRMPRCRFGFFHVVNNDYTHWQMYAIGGSSHPTIISQGNRYVAPP-DPK  368

Query  480  KKEITKRLYAT-EGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEE  304
             KEIT R Y+T E  W  W WRS+GD+  NGA+F ESG+P     H   +D I A  G  
Sbjct  369  LKEITSRAYSTPEAVWKTWQWRSEGDLMENGAYFRESGEPRKGRGHFSRFDVINAKPGSF  428

Query  303  VTWLTRFAGALHCKAGRKC  247
            V  LTRFAG L C+ G+ C
Sbjct  429  VRRLTRFAGTLGCRVGKAC  447



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 152/200 (76%), Gaps = 7/200 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++W+DHLS+ NC+DGLID I  STG+TISN H T+HN+VMLFG++DS S D++MQIT
Sbjct  252  GSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSKNPTIISQGNRYIAPP +  
Sbjct  312  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPP-NLA  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDP--NFINKHPQLYDGITAFKGE  307
             K+ITK+L A E EW  W W S+ D+FM GA+F  SG      INK     D I    G 
Sbjct  371  AKQITKQLGAEESEWKNWVWHSEEDLFMEGAYFTTSGGAIRTSINKK----DLIKPKPGS  426

Query  306  EVTWLTRFAGALHCKAGRKC  247
             VT LTRFAG++ C+ G+ C
Sbjct  427  YVTRLTRFAGSIPCRPGKPC  446



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 154/200 (77%), Gaps = 6/200 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DHLS+  C DGLID ++GSTGITISN H T HN+VMLFGA+D+ + DK+MQ+T
Sbjct  245  GSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIMQVT  304

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ L+QRMPRCRWG++HV+NNDYTHW MYAIGGS  PTI+SQGNR+IA P++  
Sbjct  305  VAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIA-PNNNA  363

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGIT--AFKGE  307
             KEIT R YA   EWS+W W+S+ D+FMNGA F++SG P  + K P    G+      G 
Sbjct  364  AKEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGSP--LGKLP-FNKGLMMKPRPGA  420

Query  306  EVTWLTRFAGALHCKAGRKC  247
            E   LTRFAGAL+CK G+ C
Sbjct  421  EANRLTRFAGALNCKVGKPC  440



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   259 bits (663),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 154/199 (77%), Gaps = 6/199 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DGLID I+ ST ITISN HFT HNEVMLFG +D+ S D  MQIT
Sbjct  242  GATNVWIDHVSMSHCYDGLIDVIQASTAITISNCHFTRHNEVMLFGGSDTYSDDAHMQIT  301

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG++HVVNNDYTHW MYAIGGS++PTIISQGNR+IAP  D  
Sbjct  302  VAFNHFGQGLVQRMPRCRWGFVHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPL-DPN  360

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDP-NFINKHPQLYDGITAFKGEE  304
             KE+TKR YA E  W  W+WRS+ D+ +NGAFFV+SG P   +NK+    + I A  G  
Sbjct  361  CKEVTKRDYAAEDVWKSWSWRSEDDLMLNGAFFVQSGSPIRNVNKN----NVIKAKPGSF  416

Query  303  VTWLTRFAGALHCKAGRKC  247
            VT LTRFAGAL+C  G+ C
Sbjct  417  VTRLTRFAGALNCVKGKPC  435



>gb|KHG08946.1| Pectate lyase [Gossypium arboreum]
Length=405

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 146/198 (74%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DH+SM  C+DGLID I+GST ITISN HFT H+ V+L G +D+ S D+ MQ+T
Sbjct  209  GSSNIWLDHISMSECQDGLIDVIQGSTAITISNCHFTHHDHVILLGGSDTYSNDQYMQVT  268

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK L+QRMPRCRWG+ HVVNNDYTHW MYAIGGS +PTIIS+GNRYIA P D  
Sbjct  269  IAFNHFGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSTHPTIISEGNRYIA-PDDPN  327

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEIT R YA E EW  W WRS+GD++MNGAFF  SG P+  N      D I A     V
Sbjct  328  TKEITNRNYAPESEWKNWVWRSEGDLYMNGAFFRTSGPPSPPNLSFSEKDVIKAKPATFV  387

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRFAG L+CK   KC
Sbjct  388  RRLTRFAGTLNCKQYVKC  405



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score =   260 bits (664),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 148/202 (73%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM  C DG+IDAI+GST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  255  GATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  315  VAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPSEQ-  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYD----GITAFK  313
             K+ITKR Y    EW  W W+S+GD F+NGA+FV+SG  N  +  PQ        I    
Sbjct  374  AKQITKREYTPLAEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPQNPIPNKFAIRPKP  433

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AGAL C+ G+ C
Sbjct  434  GTMVRKLTMEAGALGCRQGQAC  455



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   259 bits (663),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 154/200 (77%), Gaps = 6/200 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IW+DHLS+  C DGLID ++GSTGITISN H T HN+VMLFGA+D+ + DK+MQ+T
Sbjct  245  GSSNIWLDHLSLSECEDGLIDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIMQVT  304

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ L+QRMPRCRWG++HV+NNDYTHW MYAIGGS  PTI+SQGNR+IA P++  
Sbjct  305  VAFNHFGQGLIQRMPRCRWGFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIA-PNNNA  363

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGIT--AFKGE  307
             KEIT R YA   EWS+W W+S+ D+FMNGA F++SG P  + K P    G+      G 
Sbjct  364  AKEITHRDYAPPEEWSKWQWKSENDLFMNGATFLQSGAP--LGKLP-FNKGLMMKPRPGA  420

Query  306  EVTWLTRFAGALHCKAGRKC  247
            E   LTRFAGAL+CK G+ C
Sbjct  421  EANRLTRFAGALNCKVGKPC  440



>ref|NP_001150425.1| LOC100284055 precursor [Zea mays]
 gb|ACG39044.1| pectate lyase precursor [Zea mays]
 gb|ACR35178.1| unknown [Zea mays]
 gb|AFW75496.1| pectate lyase [Zea mays]
Length=453

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSDIWIDHLSM +C DGL+DA++GST IT+SN HFT H+ VMLFGA+D+ S D+ MQ+T
Sbjct  259  GSSDIWIDHLSMSSCADGLVDAVDGSTAITVSNGHFTRHDHVMLFGASDAASKDREMQVT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCR G+ HVVNNDYTHW MYAIGGS+NPTIISQGNR+ A     F
Sbjct  319  VAFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSRNPTIISQGNRFRAVDDSRF  378

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y    E+  W W+SQ D+F+NGAFF +SG  N   K+ +L D I A  G+  
Sbjct  379  -KEVTKREYTQYSEYKNWVWKSQDDLFLNGAFFNQSGGQNE-RKYDRL-DLIQAKGGQYA  435

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AGAL+C+ GRKC
Sbjct  436  ESLTRYAGALNCRVGRKC  453



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 151/202 (75%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM  C DG+IDAI+GST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  259  GATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  319  VAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ--LYD--GITAFK  313
             K+ITKR Y    EW  W W+S+GD F+NGA+FV+SG  N  +  P+  L +   I    
Sbjct  378  AKQITKREYTPYTEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKNPLPNKFAIRPKP  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AGAL CK G+ C
Sbjct  438  GTMVRKLTMDAGALGCKQGKAC  459



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IW+DH+SM  C+DGLIDAI+GST ITISN HFT H+ V+L GA+D+ S D+ MQ+T
Sbjct  189  GSSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQYMQVT  248

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK L+QRMPRCRWGY HVVNNDYTHW +YAIGGS +PTIISQGNR+IAP  D  
Sbjct  249  LAFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPD-DPL  307

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEIT R YA E EW  W WRS+GD FMNGAFFV SG P+  +   +  D I A     V
Sbjct  308  TKEITHRNYAPESEWRNWIWRSEGDRFMNGAFFVTSGPPSPPHLKLKKKDIIKAKPAIFV  367

Query  300  TWLTRFAGALHCKAGRKC  247
              LT+F+G L CK G KC
Sbjct  368  GRLTKFSGTLKCKEGVKC  385



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 150/202 (74%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM  C DG+IDAI+GST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  259  GATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  319  VAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEE-  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ--LYDGIT--AFK  313
             K+ITKR Y   GEW  W W+S+GD F+NGA+FV+SG  N  +  P+  L +  T     
Sbjct  378  AKQITKREYTPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNKFTIRPKP  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AG L CK G  C
Sbjct  438  GTMVRKLTMDAGVLGCKLGEAC  459



>gb|AAB69759.1| putative pectate lyase [Arabidopsis thaliana]
Length=459

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 150/202 (74%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM  C DG+IDAI+GST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  259  GATNIWIDHVSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  319  VAFNHFGKRLEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEE-  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ--LYDGIT--AFK  313
             K+ITKR Y   GEW  W W+S+GD F+NGA+FV+SG  N  +  P+  L +  T     
Sbjct  378  AKQITKREYTPYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNKFTIRPKP  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AG L CK G  C
Sbjct  438  GTMVRKLTMDAGVLGCKLGEAC  459



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 150/203 (74%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAI+GST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  260  GATNVWIDHVSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVMLFGARDEDVIDKKMQIT  319

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  320  VAFNHFGKRLEQRMPRCRFGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  378

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESG-----DPNFINKHPQLYDGITAF  316
             K+ITKR Y    EW  W W+S+GD F+NGA+FV+SG      P  +N  P  +  I   
Sbjct  379  AKQITKREYTPFIEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPVNPLPNKFR-IRPK  437

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V  LT  AGAL CK G+ C
Sbjct  438  PGTMVRKLTMDAGALGCKHGKAC  460



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 148/198 (75%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++W+DHLS+  C+DGLID I  +TG+TISN H T+HN+VMLFG++DS   D++MQ+T
Sbjct  250  GSTNVWLDHLSLATCQDGLIDVIAEATGVTISNCHLTNHNDVMLFGSSDSNPKDQIMQVT  309

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSKNPTIISQGNRYIAPP +  
Sbjct  310  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPP-NLA  368

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K ITKRL A+E EW  W W SQ D+ +N A F +SG  N   +     D IT   G  V
Sbjct  369  AKLITKRLGASEAEWKNWVWHSQDDLLLNDAVFADSGGAN--ERKFDKDDLITPKPGSYV  426

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG L CK G+ C
Sbjct  427  TRLTRFAGCLPCKPGKPC  444



>gb|EEE56553.1| hypothetical protein OsJ_05879 [Oryza sativa Japonica Group]
Length=410

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 147/197 (75%), Gaps = 4/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            ++D+W+DH+SM  C DGLID ++GSTG+TISNSHFT+HN+VMLFGA+DS   DK+MQITV
Sbjct  218  ATDVWVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITV  277

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGG  +PTI+SQGNRYIAPP+    
Sbjct  278  AFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPN--IA  335

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
             ++  R YA E EW  W WRS GD+FMNGA+F  S     IN+  +  D +    G  V 
Sbjct  336  AKLITRHYAPEWEWKNWAWRSDGDLFMNGAYFQASN--GAINRKVKGSDMVKPKPGSYVR  393

Query  297  WLTRFAGALHCKAGRKC  247
             LTRFAGAL C+ G  C
Sbjct  394  RLTRFAGALSCRPGEPC  410



>gb|EAY85003.1| hypothetical protein OsI_06363 [Oryza sativa Indica Group]
Length=439

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 147/197 (75%), Gaps = 4/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            ++D+W+DH+SM  C DGLID ++GSTG+TISNSHFT+HN+VMLFGA+DS   DK+MQITV
Sbjct  247  ATDVWVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITV  306

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGG  +PTI+SQGNRYIAPP+    
Sbjct  307  AFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPN--IA  364

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
             ++  R YA E EW  W WRS GD+FMNGA+F  S     IN+  +  D +    G  V 
Sbjct  365  AKLITRHYAPEWEWKNWAWRSDGDLFMNGAYFQASN--GAINRKVKGSDMVKPKPGSYVR  422

Query  297  WLTRFAGALHCKAGRKC  247
             LTRFAGAL C+ G  C
Sbjct  423  RLTRFAGALSCRPGEPC  439



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+SM NC DGLIDA++ ST ITISN HFT HN+VMLFGA+DS   D ++QIT
Sbjct  241  GSTNIWIDHVSMSNCDDGLIDAVQASTAITISNCHFTHHNDVMLFGASDSYKQDAILQIT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ L+QRMPR RWG++H VNNDYTHW MYAIGGS++PTI+SQGNR+IAPP+   
Sbjct  301  LAFNHFGQGLIQRMPRVRWGFVHAVNNDYTHWIMYAIGGSQHPTILSQGNRFIAPPNPN-  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  W WRSQGD+ MNGAFFVESG+ N  +K     D I    G + 
Sbjct  360  AKEVTKRDYSPESVWKNWVWRSQGDLMMNGAFFVESGNRN--HKFMTGPDMIHPRAGSDA  417

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRF+G+L+C  G+ C
Sbjct  418  GRLTRFSGSLNCIEGKPC  435



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 150/198 (76%), Gaps = 5/198 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+ +WIDH+S  NC DGLID +  ST +TISN H T HN+V+LFGA+DS S DK+MQ+T
Sbjct  243  GSTYVWIDHVSFTNCDDGLIDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKIMQVT  302

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK L+QRMPRCRWG+ H+VNNDYTHW MYAIGGS+ PTIISQGNR+IA P+D  
Sbjct  303  LAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSQQPTIISQGNRFIA-PNDRN  361

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E  W  W WRS+GD+ MNGAFFV+SG    + K+P+    I A  G+ V
Sbjct  362  AKEVTKRDYAPESVWKNWNWRSEGDLLMNGAFFVQSGKN--VAKNPKAE--IIAKPGKAV  417

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTRFAG L C+  + C
Sbjct  418  SSLTRFAGPLKCEVNKSC  435



>ref|NP_001046281.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAD25039.1| putative pectate lyase precursor [Oryza sativa Japonica Group]
 dbj|BAF08195.1| Os02g0214400 [Oryza sativa Japonica Group]
 dbj|BAG94880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 147/197 (75%), Gaps = 4/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            ++D+W+DH+SM  C DGLID ++GSTG+TISNSHFT+HN+VMLFGA+DS   DK+MQITV
Sbjct  254  ATDVWVDHVSMSMCEDGLIDVVQGSTGVTISNSHFTNHNDVMLFGASDSYPQDKVMQITV  313

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGG  +PTI+SQGNRYIAPP+    
Sbjct  314  AFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGMSPTILSQGNRYIAPPN--IA  371

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
             ++  R YA E EW  W WRS GD+FMNGA+F  S     IN+  +  D +    G  V 
Sbjct  372  AKLITRHYAPEWEWKNWAWRSDGDLFMNGAYFQASN--GAINRKVKGSDMVKPKPGSYVR  429

Query  297  WLTRFAGALHCKAGRKC  247
             LTRFAGAL C+ G  C
Sbjct  430  RLTRFAGALSCRPGEPC  446



>gb|KFK37588.1| hypothetical protein AALP_AA3G002600 [Arabis alpina]
Length=472

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 147/198 (74%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IW+DH+SM  C+DGLIDAI GSTGITISNSHFT HN+VML GA DS   DK MQ+T
Sbjct  276  GATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAHDSNKDDKKMQVT  335

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPR RWG++HVVNNDYTHW +YAIGGS+ PTI+S GNR+IA  H   
Sbjct  336  VAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPTILSHGNRFIASLHKPQ  395

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
              E+TKR YA+E EW  W WRS  DVFMN A+F +SG+P F   H +    I    G   
Sbjct  396  YNEVTKRDYASESEWKNWNWRSDRDVFMNRAYFRQSGNPKFKCTHTR-QQMIKPKHGVAA  454

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT++AGAL C+ G+ C
Sbjct  455  SMLTKYAGALDCRVGKPC  472



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAI GST ITISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  258  GATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  318  VAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESG-----DPNFINKHPQLYDGITAF  316
             K+ITKR Y     W  W W+S+GD F+NGA+FV+SG      P  IN  P+ +  I   
Sbjct  377  AKQITKREYTPYVNWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPINPVPKKF-AIRPQ  435

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V  LT  AGAL CK G  C
Sbjct  436  PGTMVRKLTMDAGALGCKPGTPC  458



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 149/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAI GST ITISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  258  GATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  318  VAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESG-----DPNFINKHPQLYDGITAF  316
             K+ITKR Y    +W  W W+S+GD F+NGA+FV+SG      P  +N  P+ +  I   
Sbjct  377  AKQITKREYTPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPKKF-AIRPQ  435

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V  LT  AGAL CK G  C
Sbjct  436  PGTMVRKLTMDAGALGCKPGTPC  458



>gb|EMS65801.1| hypothetical protein TRIUR3_32637 [Triticum urartu]
Length=273

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 145/197 (74%), Gaps = 3/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS +WIDH+SM +C DGLID + GST IT+SNSHFT H+ VMLFGA+++   D+MMQ+TV
Sbjct  80   SSSVWIDHVSMSSCADGLIDVVSGSTAITVSNSHFTKHDHVMLFGASNTEEQDRMMQVTV  139

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFGK LVQRMPRCR+G+  VVNNDYTHW MYAIGG+++PTIISQGNR+IAP  D   
Sbjct  140  AFNHFGKGLVQRMPRCRFGFFQVVNNDYTHWQMYAIGGNRDPTIISQGNRFIAPD-DGNA  198

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR YA   E+  W W+SQGDV +NGAFF ESG  N   +     D I A  G  V 
Sbjct  199  KEVTKREYAPYTEYKDWVWKSQGDVMVNGAFFNESGGQN--ERRYGNMDFIPAKHGRYVG  256

Query  297  WLTRFAGALHCKAGRKC  247
             LTRFAG L C  G+ C
Sbjct  257  QLTRFAGVLDCGIGKPC  273



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 146/198 (74%), Gaps = 1/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IW+DH+SM  C+DGLIDAI+GST ITISN HFT H+ V+L GA+D+ S D+ MQ+T
Sbjct  189  GSSKIWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQFMQVT  248

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK L+QRMPRCRWGY HVVNNDYTHW +YAIGGS +PTIISQGNR+IAP  D  
Sbjct  249  LAFNHFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPD-DPL  307

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEIT R YA+E EW  W WRS+GD FMNGAFFV SG  +      +  D I       V
Sbjct  308  TKEITNRNYASESEWRHWVWRSEGDRFMNGAFFVTSGPHSPPRLKFKKKDIIKPKPAIFV  367

Query  300  TWLTRFAGALHCKAGRKC  247
              LT+F+G L CK G KC
Sbjct  368  GRLTKFSGTLKCKEGVKC  385



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 148/202 (73%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DG+IDAI+GSTGITISN H TDH EVMLFG  D   IDK MQIT
Sbjct  261  GATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKKMQIT  320

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  321  VAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEE-  379

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             K++TKR Y    EW  W W+S+GD F+NGA+FV+SG  N ++  P+        I    
Sbjct  380  AKQVTKREYTPFTEWKSWNWQSEGDYFLNGAYFVQSGRANALSAAPKNPVPSKFAIRPQP  439

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AG L CK  + C
Sbjct  440  GTLVRKLTMDAGVLSCKKRKPC  461



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 149/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAI GST ITISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  258  GATNVWIDHVSMTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  318  VAFNHFGKRLDQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESG-----DPNFINKHPQLYDGITAF  316
             K+ITKR Y    +W  W W+S+GD F+NGA+FV+SG      P  +N  P+ +  I   
Sbjct  377  AKQITKREYTPYVDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPRKF-AIRPQ  435

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V  LT  AGAL CK G  C
Sbjct  436  PGTMVRKLTMDAGALGCKPGTPC  458



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 149/198 (75%), Gaps = 5/198 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAIEGST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  252  GATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  312  VAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             KE+TKR Y +  +W  W W+S+GD F+NGA+FV+SG PN  +  P+        I    
Sbjct  371  AKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKP  430

Query  312  GEEVTWLTRFAGALHCKA  259
            G  V  LT  AGAL C+A
Sbjct  431  GTMVRELTMDAGALGCEA  448



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+S+ NC DGL+D I+GST +TISN H T HN+VMLFGA+D+   DK+MQ+T
Sbjct  256  GSSNIWIDHISLSNCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDKIMQVT  315

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ L+QRMPRCRWG+ HV+NNDYTHW MYAIGGS  PTI+SQGNR+IA PH+  
Sbjct  316  VAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQGNRFIA-PHNNA  374

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFK-GEE  304
             K IT R YA E  WS+W WRS+GD FMNGA F++SG P  I   P     +   + G +
Sbjct  375  AKTITHRDYAPEAVWSKWQWRSEGDHFMNGANFIQSGPP--IKSLPFKKGFLMKPRHGSQ  432

Query  303  VTWLTRFAGALHCKAGRKC  247
               LTRF+GAL+C  GR C
Sbjct  433  ANRLTRFSGALNCVVGRPC  451



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 152/203 (75%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM +C DG+IDAI GST ITISNSHFTDH+EVMLFG  ++  IDK MQIT
Sbjct  253  GATNIWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  313  VAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNED-  371

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  372  SKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKF-AIRPQ  430

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AGAL CKAG+ C
Sbjct  431  PGTKVRRLTKDAGALGCKAGKSC  453



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 149/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SMRNC DG+IDAI GST ITISN HFTDH EVMLFGA +   IDK MQIT
Sbjct  260  GATNVWIDHVSMRNCSDGMIDAIMGSTAITISNCHFTDHEEVMLFGAKNGDVIDKKMQIT  319

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  320  VAFNHFGKRLDQRMPRVRYGMVHVVNNDYTHWQMYAIGGNMNPTIISQGNRFIAPPEED-  378

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
            KK+ITKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  379  KKQITKREYTPYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSSTPKNPIPRKFT-IRPQ  437

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AG L CK G+ C
Sbjct  438  PGTKVRRLTKDAGTLGCKPGKSC  460



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 149/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM  C DG+IDAI+GST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  255  GATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNR+IAPP++  
Sbjct  315  VAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRFIAPPNEQ-  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPN-----FINKHPQLYDGITAF  316
             K+ITKR Y    EW  W W+S+GD F+NGA+FV+SG  N       N  P  +  I   
Sbjct  374  AKQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHNPIPSKF-AIRPK  432

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V  LT  AG L CK G++C
Sbjct  433  PGTMVRKLTMEAGVLGCKHGKEC  455



>gb|EAY99626.1| hypothetical protein OsI_21605 [Oryza sativa Indica Group]
Length=441

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 150/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS+IWIDH+SM NC DGLIDA+ GST ITISN HFT H+ VMLFGA++S + D++MQITV
Sbjct  248  SSNIWIDHVSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITV  307

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFGK LVQR+PRCR+G+ HVVNNDY HW MYAIGG+ NPTIISQGNR+IAP  D   
Sbjct  308  AFNHFGKGLVQRLPRCRFGFFHVVNNDYMHWLMYAIGGNMNPTIISQGNRFIAPD-DVNA  366

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    E+ +W W+SQGDV MNGAFF ESG  N    + QL D I A  G+ V 
Sbjct  367  KEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQNE-RSYDQL-DFIPAKHGKYVG  424

Query  297  WLTRFAGALHCKAGRKC  247
             LT+FAGAL+C  G  C
Sbjct  425  QLTKFAGALNCHVGMPC  441



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 146/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS DIWIDH+SM  C DGLID I+GSTGITISNSHFTDH+  MLFG  D    D+ MQIT
Sbjct  253  GSQDIWIDHVSMTRCADGLIDIIQGSTGITISNSHFTDHDHAMLFGGNDKYPGDEKMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKR+VQRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTIISQGNRYIA     +
Sbjct  313  VAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGNRYIA--DHPY  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TKR    E EW  WTW + GD+F+ GA+F+ SGD ++ +KHP+  D I     + V
Sbjct  371  AKQVTKR-ECPESEWKHWTWVTDGDLFLRGAYFIPSGDQDWPSKHPEKSDNIKPASAKLV  429

Query  300  TWLTRFAGALHCKAGRKC  247
            + +T+FAG L CK    C
Sbjct  430  SQMTKFAGRLGCKLKYAC  447



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 145/198 (73%), Gaps = 5/198 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+ IWIDH+SM NC DGLID +  ST +TISN HF  HN+V+LFGA DS S DK+MQ+T
Sbjct  242  GSTHIWIDHVSMTNCSDGLIDVVSASTAVTISNCHFVKHNDVLLFGATDSFSRDKVMQVT  301

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK LVQRMPRCRWG+ H+VNNDYTHW MYA+GGS+ PTIISQGNR++A P D  
Sbjct  302  LAFNHFGKGLVQRMPRCRWGFFHIVNNDYTHWLMYAVGGSQQPTIISQGNRFVA-PKDRN  360

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YA E EW  W WRS+GD+F NGAFFVESG    + K P+      A   + V
Sbjct  361  AKEVTKRDYAPESEWKNWNWRSEGDLFENGAFFVESGKK--VTKFPKT--DAKAVSAKSV  416

Query  300  TWLTRFAGALHCKAGRKC  247
             +LT+ AG + C   + C
Sbjct  417  AFLTKDAGPIKCIPNKPC  434



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 149/198 (75%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+SM  C DGLIDAI GST ITISNSHFTDH+E MLFGA ++ + DK+MQIT
Sbjct  258  GASNVWIDHVSMSRCADGLIDAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ LVQRMPR R G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAP +   
Sbjct  318  LAFNHFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGV-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++T R    E EW  W WRS+GD+ MNGAFFVESG  +  +KHP   D +    G  V
Sbjct  377  TKQVTHRENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLDXMPFKPGTXV  434

Query  300  TWLTRFAGALHCKAGRKC  247
              LT+F+GAL+C  G+ C
Sbjct  435  XTLTKFSGALNCAVGKPC  452



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DG+IDAI+GSTGITISN H TDH EVMLFGA D   ID  MQIT
Sbjct  264  GATNVWIDHVSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVMLFGATDKDEIDTKMQIT  323

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  324  VAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  382

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+GD F+NGA+FV+SG  N       N  P  +  I   
Sbjct  383  AKQVTKREYTPYPEWKSWNWQSEGDYFLNGAYFVQSGRANAWSVAPKNPVPSKF-AIRPQ  441

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V  LT  +G L CK G+ C
Sbjct  442  PGTLVRKLTMNSGVLGCKKGKPC  464



>ref|XP_002436463.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
 gb|EER87830.1| hypothetical protein SORBIDRAFT_10g003080 [Sorghum bicolor]
Length=465

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 148/198 (75%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSSDIWIDH+SMR+C DGL+D ++GST +TISN HFT H+ VMLFGA+D+   DK MQ+T
Sbjct  271  GSSDIWIDHVSMRSCADGLVDVVDGSTAVTISNGHFTRHDHVMLFGASDAAVKDKAMQVT  330

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCR G+ HVVNNDYTHW MYAIGGS+NPTIISQGNR+ A     F
Sbjct  331  VAFNHFGKGLVQRMPRCRHGFFHVVNNDYTHWLMYAIGGSQNPTIISQGNRFRAVDDGRF  390

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y    E+  W W+SQ D+F+NGAFF +SG  N   +     D I A  G+  
Sbjct  391  -KEVTKREYTPYSEYKDWVWKSQDDLFLNGAFFNQSGGEN--ERRFDRLDLIQAKGGQYA  447

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AGAL+C+ G+KC
Sbjct  448  ELLTRYAGALNCRVGKKC  465



>ref|XP_004951474.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=440

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 8/200 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++D+WIDH+SM NC DGLID ++ STG+TISN HFT+HN+VMLFGA+DS   D++MQIT
Sbjct  247  GATDVWIDHISMSNCEDGLIDVVQSSTGVTISNCHFTNHNDVMLFGASDSYPQDQVMQIT  306

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGS  PTIISQGNRYIAPP +  
Sbjct  307  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSNAPTIISQGNRYIAPP-NIA  365

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGD--PNFINKHPQLYDGITAFKGE  307
             K ITK  YA EG W  W W ++ D+FMNGA F  SG   P  INK     + +    G 
Sbjct  366  AKLITKH-YADEGVWKNWVWHTEDDLFMNGAVFQPSGGAVPRKINKK----EWVKPKPGS  420

Query  306  EVTWLTRFAGALHCKAGRKC  247
             VT LTRF+G L C  GRKC
Sbjct  421  YVTRLTRFSGTLSCIPGRKC  440



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   254 bits (650),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+ DIWIDH+SM  C DGLIDAI+GST ITISN HFTDH+  MLFGA D    D+ MQIT
Sbjct  252  GAQDIWIDHVSMTRCDDGLIDAIQGSTAITISNGHFTDHDHAMLFGANDKYPGDEKMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKR+VQRMPRCR+G+ HVVNNDYTHW MYAIGGS +PTIISQGNRYIA     +
Sbjct  312  VAFNHFGKRMVQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGNRYIA--DHPY  369

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TKR    E EW  WTW + GD+F+NGA+F  SGD ++ +KHP+  DGI       V
Sbjct  370  AKQVTKR-ECPESEWRHWTWVTDGDIFLNGAYFRASGDQDWHHKHPEKSDGIKPGPATLV  428

Query  300  TWLTRFAGALHCKAGRKC  247
              +T+FAG L CK    C
Sbjct  429  AQMTQFAGRLDCKKKYAC  446



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   254 bits (650),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM  C DG+IDAI+GST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  255  GATNIWIDHVSMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ +PTIISQGNR+IAPP++  
Sbjct  315  VAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRFIAPPNEQ-  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPN-----FINKHPQLYDGITAF  316
             K+ITKR Y    EW  W W+S+GD F+NGA+FV+SG  N       N  P  +  I   
Sbjct  374  AKQITKREYTPFVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHNPIPNKF-AIRPK  432

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G  V  LT  AG L CK G+ C
Sbjct  433  PGMMVRKLTMEAGVLGCKHGKAC  455



>gb|AAA16476.1| pectate lyase homolog [Zea mays]
 gb|AFW85884.1| hypothetical protein ZEAMMB73_308319 [Zea mays]
Length=438

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS++WIDH+SM +C DGLID + GST IT+SNSHFTDH+ VMLFGA++ +  D +MQ+TV
Sbjct  245  SSNVWIDHVSMSSCSDGLIDVVNGSTAITVSNSHFTDHDHVMLFGASNDSPQDAVMQVTV  304

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCR+G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+IA P D   
Sbjct  305  AFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIA-PDDPNA  363

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    ++ +W W+SQGDV MNGAFF ESG  N   +    +D I A  G  V 
Sbjct  364  KEVTKREYTPYKDYKEWVWKSQGDVMMNGAFFNESGGQN--ERKYDRFDFIPAKHGRYVG  421

Query  297  WLTRFAGALHCKAGRKC  247
             LTRFAG L C  G+ C
Sbjct  422  QLTRFAGPLKCIVGQPC  438



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDHLS+ +C DGL+D I+GSTGITISN H T HN+VMLFGA+D+ + DK+MQ+T
Sbjct  249  GSSNIWIDHLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDTFTGDKIMQVT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ L+QRMPRCRWG+ HV+NNDYTHW MYAIGGS  PTI+SQGNR+IA P++  
Sbjct  309  VAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSAPTILSQGNRFIA-PNNNA  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFK-GEE  304
             KE+T R YA    W +W WRS+ DVFMNGA FV+SG P  + K P     +   + G +
Sbjct  368  AKEVTHRDYAEPSVWEKWQWRSENDVFMNGANFVQSGPP--LGKLPFNKGFLMKPRHGSQ  425

Query  303  VTWLTRFAGALHCKAGRKC  247
               LTRFAGAL+CKA   C
Sbjct  426  ANRLTRFAGALNCKANSPC  444



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+S+ +C DGL+D I+GST +TISN H T HN+VMLFGA+D+   DK+MQIT
Sbjct  255  GSSNIWIDHISLSDCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDKIMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ L+QRMPRCRWG+ HV+NNDYTHW MYAIGGS  PTI+SQGNR+IA PH+  
Sbjct  315  VAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQGNRFIA-PHNNA  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDP--NFINKHPQLYDGITAFKGE  307
             K +T R YA E  WS+W WRS+GD FMNGA F++SG P  N   K   L   +    G 
Sbjct  374  AKTVTHRDYAPESVWSKWQWRSEGDHFMNGATFIQSGPPIKNLPFKKGFL---MKPRHGS  430

Query  306  EVTWLTRFAGALHCKAGRKC  247
            +   LTRF+GAL+C  GR C
Sbjct  431  QANRLTRFSGALNCVVGRPC  450



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 150/198 (76%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+S+  C DGLIDAIE ST ITISN HF  HN+V+LFGA+DS S D +MQIT
Sbjct  241  GSTNIWIDHVSLSRCDDGLIDAIEASTAITISNCHFAHHNDVLLFGASDSRSEDHIMQIT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPR RWG++H+VNNDYT W MYAIGGS+ PTI+SQGNR++A P + F
Sbjct  301  VAFNHFGKGLIQRMPRVRWGFVHIVNNDYTRWQMYAIGGSQQPTILSQGNRFVA-PDNPF  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR YATE  W  W W+S+GDV  NGAFFV+SGD    +K  +  D +T   G   
Sbjct  360  AKEVTKRDYATESVWKNWVWKSEGDVMNNGAFFVQSGDVAH-HKFAKGPDMVTPKPGGFA  418

Query  300  TWLTRFAGALHCKAGRKC  247
            + L++FAG L+C  G+ C
Sbjct  419  SKLSQFAGPLNCIPGKPC  436



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 150/200 (75%), Gaps = 6/200 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+S+    DGLID I+GST ITISN H T HN+VMLFGA+DS S DK+MQIT
Sbjct  249  GSSNIWIDHISLSESEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSDDKIMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ L+QRMPRCRWG+ HV+NNDYTHW MYAIGGS  PTI+SQGNR+IAP ++  
Sbjct  309  VAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNNA-  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDP--NFINKHPQLYDGITAFKGE  307
             K IT R YA++  WS+W WRS+ D+FMNGA F+ESG P  N   K   L   +    G 
Sbjct  368  AKTITHRDYASQDVWSKWQWRSENDLFMNGATFIESGAPIKNLPFKKGYL---MKPRPGT  424

Query  306  EVTWLTRFAGALHCKAGRKC  247
            +   LTR+AGAL+C+ GR C
Sbjct  425  QANRLTRYAGALNCQIGRPC  444



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 151/203 (74%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DG+IDAI GST ITISNSHFTDH+EVMLFG  ++  IDK MQIT
Sbjct  253  GATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  313  VAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNED-  371

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  372  SKQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKF-AIRPQ  430

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AGAL CK G+ C
Sbjct  431  PGTKVRRLTKDAGALGCKPGKSC  453



>dbj|BAJ99909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 143/197 (73%), Gaps = 3/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            ++++W+DHLSM  C DG+ID +  ST ITISN H T+HN+VMLFGA D+   DK+MQ+TV
Sbjct  109  ATNVWVDHLSMALCEDGMIDVVAASTAITISNCHLTNHNDVMLFGADDNKPEDKVMQVTV  168

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCR+G+ HVVNNDYTHW MYAIGGS  PTIISQGNRYIAPP +   
Sbjct  169  AFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGSSEPTIISQGNRYIAPP-NMAA  227

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            K++TKR YA E  W  W WRS+GD+ MN AFF  SG    I++     D I    GE VT
Sbjct  228  KQVTKRDYAPEAVWKNWVWRSEGDLMMNNAFFQTSGGQ--ISQKLNGKDLIKPKPGEYVT  285

Query  297  WLTRFAGALHCKAGRKC  247
             LTRF+G L CK G  C
Sbjct  286  RLTRFSGTLACKPGCAC  302



>gb|AGT16687.1| pectate lyase [Saccharum hybrid cultivar R570]
Length=441

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS++WIDH+SM +C DGLID + GST IT+SNSHFT H+ VMLFGA++    D++MQITV
Sbjct  248  SSNVWIDHVSMSSCADGLIDVVNGSTAITVSNSHFTRHDHVMLFGASNDNPQDEVMQITV  307

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCR+G+ HVVNNDYTHW MYAIGG+KNPTIISQGNR+IA P D   
Sbjct  308  AFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGNKNPTIISQGNRFIA-PDDPNA  366

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    ++ +W W+SQGDV MNGAFF ESG  N   +    +D I A  G  V 
Sbjct  367  KEVTKREYTPYKDYKEWVWKSQGDVMMNGAFFNESGGQN--ERKYDKFDFIPAKHGRYVG  424

Query  297  WLTRFAGALHCKAGRKC  247
             LTRFAG L C  G+ C
Sbjct  425  QLTRFAGPLKCIVGQPC  441



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 147/197 (75%), Gaps = 5/197 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAIEGST +TISNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  252  GATNVWIDHVSMTRCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  312  VAFNHFGKRLEQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQ-  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             KE+TKR Y +  +W  W W+S+GD F+NGA+FV+SG PN  +  P+        I    
Sbjct  371  AKEVTKREYTSYTDWKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKP  430

Query  312  GEEVTWLTRFAGALHCK  262
            G  V  LT  AG L C+
Sbjct  431  GTMVRELTMDAGVLGCE  447



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+ +W+DHLS+  C+DGLID I  STG+TISN H T+HN+VMLFG++DS   D +MQIT
Sbjct  254  GSTSVWLDHLSLATCQDGLIDVIAESTGVTISNCHLTNHNDVMLFGSSDSNPKDVIMQIT  313

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK+PTI+SQGNRYIAPP +  
Sbjct  314  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKDPTILSQGNRYIAPP-NLA  372

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K+ITK++ A E EW  W W SQ D+ MNGAFF E+G    I +     D I    G  V
Sbjct  373  AKQITKQIGAAEPEWKNWVWHSQEDLLMNGAFFTETGGD--IKRKFDKDDLIKPKPGTYV  430

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTR+AG + C+ G+ C
Sbjct  431  TRLTRYAGCIPCRPGKPC  448



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 151/203 (74%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DG+IDAI GST ITISNSHFTDH+EVMLFG  ++  IDK MQIT
Sbjct  253  GATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQIT  312

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  313  VAFNHFGKRLKQRMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNED-  371

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  372  SKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKF-AIRPQ  430

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AGAL CK G+ C
Sbjct  431  PGTKVRRLTKDAGALGCKPGKSC  453



>ref|XP_002437815.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
 gb|EER89182.1| hypothetical protein SORBIDRAFT_10g003090 [Sorghum bicolor]
Length=444

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 148/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS++WIDH+SM  C DGLID + GST IT+SNSHFT H+ VMLFGA++    D++MQITV
Sbjct  251  SSNVWIDHVSMSRCADGLIDVVNGSTAITVSNSHFTHHDHVMLFGASNDNPQDEVMQITV  310

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCR+G+ HVVNNDYTHW MYAIGG+KNPTIISQGNR+IAP  D   
Sbjct  311  AFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWIMYAIGGNKNPTIISQGNRFIAPD-DPNA  369

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    ++ +W W+SQGDV MNGAFF ESG  N   K+ +L D I A  G  V 
Sbjct  370  KEVTKREYTAYKDYKEWVWKSQGDVMMNGAFFNESGGQNE-RKYDEL-DFIPAKHGRYVG  427

Query  297  WLTRFAGALHCKAGRKC  247
             LTRFAG L C  G+ C
Sbjct  428  QLTRFAGPLKCIVGQPC  444



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SMRNC DG+IDAI GST ITISNSHFTDH EVMLFGA +    DK MQIT
Sbjct  257  GATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQIT  316

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  317  VAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDC  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  377  -KQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFT-IRPQ  434

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AG L C+ G+ C
Sbjct  435  PGTKVRSLTKDAGTLDCRPGKSC  457



>emb|CDY04133.1| BnaA09g19110D [Brassica napus]
 gb|AIS67292.1| pectate lyase-like protein 9 [Brassica rapa subsp. chinensis]
Length=459

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH+SM NC DG+ID I GST ITISN H TDHNEVMLFGA +   IDK MQIT
Sbjct  259  GSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  319  VAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEN-  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             K++TKR YA   EW  W W+S+ D F+NGA+FV+SG  N  +  P+     +  I    
Sbjct  378  SKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPRHFAIQPQP  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT+ AG L C+ G+ C
Sbjct  438  GTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SMRNC DG+IDAI GST ITISNSHFTDH EVMLFGA +    DK MQIT
Sbjct  257  GATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQIT  316

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  317  VAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDC  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  377  -KQVTKREYTAYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFT-IRPQ  434

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AG L C+ G+ C
Sbjct  435  PGTKVRSLTKDAGTLDCRPGKSC  457



>ref|XP_009114192.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 147/202 (73%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH+SM NC DG+ID I GST ITISN H TDHNEVMLFGA +   +DK MQIT
Sbjct  259  GSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVVDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  319  VAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEN-  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             K++TKR YA   EW  W W+S+ D F+NGA+FV+SG  N  +  P+     +  I    
Sbjct  378  SKQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPRHFAIQPQP  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT+ AG L C+ G+ C
Sbjct  438  GTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   252 bits (644),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 149/198 (75%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+SM  C DGLIDA+ GST ITISNSHFTDH+E MLFGA ++ + DK+MQIT
Sbjct  258  GASNVWIDHVSMSRCADGLIDAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ LVQRMPR R G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAP +   
Sbjct  318  LAFNHFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGV-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++T R    E EW  W WRS+GD+ MNGAFFVESG  +  +KHP   D +    G  V
Sbjct  377  TKQVTHRENTPEAEWKNWEWRSEGDLMMNGAFFVESG--SGASKHPAKLDMMPFKPGTFV  434

Query  300  TWLTRFAGALHCKAGRKC  247
              LT+F+GAL+C  G+ C
Sbjct  435  ATLTKFSGALNCAVGKPC  452



>ref|XP_006655782.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=351

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS++WIDH+SM NC DGL+D + GST ITISN HFT H+ VMLFGA++S   D++MQITV
Sbjct  158  SSNVWIDHVSMSNCSDGLVDVVSGSTAITISNGHFTKHDHVMLFGASNSDPQDRVMQITV  217

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFGK LVQRMPRCR+G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+ AP  D   
Sbjct  218  AFNHFGKGLVQRMPRCRFGFFHVVNNDYTHWMMYAIGGNMNPTIISQGNRFRAPD-DGEL  276

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    E+ +W W+SQGD+F+NGAFF +SG  N   ++ QL D I A  G  V 
Sbjct  277  KEVTKREYTAYEEYKEWVWKSQGDLFLNGAFFNQSGGRNE-RRYDQL-DFIPAKHGSYVG  334

Query  297  WLTRFAGALHCKAGRKC  247
             LT+FAG L+C+ G  C
Sbjct  335  QLTQFAGTLNCRVGHPC  351



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score =   252 bits (644),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SMRNC DG+IDAI GST ITISNSHFTDH EVMLFGA +    DK MQIT
Sbjct  257  GATNIWIDHVSMRNCSDGMIDAIMGSTAITISNSHFTDHKEVMLFGAKNGDEFDKKMQIT  316

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  317  VAFNHFGKRLNQRMPRVRYGMVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPKEDC  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  377  -KQVTKREYTPYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSAAPKNPIPKEFT-IRPQ  434

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AG L C+ G+ C
Sbjct  435  PGTKVRSLTKDAGTLDCRPGKSC  457



>ref|XP_010527871.1| PREDICTED: probable pectate lyase 3 isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   258 bits (660),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 148/202 (73%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DG+IDAI+GSTGITISN H TDH EVMLFG  D   IDK MQIT
Sbjct  509  GATNVWIDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKKMQIT  568

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPRCR+G IHVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP++  
Sbjct  569  VAFNHFGKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEE-  627

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             K++TKR Y    EW  W W+S+GD F+NGA+FV+SG  N ++  P+        I    
Sbjct  628  AKQVTKREYTPFTEWKSWNWQSEGDYFLNGAYFVQSGRANALSAAPKNPVPSKFAIRPQP  687

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AG L CK  + C
Sbjct  688  GTLVRKLTMDAGVLSCKKRKPC  709



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   251 bits (642),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S +W+DHLSM NC DGLIDA++ ST ITISN H T HN+V+L GA+D +  D +MQ+T
Sbjct  242  GASHVWVDHLSMSNCADGLIDAVKASTAITISNCHLTRHNDVILLGASDKSQEDAVMQVT  301

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VA+NHFGK LVQRMPRCRWG+ HVVNNDYTHW MYA+GGS++PTIISQGNR++ PP   F
Sbjct  302  VAYNHFGKGLVQRMPRCRWGFFHVVNNDYTHWMMYAVGGSQHPTIISQGNRFVGPP-IQF  360

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+T R YA E EW  W W S+ D F +GAFF++SG   +  KH + YD I A  G   
Sbjct  361  AKEVTHREYAPESEWKNWIWTSEDDEFKSGAFFIQSGH-KYQGKHSR-YDVIKAKPGSIA  418

Query  300  TWLTRFAGALHCKAGRKC  247
              LTRF+GAL C   R C
Sbjct  419  GRLTRFSGALQCSPNRPC  436



>gb|EPS62426.1| hypothetical protein M569_12361, partial [Genlisea aurea]
Length=410

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 147/198 (74%), Gaps = 5/198 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+S   C DGLIDAI+ ST ITISN HF  HN+VML GA+D +S D+++Q+T
Sbjct  218  GATNIWIDHVSAARCSDGLIDAIQASTAITISNCHFAQHNDVMLLGASDKSSEDQILQVT  277

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG  L+QRMPR RWG++H+VNNDYT W MYAIGGS++PTI+SQGNR+ A P +  
Sbjct  278  LAFNHFGTGLIQRMPRIRWGFVHIVNNDYTKWEMYAIGGSQHPTILSQGNRFHA-PDNAA  336

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y+ E  W  W W+SQGD F NGAFFVESGD NF      + D + A  G+EV
Sbjct  337  AKEVTKREYSPESVWKNWNWKSQGDSFSNGAFFVESGDKNF----NYVSDSVGAKSGKEV  392

Query  300  TWLTRFAGALHCKAGRKC  247
              LT FAG L C AG+ C
Sbjct  393  GELTEFAGPLACFAGKAC  410



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+S+  C DGLID I+GST ITISN H T HN+VMLFGA+D+ + DK+MQIT
Sbjct  252  GSSNIWIDHVSLSQCEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDTYNGDKLMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ L+QRMPRCR+G++HVVNNDYTHW MYAIGGS  PTI+SQGNR+IAP +D  
Sbjct  312  VAFNHFGQGLIQRMPRCRFGFVHVVNNDYTHWQMYAIGGSSGPTILSQGNRFIAPDNDA-  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFK-GEE  304
             KEIT R YA    W  W W+S+ D+FMNGA FV SG P  INK P     I   + G  
Sbjct  371  AKEITHRDYAEPEVWKNWQWQSEMDLFMNGAKFVTSGSP--INKAPFKKGFIMKPRDGSH  428

Query  303  VTWLTRFAGALHCKAGRKC  247
            V+ LTR +GAL+C  G+ C
Sbjct  429  VSRLTRHSGALNCVVGKPC  447



>gb|EAY99621.1| hypothetical protein OsI_21600 [Oryza sativa Indica Group]
Length=448

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC DGLID  +GST ITISNSHFT H+ VMLFGA+D +  DK+MQ+T
Sbjct  254  GSSNIWIDHVSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGASDDSPKDKIMQVT  313

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK LVQRMPRCR+G+ H VNNDYTHW MYAIGG+ NPTIISQGNR+ A   D  
Sbjct  314  LAFNHFGKGLVQRMPRCRFGFFHTVNNDYTHWLMYAIGGNMNPTIISQGNRFRASD-DMK  372

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y +  E+ +W W+SQ D+F+NGAFF ESG  N   +     D I A  G  V
Sbjct  373  LKEVTKREYTSYDEYKEWVWKSQDDLFLNGAFFNESGGRN--ERRYNRLDLIQARNGRYV  430

Query  300  TWLTRFAGALHCKAGRKC  247
              +TRFAG L C+ G+KC
Sbjct  431  GRMTRFAGTLPCRVGKKC  448



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+SM  C DGLIDA+  ST ITISNSHFTDH++VMLFGA ++ + DK+MQIT
Sbjct  258  GASNVWIDHVSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ LVQRMPR R G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAP  +  
Sbjct  318  LAFNHFGQGLVQRMPRVRHGFFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPA-NAA  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++T R +  E EW  W WRS+GD+ MNGAFFVESG  +  ++HP   D +    G   
Sbjct  377  TKQVTHREHTPESEWKNWEWRSEGDLMMNGAFFVESG--SGASQHPAKLDMMPFQPGTFA  434

Query  300  TWLTRFAGALHCKAGRKC  247
            T LT+F+GAL+C  G+ C
Sbjct  435  TKLTKFSGALNCVVGKPC  452



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++W+DHLS+ NC+DGLID I  STG+TISN H T+HN+VMLF ++D    D++MQIT
Sbjct  292  GSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHMTNHNDVMLFSSSDKHPEDQIMQIT  351

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK PTIISQGNRYIAPP +  
Sbjct  352  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPP-NLA  410

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TK+  A E EW  W W S+ D+FM GA+F  +G    IN+     D I    G  V
Sbjct  411  AKQVTKQHDAPESEWKNWVWHSEDDLFMEGAYFTVTGGQ--INRQFNKKDLIKPKPGSYV  468

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG+L CK G+ C
Sbjct  469  TRLTRFAGSLDCKPGKPC  486



>ref|NP_001056784.1| Os06g0144900 [Oryza sativa Japonica Group]
 dbj|BAD68407.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68762.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18698.1| Os06g0144900 [Oryza sativa Japonica Group]
 gb|EAZ35811.1| hypothetical protein OsJ_20103 [Oryza sativa Japonica Group]
 dbj|BAG91996.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDH+SM NC DGLID  +GST ITISNSHFT H+ VMLFGA D +  DK+MQ+T
Sbjct  254  GSSNIWIDHVSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGARDDSPKDKIMQVT  313

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK LVQRMPRCR+G+ H+VNNDYTHW MYAIGG+ NPTIISQGNR+ A   D  
Sbjct  314  LAFNHFGKGLVQRMPRCRFGFFHMVNNDYTHWLMYAIGGNMNPTIISQGNRFRASD-DMK  372

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y +  E+ +W W+SQ D+F+NGAFF ESG  N   +     D I A  G  V
Sbjct  373  LKEVTKREYTSYDEYKEWVWKSQDDLFLNGAFFNESGGRN--ERRYNRLDLIQARNGRYV  430

Query  300  TWLTRFAGALHCKAGRKC  247
              +TRFAG L C+ G+KC
Sbjct  431  GRMTRFAGTLPCRVGKKC  448



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 149/201 (74%), Gaps = 8/201 (4%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++W+DHLSM  CRDGLIDAI+GST ITISN HFT H++VMLFGA D+  +D+ MQIT
Sbjct  245  GATNVWLDHLSMYKCRDGLIDAIQGSTAITISNCHFTHHDQVMLFGANDNHKMDEKMQIT  304

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            + FNHFGK LVQRMPRCRWG+IHVVNNDYTHW MYAIGGS +PT+ISQGNRYIA  H   
Sbjct  305  LVFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTVISQGNRYIARRH-VA  363

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDG---ITAFKG  310
             KE+TKR YA    W  W WRS+GD+ +NGAFF +SGDP   +K    + G   ++A   
Sbjct  364  SKEVTKRDYAPPEVWKTWNWRSEGDLLLNGAFFSQSGDPKASSK----FKGDTKVSAKPA  419

Query  309  EEVTWLTRFAGALHCKAGRKC  247
             +V  LT+ +G L C  GR C
Sbjct  420  YKVDLLTKDSGTLICIRGRAC  440



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAI GST +T+SNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  258  GATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ NPTIIS GNR+IAPP++  
Sbjct  318  VAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPPNEQ-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYD----GITAFK  313
             K+ITKR Y +  +W  W W+S+GD F+NGA+FV+SG PN  +  P+        I    
Sbjct  377  AKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIRPKP  436

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AG L CK G+ C
Sbjct  437  GTMVRKLTMDAGVLGCKQGQAC  458



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAI GST +T+SNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  259  GATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ NPTIIS GNR+IAPP++  
Sbjct  319  VAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPPNEQ-  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYD----GITAFK  313
             K+ITKR Y +  +W  W W+S+GD F+NGA+FV+SG PN  +  P+        I    
Sbjct  378  AKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIRPKP  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AG L CK G+ C
Sbjct  438  GTMVRKLTMDAGVLGCKQGQAC  459



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 148/198 (75%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IWIDH+SMRNCRDGLIDAI GST ITISNSHFTDHNEVMLFGA+D+   D+ MQIT
Sbjct  254  GSSHIWIDHVSMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDTYDGDQKMQIT  313

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            V FN FGK+L+QRMPRCR+G+IHV+NN Y  W MYAIGG+ +PTIIS+GN++IA P++  
Sbjct  314  VVFNRFGKKLIQRMPRCRFGFIHVLNNFYNRWEMYAIGGTMHPTIISEGNKFIA-PNNGH  372

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEITKR    E EW  W WRS  D+++NGAFF +SG    IN+     D I A  G  V
Sbjct  373  AKEITKRTLVPEAEWKTWQWRSINDLYLNGAFFRQSG-AELINRPFSNKDMIKAKPGSYV  431

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR++ +L C+ G+ C
Sbjct  432  GRLTRYSRSLRCRVGKPC  449



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM  C DG+IDAI GST +T+SNSHFTDH EVMLFGA D   IDK MQIT
Sbjct  258  GATNVWIDHVSMTRCSDGMIDAILGSTAVTVSNSHFTDHQEVMLFGANDKHEIDKKMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G IHVVNNDYTHW MYAIGG+ NPTIIS GNR+IAPP++  
Sbjct  318  VAFNHFGKRLEQRMPRVRFGTIHVVNNDYTHWEMYAIGGNMNPTIISHGNRFIAPPNEQ-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYD----GITAFK  313
             K+ITKR Y +  +W  W W+S+GD F+NGA+FV+SG PN  +  P+        I    
Sbjct  377  AKQITKREYTSYVDWKLWNWQSEGDYFLNGAYFVQSGKPNAWSPKPKNPIPNKFAIRPKP  436

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT  AG L CK G+ C
Sbjct  437  GTMVRKLTMDAGVLGCKQGQAC  458



>gb|EAZ35814.1| hypothetical protein OsJ_20107 [Oryza sativa Japonica Group]
Length=193

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS+IWIDH+SM NC DGLIDA+ GST ITIS  HFT H+ VMLFGA++S + D++MQITV
Sbjct  3    SSNIWIDHVSMSNCSDGLIDAVSGSTAITISKGHFTKHDHVMLFGASNSDAQDEVMQITV  62

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFGK LV   PRCR+G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAP  D   
Sbjct  63   AFNHFGKGLV---PRCRFGFFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPD-DLNA  118

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    E+ +W W+SQGDV MNGAFF ESG  N    + QL D I A  G+ V 
Sbjct  119  KEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQN-ERSYDQL-DFIPAKHGKYVG  176

Query  297  WLTRFAGALHCKAGRKC  247
             LT+FAG L+C  G  C
Sbjct  177  QLTKFAGTLNCHVGMPC  193



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS+IWIDHLS+  C DGL+D I+GSTGITISN H T HN+VMLFGA+DS + DK+MQIT
Sbjct  258  GSSNIWIDHLSLSECEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDSYTGDKLMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ L+QRMPRCR+G++HV+NNDYTHW MYAIGGS +PTI+SQGNR+IAP +   
Sbjct  318  VAFNHFGQGLIQRMPRCRYGFVHVLNNDYTHWIMYAIGGSSSPTILSQGNRFIAPDNGA-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHP-QLYDGITAFKGEE  304
             KE+T R YA    W  W W S+ DVFMNGA FV SG P  IN+ P +    +    G  
Sbjct  377  AKEVTHRDYAPPDVWKNWQWSSELDVFMNGAKFVPSGAP--INRKPFKKAYMMQPRDGSH  434

Query  303  VTWLTRFAGALHCKAGRKC  247
            V+ LTR AGAL+C  G+ C
Sbjct  435  VSRLTRNAGALNCVVGKPC  453



>emb|CDY17432.1| BnaC09g21050D [Brassica napus]
Length=459

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 146/202 (72%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++WIDH+SM NC DG+ID I GST ITISN H TDHNEVMLFGA +   IDK MQIT
Sbjct  259  GSTNVWIDHVSMTNCTDGMIDVIMGSTAITISNCHLTDHNEVMLFGAREEDVIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+ APP +  
Sbjct  319  VAFNHFGKRLVQRMPRARFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFTAPPKENC  378

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             K++TKR YA   EW  W W+S+ D F+NGA+FV+SG  N  +  P+     +  I    
Sbjct  379  -KQVTKREYAKYSEWKSWNWQSERDYFLNGAYFVKSGRANAWSPAPENPIPRHFAIQPQP  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT+ AG L C+ G+ C
Sbjct  438  GTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DG+IDAI GST ITISNSHFTDH+EVMLFG  +   IDK MQIT
Sbjct  255  GATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKKMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  315  VAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPIED-  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  374  SKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKF-AIRPQ  432

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AG L CK G+ C
Sbjct  433  PGTKVRRLTKDAGTLGCKPGKSC  455



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 150/198 (76%), Gaps = 9/198 (5%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S +WIDH+SM NC+DGLIDA+  ST ITISN HFT HN+V+L GA++  S D++MQ+T
Sbjct  246  GASRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQVT  305

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFGK LVQRMPRCRWG+IHVVNNDYTHW MYAIGGS       QGNR+IAPP+   
Sbjct  306  LAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSH-----XQGNRFIAPPNPNC  360

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR+YA E EW  W WRS+GD+ MNGAFF++SG+P  I ++ +  D I +  G  V
Sbjct  361  -KEVTKRVYAPESEWRSWNWRSEGDLMMNGAFFIQSGNP--IKRYSK-KDVIHSKPGTFV  416

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTRFAG L CK  + C
Sbjct  417  TRLTRFAGPLKCKKNQPC  434



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   249 bits (637),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DG+IDAI GST ITISNSHFTDH+EVMLFG  +   IDK MQIT
Sbjct  255  GATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKKMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  315  VAFNHFGKRLKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPIED-  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  374  SKQVTKREYTPYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSSTPKNPIPRKF-AIRPQ  432

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AG L CK G+ C
Sbjct  433  PGTKVRRLTKDAGTLGCKPGKSC  455



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 148/203 (73%), Gaps = 7/203 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G++++WIDH+SM +C DG+IDAI GST ITISNSHFTDH+EVMLFG  +   IDK MQIT
Sbjct  255  GATNVWIDHVSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKKMQIT  314

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRL QRMPR R+G +HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAPP +  
Sbjct  315  VAFNHFGKRLKQRMPRVRFGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPIED-  373

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNF-----INKHPQLYDGITAF  316
             K++TKR Y    EW  W W+S+ D F+NGA+FV+SG  N       N  P+ +  I   
Sbjct  374  SKQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGKANAWSATPKNPIPRKF-AIRPQ  432

Query  315  KGEEVTWLTRFAGALHCKAGRKC  247
             G +V  LT+ AG L CK G+ C
Sbjct  433  PGTKVRRLTKDAGTLGCKPGKSC  455



>dbj|BAK05605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSI-DKMMQIT  661
            SS++WIDH+SM  C DGLID + GST IT+SNSHFT+H+ VMLFGA+++    D+MMQ+T
Sbjct  254  SSNVWIDHVSMSTCADGLIDVVSGSTAITVSNSHFTNHDHVMLFGASNAQEQQDRMMQVT  313

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK LVQRMPRCR+G+ HVVNNDYTHW MYAIGG+++PTIISQGNR+IA P D  
Sbjct  314  VAFNHFGKGLVQRMPRCRFGFFHVVNNDYTHWKMYAIGGNRDPTIISQGNRFIA-PDDPN  372

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR Y    E+  W W+SQGDV MNGAFF +SG  N   +     D I A  G+ V
Sbjct  373  AKEVTKREYTPYNEYKDWVWKSQGDVMMNGAFFNQSGGQN--ERTYGNMDFIPAKHGKYV  430

Query  300  TWLTRFAGALHCKAGRKC  247
              LT+FAG L C+ G+ C
Sbjct  431  GQLTQFAGTLECRVGKPC  448



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 144/197 (73%), Gaps = 4/197 (2%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            ++++WIDH+SM NC DGLID ++ STGITISN HFT+HN+VMLFGA+DS   D+MMQITV
Sbjct  253  ATNVWIDHISMSNCEDGLIDVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQMMQITV  312

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGG K PTIISQGNRYIAPP +   
Sbjct  313  AFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGGKAPTIISQGNRYIAPP-NIAA  371

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            K ITK  YA EGEW  W W ++ D+FMNGA F  SG    + +     + +    G  VT
Sbjct  372  KVITKH-YAEEGEWKNWVWHTEDDLFMNGAIFEPSG--GAVQRQINSNEWVKPKPGTYVT  428

Query  297  WLTRFAGALHCKAGRKC  247
             LTRF+G L C   + C
Sbjct  429  RLTRFSGTLSCCMSKPC  445



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 146/200 (73%), Gaps = 9/200 (5%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S +WIDH+SM NC DGL+DA+ GST ITISN H T HN+VMLFGA D  S D++ QIT
Sbjct  242  GASHVWIDHISMWNCADGLVDAVAGSTAITISNCHMTRHNDVMLFGANDGFSGDQISQIT  301

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGK L+QRMPRCRWG+ H+VNNDYTHW MYAIGGS +PTI+SQGNR+IAPP+   
Sbjct  302  VAFNHFGKGLIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAPPNPN-  360

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGD--PNFINKHPQLYDGITAFKGE  307
             KE+TKR YA E  W  W+WRS+ D+ MNGAFF +SG    NF    P+    I A  G 
Sbjct  361  AKEVTKRDYAPESVWKAWSWRSENDLMMNGAFFKQSGTKAANF----PK--SDIKAKPGS  414

Query  306  EVTWLTRFAGALHCKAGRKC  247
                LTRF+G L C+ G+ C
Sbjct  415  FAAALTRFSGCLKCEVGKPC  434



>emb|CDY03043.1| BnaC07g21840D [Brassica napus]
Length=459

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 146/202 (72%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM +C DG+IDAI GST ITISNSH TDHNEV+LFG  D   IDK MQIT
Sbjct  259  GATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLLFGGKDGDVIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPR R+G +HVVNNDYTHW MYAIGG+KNPTIISQGNR+IAP  +T 
Sbjct  319  VAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAIGGNKNPTIISQGNRFIAPHKETC  378

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             K++TKR Y    EW  W W+S+ D F+NGA+FV SG  N  +  P+        I    
Sbjct  379  -KQVTKREYTPYTEWKSWNWQSERDYFLNGAYFVNSGRANAWSPAPKNPIHRKFAIRPQS  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT+ AG L C+ G+ C
Sbjct  438  GTGVRRLTKDAGTLGCRPGKSC  459



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 145/198 (73%), Gaps = 5/198 (3%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+S+ NC DGLIDAI  ST ITISN HFT HN VML G  +  S D +MQ+T
Sbjct  241  GSNNIWIDHVSISNCTDGLIDAIMASTAITISNCHFTRHNTVMLLGGNNKFSADSVMQVT  300

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHF ++LVQRMPR R+G  HVVNNDYT W MYAIGGS++PTIISQGNR++APP D  
Sbjct  301  VAFNHFDRKLVQRMPRVRYGLAHVVNNDYTSWEMYAIGGSEHPTIISQGNRFLAPP-DPD  359

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TKR    E EW  W WRS+GD+ +NGAFFVESG P  I  H +  + + A  G  V
Sbjct  360  CKQVTKRNVEPESEWKSWNWRSEGDLMLNGAFFVESGSP--IETHGK--EEVHAMPGTLV  415

Query  300  TWLTRFAGALHCKAGRKC  247
              LTR+AGALHCK  + C
Sbjct  416  HRLTRYAGALHCKKQKPC  433



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++W+DHLS+ NC+DGLID I  STG+TISN H T+HN+VMLF ++D    D++MQIT
Sbjct  259  GSTNVWLDHLSLSNCQDGLIDVIVKSTGVTISNCHMTNHNDVMLFSSSDKHPEDQIMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK PTIISQGNRYIAPP +  
Sbjct  319  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPP-NLA  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K +TK   A E EW  W W S+ D+FM GA F  SG    IN++    D I    G  V
Sbjct  378  AKLVTKHHDAPESEWKNWVWHSENDLFMEGANFTVSGGQK-INRNFHKKDLIKPKNGSYV  436

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTR+AGAL C+ G+ C
Sbjct  437  TRLTRYAGALACRPGKPC  454



>gb|EAY99627.1| hypothetical protein OsI_21606 [Oryza sativa Indica Group]
Length=403

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 144/195 (74%), Gaps = 3/195 (2%)
 Frame = -3

Query  831  DIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITVAF  652
            +IWIDH+SM NC DGLID  +GST ITISNSHFT H+ VMLFGA D +  DK+MQ+T+AF
Sbjct  212  NIWIDHVSMSNCSDGLIDITDGSTAITISNSHFTKHDHVMLFGARDDSPKDKIMQVTLAF  271

Query  651  NHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFKKE  472
            NHFGK LVQRMPRCR+G+ H+VNNDYTHW MYAIGG+ NPTIISQGNR+ A   D   KE
Sbjct  272  NHFGKGLVQRMPRCRFGFFHMVNNDYTHWLMYAIGGNMNPTIISQGNRFRA-SDDMKLKE  330

Query  471  ITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVTWL  292
            +TKR Y +  E+ +W W+SQ D+F+NGAFF ESG  N   +     D I A  G  V  +
Sbjct  331  VTKREYTSYDEYKEWVWKSQDDLFLNGAFFNESGGRN--ERRYNRLDLIQARNGRYVGRM  388

Query  291  TRFAGALHCKAGRKC  247
            TRFAG L C+ G+KC
Sbjct  389  TRFAGTLPCRVGKKC  403



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3-like [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 144/198 (73%), Gaps = 5/198 (3%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            +S+IWIDH+SM    DGLID I GST +TISN HFTDHNE MLFGA ++ + DK MQIT+
Sbjct  250  ASNIWIDHVSMARTADGLIDCIMGSTAVTISNGHFTDHNEAMLFGAKNTHTQDKNMQITL  309

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFG+ LVQRMPRCR+G+ HVVNNDYT W MYAIGG+ NPTIISQGNR+IA P     
Sbjct  310  AFNHFGQGLVQRMPRCRFGFFHVVNNDYTQWIMYAIGGNMNPTIISQGNRFIA-PESHVA  368

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFK-GEEV  301
            KE+TKR Y  E EW  W WRS+GDV  NGAFFVESG+PN   K   +   +  FK G+  
Sbjct  369  KEVTKREYTDESEWKNWNWRSEGDVMENGAFFVESGNPN-CAKSTNIE--MMPFKPGKLA  425

Query  300  TWLTRFAGALHCKAGRKC  247
              LT FAGAL C  GR C
Sbjct  426  PQLTSFAGALECFVGRPC  443



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 146/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+S+ NC DGLID I+GST ITISN H T HN+V LFGA+DS + DK+MQIT
Sbjct  249  GSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG++HV+NNDYTHW MYAIGGS  PTI+SQGNR+IAP +D  
Sbjct  309  VAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDN-  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEIT R YA    W  W W+S+ D+FMNGA FV SG P  +     L   +    G  V
Sbjct  368  AKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHV  425

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTR AGAL+C  G+ C
Sbjct  426  SRLTRHAGALNCFVGKPC  443



>ref|XP_009101245.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=459

 Score =   247 bits (631),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 145/202 (72%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM +C DG+IDAI GST ITISNSH TDHNEV+LFG  D   IDK MQIT
Sbjct  259  GATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLLFGGKDGDVIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPR R+G +HVVNNDYTHW MYAIGG+KNPTIISQGNR+IAP  +T 
Sbjct  319  VAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAIGGNKNPTIISQGNRFIAPHKETC  378

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             K++TKR Y    EW  W W+S+ D F+NGA+FV SG  N  +  P+        I    
Sbjct  379  -KQVTKREYTPYTEWKSWNWQSERDYFLNGAYFVNSGRANAWSPAPKNPIHRKFAIRPQS  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT+ AG L C  G+ C
Sbjct  438  GTGVRRLTKDAGTLGCTPGKSC  459



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 146/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+S+ NC DGLID I+GST ITISN H T HN+V LFGA+DS + DK+MQIT
Sbjct  249  GSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQIT  308

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG++HV+NNDYTHW MYAIGGS  PTI+SQGNR+IAP +D  
Sbjct  309  VAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDN-  367

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEIT R YA    W  W W+S+ D+FMNGA FV SG P  +     L   +    G  V
Sbjct  368  AKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHV  425

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTR AGAL+C  G+ C
Sbjct  426  SRLTRHAGALNCFVGKPC  443



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 146/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS++IWIDH+S+ NC DGLID I+GST ITISN H T HN+V LFGA+DS + DK+MQIT
Sbjct  252  GSTNIWIDHVSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG++HV+NNDYTHW MYAIGGS  PTI+SQGNR+IAP +D  
Sbjct  312  VAFNHFGQGLVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDN-  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KEIT R YA    W  W W+S+ D+FMNGA FV SG P  +     L   +    G  V
Sbjct  371  AKEITHRDYAGPDVWKNWQWQSEMDLFMNGAKFVTSGSPIKMTYKKGLI--MKPRDGTHV  428

Query  300  TWLTRFAGALHCKAGRKC  247
            + LTR AGAL+C  G+ C
Sbjct  429  SRLTRHAGALNCFVGKPC  446



>emb|CDY45202.1| BnaA06g34060D [Brassica napus]
Length=459

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 144/202 (71%), Gaps = 5/202 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+++IWIDH+SM +C DG+IDAI GST ITISNSH TDHNEV+LFG  D   IDK MQIT
Sbjct  259  GATNIWIDHVSMTHCSDGMIDAIMGSTAITISNSHLTDHNEVLLFGGKDGDVIDKKMQIT  318

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFGKRLVQRMPR R+G +HVVNNDYTHW MYAIGG+KNPTIISQGNR+IA PH   
Sbjct  319  VAFNHFGKRLVQRMPRVRYGLVHVVNNDYTHWEMYAIGGNKNPTIISQGNRFIA-PHQEN  377

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQ----LYDGITAFK  313
             K++TKR Y    EW  W W+S+ D F+NGA+FV SG  N  +  P+        I    
Sbjct  378  CKQVTKREYTPYTEWKSWNWQSERDYFLNGAYFVNSGRANAWSPAPKNPIHRKFAIRPQS  437

Query  312  GEEVTWLTRFAGALHCKAGRKC  247
            G  V  LT+ AG L C  G+ C
Sbjct  438  GTGVRRLTKDAGTLGCTPGKSC  459



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 149/198 (75%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            G+S++WIDH+SM  C DGLIDA+  ST ITISNSHFTDH++VMLFGA ++ + DK+MQIT
Sbjct  258  GASNVWIDHMSMSRCADGLIDAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQIT  317

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +AFNHFG+ LVQRMPR R G+ H+VNNDY HW MYAIGG+ NPTIISQGNR+IAP ++  
Sbjct  318  LAFNHFGRGLVQRMPRVRHGFFHLVNNDYNHWIMYAIGGNMNPTIISQGNRFIAPVNEA-  376

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++T R +  E EW  W WRS+GD+ MNGAFFVESG  +  +++P   D +    G   
Sbjct  377  TKQVTHREHTPESEWKNWEWRSEGDLMMNGAFFVESG--SRASQNPAKLDMMPFQPGTFA  434

Query  300  TWLTRFAGALHCKAGRKC  247
            T LT+F+GAL C  G+ C
Sbjct  435  TKLTKFSGALSCVVGKPC  452



>ref|NP_001056786.1| Os06g0145100 [Oryza sativa Japonica Group]
 dbj|BAD68408.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAD68763.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
 dbj|BAF18700.1| Os06g0145100 [Oryza sativa Japonica Group]
 gb|EAZ35810.1| hypothetical protein OsJ_20102 [Oryza sativa Japonica Group]
Length=348

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS+IWIDH+SM NC DGLIDA+ GST ITISN HFT H+ VMLFGA++S + D++MQITV
Sbjct  158  SSNIWIDHVSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITV  217

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFGK LV   PRCR+G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAP  D   
Sbjct  218  AFNHFGKGLV---PRCRFGFFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPD-DLNA  273

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    E+ +W W+SQGDV MNGAFF ESG  N    + QL D I A  G+ V 
Sbjct  274  KEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQNE-RSYDQL-DFIPAKHGKYVG  331

Query  297  WLTRFAGALHCKAGRKC  247
             LT+FAG L+C  G  C
Sbjct  332  QLTKFAGTLNCHVGMPC  348



>dbj|BAC42832.1| putative pectate lyase [Arabidopsis thaliana]
Length=274

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GSS IWIDH S+ NC DGLIDAI GST ITISN++ T HNEVML G +DS + DK+MQ+T
Sbjct  80   GSSHIWIDHNSLSNCADGLIDAIMGSTAITISNNYMTHHNEVMLMGHSDSYTRDKLMQVT  139

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            +A+NHFG+ L+QRMPRCR GY HVVNNDYTHW MYAIGGS NPTI SQGNR++AP  + F
Sbjct  140  IAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPG-NPF  198

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             KE+TKR+ + +GEW QW WRSQGD+ +NGA+F +SG     +       G  A     V
Sbjct  199  AKEVTKRVGSWQGEWKQWNWRSQGDLMLNGAYFTKSGAAAPASYARASSLG--AKPASVV  256

Query  300  TWLTRFAGALHCKAGRKC  247
            + LT  +GAL C+ G +C
Sbjct  257  SMLTYSSGALKCRIGMRC  274



>dbj|BAD68402.1| putative pectate lyase homolog [Oryza sativa Japonica Group]
Length=438

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS+IWIDH+SM NC DGLIDA+ GST ITISN HFT H+ VMLFGA++S + D++MQITV
Sbjct  248  SSNIWIDHVSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITV  307

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFGK LV   PRCR+G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAP  D   
Sbjct  308  AFNHFGKGLV---PRCRFGFFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPD-DLNA  363

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    E+ +W W+SQGDV MNGAFF ESG  N    + QL D I A  G+ V 
Sbjct  364  KEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQNE-RSYDQL-DFIPAKHGKYVG  421

Query  297  WLTRFAGALHCKAGRKC  247
             LT+FAG L+C  G  C
Sbjct  422  QLTKFAGTLNCHVGMPC  438



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++W+DHLS+ NC+DGLID I  STG+TISN H T+HN+VMLF ++D    D++MQIT
Sbjct  257  GSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFSSSDKHPEDQIMQIT  316

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK PTIISQGNRYIAPP +  
Sbjct  317  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPP-NLA  375

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TK+    E  W  W W S+ D+FM GA+F  +G    IN+     D I    G  V
Sbjct  376  AKQVTKQHDTPESVWKNWVWHSENDLFMEGAYFTVTGGQ--INRQFNKKDLIKPRNGSYV  433

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTR+AG+L C  G+ C
Sbjct  434  TRLTRYAGSLACTPGKPC  451



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+++W+DHLS+ NC+DGLID I  STG+TISN H T+HN+VMLF ++D    D++MQIT
Sbjct  257  GSTNVWLDHLSLSNCQDGLIDVIAKSTGVTISNCHLTNHNDVMLFSSSDKHPEDQIMQIT  316

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSK PTIISQGNRYIAPP +  
Sbjct  317  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPP-NLA  375

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEV  301
             K++TK+    E  W  W W S+ D+FM GA+F  +G    IN+     D I    G  V
Sbjct  376  AKQVTKQHDTPESVWKNWVWHSENDLFMEGAYFTVTGGQ--INRQFNKKDLIKPRNGSYV  433

Query  300  TWLTRFAGALHCKAGRKC  247
            T LTR+AG+L C  G+ C
Sbjct  434  TRLTRYAGSLACTPGKPC  451



>gb|EMT25421.1| Pectate lyase [Aegilops tauschii]
Length=323

 Score =   241 bits (614),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = -3

Query  792  DGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITVAFNHFGKRLVQRMPR  613
            DGLID I+ STG+TISN H T+HN+VMLFG++DS   D++MQITVAFNHFG+ LVQRMPR
Sbjct  145  DGLIDVIDQSTGVTISNCHLTNHNDVMLFGSSDSNPKDEIMQITVAFNHFGRGLVQRMPR  204

Query  612  CRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFKKEITKRLYATEGEWS  433
            CRWG+ HVVNNDYTHW MYAIGGSKNPTIISQGNRYIAPP +   K ITKRLYA E EW 
Sbjct  205  CRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPP-NLAAKLITKRLYAEEAEWK  263

Query  432  QWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVTWLTRFAGALHCKAGR  253
             W W S+GD+ +N A F +SG PN   +  +  D I    G  VT LTR AG L CK G+
Sbjct  264  NWVWHSEGDLMLNDAVFADSGGPN--QRKFEKDDLIPPKPGSYVTRLTRSAGCLPCKPGK  321

Query  252  KC  247
             C
Sbjct  322  PC  323



>ref|NP_001056781.1| Os06g0144200 [Oryza sativa Japonica Group]
 dbj|BAF18695.1| Os06g0144200 [Oryza sativa Japonica Group]
Length=450

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  837  SSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQITV  658
            SS+IWIDH+SM NC DGLIDA+ GST ITISN HFT H+ VMLFGA++S + D++MQITV
Sbjct  260  SSNIWIDHVSMSNCSDGLIDAVSGSTAITISNGHFTKHDHVMLFGASNSDAQDEVMQITV  319

Query  657  AFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTFK  478
            AFNHFGK LV   PRCR+G+ HVVNNDYTHW MYAIGG+ NPTIISQGNR+IAP  D   
Sbjct  320  AFNHFGKGLV---PRCRFGFFHVVNNDYTHWLMYAIGGNMNPTIISQGNRFIAPD-DLNA  375

Query  477  KEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPNFINKHPQLYDGITAFKGEEVT  298
            KE+TKR Y    E+ +W W+SQGDV MNGAFF ESG  N    + QL D I A  G+ V 
Sbjct  376  KEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQNE-RSYDQL-DFIPAKHGKYVG  433

Query  297  WLTRFAGALHCKAGRKC  247
             LT+FAG L+C  G  C
Sbjct  434  QLTKFAGTLNCHVGMPC  450



>gb|EMS45831.1| Pectate lyase [Triticum urartu]
Length=540

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  840  GSSDIWIDHLSMRNCRDGLIDAIEGSTGITISNSHFTDHNEVMLFGAADSTSIDKMMQIT  661
            GS+D+W+DHLS+  C+DGLID I+ STG+TISN H T+HN+VMLFG++DS   D++MQIT
Sbjct  252  GSTDVWLDHLSLATCQDGLIDVIDQSTGVTISNCHLTNHNDVMLFGSSDSNPKDEIMQIT  311

Query  660  VAFNHFGKRLVQRMPRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRYIAPPHDTF  481
            VAFNHFG+ LVQRMPRCRWG+ HVVNNDYTHW MYAIGGSKNPTIISQGNRYIAPP +  
Sbjct  312  VAFNHFGRGLVQRMPRCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPP-NLA  370

Query  480  KKEITKRLYATEGEWSQWTWRSQGDVFMNGAFFVESGDPN  361
             K ITKRLYA E EW  W W S+GD+ +N A F +SG PN
Sbjct  371  AKLITKRLYAEESEWKNWVWHSEGDLMLNDAVFTDSGGPN  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1627375116822