BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6515_g1_i1 len=744 path=[1:0-743]

Length=744
                                                                      Score     E

ref|XP_004235161.1|  PREDICTED: peroxisomal membrane protein 11B        356   4e-121   
ref|XP_006358254.1|  PREDICTED: peroxisomal membrane protein 11B-...    352   1e-119   
ref|XP_004148144.1|  PREDICTED: peroxisomal membrane protein 11-4...    349   3e-118   
ref|XP_009596076.1|  PREDICTED: peroxisomal membrane protein 11-4       348   4e-118   
ref|XP_009796988.1|  PREDICTED: peroxisomal membrane protein 11-4       346   5e-117   
ref|XP_002510956.1|  peroxisomal biogenesis factor, putative            345   9e-117   Ricinus communis
ref|XP_008439086.1|  PREDICTED: peroxisomal membrane protein 11B        345   1e-116   
ref|XP_002267934.1|  PREDICTED: peroxisomal membrane protein 11B        342   1e-115   Vitis vinifera
ref|XP_010089678.1|  Peroxisomal membrane protein 11B                   342   1e-115   
ref|XP_011076372.1|  PREDICTED: peroxisomal membrane protein 11B        341   3e-115   
ref|XP_007038379.1|  Peroxisomal membrane protein 11B                   341   4e-115   
emb|CDP05337.1|  unnamed protein product                                338   7e-114   
ref|XP_007219516.1|  hypothetical protein PRUPE_ppa022507mg             338   7e-114   
ref|XP_010035030.1|  PREDICTED: peroxisomal membrane protein 11-4       337   3e-113   
ref|XP_010264265.1|  PREDICTED: peroxisomal membrane protein 11-4       335   9e-113   
gb|EYU31317.1|  hypothetical protein MIMGU_mgv1a026827mg                335   1e-112   
ref|XP_008234408.1|  PREDICTED: peroxisomal membrane protein 11B        334   3e-112   
ref|XP_010933678.1|  PREDICTED: peroxisomal membrane protein 11-4       333   3e-112   
ref|XP_004506346.1|  PREDICTED: peroxisomal membrane protein 11B-...    331   3e-111   
ref|XP_004307814.1|  PREDICTED: peroxisomal membrane protein 11B-...    330   6e-111   
ref|XP_008354198.1|  PREDICTED: peroxisomal membrane protein 11B-...    329   2e-110   
ref|XP_008376049.1|  PREDICTED: peroxisomal membrane protein 11B-...    328   5e-110   
ref|XP_009374473.1|  PREDICTED: peroxisomal membrane protein 11B-...    327   2e-109   
ref|XP_003534369.1|  PREDICTED: peroxisomal membrane protein 11B-...    326   3e-109   
ref|XP_003539968.1|  PREDICTED: peroxisomal membrane protein 11B-...    325   1e-108   
emb|CAN67008.1|  hypothetical protein VITISV_028688                     323   7e-108   Vitis vinifera
ref|XP_009372874.1|  PREDICTED: peroxisomal membrane protein 11B-...    322   1e-107   
ref|XP_006490123.1|  PREDICTED: peroxisomal membrane protein 11B-...    322   2e-107   
ref|XP_008376412.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...    321   3e-107   
ref|XP_006421658.1|  hypothetical protein CICLE_v10005804mg             321   5e-107   
ref|XP_009370462.1|  PREDICTED: peroxisomal membrane protein 11B-...    320   1e-106   
gb|KFK34042.1|  hypothetical protein AALP_AA5G094200                    313   7e-104   
gb|KDP22427.1|  hypothetical protein JCGZ_26258                         312   7e-104   
ref|XP_008796086.1|  PREDICTED: peroxisomal membrane protein 11-4       312   9e-104   
ref|XP_007131465.1|  hypothetical protein PHAVU_011G015800g             310   6e-103   
ref|XP_011034001.1|  PREDICTED: peroxisomal membrane protein 11B-...    310   6e-103   
ref|XP_011018328.1|  PREDICTED: peroxisomal membrane protein 11B-...    309   2e-102   
ref|XP_011018324.1|  PREDICTED: peroxisomal membrane protein 11B-...    308   4e-102   
ref|XP_010692942.1|  PREDICTED: peroxisomal membrane protein 11-4       308   5e-102   
gb|ABK94819.1|  unknown                                                 308   5e-102   Populus trichocarpa [western balsam poplar]
ref|XP_002304410.1|  peroxisomal biogenesis factor 11 family protein    307   7e-102   Populus trichocarpa [western balsam poplar]
ref|NP_001146842.1|  peroxisomal biogenesis factor 11 family protein    305   4e-101   Zea mays [maize]
ref|XP_006368221.1|  peroxisomal biogenesis factor 11 family protein    305   4e-101   
ref|XP_010547823.1|  PREDICTED: peroxisomal membrane protein 11B        305   7e-101   
ref|XP_006404380.1|  hypothetical protein EUTSA_v10010697mg             302   9e-100   
ref|XP_006652577.1|  PREDICTED: peroxisomal membrane protein 11-4...    301   1e-99    
ref|XP_009384467.1|  PREDICTED: peroxisomal membrane protein 11-4       301   1e-99    
ref|XP_003580226.1|  PREDICTED: peroxisomal membrane protein 11-4       300   4e-99    
ref|NP_001053418.1|  Os04g0534600                                       300   4e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446856.1|  hypothetical protein SORBIDRAFT_06g023730          300   7e-99    Sorghum bicolor [broomcorn]
gb|EAZ31457.1|  hypothetical protein OsJ_15594                          298   2e-98    Oryza sativa Japonica Group [Japonica rice]
gb|KEH17629.1|  peroxisomal biogenesis factor 11 family protein         292   5e-96    
ref|XP_004976360.1|  PREDICTED: peroxisomal membrane protein 11-4...    292   7e-96    
ref|NP_190327.1|  peroxisomal membrane protein 11B                      291   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291796.1|  hypothetical protein CARUB_v10017971mg             291   2e-95    
ref|XP_010503343.1|  PREDICTED: peroxisomal membrane protein 11B        291   3e-95    
ref|XP_010426184.1|  PREDICTED: peroxisomal membrane protein 11B-...    290   4e-95    
ref|XP_010515049.1|  PREDICTED: peroxisomal membrane protein 11B-...    290   5e-95    
ref|XP_002875839.1|  peroxisomal biogenesis factor 11 family protein    288   2e-94    
ref|XP_008667879.1|  PREDICTED: peroxisomal biogenesis factor 11 ...    290   3e-94    
dbj|BAK06013.1|  predicted protein                                      287   6e-94    
ref|XP_009149915.1|  PREDICTED: peroxisomal membrane protein 11B        286   2e-93    
emb|CDY47414.1|  BnaCnng15230D                                          280   3e-91    
emb|CDX99049.1|  BnaA06g17400D                                          280   3e-91    
gb|EMT08002.1|  Peroxisomal membrane protein 11-4                       268   1e-86    
ref|XP_001755217.1|  predicted protein                                  267   7e-86    
gb|KHN46501.1|  Peroxisomal membrane protein 11B                        264   4e-85    
gb|EPS60156.1|  peroxisomal biogenesis factor 11 family protein         254   5e-81    
ref|XP_002994448.1|  hypothetical protein SELMODRAFT_138612             253   2e-80    
ref|XP_002972102.1|  hypothetical protein SELMODRAFT_96286              252   5e-80    
ref|XP_001773175.1|  predicted protein                                  232   3e-72    
ref|XP_001757043.1|  predicted protein                                  222   2e-68    
gb|EMS64743.1|  hypothetical protein TRIUR3_02525                       122   2e-31    
ref|XP_008444688.1|  PREDICTED: peroxisomal membrane protein 11A        121   2e-29    
ref|XP_004152708.1|  PREDICTED: peroxisomal membrane protein 11A-...    121   2e-29    
ref|XP_005643088.1|  peroxisomal biogenesis factor 11                   119   1e-28    
ref|XP_004160026.1|  PREDICTED: peroxisomal membrane protein 11A-...    118   2e-28    
ref|XP_007160778.1|  hypothetical protein PHAVU_001G016000g             116   5e-27    
ref|XP_004291898.1|  PREDICTED: peroxisomal membrane protein 11A-...    112   9e-26    
ref|XP_009411642.1|  PREDICTED: peroxisomal membrane protein 11-3       111   9e-26    
ref|XP_003550370.1|  PREDICTED: peroxisomal membrane protein 11A-...    110   2e-25    
ref|XP_008807760.1|  PREDICTED: peroxisomal membrane protein 11-3...    110   2e-25    
gb|KHN12727.1|  Peroxisomal membrane protein 11A                        110   2e-25    
gb|KEH40100.1|  peroxisomal biogenesis factor 11 family protein         110   3e-25    
ref|XP_003544424.1|  PREDICTED: peroxisomal membrane protein 11A-...    110   3e-25    
ref|XP_009364643.1|  PREDICTED: peroxisomal membrane protein 11A-...    109   8e-25    
ref|XP_008347423.1|  PREDICTED: peroxisomal membrane protein 11A-...    108   2e-24    
ref|XP_009365575.1|  PREDICTED: peroxisomal membrane protein 11A-...    108   2e-24    
ref|XP_008377400.1|  PREDICTED: peroxisomal membrane protein 11A-...    107   3e-24    
ref|XP_010106027.1|  Peroxisomal membrane protein 11A                   107   3e-24    
ref|XP_007226019.1|  hypothetical protein PRUPE_ppa010125mg             107   3e-24    
ref|XP_002955780.1|  hypothetical protein VOLCADRAFT_66153              105   9e-24    
ref|XP_008357176.1|  PREDICTED: peroxisomal membrane protein 11A-...    106   1e-23    
ref|XP_006854415.1|  hypothetical protein AMTR_s00039p00202880          105   1e-23    
ref|NP_001150920.1|  peroxisomal biogenesis factor 11 family protein    105   2e-23    Zea mays [maize]
ref|XP_004984653.1|  PREDICTED: peroxisomal membrane protein 11-3...    104   3e-23    
ref|XP_001694061.1|  predicted protein                                  103   4e-23    Chlamydomonas reinhardtii
ref|XP_008220763.1|  PREDICTED: peroxisomal membrane protein 11A        104   5e-23    
ref|XP_004499131.1|  PREDICTED: peroxisomal membrane protein 11A-...    103   2e-22    
ref|XP_009145032.1|  PREDICTED: peroxisomal membrane protein 11A-...    102   2e-22    
ref|XP_010690954.1|  PREDICTED: peroxisomal membrane protein 11A        102   2e-22    
ref|XP_010027036.1|  PREDICTED: peroxisomal membrane protein 11A        102   5e-22    
ref|XP_002302475.2|  hypothetical protein POPTR_0002s13510g             102   5e-22    Populus trichocarpa [western balsam poplar]
gb|KDP38472.1|  hypothetical protein JCGZ_04397                         102   7e-22    
ref|XP_011017298.1|  PREDICTED: peroxisomal membrane protein 11A-...    100   8e-22    
ref|XP_006393523.1|  hypothetical protein EUTSA_v10011736mg             100   1e-21    
ref|XP_007017468.1|  Peroxin 11A isoform 1                              100   2e-21    
ref|XP_010543082.1|  PREDICTED: peroxisomal membrane protein 11A ...    100   2e-21    
ref|XP_002510349.1|  peroxisomal biogenesis factor, putative            100   2e-21    Ricinus communis
ref|XP_002467997.1|  hypothetical protein SORBIDRAFT_01g037780        99.4    3e-21    Sorghum bicolor [broomcorn]
ref|XP_010905683.1|  PREDICTED: peroxisomal membrane protein 11-3...  99.4    4e-21    
gb|KFM25604.1|  Peroxisomal membrane protein 11A                      98.6    4e-21    
ref|XP_007017469.1|  Peroxin 11A isoform 2                            98.2    5e-21    
emb|CDY25676.1|  BnaC05g25550D                                        97.1    1e-20    
gb|EPS72971.1|  hypothetical protein M569_01784                       97.1    3e-20    
gb|KFK29076.1|  hypothetical protein AALP_AA7G085700                  96.7    3e-20    
ref|XP_009107407.1|  PREDICTED: peroxisomal membrane protein 11A      96.7    3e-20    
gb|KDO84453.1|  hypothetical protein CISIN_1g039694mg                 95.9    4e-20    
ref|XP_002281733.1|  PREDICTED: peroxisomal membrane protein 11A      96.3    4e-20    Vitis vinifera
ref|XP_002985810.1|  hypothetical protein SELMODRAFT_234888           95.9    4e-20    
ref|XP_006473464.1|  PREDICTED: peroxisomal membrane protein 11A-...  95.1    9e-20    
emb|CDY17001.1|  BnaA08g03650D                                        94.7    1e-19    
ref|XP_010479175.1|  PREDICTED: peroxisomal membrane protein 11A      94.7    1e-19    
ref|XP_006434939.1|  hypothetical protein CICLE_v10002211mg           94.7    1e-19    
ref|XP_011031523.1|  PREDICTED: peroxisomal membrane protein 11A-...  94.7    1e-19    
ref|XP_010320374.1|  PREDICTED: peroxisomal membrane protein 11A      94.4    2e-19    
ref|XP_006375076.1|  peroxisomal biogenesis factor 11 family protein  94.4    2e-19    
ref|XP_009608297.1|  PREDICTED: peroxisomal membrane protein 11A      93.6    3e-19    
ref|XP_009782199.1|  PREDICTED: peroxisomal membrane protein 11A      93.6    3e-19    
ref|XP_010461571.1|  PREDICTED: peroxisomal membrane protein 11A-...  93.2    4e-19    
gb|AID68437.1|  putative peroxisomal membrane protein 11A-like pr...  91.3    4e-19    
ref|XP_006305998.1|  hypothetical protein CARUB_v10011277mg           93.2    4e-19    
ref|XP_002984748.1|  hypothetical protein SELMODRAFT_121160           93.2    5e-19    
ref|XP_002281759.1|  PREDICTED: peroxisomal membrane protein 11A      93.2    5e-19    Vitis vinifera
ref|XP_010254932.1|  PREDICTED: peroxisomal membrane protein 11A      92.8    6e-19    
ref|XP_002894067.1|  peroxisomal biogenesis factor 11 family protein  92.0    1e-18    
ref|XP_001766434.1|  predicted protein                                91.7    1e-18    
ref|NP_001049868.1|  Os03g0302000                                     91.7    2e-18    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006367303.1|  PREDICTED: peroxisomal membrane protein 11A-...  91.7    2e-18    
emb|CBI19655.3|  unnamed protein product                              90.5    3e-18    
ref|XP_008807786.1|  PREDICTED: peroxisomal membrane protein 11A-...  90.9    4e-18    
ref|XP_011083729.1|  PREDICTED: peroxisomal membrane protein 11A      90.1    5e-18    
ref|NP_564514.1|  peroxisomal membrane protein 11A                    90.1    6e-18    Arabidopsis thaliana [mouse-ear cress]
gb|AAM60843.1|  unknown                                               89.7    6e-18    Arabidopsis thaliana [mouse-ear cress]
emb|CDP07555.1|  unnamed protein product                              89.4    1e-17    
ref|XP_010462528.1|  PREDICTED: peroxisomal membrane protein 11A-...  85.9    3e-17    
ref|XP_006651300.1|  PREDICTED: peroxisomal membrane protein 11-3...  87.0    4e-17    
gb|ABK21595.1|  unknown                                               84.7    4e-16    Picea sitchensis
gb|KDD72469.1|  peroxisomal biogenesis factor 11                      80.1    7e-15    
ref|XP_003561709.1|  PREDICTED: peroxisomal membrane protein 11-3     79.3    2e-14    
ref|XP_010905698.1|  PREDICTED: peroxisomal membrane protein 11-3...  75.5    8e-13    
ref|XP_010501868.1|  PREDICTED: peroxisomal membrane protein 11A-...  71.6    2e-11    
gb|EYU45116.1|  hypothetical protein MIMGU_mgv1a023225mg              70.5    2e-11    
gb|KHN20996.1|  Peroxisomal membrane protein 11A                      70.1    3e-11    
ref|NP_001173387.1|  Os03g0301950                                     68.6    1e-10    
dbj|GAM18062.1|  hypothetical protein SAMD00019534_012370             67.8    4e-10    
gb|EAY89667.1|  hypothetical protein OsI_11200                        67.0    4e-10    Oryza sativa Indica Group [Indian rice]
ref|XP_009044052.1|  hypothetical protein LOTGIDRAFT_208523           65.9    2e-09    
ref|XP_636138.1|  transmembrane protein                               64.7    4e-09    Dictyostelium discoideum AX4
ref|XP_006840348.1|  hypothetical protein AMTR_s00045p00107790        62.0    3e-08    
ref|XP_006649948.1|  PREDICTED: peroxisomal membrane protein 11-2...  62.0    4e-08    
gb|ACJ84112.1|  unknown                                               59.7    9e-08    Medicago truncatula
ref|XP_009389495.1|  PREDICTED: peroxisomal membrane protein 11-5...  60.1    1e-07    
ref|XP_787666.1|  PREDICTED: peroxisomal membrane protein 11B-like    60.1    2e-07    Strongylocentrotus purpuratus [purple urchin]
ref|XP_002503548.1|  predicted protein                                60.5    2e-07    Micromonas commoda
ref|XP_004350943.1|  transmembrane protein                            59.7    2e-07    
ref|XP_004343743.1|  predicted protein                                59.7    2e-07    
ref|XP_003623838.1|  Peroxisomal membrane protein 11-1                59.3    3e-07    
gb|AFK43968.1|  unknown                                               59.3    3e-07    
ref|XP_009138795.1|  PREDICTED: peroxisomal membrane protein 11E      58.9    4e-07    
gb|EYU32055.1|  hypothetical protein MIMGU_mgv1a012957mg              58.2    7e-07    
ref|XP_002131580.1|  PREDICTED: peroxisomal membrane protein 11A-...  57.4    1e-06    Ciona intestinalis [sea vase]
gb|KDP28689.1|  hypothetical protein JCGZ_14460                       57.8    1e-06    
ref|XP_005094067.1|  PREDICTED: peroxisomal membrane protein 11B-...  57.8    1e-06    
gb|EEE58900.1|  hypothetical protein OsJ_10529                        57.8    2e-06    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008795374.1|  PREDICTED: peroxisomal membrane protein 11D-...  56.2    3e-06    
ref|XP_002741558.1|  PREDICTED: peroxisomal membrane protein PMP2...  56.2    4e-06    Saccoglossus kowalevskii
ref|XP_005107819.1|  PREDICTED: peroxisomal membrane protein 11B-...  55.8    4e-06    
gb|AEI25543.1|  peroxin 11 alpha                                      56.2    4e-06    
ref|XP_010255528.1|  PREDICTED: peroxisomal membrane protein 11C-...  55.8    5e-06    
ref|XP_009758497.1|  PREDICTED: peroxisomal membrane protein 11C      55.8    5e-06    
ref|NP_001096590.1|  peroxisomal membrane protein 11A                 55.8    5e-06    Danio rerio [leopard danio]
gb|ABK26140.1|  unknown                                               55.5    7e-06    Picea sitchensis
ref|XP_006341731.1|  PREDICTED: peroxisomal membrane protein 11C-...  55.5    7e-06    
ref|XP_010518193.1|  PREDICTED: peroxisomal membrane protein 11D      55.5    7e-06    
ref|XP_011091593.1|  PREDICTED: peroxisomal membrane protein 11C      55.1    8e-06    
ref|NP_001056660.2|  Os06g0127000                                     55.1    9e-06    Oryza sativa Japonica Group [Japonica rice]
gb|ELU13421.1|  hypothetical protein CAPTEDRAFT_154211                54.7    1e-05    
ref|XP_009601682.1|  PREDICTED: peroxisomal membrane protein 11C      54.7    1e-05    
ref|XP_008375908.1|  PREDICTED: peroxisomal membrane protein 11D-...  54.7    1e-05    
gb|EMS58459.1|  Peroxisomal membrane protein 11-5                     55.5    1e-05    
emb|CDX74760.1|  BnaA05g05060D                                        54.7    1e-05    
ref|XP_002862253.1|  peroxisomal biogenesis factor 11 family protein  54.7    1e-05    
ref|XP_009761323.1|  PREDICTED: peroxisomal membrane protein 11D-...  54.7    1e-05    
ref|XP_004492683.1|  PREDICTED: peroxisomal membrane protein 11C-...  54.7    1e-05    
ref|XP_010053656.1|  PREDICTED: peroxisomal membrane protein 11D-...  54.3    2e-05    
ref|XP_009047711.1|  hypothetical protein LOTGIDRAFT_139407           54.3    2e-05    
gb|EMT21632.1|  Peroxisomal membrane protein 11-5                     55.1    2e-05    
ref|XP_006655734.1|  PREDICTED: peroxisomal membrane protein 11-5...  54.3    2e-05    
ref|XP_002880194.1|  peroxisomal biogenesis factor 11 family protein  54.3    2e-05    
ref|XP_009143164.1|  PREDICTED: peroxisomal membrane protein 11D-...  54.3    2e-05    
emb|CDQ72339.1|  unnamed protein product                              54.3    2e-05    
ref|XP_011093177.1|  PREDICTED: peroxisomal membrane protein 11C-...  53.9    2e-05    
ref|XP_010091543.1|  Peroxisomal membrane protein 11C                 53.9    2e-05    
ref|XP_006397755.1|  hypothetical protein EUTSA_v10001566mg           54.3    2e-05    
gb|EEC79907.1|  hypothetical protein OsI_21452                        54.3    3e-05    Oryza sativa Indica Group [Indian rice]
ref|XP_009142360.1|  PREDICTED: peroxisomal membrane protein 11D      53.9    3e-05    
ref|XP_006586626.1|  PREDICTED: uncharacterized protein LOC100499...  53.5    3e-05    
ref|XP_002602123.1|  hypothetical protein BRAFLDRAFT_97937            53.9    3e-05    Branchiostoma floridae
ref|XP_007051927.1|  Peroxin 11c isoform 1                            53.5    3e-05    
ref|XP_010540271.1|  PREDICTED: peroxisomal membrane protein 11C      53.5    3e-05    
ref|XP_010933889.1|  PREDICTED: peroxisomal membrane protein 11-5...  53.5    3e-05    
ref|XP_004229845.1|  PREDICTED: peroxisomal membrane protein 11D      53.5    3e-05    
ref|XP_006418462.1|  hypothetical protein EUTSA_v10008643mg           53.5    3e-05    
ref|XP_010506524.1|  PREDICTED: peroxisomal membrane protein 11D-...  53.5    3e-05    
ref|XP_006294921.1|  hypothetical protein CARUB_v10023974mg           53.5    3e-05    
emb|CDX95662.1|  BnaC03g25430D                                        53.1    4e-05    
ref|XP_009118837.1|  PREDICTED: peroxisomal membrane protein 11C      53.1    4e-05    
gb|KCW78000.1|  hypothetical protein EUGRSUZ_D02241                   52.0    4e-05    
ref|XP_009343541.1|  PREDICTED: peroxisomal membrane protein 11D-...  53.1    5e-05    
ref|XP_009104286.1|  PREDICTED: peroxisomal membrane protein 11E      53.1    5e-05    
ref|NP_001234463.1|  uncharacterized protein LOC543655                53.1    5e-05    
gb|KDO85998.1|  hypothetical protein CISIN_1g024612mg                 52.8    5e-05    
ref|XP_004133885.1|  PREDICTED: peroxisomal membrane protein 11D-...  52.8    6e-05    
ref|XP_003291200.1|  hypothetical protein DICPUDRAFT_49683            52.8    6e-05    
gb|ACG35424.1|  peroxisomal membrane protein PEX11-1                  52.8    6e-05    Zea mays [maize]
gb|KDO85999.1|  hypothetical protein CISIN_1g024612mg                 52.8    7e-05    
gb|AFW75334.1|  hypothetical protein ZEAMMB73_104531                  53.1    7e-05    
ref|NP_001131375.1|  peroxisomal membrane protein PEX11-1 isoform 1   52.4    7e-05    Zea mays [maize]
ref|XP_006445153.1|  hypothetical protein CICLE_v10022007mg           52.4    7e-05    
ref|XP_002511795.1|  peroxisomal biogenesis factor, putative          52.4    7e-05    Ricinus communis
ref|NP_001235577.1|  uncharacterized protein LOC100499755             52.4    7e-05    
ref|XP_004964390.1|  PREDICTED: peroxisomal membrane protein 11-5...  52.4    8e-05    
gb|ETI41008.1|  hypothetical protein F443_13717                       52.8    8e-05    
ref|XP_008894594.1|  hypothetical protein PPTG_03656                  52.8    8e-05    
gb|EYU35059.1|  hypothetical protein MIMGU_mgv1a012938mg              52.4    9e-05    
ref|XP_001752238.1|  predicted protein                                52.4    9e-05    
ref|XP_002465980.1|  hypothetical protein SORBIDRAFT_01g049450        52.4    9e-05    Sorghum bicolor [broomcorn]
emb|CDY18905.1|  BnaC04g04450D                                        52.4    9e-05    
ref|XP_008460171.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  52.0    1e-04    
ref|XP_003564336.1|  PREDICTED: peroxisomal membrane protein 11-5     52.0    1e-04    
emb|CDY37060.1|  BnaA04g26380D                                        52.0    1e-04    
ref|XP_004344055.1|  glycosomal membrane protein                      51.6    1e-04    
ref|XP_010899930.1|  PREDICTED: peroxisomal membrane protein 11A      52.0    1e-04    
ref|NP_566055.1|  peroxisomal membrane protein 11D                    51.6    1e-04    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523724.1|  PREDICTED: peroxisomal membrane protein 11D-...  51.6    2e-04    
emb|CDP08886.1|  unnamed protein product                              51.6    2e-04    
ref|XP_010512437.1|  PREDICTED: peroxisomal membrane protein 11E-...  51.6    2e-04    
emb|CDY45676.1|  BnaCnng13410D                                        51.6    2e-04    
ref|NP_001235755.1|  peroxisomal biogenesis factor 11 family protein  51.6    2e-04    
ref|XP_003475544.1|  PREDICTED: peroxisomal membrane protein 11A ...  51.6    2e-04    
gb|KFM27101.1|  Peroxisomal membrane protein 11-1                     51.2    2e-04    
ref|XP_004170621.1|  PREDICTED: peroxisomal membrane protein 11C-...  51.2    2e-04    
ref|XP_010544687.1|  PREDICTED: peroxisomal membrane protein 11D ...  51.2    2e-04    
gb|AEX93433.1|  peroxin Pex11                                         51.2    2e-04    
ref|XP_004144983.1|  PREDICTED: peroxisomal membrane protein 11C-...  51.2    2e-04    
ref|XP_001824359.1|  peroxin PEX11-2                                  51.2    2e-04    Aspergillus oryzae RIB40
ref|XP_002273596.1|  PREDICTED: peroxisomal membrane protein 11C      50.8    2e-04    Vitis vinifera
emb|CDY38031.1|  BnaCnng08920D                                        51.6    3e-04    
ref|XP_006402523.1|  hypothetical protein EUTSA_v10006216mg           50.8    3e-04    
gb|EMS65426.1|  Peroxisomal membrane protein 11-1                     51.6    3e-04    
ref|XP_006339470.1|  PREDICTED: peroxisomal membrane protein 11C-...  50.4    3e-04    
ref|XP_004578373.1|  PREDICTED: peroxisomal membrane protein 11A      50.8    3e-04    
emb|CDY27363.1|  BnaC04g50420D                                        50.4    4e-04    
ref|XP_008365159.1|  PREDICTED: peroxisomal membrane protein 11D-...  49.3    4e-04    
ref|XP_011035325.1|  PREDICTED: peroxisomal membrane protein 11D      50.4    4e-04    
ref|XP_005148806.1|  PREDICTED: peroxisomal membrane protein 11A      50.4    4e-04    
ref|XP_009598453.1|  PREDICTED: peroxisomal membrane protein 11D      50.4    4e-04    
ref|XP_008438098.1|  PREDICTED: peroxisomal membrane protein 11D      50.4    4e-04    
dbj|GAD97544.1|  hypothetical protein ATEG_05891                      50.1    5e-04    
gb|KFM78352.1|  Peroxisomal membrane protein 11B                      50.4    5e-04    
ref|XP_007435313.1|  PREDICTED: peroxisomal membrane protein 11A ...  50.1    5e-04    
ref|XP_002889352.1|  peroxisomal biogenesis factor 11 family protein  50.1    5e-04    
ref|XP_002436385.1|  hypothetical protein SORBIDRAFT_10g001610        50.1    5e-04    Sorghum bicolor [broomcorn]
ref|XP_002110961.1|  expressed hypothetical protein                   50.1    5e-04    Trichoplax adhaerens
ref|XP_010413496.1|  PREDICTED: peroxisomal membrane protein 11E      50.1    5e-04    
ref|XP_010469126.1|  PREDICTED: peroxisomal membrane protein 11E      50.1    5e-04    
ref|XP_005537387.1|  hypothetical protein CYME_CMN269C                50.4    6e-04    
gb|AER13164.1|  peroxisomal biogenesis factor 11                      50.1    6e-04    
gb|KEQ71340.1|  peroxisomal biogenesis factor 11                      49.7    6e-04    
ref|XP_006290379.1|  hypothetical protein CARUB_v10017960mg           49.7    7e-04    
ref|XP_010055228.1|  PREDICTED: peroxisomal membrane protein 11D      49.7    7e-04    
gb|KCW77996.1|  hypothetical protein EUGRSUZ_D02241                   49.7    7e-04    
emb|CAG13099.1|  unnamed protein product                              49.7    8e-04    
ref|XP_005381602.1|  PREDICTED: peroxisomal membrane protein 11A      49.7    8e-04    
ref|XP_004344731.1|  PHD-finger domain containing protein             50.4    8e-04    
ref|XP_002491415.1|  Peroxisomal membrane protein                     49.3    9e-04    
ref|XP_001637698.1|  predicted protein                                49.3    0.001    



>ref|XP_004235161.1| PREDICTED: peroxisomal membrane protein 11B [Solanum lycopersicum]
Length=224

 Score =   356 bits (914),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 187/226 (83%), Positives = 207/226 (92%), Gaps = 4/226 (2%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNW +E ++P+LA RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWHVETTYPDLATRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GR LTGFNALRRSPG TP FRLLA+LANSGEMVYFFFDH LWL+RIGV+D K A+RM
Sbjct  61   FRTGRSLTGFNALRRSPGTTPGFRLLAVLANSGEMVYFFFDHFLWLARIGVIDGKYAKRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGESVGYVFFVISDFILI+RG++AERKL    + EE +++E+IKKIR DR+MRLM
Sbjct  121  SFISAFGESVGYVFFVISDFILITRGLKAERKL----LIEEKDSKEEIKKIRMDRIMRLM  176

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             VAANIADLIIALA+IEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  177  GVAANIADLIIALAEIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  222



>ref|XP_006358254.1| PREDICTED: peroxisomal membrane protein 11B-like [Solanum tuberosum]
Length=225

 Score =   352 bits (904),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 207/228 (91%), Gaps = 5/228 (2%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNW +E ++P++A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWHVETTYPDIATRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GR LTGFNALRRSPG +P FRLLA+LANSGEMVYFFFDH LWL+RIGV+DPK A+RM
Sbjct  61   FRTGRSLTGFNALRRSPGTSPGFRLLAVLANSGEMVYFFFDHFLWLARIGVIDPKYAKRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEED--ENEEQIKKIRADRVMR  150
            SF+SAFGESVGYVFFVISDFILI+RG++AER+L    + E+D  E E +IKKIR DR+MR
Sbjct  121  SFISAFGESVGYVFFVISDFILITRGLKAERRLL---IEEKDSKETEGEIKKIRMDRIMR  177

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LM VAANIADLIIA+A+IEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  178  LMGVAANIADLIIAIAEIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  225



>ref|XP_004148144.1| PREDICTED: peroxisomal membrane protein 11-4-like [Cucumis sativus]
 ref|XP_004165036.1| PREDICTED: peroxisomal membrane protein 11-4-like [Cucumis sativus]
 gb|KGN57265.1| hypothetical protein Csa_3G175660 [Cucumis sativus]
Length=227

 Score =   349 bits (895),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E SHP+ A RAK WEVASG+SRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHLETSHPDKATRAKNWEVASGISRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRRSPG TP F+ LA+LAN+GEMVYFFFDH+LWLSRIG +D KLA++M
Sbjct  61   FRTGRFLTGFNALRRSPGSTPTFQFLAVLANAGEMVYFFFDHLLWLSRIGTLDAKLAKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKV-AEEDENEEQIKKIRADRVMRL  147
            SF+SAFGES GY+FF+++D I++ RGI+AERKLR SK  ++ED  EE I KI++DR+MRL
Sbjct  121  SFISAFGESFGYIFFIVADVIMLKRGIEAERKLRSSKEDSKEDSKEESINKIKSDRIMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+ADLII LA+IEPNPFC HT+TLGISGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADLIIGLAEIEPNPFCNHTITLGISGLVSAWAGWYRNWPS  227



>ref|XP_009596076.1| PREDICTED: peroxisomal membrane protein 11-4 [Nicotiana tomentosiformis]
Length=225

 Score =   348 bits (894),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 206/226 (91%), Gaps = 1/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNW +EK++PE A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWHVEKTYPEFATRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRRSPG +  FRLLA+LANSGEMVYFFFDH LWLSRIGV+D K A+RM
Sbjct  61   FRSGRFLTGFNALRRSPGTSSGFRLLAVLANSGEMVYFFFDHFLWLSRIGVMDSKYAKRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGESVGYVFF+ISDFILISRG++AERKL  ++  E  E E +IKKIR DR+MRLM
Sbjct  121  SFISAFGESVGYVFFIISDFILISRGLKAERKLL-TEEEESKETEGEIKKIRMDRIMRLM  179

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAANIADLIIALA+IEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  180  AVAANIADLIIALAEIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  225



>ref|XP_009796988.1| PREDICTED: peroxisomal membrane protein 11-4 [Nicotiana sylvestris]
Length=225

 Score =   346 bits (887),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 189/226 (84%), Positives = 205/226 (91%), Gaps = 1/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNW  EK++PE A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWHAEKTYPEFATRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRRSPG +  FRLLA+LANSGEMVYFFFDH LWLSRIGV+D K A+RM
Sbjct  61   FRSGRFLTGFNALRRSPGTSSGFRLLAVLANSGEMVYFFFDHFLWLSRIGVMDSKYAKRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGESVGYVFF+ISDFILISRG++AERKL  ++  E  E E +IKKIR DR+MRLM
Sbjct  121  SFISAFGESVGYVFFIISDFILISRGLKAERKLL-TEEEEPKETEGEIKKIRMDRIMRLM  179

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAANIADLIIALA+IEPNPFC HT+TLGISGLVSAWAGWYRNWPS
Sbjct  180  AVAANIADLIIALAEIEPNPFCNHTLTLGISGLVSAWAGWYRNWPS  225



>ref|XP_002510956.1| peroxisomal biogenesis factor, putative [Ricinus communis]
 gb|EEF51558.1| peroxisomal biogenesis factor, putative [Ricinus communis]
Length=226

 Score =   345 bits (885),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLV+FLAKRDGIDKLVKTFQYVSKLVNW  E  HPE+A R K WEVASGLSRKA
Sbjct  1    MNDTVDKLVVFLAKRDGIDKLVKTFQYVSKLVNWHAESKHPEIAQRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR PG +  FR LA+LAN+GEMVYFFFDH LWLSRIG +D KLA+RM
Sbjct  61   FRTGRFLTGFNALRRGPGSSTTFRFLAVLANAGEMVYFFFDHFLWLSRIGTLDAKLAKRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GY+FFVI+DFI+I  GI+ ERKL  +K  +  E +E IKKIRADRVMRLM
Sbjct  121  SFISAFGESFGYIFFVIADFIMIREGIRKERKLVSTKEDDPKEVQENIKKIRADRVMRLM  180

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAANIADLIIALA+IEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  181  AVAANIADLIIALAEIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  226



>ref|XP_008439086.1| PREDICTED: peroxisomal membrane protein 11B [Cucumis melo]
Length=223

 Score =   345 bits (884),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 202/226 (89%), Gaps = 3/226 (1%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIF AKRDGIDKLVKTFQYVSKLV+W +E SHP+ A RAK WEVASG+SRKA
Sbjct  1    MNDTVDKLVIFFAKRDGIDKLVKTFQYVSKLVHWHLETSHPDKATRAKNWEVASGISRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRRSPG TP F+ LA+LAN+GEMVYFFFDH+LWLSRIG +D KLA++M
Sbjct  61   FRTGRFLTGFNALRRSPGSTPMFQFLAVLANAGEMVYFFFDHLLWLSRIGTLDAKLAKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GY+FF+++D I++ +GI+AERKLR SK   ED  EE I KI++DR+MRLM
Sbjct  121  SFISAFGESFGYIFFIVADVIMLKQGIEAERKLRSSK---EDSKEESINKIKSDRIMRLM  177

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADLII LA+IEPNPFC HT+TLGISGLVSAWAGWYRNWPS
Sbjct  178  AVAANVADLIIGLAEIEPNPFCNHTITLGISGLVSAWAGWYRNWPS  223



>ref|XP_002267934.1| PREDICTED: peroxisomal membrane protein 11B [Vitis vinifera]
 emb|CBI24599.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   342 bits (878),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 200/227 (88%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E +HP+ AH+AK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEAAHPDAAHKAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRR+PG TP FR LA+LAN+GEMVYFFFDH LWLSRIGV+D KLARRM
Sbjct  61   FRSGRFLTGFNALRRNPGSTPTFRFLAVLANAGEMVYFFFDHFLWLSRIGVLDAKLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKL-RHSKVAEEDENEEQIKKIRADRVMRL  147
            SF+SAFGES GY+FF+ISDFI+I  G++ ERKL   S     D+ +  ++KIR DRVMRL
Sbjct  121  SFISAFGESFGYIFFIISDFIMIKGGVEQERKLITTSTDKSTDDVKASVRKIREDRVMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+ADLIIA+ADIEPNPFC H V+LGISGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADLIIAVADIEPNPFCNHAVSLGISGLVSAWAGWYRNWPS  227



>ref|XP_010089678.1| Peroxisomal membrane protein 11B [Morus notabilis]
 gb|EXC36301.1| Peroxisomal membrane protein 11B [Morus notabilis]
Length=228

 Score =   342 bits (878),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 201/228 (88%), Gaps = 2/228 (1%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLV+FLAKRDGIDKLVKTFQYVSKLV+W +E ++P +A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVVFLAKRDGIDKLVKTFQYVSKLVHWHVEATNPGVAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRR+PG TP FR LA+LAN+GEMVYFFFDHILWLSRIG +D K A++M
Sbjct  61   FRSGRFLTGFNALRRNPGNTPGFRFLAVLANAGEMVYFFFDHILWLSRIGTLDAKWAKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENE--EQIKKIRADRVMR  150
            SFVSAFGES GYVFF+ISDFILI +GIQ ERKL H    +ED  +  E+I+KI+ DRVMR
Sbjct  121  SFVSAFGESFGYVFFIISDFILIKQGIQTERKLVHGLDNKEDNKDVSERIRKIKVDRVMR  180

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LMAVAAN+ADLIIALA+IEPNPFC H VTLGISGLVSAW GWYRNWPS
Sbjct  181  LMAVAANVADLIIALAEIEPNPFCNHAVTLGISGLVSAWGGWYRNWPS  228



>ref|XP_011076372.1| PREDICTED: peroxisomal membrane protein 11B [Sesamum indicum]
Length=225

 Score =   341 bits (875),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 201/226 (89%), Gaps = 1/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +EK+HP+ A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEKTHPDAATRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRR+PG T  FRLLA+L+N+GEMVYFFFDH LWLSRIGV+D KLARRM
Sbjct  61   FRSGRFLTGFNALRRNPGTTTTFRLLAVLSNAGEMVYFFFDHFLWLSRIGVLDAKLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GY+FF++SD ILI  GI+AER++  S    ED ++ +IK IR DRVMRLM
Sbjct  121  SFISAFGESFGYIFFMVSDIILIQEGIKAERRIVKSGDESED-SKGKIKNIRGDRVMRLM  179

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADLIIALADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  180  AVAANLADLIIALADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  225



>ref|XP_007038379.1| Peroxisomal membrane protein 11B [Theobroma cacao]
 gb|EOY22880.1| Peroxisomal membrane protein 11B [Theobroma cacao]
Length=226

 Score =   341 bits (874),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 204/228 (89%), Gaps = 4/228 (2%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W++E +HP++A+R K WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWQVETTHPDIANRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRR+PG +P F+ LA+LAN+GEMVYFFFDH LWLSRIG +D KLARRM
Sbjct  61   FRSGRFLTGFNALRRNPGSSPTFKFLAVLANAGEMVYFFFDHFLWLSRIGTLDAKLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIK--KIRADRVMR  150
            SF+SAFGES GY+FF++SDFI++  G++AERKL    +AEED  + ++K   IRADRVMR
Sbjct  121  SFISAFGESFGYIFFIVSDFIIMKEGLEAERKL--IALAEEDSKDAKVKIRSIRADRVMR  178

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LMAVAANIADLIIALADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  179  LMAVAANIADLIIALADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  226



>emb|CDP05337.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   338 bits (867),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 201/231 (87%), Gaps = 6/231 (3%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E + PE+A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEATRPEIAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRR+PG TP  + LA+LAN GEMVYFFFDH LWL+RIGV+D KLARRM
Sbjct  61   FRSGRFLTGFNALRRNPGSTPTLKFLAVLANGGEMVYFFFDHFLWLARIGVLDGKLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLR-----HSKVAEEDENEEQIKKIRADR  159
            SF+SAFGES GY+FF++SDFILI+ GI+AERKLR      SK A+E+     I KIR DR
Sbjct  121  SFISAFGESFGYIFFIVSDFILITEGIRAERKLRVVKEEGSKDAKEN-TSSGIMKIRVDR  179

Query  158  VMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            VMRLMAVAAN+ADL+IALADIEPNPFC H V+LGISGLVSAWAGWYRNWPS
Sbjct  180  VMRLMAVAANVADLVIALADIEPNPFCNHAVSLGISGLVSAWAGWYRNWPS  230



>ref|XP_007219516.1| hypothetical protein PRUPE_ppa022507mg [Prunus persica]
 gb|EMJ20715.1| hypothetical protein PRUPE_ppa022507mg [Prunus persica]
Length=227

 Score =   338 bits (866),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E  +PE+A RAK WEVASGLSRKAF
Sbjct  3    NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEAKNPEIAQRAKQWEVASGLSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GRFLTGFNALRRSPG TP  R LA+LAN+GEMVYFFFDH LWLSRIG ++P LAR+MS
Sbjct  63   RTGRFLTGFNALRRSPGSTPTLRFLAVLANAGEMVYFFFDHFLWLSRIGTLNPNLARKMS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMa  141
            F+SAFGES GY+FF+ISDFI +  G++AER+L   +    D+  E ++KIR+DRVMRLMA
Sbjct  123  FISAFGESFGYIFFIISDFIALKEGLEAERELAALEDKSTDKKIESLRKIRSDRVMRLMA  182

Query  140  vaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            VAAN+ADL IA+ADIEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  183  VAANVADLFIAVADIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  227



>ref|XP_010035030.1| PREDICTED: peroxisomal membrane protein 11-4 [Eucalyptus grandis]
 gb|KCW46295.1| hypothetical protein EUGRSUZ_K00161 [Eucalyptus grandis]
Length=234

 Score =   337 bits (863),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 205/234 (88%), Gaps = 8/234 (3%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MND+VDKLVIFLAKRDGIDKLVKTFQYVSKLV+W  E +HP++A RAK WEVASGLSRKA
Sbjct  1    MNDSVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHAESAHPDVAQRAKNWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRRSPGPTPAFRLL +LAN+GEM+YFFFDHILWLSRIG++D  LARRM
Sbjct  61   FRTGRFLTGFNALRRSPGPTPAFRLLGVLANAGEMIYFFFDHILWLSRIGMLDAALARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSK--------VAEEDENEEQIKKIR  168
            SFVSAFGES GY+FF+I DFI++  G++AER+LR             ++D  +E++ KIR
Sbjct  121  SFVSAFGESFGYIFFIIMDFIMLKEGLKAERELRRKAREKEAKDDDEDDDGAKERVAKIR  180

Query  167  ADRVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ADRVMRLMAVAAN+ADL+IA+ADIEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  181  ADRVMRLMAVAANLADLVIAVADIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  234



>ref|XP_010264265.1| PREDICTED: peroxisomal membrane protein 11-4 [Nelumbo nucifera]
Length=232

 Score =   335 bits (860),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 203/232 (88%), Gaps = 6/232 (3%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E +HP++A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVETTHPDIAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRR+PG T  FR LA+LAN+GEMVYFFFDH LWLSRIGV+D  LARRM
Sbjct  61   FRSGRFLTGFNALRRNPGSTLTFRFLAVLANAGEMVYFFFDHFLWLSRIGVIDAGLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERK----LRHSKVAEED--ENEEQIKKIRAD  162
            SF+SAFGE+ GYVFF+ISDFI++  G++A+R+    L+    ++E   E E+++++IRAD
Sbjct  121  SFISAFGEAFGYVFFIISDFIIMKEGLEAQRRISLQLKAGDTSKEKSMEMEQKVRQIRAD  180

Query  161  RVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            RVMRLMAVAAN+ADLIIALADIEPNPFC H V LGISGLVSAWAGWYRNWPS
Sbjct  181  RVMRLMAVAANVADLIIALADIEPNPFCNHAVILGISGLVSAWAGWYRNWPS  232



>gb|EYU31317.1| hypothetical protein MIMGU_mgv1a026827mg [Erythranthe guttata]
Length=224

 Score =   335 bits (858),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 199/226 (88%), Gaps = 2/226 (1%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            M+D VD+LVIFLAKRDGIDKLVKTFQYVSKLV+WR+E SHP  A RAK WEVASGLSRKA
Sbjct  1    MDDKVDRLVIFLAKRDGIDKLVKTFQYVSKLVHWRVENSHPRAADRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR+PGPT  FR LA+LAN+GEMVYFFFDH LWLSR+GV+D KLARRM
Sbjct  61   FRTGRFLTGFNALRRNPGPTATFRALAVLANAGEMVYFFFDHFLWLSRVGVLDAKLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SFVSAFGE+ GYVFF++SD+I+I  GI+AER++  S V  E +  + I+KIRADRVMRLM
Sbjct  121  SFVSAFGEAFGYVFFIVSDYIVIRDGIRAERRIVESGV--ESKEGDVIRKIRADRVMRLM  178

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             VAAN+ADL+IALADIEPNP C H VTLGISGLVSAWAGWYRNWPS
Sbjct  179  GVAANVADLVIALADIEPNPVCNHAVTLGISGLVSAWAGWYRNWPS  224



>ref|XP_008234408.1| PREDICTED: peroxisomal membrane protein 11B [Prunus mume]
Length=228

 Score =   334 bits (856),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 196/226 (87%), Gaps = 1/226 (0%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E  +PE+A RAK WEVASGLSRKAF
Sbjct  3    NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEPKNPEIAQRAKQWEVASGLSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GRFLTGFNALRRSPG TP  R LA+LAN+GEMVYFFFDH LWLSRIG ++P LAR+MS
Sbjct  63   RTGRFLTGFNALRRSPGSTPTLRFLAVLANAGEMVYFFFDHFLWLSRIGTLNPNLARKMS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRH-SKVAEEDENEEQIKKIRADRVMRLM  144
            F+SAFGES GY+FF+ISDFI +  G++AERKL         D+  E ++KIR+DRVMRLM
Sbjct  123  FISAFGESFGYIFFIISDFIALKEGLEAERKLGALEDNKSRDKKIESLRKIRSDRVMRLM  182

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADL IA+ADIEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  183  AVAANVADLFIAVADIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  228



>ref|XP_010933678.1| PREDICTED: peroxisomal membrane protein 11-4 [Elaeis guineensis]
Length=220

 Score =   333 bits (855),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 198/226 (88%), Gaps = 6/226 (3%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            M DTVDKLV+FLAKRDGIDKLVKTFQYVSKLV+W +E +H ++A RAK WEVASGLSRKA
Sbjct  1    MTDTVDKLVVFLAKRDGIDKLVKTFQYVSKLVHWHVEATHQDIAKRAKNWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR+PG TP FR LA+ AN+GEMVYFFFDH LWLSRIGV+D  LARRM
Sbjct  61   FRTGRFLTGFNALRRNPGSTPLFRFLAVFANAGEMVYFFFDHFLWLSRIGVIDANLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            S++SAFGE++GYVFF+I DF++I +G+  +RKL      E  EN+EQ++KIR DRVMRLM
Sbjct  121  SYISAFGEALGYVFFIIMDFLMIKKGLVEQRKL------EAAENKEQVRKIRDDRVMRLM  174

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAANIADL+IALADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  175  AVAANIADLVIALADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  220



>ref|XP_004506346.1| PREDICTED: peroxisomal membrane protein 11B-like [Cicer arietinum]
Length=227

 Score =   331 bits (849),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 202/227 (89%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MND VDKLVIFLAKRDGIDKLVKTFQYVSKLVNW++E +HP+++ R K WEVASGLSRKA
Sbjct  1    MNDRVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWKVEATHPDISKRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFN LRR+PG T   RLLA+L+N+GEMVYFFFDH LWLSRIG +D  LA++M
Sbjct  61   FRTGRFLTGFNGLRRNPGSTQTLRLLAVLSNAGEMVYFFFDHFLWLSRIGTLDANLAKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEE-DENEEQIKKIRADRVMRL  147
            S++SAFGE+VGYVFF+I+DFIL+  G++ E++LR S+  E+ +ENE+ I++IR DR+MRL
Sbjct  121  SYISAFGEAVGYVFFIIADFILLKEGLKEEKQLRSSEGKEKSEENEKVIQRIRNDRIMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+ADLIIALA+IEPNP C HT++LGISGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADLIIALAEIEPNPLCNHTISLGISGLVSAWAGWYRNWPS  227



>ref|XP_004307814.1| PREDICTED: peroxisomal membrane protein 11B-like [Fragaria vesca 
subsp. vesca]
Length=226

 Score =   330 bits (847),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E ++P++A R K WEV+SGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVESTNPKMAERFKQWEVSSGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNA+RRSPG TP  R LA+LAN+GEM+YFFFDH LWLS+IG +DP LAR+M
Sbjct  61   FRTGRFLTGFNAMRRSPGSTPTLRFLAVLANAGEMIYFFFDHFLWLSKIGTLDPSLARKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GY+FF++SDFI +  G++ ERK+   +    ++  E ++KIR+DRVMRLM
Sbjct  121  SFISAFGESFGYIFFIVSDFIALKEGLEQERKVMSLEDKSIEKKNESLRKIRSDRVMRLM  180

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADL IALADIEPNPFC HTVTLGISGLVSAW+GWYRNWPS
Sbjct  181  AVAANVADLFIALADIEPNPFCNHTVTLGISGLVSAWSGWYRNWPS  226



>ref|XP_008354198.1| PREDICTED: peroxisomal membrane protein 11B-like [Malus domestica]
Length=226

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSK+ +W  E  +PE+A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKIAHWHAEAKNPEIAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRRSPG TP  R LA+LAN+GEMVYFFFDH LWLSRIG ++P LAR+M
Sbjct  61   FRTGRFLTGFNALRRSPGSTPTLRFLAVLANAGEMVYFFFDHFLWLSRIGTLNPNLARKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GYVFF++ DFI +  G++ E+K+   +    +   E ++KIRADRVMRLM
Sbjct  121  SFISAFGESFGYVFFIVLDFIALKEGVETEKKVAALEDKSAETKSESLRKIRADRVMRLM  180

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADLII +ADIEPNPFC H VTLGISGLVSAW+GWYRNWPS
Sbjct  181  AVAANVADLIIGIADIEPNPFCNHAVTLGISGLVSAWSGWYRNWPS  226



>ref|XP_008376049.1| PREDICTED: peroxisomal membrane protein 11B-like [Malus domestica]
Length=226

 Score =   328 bits (841),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSK+ +W  E  +PE+A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKIAHWHAEAKNPEIAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRRSPG TP  R LA+LAN+GEMVYFFFDH LWLSRIG ++P LAR+M
Sbjct  61   FRTGRFLTGFNALRRSPGSTPTLRFLAVLANAGEMVYFFFDHFLWLSRIGTLNPNLARKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GYVFF++ DFI +  G++ E+K+   +    +   E ++KIRADRVMRLM
Sbjct  121  SFISAFGESFGYVFFIVLDFIALKEGVEXEKKVAALEDKSAETKSESLRKIRADRVMRLM  180

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADLII +ADIEPNPFC H VTLGISGLVSAW+GWYRNWPS
Sbjct  181  AVAANVADLIIGIADIEPNPFCNHAVTLGISGLVSAWSGWYRNWPS  226



>ref|XP_009374473.1| PREDICTED: peroxisomal membrane protein 11B-like [Pyrus x bretschneideri]
 ref|XP_009340571.1| PREDICTED: peroxisomal membrane protein 11B-like [Pyrus x bretschneideri]
Length=226

 Score =   327 bits (837),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 191/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSK+ +W  E  +PE+A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKIAHWHAEAKNPEVAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRRSPG  P  R LA+LAN+GEMVYFFFDH LWLSRIG ++P LAR+M
Sbjct  61   FRTGRFLTGFNALRRSPGSNPTLRFLAVLANAGEMVYFFFDHFLWLSRIGTLNPNLARKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GYVFF++ DFI +  G +AE+K+   +    +   E ++KIRADRVMRLM
Sbjct  121  SFISAFGESFGYVFFIVLDFIALKEGAEAEKKVAALEDKSAETKSESLRKIRADRVMRLM  180

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADLII +ADIEPNPFC H VTLGISGLVSAW+GWYRNWPS
Sbjct  181  AVAANVADLIIGIADIEPNPFCNHAVTLGISGLVSAWSGWYRNWPS  226



>ref|XP_003534369.1| PREDICTED: peroxisomal membrane protein 11B-like [Glycine max]
 gb|KHN11736.1| Peroxisomal membrane protein 11B [Glycine soja]
Length=223

 Score =   326 bits (836),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 199/226 (88%), Gaps = 3/226 (1%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MND+VDKLVIFLAKRDGIDK+VKTFQYVSKLVNW +E +  +++ R K WEVASGLSRKA
Sbjct  1    MNDSVDKLVIFLAKRDGIDKVVKTFQYVSKLVNWHVEGTQADISRRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFL+GFN LRR+PG T + RLLA+LAN+GEMVYFFFDH LWL+RIG +D  LA++M
Sbjct  61   FRTGRFLSGFNVLRRNPGSTLSLRLLAVLANAGEMVYFFFDHFLWLARIGTIDASLAKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGESVGYVFF+I+DFI++  GI+A+R+L  SK   E+E +  I+KIR+DR+MRLM
Sbjct  121  SFISAFGESVGYVFFIIADFIMLKEGIKAQRELSSSK---EEEIKIGIQKIRSDRIMRLM  177

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADL IA+A+IEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  178  AVAANVADLFIAIAEIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  223



>ref|XP_003539968.1| PREDICTED: peroxisomal membrane protein 11B-like [Glycine max]
Length=228

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 201/228 (88%), Gaps = 2/228 (1%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MND+VDKLVIFLAKRDGIDKLVKTFQYVSKLVNW +E +HP+ + R K WEVASGLSRKA
Sbjct  1    MNDSVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWHVEATHPDTSKRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFN LRR+PG T + RLLA+L+N+GEMVYFFFDH LWL+RIG +D  LA++M
Sbjct  61   FRTGRFLTGFNVLRRNPGSTLSLRLLAVLSNAGEMVYFFFDHFLWLARIGTIDASLAKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQ--IKKIRADRVMR  150
            SF+SAFGESVGYVFF+I+DFI++  G++AERKLR S   E+ E EE+  I KIR+DR+MR
Sbjct  121  SFISAFGESVGYVFFIIADFIMLKEGLKAERKLRRSSSKEKSEEEEKAVILKIRSDRIMR  180

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LMAVAAN+ADL IA+A+IEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  181  LMAVAANLADLFIAIAEIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  228



>emb|CAN67008.1| hypothetical protein VITISV_028688 [Vitis vinifera]
Length=227

 Score =   323 bits (827),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 197/227 (87%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E +HP+ A  AK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEAAHPDAAXXAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRR+PG TP FR LA+LAN+GEMVYFFFDH LWLSRIGV+D KLA RM
Sbjct  61   FRSGRFLTGFNALRRNPGSTPTFRFLAVLANAGEMVYFFFDHFLWLSRIGVLDAKLAXRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKL-RHSKVAEEDENEEQIKKIRADRVMRL  147
            SF+SAFGES GY+FF+ISDFI+I  G++ ERKL   S     D+ +  ++KIR DRVMRL
Sbjct  121  SFISAFGESFGYIFFIISDFIMIKGGVEQERKLITTSTDKSTDDVKASVRKIREDRVMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+ADLIIA+ADIEPNPFC H V+LGISGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADLIIAVADIEPNPFCNHAVSLGISGLVSAWAGWYRNWPS  227



>ref|XP_009372874.1| PREDICTED: peroxisomal membrane protein 11B-like [Pyrus x bretschneideri]
Length=225

 Score =   322 bits (825),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 191/226 (85%), Gaps = 1/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQY+SK+ +W  E  +PE+A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYISKIAHWHAEAKNPEIAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRRSPG TP  R LA+LAN+GEMVYFFFDH LWLSRIG + P LA++M
Sbjct  61   FRTGRFLTGFNALRRSPGSTPTLRFLAVLANAGEMVYFFFDHFLWLSRIGTLSPNLAQKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GYVFF++ DFI +  G++AE+       + E ++ E ++KIR DRVMRLM
Sbjct  121  SFISAFGESFGYVFFIVLDFIALKEGVEAEKVAALEDTSAETKS-ESLRKIRGDRVMRLM  179

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADL+I +ADIEPNPFC H VTLGISGLVSAW+GWYRNWPS
Sbjct  180  AVAANVADLVIGIADIEPNPFCNHAVTLGISGLVSAWSGWYRNWPS  225



>ref|XP_006490123.1| PREDICTED: peroxisomal membrane protein 11B-like [Citrus sinensis]
 gb|KDO65512.1| hypothetical protein CISIN_1g027077mg [Citrus sinensis]
Length=228

 Score =   322 bits (825),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 196/226 (87%), Gaps = 1/226 (0%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E + PELA R K WEVASGLSRKAF
Sbjct  3    NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEATKPELAQRFKQWEVASGLSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GRFLTGFN LRR+PG TP  RLLA+LAN+GEMVY+ FDH+LWLSRIG +D K ARR+S
Sbjct  63   RTGRFLTGFNLLRRNPGATPTLRLLAVLANAGEMVYWSFDHLLWLSRIGTLDAKFARRLS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDEN-EEQIKKIRADRVMRLM  144
            F+SAFGES GYVFF+I+DFIL+ +G+  ER+L      E+ ++ EE ++KI+ DRVMRLM
Sbjct  123  FISAFGESFGYVFFIIADFILMKQGLAKERQLVAPDHEEKSKDVEESLRKIKVDRVMRLM  182

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADLIIALADIEPNPFC H VTLGISGLVSAW+GWYRNWPS
Sbjct  183  AVAANVADLIIALADIEPNPFCNHVVTLGISGLVSAWSGWYRNWPS  228



>ref|XP_008376412.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal membrane protein 
11B [Malus domestica]
Length=226

 Score =   321 bits (822),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQY+SK+ +W  E  +PE A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYISKIAHWHAEAKNPETAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRRSPG TP  R LA+LAN+GEMVYFFFDH LWLSRIG + P LA++M
Sbjct  61   FRTGRFLTGFNALRRSPGSTPTIRFLAVLANAGEMVYFFFDHFLWLSRIGTLSPNLAQKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GYVFF++ DFI +  G++AE+K+   +    +   E ++KIR DRVMRLM
Sbjct  121  SFISAFGESFGYVFFIVLDFIALKEGVEAEKKVAALEDKSAEMKSESLRKIRGDRVMRLM  180

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAANIADL+I +ADIEPNPFC H VTLGISGLVSAW+GW RNWPS
Sbjct  181  AVAANIADLVIGIADIEPNPFCNHAVTLGISGLVSAWSGWCRNWPS  226



>ref|XP_006421658.1| hypothetical protein CICLE_v10005804mg [Citrus clementina]
 gb|ESR34898.1| hypothetical protein CICLE_v10005804mg [Citrus clementina]
Length=228

 Score =   321 bits (822),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 196/226 (87%), Gaps = 1/226 (0%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E + PELA R K WEVASGLSRKAF
Sbjct  3    NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEATKPELAQRFKQWEVASGLSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GRFLTGFN LRR+PG TP  RLLA+LAN+GEMVY+ FDH+LWLSRIG +D K ARR+S
Sbjct  63   RTGRFLTGFNLLRRNPGATPTLRLLAVLANAGEMVYWSFDHLLWLSRIGTLDAKFARRLS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDEN-EEQIKKIRADRVMRLM  144
            F+SAFGES GYVFF+I+DFIL+ +G+  ER+L      E+ ++ EE ++KI+ DRVMRLM
Sbjct  123  FISAFGESFGYVFFIIADFILMKQGLAKERQLVAPDHEEKYKDVEESLRKIKVDRVMRLM  182

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADLIIALADIEPNPFC H VTLGISGLVSAW+GWYRNWPS
Sbjct  183  AVAANVADLIIALADIEPNPFCNHAVTLGISGLVSAWSGWYRNWPS  228



>ref|XP_009370462.1| PREDICTED: peroxisomal membrane protein 11B-like [Pyrus x bretschneideri]
Length=225

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 190/226 (84%), Gaps = 1/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQY+SK+ +W  E  +PE+A RAK WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYISKIAHWHAEAKNPEIAQRAKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFL GFNALRRSPG TP  R LA+LAN+GEMVYFFFDH LWLSRIG + P LA++M
Sbjct  61   FRTGRFLMGFNALRRSPGSTPTLRFLAVLANAGEMVYFFFDHFLWLSRIGTLSPNLAQKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GYVFF++ DFI +  G++AE+       + E ++ E ++KIR DRVMRLM
Sbjct  121  SFISAFGESFGYVFFIVLDFIALKEGVEAEKVAALEDTSAETKS-ESLRKIRGDRVMRLM  179

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADL+I +ADIEPNPFC H VTLGISGLVSAW+GWYRNWPS
Sbjct  180  AVAANVADLVIGIADIEPNPFCNHAVTLGISGLVSAWSGWYRNWPS  225



>gb|KFK34042.1| hypothetical protein AALP_AA5G094200 [Arabis alpina]
Length=227

 Score =   313 bits (801),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 190/224 (85%), Gaps = 0/224 (0%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            DTVDKLV+FLAKRDGIDKLVKTFQYVSKL  W +E + P+ A + K WEVASGLSRKAFR
Sbjct  4    DTVDKLVVFLAKRDGIDKLVKTFQYVSKLACWHVEATRPDAAEKFKKWEVASGLSRKAFR  63

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
            +GR LTGFNALRR+PG TP  R LA+LANSGEMVYFFFDH LWLSRIG +DPK+A+RMSF
Sbjct  64   TGRSLTGFNALRRNPGATPMIRFLAVLANSGEMVYFFFDHFLWLSRIGTLDPKIAKRMSF  123

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SAFGES GY+FF++ D I I + +Q+ +KLR+     ++E + +IK+IR D VMRLM +
Sbjct  124  ISAFGESFGYIFFIVIDCIFIRQRLQSLKKLRYPTDESKEEIDGKIKEIRGDIVMRLMGI  183

Query  137  aaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +ANIADL+IALA+IEPNPFC HT+TLGISGLVSAWAGWYRNWPS
Sbjct  184  SANIADLLIALAEIEPNPFCNHTITLGISGLVSAWAGWYRNWPS  227



>gb|KDP22427.1| hypothetical protein JCGZ_26258 [Jatropha curcas]
Length=225

 Score =   312 bits (800),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 200/226 (88%), Gaps = 1/226 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W  E + P++A+R K WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHAEATSPDIANRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNA+RRSPG +P FR L++LAN+GEMVYFFFDH LWLSRIG +D KLA++M
Sbjct  61   FRTGRFLTGFNAIRRSPGSSPGFRFLSVLANAGEMVYFFFDHFLWLSRIGTLDAKLAKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGES GY+FF+I+DFI+I  GI+AERKL  SK  +  E ++ I+KIRADR+MR M
Sbjct  121  SFISAFGESFGYIFFIIADFIIIKEGIRAERKLVSSK-EDSKEVKDNIRKIRADRIMRFM  179

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAANIADLII LA+IEPNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  180  AVAANIADLIIGLAEIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS  225



>ref|XP_008796086.1| PREDICTED: peroxisomal membrane protein 11-4 [Phoenix dactylifera]
Length=220

 Score =   312 bits (799),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 198/226 (88%), Gaps = 6/226 (3%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            M DTVDKLV+FLAKRDGIDKLVKTFQYVSKLV+W +E +HP++A RAK WEVASGLSRKA
Sbjct  1    MTDTVDKLVVFLAKRDGIDKLVKTFQYVSKLVHWHVEAAHPDIARRAKHWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFNALRR+PG  P FR LA+ AN+GEMVYFFFDH+LWLSRIGV+D  LARRM
Sbjct  61   FRSGRFLTGFNALRRNPGSAPLFRFLAVFANAGEMVYFFFDHLLWLSRIGVIDANLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            S++SAFGE++GYVFF+I +FI+I +G+  +RKL      E  ++EEQ++KIR DRVMRLM
Sbjct  121  SYISAFGEALGYVFFIIMEFIIIKKGLVEQRKL------EAMKDEEQVRKIRDDRVMRLM  174

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAANIADL+IALADI+PNPFC H  TLGISGLVSAWAGWYRNWPS
Sbjct  175  AVAANIADLVIALADIQPNPFCNHAATLGISGLVSAWAGWYRNWPS  220



>ref|XP_007131465.1| hypothetical protein PHAVU_011G015800g [Phaseolus vulgaris]
 gb|ESW03459.1| hypothetical protein PHAVU_011G015800g [Phaseolus vulgaris]
Length=225

 Score =   310 bits (794),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 200/225 (89%), Gaps = 1/225 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MND+VDKLVIFLAKRDGIDKLVKTFQYVSKLVNW +E + P+++ R K WEVASGLSRKA
Sbjct  1    MNDSVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWHVEATSPDISKRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR+PG T + RLLA+ AN+GEMVYFFFDH LWL+RIG +D  LA+RM
Sbjct  61   FRTGRFLTGFNALRRNPGATHSLRLLAVFANAGEMVYFFFDHFLWLARIGTIDVNLAKRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGESVGYVFF+I+DFI++ +G++ ERK+R S   + +E E++I++IR+DRVMRLM
Sbjct  121  SFISAFGESVGYVFFIIADFIMLRKGVKEERKVR-SCKEKTEEEEKRIEEIRSDRVMRLM  179

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWP  9
             VAAN+ADL+IA+A+IEPN FC HTVTLGISGLVSAWAGWYRNWP
Sbjct  180  GVAANVADLLIAVAEIEPNRFCNHTVTLGISGLVSAWAGWYRNWP  224



>ref|XP_011034001.1| PREDICTED: peroxisomal membrane protein 11B-like [Populus euphratica]
 ref|XP_011010839.1| PREDICTED: peroxisomal membrane protein 11B-like [Populus euphratica]
Length=227

 Score =   310 bits (794),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 197/227 (87%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV W++E +HP++A R K WEVASGL RKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVRWQVEATHPDVAERFKQWEVASGLGRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR PG TP F++LA+LAN+GEMVYFFFDH LWLSRIG +D KLA RM
Sbjct  61   FRTGRFLTGFNALRRGPGSTPTFKILAVLANAGEMVYFFFDHFLWLSRIGTLDAKLAGRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLR-HSKVAEEDENEEQIKKIRADRVMRL  147
            SF+SAFGES GY+FF+I+DFI+I +G++ ER+L   SK     +  E ++KIRADRVMRL
Sbjct  121  SFISAFGESFGYIFFIIADFIIIKQGLEEERRLLISSKEDTSKDATESLRKIRADRVMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+AD IIALADIEPNPFC H VTLG+SGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADFIIALADIEPNPFCNHAVTLGVSGLVSAWAGWYRNWPS  227



>ref|XP_011018328.1| PREDICTED: peroxisomal membrane protein 11B-like [Populus euphratica]
Length=227

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 197/227 (87%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E +HP+ A R K WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEATHPDAAMRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR PG TP  ++LA+LAN+GEMVYFFFDH LWLSRIG +D KLARRM
Sbjct  61   FRTGRFLTGFNALRRGPGATPTLKVLAVLANAGEMVYFFFDHFLWLSRIGTLDAKLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDEN-EEQIKKIRADRVMRL  147
            SF+SA GES GY+FF+I+DFI++  G++ ER+L  S   +  E+ +E  +KIRA+RVMRL
Sbjct  121  SFISALGESFGYIFFIIADFIIMKEGLETERRLLISSKEDGSEDAKESTRKIRAERVMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+ADLIIALADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADLIIALADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  227



>ref|XP_011018324.1| PREDICTED: peroxisomal membrane protein 11B-like [Populus euphratica]
Length=227

 Score =   308 bits (789),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 197/227 (87%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E +HP+ A R K WEVASGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEATHPDAAMRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR PG TP  ++LA+LAN+GEMVYFFFDH LWLSRIG +D KLARRM
Sbjct  61   FRTGRFLTGFNALRRGPGATPTLKVLAVLANAGEMVYFFFDHFLWLSRIGTLDAKLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDEN-EEQIKKIRADRVMRL  147
            SF+SA GES GY+FF+I+DFI++  G++ ER+L  S   +  E+ +E  +KI+A+RVMRL
Sbjct  121  SFISALGESFGYIFFIIADFIIMKEGLETERRLLISSKEDGSEDAKESTRKIKAERVMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+ADLIIALADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADLIIALADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  227



>ref|XP_010692942.1| PREDICTED: peroxisomal membrane protein 11-4 [Beta vulgaris subsp. 
vulgaris]
Length=234

 Score =   308 bits (789),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 195/233 (84%), Gaps = 9/233 (4%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            NDT+DKLVIFLAKRDGIDKLVKT+QYVSKL +W +++S P+LA R K WEVA+G+SRKAF
Sbjct  3    NDTLDKLVIFLAKRDGIDKLVKTYQYVSKLAHWHLDESQPDLARRFKQWEVAAGMSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            RSGR LTG N +RRSPGPT   R LA+L N+GEMVYFFFDH  WLSR+GV+D KLA++MS
Sbjct  63   RSGRSLTGLNLIRRSPGPTRGLRTLAVLGNAGEMVYFFFDHFTWLSRLGVLDTKLAKKMS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQ--------IKKIRA  165
            ++SAFGESVGYVFF+ISDFIL+  G++ E KL    + E D+ +E+        + KIR 
Sbjct  123  YISAFGESVGYVFFIISDFILMHEGLRKE-KLLLKGLNEGDQKKEEEVKELKEGVGKIRG  181

Query  164  DRVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            DRVMRLMAVAAN+ADLIIA+A+IEPNPFCCHT+TLGISGLVSAWAGWYRNWPS
Sbjct  182  DRVMRLMAVAANVADLIIAVAEIEPNPFCCHTLTLGISGLVSAWAGWYRNWPS  234



>gb|ABK94819.1| unknown [Populus trichocarpa]
Length=227

 Score =   308 bits (788),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 196/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVD+LVIFLAKRDGIDKLVKTFQYVSKLV W++E +HP++A R + WEVASGL RKA
Sbjct  1    MNDTVDRLVIFLAKRDGIDKLVKTFQYVSKLVRWQVEATHPDVARRFQQWEVASGLGRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR PG TP F++LA+LAN+GEMVYFFFDH LWLSRIG +D KLA RM
Sbjct  61   FRTGRFLTGFNALRRGPGSTPTFKILAVLANAGEMVYFFFDHFLWLSRIGTLDAKLAGRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERK-LRHSKVAEEDENEEQIKKIRADRVMRL  147
            SF+SAFGES GY+FF+I+DFI+I  G++ ER+ L  SK     +  E ++KIRADRVMRL
Sbjct  121  SFISAFGESFGYIFFIIADFIIIKEGLKQERRLLTSSKEDTSKDATESLRKIRADRVMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+AD IIALADIEPNPFC H VTLG+SGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADFIIALADIEPNPFCNHAVTLGVSGLVSAWAGWYRNWPS  227



>ref|XP_002304410.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa]
 gb|EEE79389.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa]
Length=227

 Score =   307 bits (787),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 196/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVD+LVIFLAKRDGIDKLVKTFQYVSKLV W++E +HP++A R + WEVASGL RKA
Sbjct  1    MNDTVDRLVIFLAKRDGIDKLVKTFQYVSKLVRWQVEATHPDVARRFQQWEVASGLGRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR PG TP F++LA+LAN+GEMVYFFFDH LWLSRIG +D KLA RM
Sbjct  61   FRTGRFLTGFNALRRGPGSTPTFKILAVLANAGEMVYFFFDHFLWLSRIGTLDAKLAGRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERK-LRHSKVAEEDENEEQIKKIRADRVMRL  147
            SF+SAFGES GY+FF+I+DFI+I  G++ ER+ L  SK     +  E ++KIRADRVMRL
Sbjct  121  SFISAFGESFGYIFFIIADFIIIKEGLKEERRLLTSSKEDTSKDATESLRKIRADRVMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+AD IIALADIEPNPFC H VTLG+SGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADFIIALADIEPNPFCNHAVTLGVSGLVSAWAGWYRNWPS  227



>ref|NP_001146842.1| peroxisomal biogenesis factor 11 family protein [Zea mays]
 gb|ACG23905.1| peroxisomal biogenesis factor 11 family protein [Zea mays]
 tpg|DAA36683.1| TPA: peroxisomal biogenesis factor 11 family protein [Zea mays]
Length=227

 Score =   305 bits (782),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 184/226 (81%), Gaps = 3/226 (1%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
             DT+DKLV+FLAKRDGIDKLVKTFQYVSKL +W  E S PELA RAK WE ASGLSRKAF
Sbjct  4    GDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWGAESSLPELAQRAKSWETASGLSRKAF  63

Query  500  RSGRFLTGFNALRRSPGPTPA-FRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            RSGRFL GFNALRR P P P     LA+LAN+GEMVYFFFDH  WLSR GV++P LARR 
Sbjct  64   RSGRFLAGFNALRRGPVPVPGELGALAVLANAGEMVYFFFDHFTWLSRAGVLEPWLARRA  123

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SFVSAFGE+VGYVFF+  DFI+I RG++ ER+L       +D  E+++++IR DRVMRLM
Sbjct  124  SFVSAFGEAVGYVFFIAMDFIMIRRGLRQERELLRE--GAKDAAEKEVRRIRVDRVMRLM  181

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            A AAN ADLIIA+A+ +PNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  182  ATAANAADLIIAVAETDPNPFCNHAVTLGISGLVSAWAGWYRNWPS  227



>ref|XP_006368221.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa]
 gb|ERP64790.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa]
Length=227

 Score =   305 bits (782),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV+W +E +HP+ A R K WEVASGL RKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVHWHVEATHPDAAMRFKQWEVASGLGRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR PG TP  ++LA+LAN+GEMVYFFFDH LWLSRIG +D KLARRM
Sbjct  61   FRTGRFLTGFNALRRGPGATPTLKVLAVLANAGEMVYFFFDHFLWLSRIGTLDAKLARRM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDEN-EEQIKKIRADRVMRL  147
            SF+SA GES GY+FF+I+DFI++  G++ ER+L  S   +  E+ +E  +KIR +RVMRL
Sbjct  121  SFISALGESFGYIFFIIADFIIMKEGLETERRLLISSKEDGSEDAKESTRKIRVERVMRL  180

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MAVAAN+ADLIIALADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  181  MAVAANVADLIIALADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  227



>ref|XP_010547823.1| PREDICTED: peroxisomal membrane protein 11B [Tarenaya hassleriana]
Length=224

 Score =   305 bits (780),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 187/227 (82%), Gaps = 4/227 (2%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            M+D VDKLV+FLAKRDGIDKLVKTFQYVSKL+ WR++   P L+ R K WEVASGLSRKA
Sbjct  1    MSDAVDKLVVFLAKRDGIDKLVKTFQYVSKLLCWRLQSKQPHLSLRFKHWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTG NALRRSPG TP FR L++LANSGEMVYFFFDH LWLSRIG++D  L+++M
Sbjct  61   FRTGRFLTGLNALRRSPGATPLFRFLSVLANSGEMVYFFFDHFLWLSRIGILDSSLSKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS-KVAEEDENEEQIKKIRADRVMRL  147
            SF+SAFGES GYVFF+  D I+I + +Q+ +KL  S K   E E   +IK    D VMRL
Sbjct  121  SFISAFGESFGYVFFIFIDCIVIRQRLQSAKKLPPSDKTLSEQEKASEIK---GDIVMRL  177

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            M ++ANIADLIIALA+IEPNPFCCH VTLGISGLVSAWAGWYRNWPS
Sbjct  178  MGISANIADLIIALAEIEPNPFCCHAVTLGISGLVSAWAGWYRNWPS  224



>ref|XP_006404380.1| hypothetical protein EUTSA_v10010697mg [Eutrema salsugineum]
 gb|ESQ45833.1| hypothetical protein EUTSA_v10010697mg [Eutrema salsugineum]
Length=226

 Score =   302 bits (773),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 188/224 (84%), Gaps = 1/224 (0%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            DTVDKLV+FLAKRDGIDKLVKTFQYV+KL  W +E + P+ A R K WEVASGLSRKAFR
Sbjct  4    DTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPDAAERFKKWEVASGLSRKAFR  63

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
            +GR LTGFNALRR+PG T   R LA+LANSGEMVYFFFDH LWLSRIG +DPK+A++MSF
Sbjct  64   TGRSLTGFNALRRNPGATRTIRFLAVLANSGEMVYFFFDHFLWLSRIGALDPKIAKKMSF  123

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SAFGES GYVFF++ D I I + +++ + LR +   +E E  E+I++IR D VMRLM +
Sbjct  124  ISAFGESFGYVFFIVIDCIFIRQRLKSLKTLRSNDEPKE-ETGEKIREIRGDIVMRLMGI  182

Query  137  aaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +AN+ADLIIALA+I+PNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  183  SANVADLIIALAEIQPNPFCNHTVTLGISGLVSAWAGWYRNWPS  226



>ref|XP_006652577.1| PREDICTED: peroxisomal membrane protein 11-4-like [Oryza brachyantha]
Length=222

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 186/228 (82%), Gaps = 6/228 (3%)
 Frame = -2

Query  689  VAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSR  510
            ++  DT+DKLV+FLAKRDGIDKLVKTFQYVSKL +W  E S+P  A RAK WE ++GLSR
Sbjct  1    MSAGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWAAESSNPGFAGRAKNWETSAGLSR  60

Query  509  KAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            KAFR+GRFLTG NALRR+PG    F  LA+LAN+GEMVYFFFDH  WLSR GV+D  LAR
Sbjct  61   KAFRTGRFLTGLNALRRAPGE---FGALAVLANAGEMVYFFFDHFTWLSRAGVLDAWLAR  117

Query  329  RMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMR  150
            RMSF+SAFGESVGYVFF+  D I+I RG++ ERKL         +NE+++KKIR DRVMR
Sbjct  118  RMSFISAFGESVGYVFFIAMDLIMIRRGLRQERKLLRDG---GKDNEKEVKKIRMDRVMR  174

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LMA AAN+ADLII +ADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  175  LMATAANVADLIIGIADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  222



>ref|XP_009384467.1| PREDICTED: peroxisomal membrane protein 11-4 [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 190/226 (84%), Gaps = 3/226 (1%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            M+DTVDKLV+FLAKRDGIDKLVKTFQYVSKL +W  E +HP LA RAK WEVASGLSRKA
Sbjct  1    MSDTVDKLVVFLAKRDGIDKLVKTFQYVSKLAHWHAESAHPGLAGRAKSWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FRSGRFLTGFN LRRSPG TP  R LA+ AN+GEMVYFFFDH LWLSRIG +D  LAR+M
Sbjct  61   FRSGRFLTGFNTLRRSPGSTPLLRFLAVFANAGEMVYFFFDHFLWLSRIGALDASLARKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            S++SAFGE++GYVFFV+ DFI+I +G+  ++K    + A     +E+ KKIRA+RVMRLM
Sbjct  121  SYISAFGEALGYVFFVVIDFIMIRKGLAEQKK---VEKAGGGGGKEESKKIRAERVMRLM  177

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+AD +IALADI PNPFC H VTLGISGLVSAW+GWYRNWPS
Sbjct  178  AVAANVADFVIALADIAPNPFCNHAVTLGISGLVSAWSGWYRNWPS  223



>ref|XP_003580226.1| PREDICTED: peroxisomal membrane protein 11-4 [Brachypodium distachyon]
Length=224

 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 187/228 (82%), Gaps = 4/228 (2%)
 Frame = -2

Query  689  VAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSR  510
            ++  DT+DKLV+FLAKRDGIDKLVKT+QYVSKL +W  E SHP+LA RAK WE A+GLSR
Sbjct  1    MSAGDTLDKLVVFLAKRDGIDKLVKTYQYVSKLAHWAAESSHPDLARRAKNWETAAGLSR  60

Query  509  KAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            K FRSGR LTGFN LRRSPG    F  LA+LAN+GEMVYFFFDH  WLSR+GV++P LAR
Sbjct  61   KVFRSGRSLTGFNTLRRSPGE---FGALAVLANAGEMVYFFFDHFTWLSRVGVLEPWLAR  117

Query  329  RMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMR  150
            RMSFVSAFGESVGYVFF+  DFI++ RGI+ ERKL       + E E ++ KIR DRVMR
Sbjct  118  RMSFVSAFGESVGYVFFIAMDFIMLRRGIRQERKLLREGGGGK-EKEGELSKIRTDRVMR  176

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LM  AAN+ADL+IA+ADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  177  LMGTAANLADLVIAIADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  224



>ref|NP_001053418.1| Os04g0534600 [Oryza sativa Japonica Group]
 sp|Q7XU74.2|PX114_ORYSJ RecName: Full=Peroxisomal membrane protein 11-4; AltName: Full=OsPEX11-4; 
AltName: Full=Peroxin-11-4 [Oryza sativa Japonica 
Group]
 sp|Q01IH3.1|PX114_ORYSI RecName: Full=Peroxisomal membrane protein 11-4; AltName: Full=OsPEX11-4; 
AltName: Full=Peroxin-11-4 [Oryza sativa Indica 
Group]
 emb|CAD41517.3| OSJNBb0020O11.14 [Oryza sativa Japonica Group]
 dbj|BAF15332.1| Os04g0534600 [Oryza sativa Japonica Group]
 emb|CAH67467.1| OSIGBa0159I10.12 [Oryza sativa Indica Group]
 gb|EAY94971.1| hypothetical protein OsI_16779 [Oryza sativa Indica Group]
 dbj|BAG93668.1| unnamed protein product [Oryza sativa Japonica Group]
Length=222

 Score =   300 bits (768),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 186/228 (82%), Gaps = 6/228 (3%)
 Frame = -2

Query  689  VAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSR  510
            ++  DT+DKLV+FLAKRDGIDKLVKTFQYVSKL +W  E S P LA RAK WE ++GLSR
Sbjct  1    MSAGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWAAESSSPGLAGRAKNWETSAGLSR  60

Query  509  KAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            KAFR+GRFLTG N LRR+PG    F  LA+LAN+GEMVYFFFDH  WLSR+GV+D  LAR
Sbjct  61   KAFRTGRFLTGLNGLRRAPGE---FGALAVLANAGEMVYFFFDHFTWLSRVGVLDAWLAR  117

Query  329  RMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMR  150
            RMSF+SAFGESVGYVFF+  D I+I RG++ ERKL      ++D   +++KKIR DRVMR
Sbjct  118  RMSFISAFGESVGYVFFIAMDLIMIRRGLRQERKLLREGGKDKD---KEVKKIRMDRVMR  174

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LMA AAN+ADL+I +ADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  175  LMATAANVADLVIGIADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  222



>ref|XP_002446856.1| hypothetical protein SORBIDRAFT_06g023730 [Sorghum bicolor]
 gb|EES11184.1| hypothetical protein SORBIDRAFT_06g023730 [Sorghum bicolor]
Length=229

 Score =   300 bits (767),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 185/231 (80%), Gaps = 5/231 (2%)
 Frame = -2

Query  689  VAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSH-PELAHRAKLWEVASGLS  513
            +   DT+DKLV+FLAKRDGIDKLVKTFQYVSKL +W  E S  PELA RAK WE ASGLS
Sbjct  1    MGTGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWGAESSSLPELARRAKSWETASGLS  60

Query  512  RKAFRSGRFLTGFNALRRSPGPTPA--FRLLALLANSGEMVYFFFDHILWLSRIGVVDPK  339
            RKAFRSGRFLTGFNALRR P P P   F  LA+LAN+GEMVYFFFDH  WLSR+GV+DP 
Sbjct  61   RKAFRSGRFLTGFNALRRGP-PPPGDEFGALAVLANAGEMVYFFFDHFTWLSRVGVLDPW  119

Query  338  LARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADR  159
            +A R S+VSAFGE+VGYVFFV  D I+I RG++ ERKL   K   ED  E+++++IR DR
Sbjct  120  IAPRASYVSAFGEAVGYVFFVAMDLIMIRRGLRRERKLLKEKDGGEDA-EKEVRRIRVDR  178

Query  158  VMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            VMRLMA AAN AD II +A+ +PNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  179  VMRLMATAANAADFIICIAETDPNPFCNHAVTLGISGLVSAWAGWYRNWPS  229



>gb|EAZ31457.1| hypothetical protein OsJ_15594 [Oryza sativa Japonica Group]
Length=222

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 185/228 (81%), Gaps = 6/228 (3%)
 Frame = -2

Query  689  VAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSR  510
            ++  DT+DKLV+FLAKRDGIDKLVKTFQYVSKL +W  E S P LA RAK WE ++GLSR
Sbjct  1    MSAGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWAAESSSPGLAGRAKNWETSAGLSR  60

Query  509  KAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            KAFR+GRFLTG N LRR+PG    F  LA+LAN+GEMVY FFDH  WLSR+GV+D  LAR
Sbjct  61   KAFRTGRFLTGLNGLRRAPGE---FGALAVLANAGEMVYLFFDHFTWLSRVGVLDAWLAR  117

Query  329  RMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMR  150
            RMSF+SAFGESVGYVFF+  D I+I RG++ ERKL      ++D   +++KKIR DRVMR
Sbjct  118  RMSFISAFGESVGYVFFIAMDLIMIRRGLRQERKLLREGGKDKD---KEVKKIRMDRVMR  174

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LMA AAN+ADL+I +ADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  175  LMATAANVADLVIGIADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  222



>gb|KEH17629.1| peroxisomal biogenesis factor 11 family protein [Medicago truncatula]
Length=212

 Score =   292 bits (747),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 186/226 (82%), Gaps = 14/226 (6%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MNDTVDKLVIFLAKRDGIDKL KTFQ           +  P      KL    SGLSRKA
Sbjct  1    MNDTVDKLVIFLAKRDGIDKLEKTFQ-----------EDIPICFQACKLACGTSGLSRKA  49

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFNALRR+PG T   RLLA+L+NSGEMVYFFFDH LWLSRIG VD  LA++M
Sbjct  50   FRTGRFLTGFNALRRNPGSTLTLRLLAVLSNSGEMVYFFFDHFLWLSRIGTVDANLAKKM  109

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SF+SAFGE+VGYVFF+I+DFIL++ G++AE+KLR S   E  +NE++I+K+++DR+MRLM
Sbjct  110  SFISAFGEAVGYVFFIIADFILLNEGLKAEKKLRSS---EGKDNEKEIQKLKSDRIMRLM  166

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            AVAAN+ADLIIALA+IEPNPFC HT++LGISGLVSAWAGWYRNWPS
Sbjct  167  AVAANVADLIIALAEIEPNPFCNHTISLGISGLVSAWAGWYRNWPS  212



>ref|XP_004976360.1| PREDICTED: peroxisomal membrane protein 11-4-like [Setaria italica]
Length=227

 Score =   292 bits (748),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 183/230 (80%), Gaps = 5/230 (2%)
 Frame = -2

Query  689  VAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSR  510
            ++  DT+DKLV+FLAKRDGIDKLVKTFQYVSKL +W  E S PELA RAK WE ASGLSR
Sbjct  1    MSAGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWGAESSRPELAKRAKSWETASGLSR  60

Query  509  KAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            KAFRSGRFLTGFN LRR+PG    F  LA+LAN+GEMVY+FFDH  W+SR+G ++ +LAR
Sbjct  61   KAFRSGRFLTGFNTLRRAPGE---FGALAVLANAGEMVYYFFDHFTWMSRVGFLEARLAR  117

Query  329  RMSFVSAFGESVGYVFFVISDFILISRGIQ--AERKLRHSKVAEEDENEEQIKKIRADRV  156
            R SF+SAFGES+GYVFF+  D I+I RG++             ++ E E++++KIR DRV
Sbjct  118  RSSFISAFGESIGYVFFIAMDLIMIRRGLRQERRLLREGGGGGKDAEKEKELRKIRMDRV  177

Query  155  MRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            MRLMA AAN ADL+IA+A++EPN FC H VTLGISGLVSAWAGWYRNWPS
Sbjct  178  MRLMATAANAADLVIAIAEVEPNRFCNHAVTLGISGLVSAWAGWYRNWPS  227



>ref|NP_190327.1| peroxisomal membrane protein 11B [Arabidopsis thaliana]
 sp|Q9STY0.1|PX11B_ARATH RecName: Full=Peroxisomal membrane protein 11B; AltName: Full=Peroxin-11B; 
Short=AtPEX11b [Arabidopsis thaliana]
 emb|CAB51215.1| putative protein [Arabidopsis thaliana]
 gb|AAN72044.1| putative protein [Arabidopsis thaliana]
 gb|AAP13379.1| At3g47430 [Arabidopsis thaliana]
 emb|CAD58678.1| putative PEX11-4 protein [Arabidopsis thaliana]
 gb|AEE78280.1| peroxisomal membrane protein 11B [Arabidopsis thaliana]
Length=227

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 186/224 (83%), Gaps = 0/224 (0%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            DTVDKLV+FLAKRDGIDKLVKTFQYV+KL  W +E + PE A R K WEVASGLSRKAFR
Sbjct  4    DTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPEAADRFKKWEVASGLSRKAFR  63

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
            +GR LTGFNALRR+PG TP  R LA+LANSGEMVYFFFDH LWLSRIG +D KLA++MSF
Sbjct  64   TGRSLTGFNALRRNPGATPMIRFLAVLANSGEMVYFFFDHFLWLSRIGSIDAKLAKKMSF  123

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SAFGES GY FF+I D I I + +++ +KL+HS    ++E   +I +IR D VMRLM +
Sbjct  124  ISAFGESFGYTFFIIIDCIFIKQRLKSLKKLQHSTDEPKEEIGAKISEIRGDIVMRLMGI  183

Query  137  aaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +AN+ADL+IALA+I PNPFC HT+TLGISGLVSAWAGWYRNWPS
Sbjct  184  SANVADLLIALAEIHPNPFCNHTITLGISGLVSAWAGWYRNWPS  227



>ref|XP_006291796.1| hypothetical protein CARUB_v10017971mg [Capsella rubella]
 gb|EOA24694.1| hypothetical protein CARUB_v10017971mg [Capsella rubella]
Length=228

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            +DT+DKLV+FLAKRDGIDKLVKTFQYV+KL  W +E + PE A R K WEVASGLSRKAF
Sbjct  3    SDTLDKLVVFLAKRDGIDKLVKTFQYVAKLGCWHVEATRPEAADRFKKWEVASGLSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GR LTGFNALRR+PG TP  RLLA+LANSGEMVYFFFDH LWLSRIG +D KLA++MS
Sbjct  63   RTGRSLTGFNALRRNPGATPTIRLLAVLANSGEMVYFFFDHFLWLSRIGSLDAKLAKKMS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMa  141
            F+SAFGES GY FF+I D I I + I++ ++LR+S    +DE   +I +IR D VMRLM 
Sbjct  123  FISAFGESFGYTFFIIIDCIFIRQRIESLKRLRYSSDEPKDEISAKISEIRGDIVMRLMG  182

Query  140  vaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++ANIADLIIALA+I+PNPFC HT+TLGISGLVSAWAGWYRNWP+
Sbjct  183  ISANIADLIIALAEIQPNPFCNHTLTLGISGLVSAWAGWYRNWPT  227



>ref|XP_010503343.1| PREDICTED: peroxisomal membrane protein 11B [Camelina sativa]
Length=228

 Score =   291 bits (744),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 187/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            +DT+DKLV+FLAKRDGIDKLVKTFQYV+KL  W +E + PE A R K WEVASGLSRKAF
Sbjct  3    SDTLDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPEAADRFKKWEVASGLSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GR LTGFNALRR+PG TP  RLLA+LANSGEMVYFFFDH LWLSRIG +D KLA++MS
Sbjct  63   RTGRSLTGFNALRRNPGATPVIRLLAVLANSGEMVYFFFDHFLWLSRIGSLDAKLAKKMS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMa  141
            F+SAFGES GY FF+I D I I + + + +KLR+     +DE   +I +IR D VMRLM 
Sbjct  123  FISAFGESFGYTFFIIIDCIFIRQRLDSLKKLRYPSDETKDEINAKISEIRGDIVMRLMG  182

Query  140  vaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++AN+ADLIIALA+I+PNPFC HTVTLGISGLVSAWAGWYRNWP+
Sbjct  183  ISANVADLIIALAEIQPNPFCNHTVTLGISGLVSAWAGWYRNWPT  227



>ref|XP_010426184.1| PREDICTED: peroxisomal membrane protein 11B-like [Camelina sativa]
Length=228

 Score =   290 bits (743),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 187/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            +DT+DKLV+FLAKRDGIDKLVKTFQYV+KL  W +E + PE A R K WEVASGLSRKAF
Sbjct  3    SDTLDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPEAADRFKKWEVASGLSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GR LTGFNALRR+PG TP  RLLA+LANSGEMVYFFFDH LWLSRIG +D KLA++MS
Sbjct  63   RTGRSLTGFNALRRNPGATPVIRLLAVLANSGEMVYFFFDHFLWLSRIGSLDAKLAKKMS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMa  141
            F+SAFGES GY FF+I D I I + + + +KLR+     +DE   +I +IR D VMRLM 
Sbjct  123  FISAFGESFGYTFFIIIDCIFIRQRLDSLKKLRYPSDETKDEINAKISEIRGDIVMRLMG  182

Query  140  vaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++ANIADLIIALA+I+PNPFC HTVTLGISGLVSAWAGWYRNWP+
Sbjct  183  ISANIADLIIALAEIQPNPFCNHTVTLGISGLVSAWAGWYRNWPT  227



>ref|XP_010515049.1| PREDICTED: peroxisomal membrane protein 11B-like [Camelina sativa]
Length=228

 Score =   290 bits (742),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 187/225 (83%), Gaps = 0/225 (0%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            +DT+DKL++FLAKRDGIDKLVKTFQYV+KL  W +E + PE A R K WEVASGLSRKAF
Sbjct  3    SDTLDKLIVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPEAADRFKKWEVASGLSRKAF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GR LTGFNALRRSPG TP  RLLA+LANSGEMVYFFFDH LWLSRIG +D KLA++MS
Sbjct  63   RTGRSLTGFNALRRSPGATPVIRLLAVLANSGEMVYFFFDHFLWLSRIGSLDAKLAKKMS  122

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMa  141
            F+SAFGES GY FF+I D I I + + + ++LR+     +DE   +I +IR D VMRLM 
Sbjct  123  FISAFGESFGYTFFIIIDCIFIRQRLDSLKRLRYPSDETKDEINAKISEIRGDIVMRLMG  182

Query  140  vaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++ANIADLIIALA+I+PNPFC HTVTLGISGLVSAWAGWYRNWP+
Sbjct  183  ISANIADLIIALAEIQPNPFCNHTVTLGISGLVSAWAGWYRNWPT  227



>ref|XP_002875839.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52098.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=226

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 184/224 (82%), Gaps = 1/224 (0%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            DTVDKLV+FLAKRDGIDKLVKTFQYV+KL  WR E + PE A R K WEVASGLSRKAFR
Sbjct  4    DTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWRFEATQPEAADRFKKWEVASGLSRKAFR  63

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
            +GR LTGFNALRR+PG TP  R LA+LANSGEMVYFFFDH LWLSRIG +D KLA++MSF
Sbjct  64   TGRSLTGFNALRRNPGATPVIRFLAVLANSGEMVYFFFDHFLWLSRIGTIDAKLAKKMSF  123

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SAFGES GY FF+I D I I +  ++ +KLR S    +DE   +I +IR D VMRLM +
Sbjct  124  ISAFGESFGYTFFIIIDCIFIRQRFKSLKKLRSSD-GPKDEIGAKISEIREDIVMRLMGI  182

Query  137  aaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +ANIADL+IALA+I PNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  183  SANIADLLIALAEIHPNPFCNHTVTLGISGLVSAWAGWYRNWPS  226



>ref|XP_008667879.1| PREDICTED: peroxisomal biogenesis factor 11 family protein isoform 
X1 [Zea mays]
Length=300

 Score =   290 bits (743),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
             DT+DKLV+FLAKRDGIDKLVKTFQYVSKL +W  E S PELA RAK WE ASGLSRKAF
Sbjct  4    GDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWGAESSLPELAQRAKSWETASGLSRKAF  63

Query  500  RSGRFLTGFNALRRSPGPTPA-FRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            RSGRFL GFNALRR P P P     LA+LAN+GEMVYFFFDH  WLSR GV++P LARR 
Sbjct  64   RSGRFLAGFNALRRGPVPVPGELGALAVLANAGEMVYFFFDHFTWLSRAGVLEPWLARRA  123

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SFVSAFGE+VGYVFF+  DFI+I RG++ ER+L       +D  E+++++IR DRVMRLM
Sbjct  124  SFVSAFGEAVGYVFFIAMDFIMIRRGLRQERELLRE--GAKDAAEKEVRRIRVDRVMRLM  181

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGW  24
            A AAN ADLIIA+A+ +PNPFC H VTLGISGLVSAWAGW
Sbjct  182  ATAANAADLIIAVAETDPNPFCNHAVTLGISGLVSAWAGW  221



>dbj|BAK06013.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   287 bits (735),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 183/229 (80%), Gaps = 7/229 (3%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
             DT+DKLV+FLAKRDG+DKLVKT+QYVSKL +W  E SHP LA RAK WE A+GLSRK F
Sbjct  3    GDTLDKLVVFLAKRDGVDKLVKTYQYVSKLAHWAAEPSHPGLAGRAKSWETAAGLSRKVF  62

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            RSGR LTG NALRRSPG   A   LA++AN+GEMVYFFFDH  WLSR+GV++P LARRMS
Sbjct  63   RSGRSLTGLNALRRSPGELGA---LAVMANAGEMVYFFFDHFTWLSRVGVLEPWLARRMS  119

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKL----RHSKVAEEDENEEQIKKIRADRVM  153
            FVSAFGE VGY FF+  D ++I RG++ ER L           ++E E ++++IRADRVM
Sbjct  120  FVSAFGECVGYSFFIAMDLVMIRRGVRRERALLLREGGGGGEGKEEEEGEVRRIRADRVM  179

Query  152  RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            RLM  AAN+ADL+IA+ADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  180  RLMGTAANLADLVIAVADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  228



>ref|XP_009149915.1| PREDICTED: peroxisomal membrane protein 11B [Brassica rapa]
Length=226

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 189/224 (84%), Gaps = 1/224 (0%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            DTVDKLV+FLAKRDGIDKLVKTFQYV+KL  W +E + P+ A R K WEVASGLSRKAFR
Sbjct  4    DTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPDAAERFKKWEVASGLSRKAFR  63

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
            +GR LTGFNALRR+PG TP  R LA+LANSGEMVYFFFDH LWLSRIG++DPK+A++MSF
Sbjct  64   TGRSLTGFNALRRNPGATPVIRFLAVLANSGEMVYFFFDHFLWLSRIGILDPKIAKKMSF  123

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SAFGES GYVFF+I D I I + +++ ++LR +   +E E   ++ +I+ D VMRLM +
Sbjct  124  ISAFGESFGYVFFIIIDCIFIRQRLRSLKRLRTNDEPKE-EVSGKVSEIQGDIVMRLMGI  182

Query  137  aaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +AN+ADLIIALA+I+PNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  183  SANVADLIIALAEIQPNPFCNHTVTLGISGLVSAWAGWYRNWPS  226



>emb|CDY47414.1| BnaCnng15230D [Brassica napus]
Length=227

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 188/225 (84%), Gaps = 2/225 (1%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF-  501
            DTVDKLV+FLAKRDGIDKLVKTFQYV+KL  W +E + P+ A R K WEVASGLSRKAF 
Sbjct  4    DTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPDAAERFKKWEVASGLSRKAFS  63

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GR LTGFNALRR+PG TP  R LA+LANSGEMVYFFFDH LWLSRIG +DPK+A++MS
Sbjct  64   RTGRSLTGFNALRRNPGATPVIRFLAVLANSGEMVYFFFDHFLWLSRIGTLDPKIAKKMS  123

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMa  141
            F+SAFGES GYVFF+I D I I + +++ ++LR +   +E E   ++ +I+ D VMRLM 
Sbjct  124  FISAFGESFGYVFFIIIDCIFIRQRLRSLKRLRTNDEPKE-EVSGKVSEIQGDIVMRLMG  182

Query  140  vaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++AN+ADLIIALA+I+PNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  183  ISANVADLIIALAEIQPNPFCNHTVTLGISGLVSAWAGWYRNWPS  227



>emb|CDX99049.1| BnaA06g17400D [Brassica napus]
Length=227

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF-  501
            DTVDKLV+FLAKRDGIDKLVKTFQYV+KL  W +E + P+ A R K WEVASGLSRKAF 
Sbjct  4    DTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPDAAERFKKWEVASGLSRKAFS  63

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GR LTGFNALRR+PG TP  R LA+LANSGEMVYFFFDH LWLSRIG +DPK+A++MS
Sbjct  64   RTGRSLTGFNALRRNPGATPVIRFLAVLANSGEMVYFFFDHFLWLSRIGTLDPKIAKKMS  123

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMa  141
            F+SAFGES GYVFF+I D I I + + + ++LR +    ++E   ++ +I+ D VMRLM 
Sbjct  124  FISAFGESFGYVFFIIIDCIFIRQRLSSLKRLR-TNYEPKEEVSGKVSEIQGDIVMRLMG  182

Query  140  vaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++AN+ADLIIALA+I+PNPFC HTVTLGISGLVSAWAGWYRNWPS
Sbjct  183  ISANVADLIIALAEIQPNPFCNHTVTLGISGLVSAWAGWYRNWPS  227



>gb|EMT08002.1| Peroxisomal membrane protein 11-4 [Aegilops tauschii]
Length=218

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 176/213 (83%), Gaps = 4/213 (2%)
 Frame = -2

Query  641  RDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLTGFNALR  462
            RDGIDKLVKT+QYVSKL +W  E SHP LA R+K WE A+GLSRK FRSGR LTG NALR
Sbjct  9    RDGIDKLVKTYQYVSKLAHWEAESSHPGLAGRSKSWETAAGLSRKVFRSGRSLTGLNALR  68

Query  461  RSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGESVGYVF  282
            RSPG    F  LA+LAN+GEMVYFFFDH  WLSR+GV++P LARR SFVSAFGE VGYVF
Sbjct  69   RSPGE---FGALAVLANAGEMVYFFFDHFTWLSRVGVLEPWLARRASFVSAFGECVGYVF  125

Query  281  FVISDFILISRGIQAERK-LRHSKVAEEDENEEQIKKIRADRVMRLMavaaniadliial  105
            F++ DFI+I RGI+ ER  LR  +  EE+E E ++++IRADRVMRLM  AAN+ADL+IA+
Sbjct  126  FIVMDFIMIRRGIRRERALLRGGEGKEEEEREGEVRRIRADRVMRLMGTAANLADLVIAV  185

Query  104  adIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  186  ADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  218



>ref|XP_001755217.1| predicted protein [Physcomitrella patens]
 gb|EDQ80161.1| predicted protein [Physcomitrella patens]
Length=227

 Score =   267 bits (682),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 180/224 (80%), Gaps = 3/224 (1%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            DT+DKLVIFLAKRDGIDKLVKTFQYV KL ++ +E+ +P+LA R K  EVA+GLSRKAFR
Sbjct  6    DTLDKLVIFLAKRDGIDKLVKTFQYVGKLGHYNLERRNPQLADRCKKLEVAAGLSRKAFR  65

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
            +GRFLTGFNALR +  P    ++L++    GEMVY+FFDH LWLSR+GV+DP+LARRMS+
Sbjct  66   TGRFLTGFNALRTTTFPDHKLQVLSIFGYGGEMVYWFFDHFLWLSRVGVLDPELARRMSY  125

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SAFGE  GY+FF+I+D I+I RG+ AE + + S++ E +  E QI  +R  R+M +M++
Sbjct  126  ISAFGEGFGYIFFIIADLIVIRRGLLAEARYK-SQITELE--ELQIAAVRLQRIMSVMSI  182

Query  137  aaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             AN++DLIIALAD++PNPF CH VTLGISGL SA +GWY+NWP 
Sbjct  183  IANVSDLIIALADVDPNPFVCHPVTLGISGLASACSGWYKNWPD  226



>gb|KHN46501.1| Peroxisomal membrane protein 11B [Glycine soja]
Length=212

 Score =   264 bits (675),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MND+VDKLVIFLAKRDGIDKLVKTFQYVSKLVNW +E +HP+ + R K WEVASGLSRKA
Sbjct  1    MNDSVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWHVEATHPDTSKRFKQWEVASGLSRKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR+GRFLTGFN LRR+PG T + RLLA+L+N+GEMVYFFFDH LWL+RIG +D  LA++M
Sbjct  61   FRTGRFLTGFNVLRRNPGSTLSLRLLAVLSNAGEMVYFFFDHFLWLARIGTIDASLAKKM  120

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQ--IKKIRADRVMR  150
            SF+SAFGESVGYVFF+I+DFI++  G++AERKLR S   E+ E EE+  I KIR+DR+MR
Sbjct  121  SFISAFGESVGYVFFIIADFIMLKEGLKAERKLRRSSSKEKSEEEEKAVILKIRSDRIMR  180

Query  149  LM  144
            LM
Sbjct  181  LM  182



>gb|EPS60156.1| peroxisomal biogenesis factor 11 family protein, partial [Genlisea 
aurea]
Length=217

 Score =   254 bits (648),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 170/225 (76%), Gaps = 8/225 (4%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            MND VDKLVIFL KR GIDKLVKT QY SKL +W +  +  +LA RAK WE++SGL+RKA
Sbjct  1    MNDGVDKLVIFLGKRAGIDKLVKTIQYASKLTHWHLRNTRSDLADRAKKWELSSGLARKA  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            +R+G+F+  FN LRR  GP P+   L++ AN+G+M Y+FFDH+LWL+RIGV+D K A   
Sbjct  61   YRTGQFVAAFNDLRRRNGPPPS--ALSVAANAGQMAYYFFDHVLWLARIGVLDGKRAASA  118

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
            SFVSAFGE++ YV  +I+D   I+ GI+AER++  S      E + +I+KIRA R MRLM
Sbjct  119  SFVSAFGEAIWYVCNLIADAKAIAAGIRAEREIGAS------EKKGEIEKIRAGRTMRLM  172

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWP  9
             +AA+ AD +IA A+I PNPFC H +TLGISGL+SAWAGWYRNWP
Sbjct  173  GMAADSADFVIAAAEIHPNPFCNHVITLGISGLISAWAGWYRNWP  217



>ref|XP_002994448.1| hypothetical protein SELMODRAFT_138612 [Selaginella moellendorffii]
 gb|EFJ04484.1| hypothetical protein SELMODRAFT_138612 [Selaginella moellendorffii]
Length=236

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 168/230 (73%), Gaps = 6/230 (3%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEK-----SHPELAHRAKLWEVASGL  516
             D +D+LVIFLAKRDGIDKLVKT QY  KL +W + +     S P LA RAK  EV+ GL
Sbjct  7    QDFLDRLVIFLAKRDGIDKLVKTLQYTGKLSHWHLSRRSKRSSVPNLATRAKALEVSCGL  66

Query  515  SRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKL  336
            +RKAFR GR+L+G N LR +P P   F  LA+LAN+GEMVYFFFDH  WLSRIGV+DP L
Sbjct  67   ARKAFRLGRWLSGLNNLR-APAPNLPFLALAILANAGEMVYFFFDHFTWLSRIGVLDPSL  125

Query  335  ARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRV  156
            A R S VSA GE+ GYVFFVI+D ILI++G++ ER+L     A        I  IR  RV
Sbjct  126  APRFSLVSASGEAFGYVFFVIADAILIAQGVREERRLALELQAMIQAKRVAIAAIRVKRV  185

Query  155  MRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            M  MA+AAN+AD +IALADIEPNPF  H VTLGISGLVSAWAGWYRNWPS
Sbjct  186  MSAMAIAANVADFVIALADIEPNPFVTHAVTLGISGLVSAWAGWYRNWPS  235



>ref|XP_002972102.1| hypothetical protein SELMODRAFT_96286 [Selaginella moellendorffii]
 gb|EFJ27019.1| hypothetical protein SELMODRAFT_96286 [Selaginella moellendorffii]
Length=236

 Score =   252 bits (644),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 168/230 (73%), Gaps = 6/230 (3%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEK-----SHPELAHRAKLWEVASGL  516
             D +D+LVIFLAKRDGIDKLVKT QY  KL +W + +     S P LA RAK  EV+ GL
Sbjct  7    QDFLDRLVIFLAKRDGIDKLVKTLQYTGKLSHWHLSRRSKRSSVPNLATRAKALEVSCGL  66

Query  515  SRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKL  336
            +RKAFR GR+L+G N LR +P P   F  LA+LAN+GEMVYFFFDH  WLSRIGV+DP L
Sbjct  67   ARKAFRLGRWLSGLNNLR-APAPNLPFLALAILANAGEMVYFFFDHFTWLSRIGVLDPSL  125

Query  335  ARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRV  156
            A R S VS+ GE+ GYVFFVI+D ILI++G++ ER+L     A        I  IR  RV
Sbjct  126  APRFSLVSSSGEAFGYVFFVIADAILIAQGVREERRLALELQAMIQAKRVAITAIRVKRV  185

Query  155  MRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            M  MA+AAN+AD +IALADIEPNPF  H VTLGISGLVSAWAGWYRNWPS
Sbjct  186  MSAMAIAANVADFVIALADIEPNPFVTHAVTLGISGLVSAWAGWYRNWPS  235



>ref|XP_001773175.1| predicted protein [Physcomitrella patens]
 gb|EDQ62028.1| predicted protein [Physcomitrella patens]
Length=238

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 162/232 (70%), Gaps = 7/232 (3%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
             DT+DKLV+FLAKRDGIDK+VKT QYV KL ++ +E+ +P LA R K  EVA+GLSRKAF
Sbjct  5    KDTLDKLVVFLAKRDGIDKVVKTLQYVGKLAHYGLERKNPVLAARYKNLEVAAGLSRKAF  64

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R+GR L  FN LR +  P    +LL +    GEMVY+FFDH  WLS++GV+DP +  R +
Sbjct  65   RTGRSLGAFNTLRTASHPDLTIQLLTIFGYGGEMVYWFFDHFTWLSKVGVLDPSVGVRTA  124

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHS---KVAEEDENEEQIK----KIRAD  162
            ++SAFGESV Y+FF+  D I+I RG++ E +L+      V  ED+    +K     IR  
Sbjct  125  YISAFGESVWYIFFITMDVIVIKRGLKTEVELKKQLAKLVKSEDQARAPLKAKLSSIRLQ  184

Query  161  RVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            RVM + ++ A  ADL IALA ++PNPF  HT+TLG+SGL SAWAGWY+ WP+
Sbjct  185  RVMAVSSIIAKTADLFIALAVVDPNPFVSHTITLGLSGLASAWAGWYQLWPA  236



>ref|XP_001757043.1| predicted protein [Physcomitrella patens]
 gb|EDQ78274.1| predicted protein [Physcomitrella patens]
Length=217

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V+FLAKRDGIDK+VKT QY  KL +W +E+ +P LA R K  EVA+GLSRKA R+GR LT
Sbjct  1    VLFLAKRDGIDKVVKTLQYAGKLAHWSLEERNPILAARYKNLEVAAGLSRKAHRAGRSLT  60

Query  479  GFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGE  300
            GF+ LR +  P    +LL +   SGEMVY+ FDH  WLS++GV++  LA +  ++S+FGE
Sbjct  61   GFSTLRSTTYPDLTIQLLTIFGFSGEMVYWLFDHFTWLSKVGVLNAGLAAKTIYISSFGE  120

Query  299  SVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMavaaniad  120
            SVGY+FF+  D ILI RG+QAE     + + +    + +I  I+  RVM  M++ A  +D
Sbjct  121  SVGYIFFITIDVILIKRGMQAEAS---ATLVQVQSLKAKISGIKMQRVMSTMSIIARTSD  177

Query  119  liialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWP  9
            LIIAL+ I+PNPF  HT+TLG+SGL SAWAGW++ WP
Sbjct  178  LIIALSVIDPNPFVSHTITLGLSGLASAWAGWHQQWP  214



>gb|EMS64743.1| hypothetical protein TRIUR3_02525 [Triticum urartu]
Length=114

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -2

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQAERKL-RHSKVAEEDENEEQIKKIRADRVMR  150
            ++FVSAFGE VGYVFF+  DFI+I RGI+ ER L R     E  E E +++ IRADRVMR
Sbjct  7    INFVSAFGECVGYVFFIAMDFIMIRRGIRRERALLRGEGGGEGKEKEGEVRMIRADRVMR  66

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            LM  AAN+ADL+I +ADIEPNPFC H VTLGISGLVSAWAGWYRNWPS
Sbjct  67   LMGTAANLADLVIGVADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS  114



>ref|XP_008444688.1| PREDICTED: peroxisomal membrane protein 11A [Cucumis melo]
Length=247

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/233 (34%), Positives = 131/233 (56%), Gaps = 10/233 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D  + L  +LAKRDG+DKL+K  +Y +K++  +  I +SHP L HR K +E + G+SRKA
Sbjct  15   DFFNHLEAYLAKRDGVDKLLKISRYTTKIILSSSAISESHP-LTHRLKSFESSVGVSRKA  73

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    LLALLA  GE +Y+F +  +WL++ G++D + + R+
Sbjct  74   FRLGKFIQDINALRNSHFESNQEFLLALLAYGGEGIYYFVEQFIWLAKSGLIDKRHSSRL  133

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRAD  162
              +SA+ E +GY+  +   F  ++R ++ E  L+ S      +     E +E++KK+RA 
Sbjct  134  QKISAWAELIGYIGSISLKFRDLNRILEDEACLKASIEIAVNRGIGHREEDEKMKKLRAK  193

Query  161  RVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             +M +L  V       +      + N      + +  +GL+SA    ++NW S
Sbjct  194  MLMKKLSIVQDFADGFMAVADVRDGNGRFSGPLLISFAGLLSALISTHKNWIS  246



>ref|XP_004152708.1| PREDICTED: peroxisomal membrane protein 11A-like [Cucumis sativus]
 gb|KGN62580.1| hypothetical protein Csa_2G361460 [Cucumis sativus]
Length=247

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 130/233 (56%), Gaps = 10/233 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D  + L  +LAKRDG+DKL+K  +Y +K++  +  I +SHP L  R K +E + G+SRKA
Sbjct  15   DFFNHLEAYLAKRDGVDKLLKISRYTTKIILSSSAISESHP-LTQRLKSFESSVGVSRKA  73

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    LLALLA  GE  Y+F +  +WL++ G++D + + R+
Sbjct  74   FRLGKFIQDLNALRNSHFESNQEFLLALLAYGGEGFYYFVEQFIWLAKSGLIDKRHSSRL  133

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRAD  162
              +SA+ E +GY+  +   F  ++R ++ E  L+ S      +     E EE++KK+RA 
Sbjct  134  QKISAWAELIGYIGSISLKFRDLNRILEDEACLKASIEIAVNRGIGHREEEEKMKKLRAK  193

Query  161  RVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            R+M +L  V       +      + N      + +  +GL+SA    ++NW S
Sbjct  194  RLMKKLSIVQDFADGFMAVADVRDGNGRFSGPLLISFAGLLSALISTHKNWIS  246



>ref|XP_005643088.1| peroxisomal biogenesis factor 11 [Coccomyxa subellipsoidea C-169]
 gb|EIE18544.1| peroxisomal biogenesis factor 11 [Coccomyxa subellipsoidea C-169]
Length=273

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 135/232 (58%), Gaps = 16/232 (7%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            DT+DK V FLAKRDGIDK++K  +Y SKLV    +  S  +LA R K +E + G SRKA+
Sbjct  41   DTLDKTVAFLAKRDGIDKVLKLIRYTSKLVLASALADSKSDLALRLKAFESSIGTSRKAY  100

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G++L   NA+R+ P  T  F  L  LA+ GE VY+F + + WL + GV+  + AR  S
Sbjct  101  RLGKWLANVNAIRKMP-LTTRFSYLEWLASGGEGVYYFVEQLTWLVKAGVIPQRHARLFS  159

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKL-----RHSKVAEEDENE--EQIKKIRAD  162
             +SA  E VGYV  +    + I+  ++ ER L     R  K AE  ++E   +++ ++  
Sbjct  160  LISASAELVGYVGSITLCALRIAAALERERALTEELHRRKKQAEYGDSELRAEVRALQER  219

Query  161  RVMRLMavaaniadliialadIE------PNPFCCHTVTLGISGLVSAWAGW  24
            R++R +A+  +I+D ++A++DI        NP    +  L ISGL+SA   W
Sbjct  220  RLLRTLALTQDISDALLAVSDIRDGKGRLSNPVLLASGGL-ISGLISARKNW  270



>ref|XP_004160026.1| PREDICTED: peroxisomal membrane protein 11A-like [Cucumis sativus]
Length=247

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/233 (34%), Positives = 129/233 (55%), Gaps = 10/233 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D  + L  +LAKRDG+DKL+K  +Y +K++  +  I +SHP L  R K +E + G+SRKA
Sbjct  15   DFFNHLEAYLAKRDGVDKLLKISRYTTKIILSSSAISESHP-LTQRLKSFESSVGVSRKA  73

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    LLALLA  GE  Y+F +  +WL++ G++D + + R+
Sbjct  74   FRLGKFIQDLNALRNSHFESNQEFLLALLAYGGEGFYYFVEQFIWLAKSGLIDKRHSSRL  133

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRAD  162
              +SA+ E +GY+  +   F  ++R ++ E  L+ S      +     E EE++KK+RA 
Sbjct  134  QKISAWAELIGYIGSISLKFRDLNRILEDEACLKASIEIAVNRGIGHREEEEKMKKLRAK  193

Query  161  RVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             +M +L  V       +      + N      + +  +GL+SA    ++NW S
Sbjct  194  MLMKKLSIVQDFADGFMAVADVRDGNGRFSGPLLISFAGLLSALISTHKNWIS  246



>ref|XP_007160778.1| hypothetical protein PHAVU_001G016000g [Phaseolus vulgaris]
 ref|XP_007160779.1| hypothetical protein PHAVU_001G016000g [Phaseolus vulgaris]
 ref|XP_007160780.1| hypothetical protein PHAVU_001G016000g [Phaseolus vulgaris]
 ref|XP_007160781.1| hypothetical protein PHAVU_001G016000g [Phaseolus vulgaris]
 gb|ESW32772.1| hypothetical protein PHAVU_001G016000g [Phaseolus vulgaris]
 gb|ESW32773.1| hypothetical protein PHAVU_001G016000g [Phaseolus vulgaris]
 gb|ESW32774.1| hypothetical protein PHAVU_001G016000g [Phaseolus vulgaris]
 gb|ESW32775.1| hypothetical protein PHAVU_001G016000g [Phaseolus vulgaris]
Length=303

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 127/238 (53%), Gaps = 18/238 (8%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV---NWRIEKSHPELAHRAKLWEVASGLSRK  507
            D ++ +  +LAKRDG+DKL+K  +Y +KL+   +     ++P L+HR K +E + G+SRK
Sbjct  69   DLLNCIEAYLAKRDGVDKLLKISRYAAKLILASSLLQSSNNPTLSHRLKSFESSVGVSRK  128

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR S   +    L  LL   GE  Y+F +  +WL++ G++DPK AR 
Sbjct  129  AFRLGKFVQDLNALRASHPHSNRHLLFTLLTYGGEGFYYFVEQFVWLAKSGLIDPKHARA  188

Query  326  MSFVSAFGESVGY---VFFVISDF-------ILISRGIQAERKLRHSKVAEEDENEEQIK  177
               VSA+ E VGY   +   ++D          ++  ++  R LR    AEE   E +++
Sbjct  189  FQKVSAWAELVGYFGSLALKLADLNSIAEEETCLASSVEITR-LRGVGCAEE---ESRLR  244

Query  176  KIRADRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            K+R  + M RL  V       +     ++ N      V L  +GL+SA  G ++NW S
Sbjct  245  KLREKKTMKRLSVVQDLADAAMALDDVLDGNAPFSKPVFLASAGLLSALIGTHKNWVS  302



>ref|XP_004291898.1| PREDICTED: peroxisomal membrane protein 11A-like [Fragaria vesca 
subsp. vesca]
Length=260

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 125/235 (53%), Gaps = 12/235 (5%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSR  510
             D ++ L  +LAKRDG+DKL+K  +Y +K++      + PE   L HR K +E + G+SR
Sbjct  27   KDFLNHLEAYLAKRDGVDKLLKISRYATKII--LASSALPETLTLNHRLKSFESSVGVSR  84

Query  509  KAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            KAFR G+F+   NALR S   +     L+L+A  GE VYFF +  +WL + G++D + AR
Sbjct  85   KAFRLGKFVQDVNALRASHFDSAEELALSLVAYGGEGVYFFVEQFVWLVKSGLIDKRHAR  144

Query  329  RMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS-------KVAEEDENEEQIKKI  171
            R+  +SA+ E VGYV  V      + R  + E++++ S        +  E+E E   K I
Sbjct  145  RLGLISAWAEFVGYVGSVSLKIRDLRRIAEDEKRVKMSIEVAITRGIKCEEEKERLGKLI  204

Query  170  RADRVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
                + RL  V  +   L+      +        +++ I+GL+SA    ++NW S
Sbjct  205  EKKLMKRLSVVQDSADALMALADIRDGKGHFLGPLSVSIAGLLSALISTHKNWVS  259



>ref|XP_009411642.1| PREDICTED: peroxisomal membrane protein 11-3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411643.1| PREDICTED: peroxisomal membrane protein 11-3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411645.1| PREDICTED: peroxisomal membrane protein 11-3 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 127/231 (55%), Gaps = 12/231 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKL-VNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D +  L  +LA+RDG+DKL+K  +Y +K+ ++       P LA R K +E + GLSRKAF
Sbjct  27   DFLVHLEAYLARRDGVDKLLKISRYAAKIALSAPSSPIPPALAPRLKAFESSVGLSRKAF  86

Query  500  RSGRFLTGFNALRRSPGP--TPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            R G+F+   NALR + G    P  RLLA +A  GE VY+F +  +WLS+ G++  +L+RR
Sbjct  87   RLGKFVQDLNALRAATGGALNPTDRLLAAVAYGGEGVYYFVEQFVWLSKAGLIPAELSRR  146

Query  326  MSFVSAFGESVGY---VFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRV  156
               +SA+ E +GY   V     +   IS  IQ+  ++   K A+ D   E+I+K+R   +
Sbjct  147  FQKISAWAELIGYFGSVALKARELRKISSLIQS--RIESGKSADCD---EEIRKLRTKLL  201

Query  155  MR-LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++ L  +      L+      +   F   ++ +  +GL+SA    ++NW S
Sbjct  202  LKQLSVIQDLADGLMALGDVRDGEGFLSSSLLMASAGLLSALISTHKNWTS  252



>ref|XP_003550370.1| PREDICTED: peroxisomal membrane protein 11A-like [Glycine max]
Length=262

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 129/237 (54%), Gaps = 17/237 (7%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ +  +LAKRDG+DKL+K  +Y +KL+     ++ ++P L+HR K +E + G+SRKA
Sbjct  29   DLLNHVEAYLAKRDGVDKLLKISRYTAKLILATSLLQSNNPTLSHRLKSFESSVGVSRKA  88

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NAL+ +   +     L++LA  GE +Y+F +  +WL++ G++D K +R+ 
Sbjct  89   FRLGKFVQDLNALKTTHPHSNLDLFLSVLAYGGEGLYYFVEQFVWLAKSGLIDAKHSRKF  148

Query  323  SFVSAFGESVGY---VFFVISDFILISR-------GIQAERKLRHSKVAEEDENEEQIKK  174
              +SA+ E VGY   V   + D   I++        ++  R LR     +E   E Q+ K
Sbjct  149  QKLSAWAEFVGYFGSVALKLGDLGAIAQEEACLKSSVEITR-LREGGCVDE---EAQLGK  204

Query  173  IRADRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +R  + M RL  V      ++     ++ N      V +  +GL+SA    ++NW S
Sbjct  205  LRDKKTMKRLSVVQDLADAVMALDDVLDGNGPFSKPVLMASAGLLSALISTHKNWVS  261



>ref|XP_008807760.1| PREDICTED: peroxisomal membrane protein 11-3-like [Phoenix dactylifera]
 ref|XP_008807761.1| PREDICTED: peroxisomal membrane protein 11-3-like [Phoenix dactylifera]
Length=252

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 127/225 (56%), Gaps = 13/225 (6%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE--LAHRAKLWEVASGLSRKAFRSGR  489
            L  +LA+RDG+DKL+K  +Y +K+V   +  S P   LA R K +E + GLSRKAFR G+
Sbjct  34   LEAYLARRDGVDKLLKISRYAAKIV---LSTSLPSKALAPRLKAFESSVGLSRKAFRLGK  90

Query  488  FLTGFNALRRSPG-PTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVS  312
            F+   NA R + G P+ A  LLA +A  GE +Y+F +  +WLS+ G++  +  RR+  +S
Sbjct  91   FVQDVNAFRSADGSPSSADLLLAAVAYGGEGLYYFVEQFVWLSKAGLIPSQHLRRLQKIS  150

Query  311  AFGESVGYVFFVISDFILISRGIQAERKLRHSKV--AEEDENEEQIKKIRADRVMR-LMa  141
            A+ E VGY    +    L ++ ++  R L  SKV   +  E++++I+K+R   +++ L  
Sbjct  151  AWAELVGY----LGSISLKAKELRKIRFLLESKVRSTKSSEDDDEIQKLRVKLLLKQLSL  206

Query  140  vaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            V      L+      +   F  + + +  +GL+SA    ++NW S
Sbjct  207  VQDFADGLMALGDVSDGKGFLSNPLLMASAGLLSALISTHKNWTS  251



>gb|KHN12727.1| Peroxisomal membrane protein 11A [Glycine soja]
Length=264

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 128/237 (54%), Gaps = 17/237 (7%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ +  +LAKRDG+DKL+K  +Y +KL+     ++ ++P L+HR K +E + G+SRKA
Sbjct  31   DLLNHVEAYLAKRDGVDKLLKISRYTAKLILATSLLQSNNPTLSHRLKSFESSVGVSRKA  90

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NAL+ +   +     L++LA  GE +Y+F +  +WL++ G++D K +R+ 
Sbjct  91   FRLGKFVQDLNALKTTHPHSNLDLFLSVLAYGGEGLYYFVEQFVWLAKSGLIDAKHSRKF  150

Query  323  SFVSAFGESVGY---VFFVISDFILISR-------GIQAERKLRHSKVAEEDENEEQIKK  174
              +SA+ E VGY   V   + D   I++        ++  R LR     +E   E Q+ K
Sbjct  151  QKLSAWAELVGYFGSVALKLGDLGAIAKEEACLKSSVEITR-LREGGCVDE---EAQLGK  206

Query  173  IRADRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +R  + M RL  V      ++     +  N      V +  +GL+SA    ++NW S
Sbjct  207  LRDKKTMKRLSVVQDLADAVMALDDVLNGNGPFSKPVLMASAGLLSALISTHKNWVS  263



>gb|KEH40100.1| peroxisomal biogenesis factor 11 family protein [Medicago truncatula]
Length=261

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 119/228 (52%), Gaps = 16/228 (7%)
 Frame = -2

Query  653  FLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLTG  477
            +LAKRDG+DKL+K  +Y +KL+    +  S P L HR K +E + G+SRKAFR G+F+  
Sbjct  37   YLAKRDGVDKLLKISRYTAKLILASNLSASDPNLTHRLKSFESSVGVSRKAFRLGKFVQD  96

Query  476  FNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGES  297
             NALR +   +    + + +A  GE  YFF +  +WLS+ G++DPK ++  + +SA+ E 
Sbjct  97   LNALRNTRVDSTRDLIFSFIAYGGEGFYFFIEQFVWLSKTGLIDPKRSKTFTKISAYAEF  156

Query  296  VGY----------VFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVM-R  150
            +GY          +  ++ D   +   I+    LR     EE   E +++K+R   +M +
Sbjct  157  IGYFGSIALKTRDLKIIVEDEACLKSSIEINV-LRGDGCGEE---EIKLRKLREKILMKK  212

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            L  V      L+     ++        + L  +GL+SA    ++NW S
Sbjct  213  LSIVQDLADGLMALDDILDGKGLFSKPIVLSSAGLLSALISTHKNWVS  260



>ref|XP_003544424.1| PREDICTED: peroxisomal membrane protein 11A-like [Glycine max]
Length=259

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 136/237 (57%), Gaps = 18/237 (8%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D +  +  +LAKRDG+DKL+K  +Y +KL+    + +S+P L+HR K +E + G+SRKAF
Sbjct  27   DLLSHVEAYLAKRDGVDKLLKISRYATKLILASSLLQSNPTLSHRLKSFESSVGVSRKAF  86

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NAL+ +   +     L+LLA  GE  Y+F +  +WL++ G++DPK AR   
Sbjct  87   RLGKFVQDLNALKTTHPHSKRQLFLSLLAYGGEGFYYFVEQFVWLAKSGLIDPKHARFFQ  146

Query  320  FVSAFGESVGY---VFFVISDFILISR-------GIQAERKLRHSKVAEEDENEEQIKKI  171
             +SA+ E VGY   V   + D   I++        ++  R LR S   +E   E ++ K+
Sbjct  147  KLSAWAEFVGYFGSVALKLGDLQEIAKEEACVESSVEITR-LRGSGCVDE---EVRLGKL  202

Query  170  RADRVMRLMavaaniadliial--adIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            R  ++M+ ++V  ++AD ++AL        PF    V + ++GL+SA    ++NW S
Sbjct  203  REKKMMKRLSVVQDLADAVMALDDILDGKGPF-SKPVLMALAGLLSALISSHKNWIS  258



>ref|XP_009364643.1| PREDICTED: peroxisomal membrane protein 11A-like [Pyrus x bretschneideri]
 ref|XP_009364647.1| PREDICTED: peroxisomal membrane protein 11A-like [Pyrus x bretschneideri]
 ref|XP_009364654.1| PREDICTED: peroxisomal membrane protein 11A-like [Pyrus x bretschneideri]
Length=261

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 131/233 (56%), Gaps = 10/233 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K+V  +  + ++ P L  R K +E + G+SRKA
Sbjct  29   DFLNHLEAYLAKRDGVDKLLKISRYATKIVLASSALPETLP-LTQRLKSFESSVGVSRKA  87

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +LAL+A  GE +YFF +  +WL + G++D K +R +
Sbjct  88   FRLGKFVQDVNALRSSKFDSNQELVLALIAYVGEGLYFFVEQFVWLVKTGLIDKKHSRNL  147

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRAD  162
              +SA+ E +GY   +   F  +SR  + E+ ++ S      +    +E +E++ K+R  
Sbjct  148  QKISAWAEFIGYAGSISLKFRDLSRISEDEKCVKSSIEIAIMRGNGCEEEKEKLSKLREK  207

Query  161  RVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++M RL  V  +   L+      E        +++ ++G++SA    ++NW S
Sbjct  208  KMMKRLSVVQDSADALMALADIREGGGPFLGPLSISLAGMLSALISTHKNWVS  260



>ref|XP_008347423.1| PREDICTED: peroxisomal membrane protein 11A-like [Malus domestica]
Length=261

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/234 (34%), Positives = 140/234 (60%), Gaps = 12/234 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K+V  +  + ++ P L  R K +E + G+SRKA
Sbjct  29   DFLNHLEAYLAKRDGVDKLIKISRYATKIVIASSALPETLP-LTQRLKSFESSVGVSRKA  87

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +LAL+A  GE +YFF +  +WL + G++D K +R +
Sbjct  88   FRLGKFVQDVNALRSSTFDSNQELVLALIAYGGEGLYFFVEQFVWLVKSGLIDKKHSRNL  147

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRAD  162
              +SA+ E +GY   +   F  ++R  + E+ ++ S      +    +E +E++ K+R  
Sbjct  148  QKISAWAEFIGYAGSIXLKFRDLNRISEDEKCVKSSIEIXITRGNGCEEEKERLSKLREK  207

Query  161  RVMRLMavaaniadliialadIEP--NPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++M+ ++V  + AD ++ALADI     PF    +++ ++G++SA    ++NW S
Sbjct  208  KMMKRLSVVQDSADALMALADIRDGGGPF-LGPLSVSLAGMLSALISTHKNWVS  260



>ref|XP_009365575.1| PREDICTED: peroxisomal membrane protein 11A-like [Pyrus x bretschneideri]
Length=261

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 140/234 (60%), Gaps = 12/234 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K+V  +  + ++ P L  R K +E + G+SRKA
Sbjct  29   DFLNHLEAYLAKRDGVDKLIKISRYATKIVLASSALPETLP-LTQRLKSFESSVGVSRKA  87

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +LAL+A   E +YFF +  +WL + G++D KL+R +
Sbjct  88   FRLGKFVQDVNALRSSKFDSNQELVLALIAYGCEGLYFFVEQFVWLVKSGLIDKKLSRNL  147

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRAD  162
              +SA+ E +GY   +   F  ++R  + E+ ++ S      +V   +E +E++ K+   
Sbjct  148  QKISAWAEFIGYAGSISLKFRDLNRISEDEKCVKSSIEIAITRVNGCEEEKERLSKLCEK  207

Query  161  RVMRLMavaaniadliialadIEP--NPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            R+M+ ++V  + AD ++ALADI     PF    +++ ++G++SA    ++NW S
Sbjct  208  RMMKRLSVVQDSADALMALADIRDGGGPF-LGPLSVSLAGMLSALISTHKNWVS  260



>ref|XP_008377400.1| PREDICTED: peroxisomal membrane protein 11A-like [Malus domestica]
Length=261

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 140/234 (60%), Gaps = 12/234 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG++KL+K  +Y +K+V  +  + ++ P L  R K +E + G+SRKA
Sbjct  29   DFLNHLEAYLAKRDGVBKLIKISRYATKIVIASSALPETLP-LTQRLKSFESSVGVSRKA  87

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +LAL+A  GE +YFF +  +WL + G++D K +R +
Sbjct  88   FRLGKFVQDVNALRSSTFDSNQELVLALIAYGGEGLYFFVEQFVWLVKSGLIDKKHSRNL  147

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRAD  162
              +SA+ E +GY   +   F  ++R  + E+ ++ S      +    +E +E++ K+R  
Sbjct  148  QKISAWAEFIGYAGSIXLKFRDLNRISEDEKCVKSSIEIXITRGNGCEEEKERLSKLREK  207

Query  161  RVMRLMavaaniadliialadIEP--NPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++M+ ++V  + AD ++ALADI     PF    +++ ++G++SA    ++NW S
Sbjct  208  KMMKRLSVVQDSADALMALADIRDGGGPF-LGPLSVSLAGMLSALISTHKNWVS  260



>ref|XP_010106027.1| Peroxisomal membrane protein 11A [Morus notabilis]
 gb|EXC07297.1| Peroxisomal membrane protein 11A [Morus notabilis]
Length=264

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 130/243 (53%), Gaps = 15/243 (6%)
 Frame = -2

Query  692  PVAMNDTVDK-----LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHP-ELAHRAKLWE  531
            P+  N  VD+     L  +LAKRDG+DKL+K  +Y +K++      S    L  R K +E
Sbjct  22   PIPPNPKVDRDFLNHLEAYLAKRDGVDKLLKISRYATKIILASSALSETLTLTRRLKSFE  81

Query  530  VASGLSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGV  351
               G+SRKAFR G+F+   NALR S   +    +L+++A  GE +Y+F +  +WL++ G+
Sbjct  82   TNVGVSRKAFRLGKFVQDVNALRNSHFDSKEELVLSVIAYGGEGLYYFVEQFIWLAKSGL  141

Query  350  VDPKLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS-------KVAEEDEN  192
            +DPK +R +  +SA+ E +GY+  +   F  ++R  + E  L  S        +  ++EN
Sbjct  142  IDPKHSRNLQKISAWAEFIGYLGSMSLKFRDLNRICEDEACLESSIGIAITRGIGFKEEN  201

Query  191  EEQIKKIRADRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRN  15
             E+++K+R  ++M RL  V      L+      +        +++  +GL+SA    ++N
Sbjct  202  -ERLRKLREKKLMKRLSIVQDLADGLMALADIRDGKGLLLGPLSVSCAGLLSALISTHKN  260

Query  14   WPS  6
            W S
Sbjct  261  WIS  263



>ref|XP_007226019.1| hypothetical protein PRUPE_ppa010125mg [Prunus persica]
 gb|EMJ27218.1| hypothetical protein PRUPE_ppa010125mg [Prunus persica]
Length=262

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 139/238 (58%), Gaps = 14/238 (6%)
 Frame = -2

Query  692  PVAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVAS  522
            P    D ++ +  +LAKRDG+DKL+K  +Y +K++      + PE   L HR K +E + 
Sbjct  25   PKKERDFLNHVEAYLAKRDGVDKLLKISRYATKII--LASSALPETLTLTHRLKSFESSV  82

Query  521  GLSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDP  342
            G+SRKAFR G+F+   NALR S   +    +L+L A  GE +YFF +  +WL++ G++D 
Sbjct  83   GVSRKAFRLGKFVQDVNALRNSNFDSNEDLVLSLFAYGGEGLYFFVEQFIWLAKSGLIDS  142

Query  341  KLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQI  180
            K +R +  +SA+ E +GYV  +   F  ++R  + E+ L+ S      +  +  E +E++
Sbjct  143  KHSRSLQKISAWAEFIGYVGSISLKFRDLNRISEDEKCLKSSIEIAITRGNKCQEEKERL  202

Query  179  KKIRADRVMRLMavaaniadliialadIE--PNPFCCHTVTLGISGLVSAWAGWYRNW  12
             K+   ++M+ ++V  + AD ++ALADI     PF    +++ ++G++SA    ++NW
Sbjct  203  SKLCEKKLMKRLSVVQDAADALMALADIRDGDGPF-LGPLSISLAGMLSALISTHKNW  259



>ref|XP_002955780.1| hypothetical protein VOLCADRAFT_66153 [Volvox carteri f. nagariensis]
 gb|EFJ43205.1| hypothetical protein VOLCADRAFT_66153 [Volvox carteri f. nagariensis]
Length=234

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 115/232 (50%), Gaps = 9/232 (4%)
 Frame = -2

Query  686  AMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRK  507
            +  D  DK+  FLAKR+GIDK +K  +Y ++L    +     EL  R   +E + G+SRK
Sbjct  3    SQEDVFDKISRFLAKREGIDKTLKVLRYSARLA-VALSPKDQELTKRLSSFEKSVGVSRK  61

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+FL   N+LR S        +L LLA  GE +Y+F +   WL + G ++  L  R
Sbjct  62   AFRLGKFLQDVNSLRHSKTKDATI-ILELLAYGGEGIYYFIEQFTWLVKTGALNKDLEER  120

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQ-----AERKLRHSKVAEEDENEEQIKKIRAD  162
            +++ SAF E VGY   +   ++ + + I+      ER L+  K   + + E  +  +R  
Sbjct  121  LAYASAFAELVGYAGNIWISYLKLEKLIKQESELTERLLKLRKGVTDAKLESTLVTLRFQ  180

Query  161  RVMR--LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNW  12
            R +R  L+      + + +       +      V L ++GL S    +Y+NW
Sbjct  181  RNLRCALIVQDIADSVMALNDVTGGRHRALNSPVVLALAGLTSGCISFYKNW  232



>ref|XP_008357176.1| PREDICTED: peroxisomal membrane protein 11A-like [Malus domestica]
 ref|XP_008357177.1| PREDICTED: peroxisomal membrane protein 11A-like [Malus domestica]
 ref|XP_008357178.1| PREDICTED: peroxisomal membrane protein 11A-like [Malus domestica]
Length=261

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 141/234 (60%), Gaps = 12/234 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSK--LVNWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K  L +  + ++ P L  R K +E + G+SRKA
Sbjct  29   DFLNHLEAYLAKRDGVDKLLKISRYATKIALASSVLPETLP-LTQRLKSFESSVGVSRKA  87

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +LAL+A  GE +YFF +  +WL + G++D K +R +
Sbjct  88   FRLGKFVQDVNALRSSKFDSNQELVLALIAYGGEGLYFFVEQFVWLVKSGLIDKKHSRNL  147

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS-KVAEE-----DENEEQIKKIRAD  162
              +SA+ E +GY   +   F  ++R  + E+ ++ S ++A       +E +E++ K+R  
Sbjct  148  QKISAWAEFIGYAGSISLKFRDLNRISEDEKCVKSSIEIAITRGNGCEEEKERLSKLREK  207

Query  161  RVMRLMavaaniadliialadIEP--NPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++M+ ++V  + AD ++ALADI     PF    +++ ++G++SA    ++NW S
Sbjct  208  KMMKRLSVVQDSADALMALADIRDGGGPF-LGPLSISLAGMLSALISTHKNWVS  260



>ref|XP_006854415.1| hypothetical protein AMTR_s00039p00202880 [Amborella trichopoda]
 gb|ERN15882.1| hypothetical protein AMTR_s00039p00202880 [Amborella trichopoda]
Length=240

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/235 (32%), Positives = 124/235 (53%), Gaps = 15/235 (6%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D  D   ++LAKRDG+DKL+K  +Y SK+V +  I   +  L  R K +E + G+SRKAF
Sbjct  9    DFTDHFEVYLAKRDGVDKLLKISRYASKIVISSAILPENSPLNQRLKSFESSVGVSRKAF  68

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NAL++    + A +L  ++A  GE +Y+F +  LWLS+ G++    ++ + 
Sbjct  69   RLGKFIQDLNALKKVAFDSRAGKL-GIVAYGGEGIYYFVEQFLWLSKAGLISGHYSKNLQ  127

Query  320  FVSAFGESVGYVFFV---------ISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIR  168
             VSA+ E +GY+  +         I++  L  R    E KL+     E DE  E+++++ 
Sbjct  128  KVSAWAEFIGYIGSISLKTLDLKAINEEELGLRAALEELKLQGK---EFDEEAEKLQRLE  184

Query  167  ADRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
              ++M RL  V      L+      +   F    V +  +GL+SA    ++NW S
Sbjct  185  EKKLMKRLSIVQDFADALMALGDIKDGRGFLAKPVFVAFAGLLSAIISTHKNWVS  239



>ref|NP_001150920.1| peroxisomal biogenesis factor 11 family protein [Zea mays]
 gb|ACG40951.1| peroxisomal biogenesis factor 11 family protein [Zea mays]
 tpg|DAA44968.1| TPA: peroxisomal biogenesis factor 11 family protein [Zea mays]
Length=242

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 126/225 (56%), Gaps = 7/225 (3%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            D +  L  +LA+RDG+DKL+K  +Y ++L         P  + R K +E + GLSRKAFR
Sbjct  23   DFLAHLEAYLARRDGVDKLLKISRYATRLALAAGPPLPPGASARLKSFESSVGLSRKAFR  82

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
             G+F+   NAL   P P P+   LALLA  GE VY+F +  +W+++ G++   L  R+  
Sbjct  83   LGKFVQSLNALLAHPHPPPS---LALLAYGGEGVYYFVEQFVWIAKAGLLPAHLLPRLQR  139

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SA+ E +GYV  ++   I +    + E  ++   V + D+  E +K ++   +++ M+V
Sbjct  140  LSAWAELLGYVGSIL---IKLEEVAKIESSIKKRLVKDCDKESEAVKTMQGKLLLKRMSV  196

Query  137  aaniadliialadIEPNPFCCHTVTL-GISGLVSAWAGWYRNWPS  6
              ++AD ++AL D+        + TL   +GL+SA    ++NW S
Sbjct  197  VQDVADAVMALGDVTDGKGLLGSSTLMAAAGLLSALISTHKNWNS  241



>ref|XP_004984653.1| PREDICTED: peroxisomal membrane protein 11-3-like [Setaria italica]
Length=242

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 123/225 (55%), Gaps = 7/225 (3%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            D +  L  +LA+RDG+DKL+K  +Y ++L         P  + R K +E + GLSRKAFR
Sbjct  23   DFLAHLEAYLARRDGVDKLLKISRYSARLALSAGPPLPPSASARLKSFESSVGLSRKAFR  82

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
             G+F+   NALR  P P PA   LA+LA  GE VY+F +  +WL++ G++   L  R+  
Sbjct  83   LGKFVQSLNALRAHPHPPPA---LAVLACGGEGVYYFVEQFVWLAKAGLLPAHLLPRLQL  139

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SA+ E +GYV  +    I +    + E  ++        E  E ++ +R   +++ M+V
Sbjct  140  LSAWAELLGYVGSIA---IKLEEVAKIESSIKERLAEGCGEESEAVRTMRGKLLLKRMSV  196

Query  137  aaniadliialadIEPNPFCCHTVTLGIS-GLVSAWAGWYRNWPS  6
              ++AD ++AL D+        + TL  S GL+SA    ++NW S
Sbjct  197  VQDVADAVMALGDVTDGKGWLGSSTLMASAGLLSALISTHKNWKS  241



>ref|XP_001694061.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02997.1| predicted protein [Chlamydomonas reinhardtii]
Length=204

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 88/155 (57%), Gaps = 2/155 (1%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
             D +DK   FLAKR+GIDK +K  +Y ++LV   ++    EL  R   +E + G+SRKAF
Sbjct  6    EDFLDKTSRFLAKREGIDKTLKLLRYTARLV-VSLQPKDQELTKRLAAFEKSVGVSRKAF  64

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+FL   N+LR S      F +L L+A  GE +Y+F +   WL + G +   L  R++
Sbjct  65   RLGKFLQDVNSLRHSQTKDAQF-VLELVAYGGEGIYYFLEQFTWLVKTGALSKDLEERLA  123

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHS  216
            + SA  E VGY   +   F+ + + +Q ER++  +
Sbjct  124  YASALAELVGYAGNIWLSFLKLQKLMQQEREVEAT  158



>ref|XP_008220763.1| PREDICTED: peroxisomal membrane protein 11A [Prunus mume]
 ref|XP_008220764.1| PREDICTED: peroxisomal membrane protein 11A [Prunus mume]
 ref|XP_008220765.1| PREDICTED: peroxisomal membrane protein 11A [Prunus mume]
Length=262

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 78/240 (33%), Positives = 139/240 (58%), Gaps = 14/240 (6%)
 Frame = -2

Query  692  PVAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVAS  522
            P    D ++ +  +LAKRDG+DKL+K  +Y +K++      + PE   L HR K +E + 
Sbjct  25   PKKERDFLNHVEAYLAKRDGVDKLLKISRYATKII--LASSALPETLTLTHRLKSFESSV  82

Query  521  GLSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDP  342
            G+SRKAFR G+F+   N LR S   +    +L+L+A  GE +YFF +  +WL++ G++D 
Sbjct  83   GVSRKAFRLGKFVQDVNGLRNSNFDSNEDLVLSLIAYGGEGLYFFVEQFIWLAKSGLIDS  142

Query  341  KLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQI  180
            K +R +  +SA+ E +GYV  +   F  ++R  + E+ L+ S      +  +  E +E++
Sbjct  143  KHSRSLQKISAWAEFIGYVGSISLKFRDLNRISEDEKCLKSSIEIAITRGNKCQEEKERL  202

Query  179  KKIRADRVMRLMavaaniadliialadIE--PNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
              +   ++M+ ++V  + AD ++ALADI     PF    +++ ++G++SA    ++NW S
Sbjct  203  SILCEKKLMKRLSVVQDAADALMALADIRDGDGPF-LGPLSISLAGMLSALISTHKNWVS  261



>ref|XP_004499131.1| PREDICTED: peroxisomal membrane protein 11A-like [Cicer arietinum]
Length=264

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 116/239 (49%), Gaps = 42/239 (18%)
 Frame = -2

Query  653  FLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLTG  477
            +LAKRDGIDKL+K  +Y +KL+       S P L  R K +E + G+SRKAFR G+F+  
Sbjct  40   YLAKRDGIDKLLKICRYTTKLILASSFLASDPNLTQRLKSFESSVGVSRKAFRLGKFIQD  99

Query  476  FNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGES  297
             NALR S   +    LL+L+A  GE  Y+F +  +WLS+ G++D K ++    VSA+ E 
Sbjct  100  LNALRNSHVDSKRELLLSLIAYGGEGFYYFIEQFVWLSKTGLIDSKRSKIFQKVSAYAEF  159

Query  296  VGY---VFFVISDFILIS---------------RGIQAE------RKLRHSKVAEEDENE  189
            VGY   V   I D  +I+               RG+  E      RKLR  K+ +    +
Sbjct  160  VGYFGSVALKIRDLRIINEDEACLKSSIEIGVLRGVGCEEEKIRSRKLREKKLMK----K  215

Query  188  EQIKKIRADRVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNW  12
              I +  AD +M L                ++        + +  +GL+SA    ++NW
Sbjct  216  VSIVQDLADGLMAL-------------DDILDGKGIFSKPILMSSAGLLSALISTHKNW  261



>ref|XP_009145032.1| PREDICTED: peroxisomal membrane protein 11A-like [Brassica rapa]
 emb|CDY23656.1| BnaA05g17730D [Brassica napus]
 emb|CDY10615.1| BnaC03g69990D [Brassica napus]
Length=226

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D ++ L  +LAKRDG+DKL+K  +Y +K++    +      L HR K +E + G+SRKAF
Sbjct  7    DFLNHLETYLAKRDGVDKLLKISRYTTKIILASSLLPESGSLTHRLKSFESSVGVSRKAF  66

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NALR SP  +    LL ++A  GE +Y+F +  +WL++ G++D K A+ + 
Sbjct  67   RLGKFVQDINALRASPRDSSRDLLLLVIAYGGEGLYYFVEQFIWLAKSGLIDAKHAKWLQ  126

Query  320  FVSAFGESVGYV  285
             +SA+ E VGYV
Sbjct  127  KISAWAELVGYV  138



>ref|XP_010690954.1| PREDICTED: peroxisomal membrane protein 11A [Beta vulgaris subsp. 
vulgaris]
Length=245

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 126/241 (52%), Gaps = 23/241 (10%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L ++L+KRDG+DKL+K  +Y SK +  +  +  +HP L  R K +E + GLSRKA
Sbjct  10   DFLNHLEVYLSKRDGVDKLLKISRYASKFIISSSILPHAHP-LTRRLKSFESSVGLSRKA  68

Query  503  FRSGRFLTGFNALR---RSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLA  333
            FR G+F+   NALR   R    +  F +L+L++  GE +Y+F + I+WLS+ G++  + A
Sbjct  69   FRLGKFIQDVNALRSAAREENRSRLFYILSLISYGGEGIYYFVEQIVWLSKSGLIHARHA  128

Query  332  RRMSFVSAFGESVGY---VFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRAD  162
              +  +SA+ E VGY   +   + D   +   ++         V  ++  EE+ +K++  
Sbjct  129  SELQKISAWSEFVGYLGSISLKVEDLKELDEKLKCLCSSIEIAVVRDENCEEEREKVKVV  188

Query  161  RVMRLMavaaniadliialadIEP---------NPFCCHTVTLGISGLVSAWAGWYRNWP  9
            R+  +M   + + D    L  +           +PF      L  +GL+SA    ++NW 
Sbjct  189  RLKMMMKKLSILQDFADGLMALADIRDGKGKVFSPF-----VLSCAGLLSALISTHKNWI  243

Query  8    S  6
            S
Sbjct  244  S  244



>ref|XP_010027036.1| PREDICTED: peroxisomal membrane protein 11A [Eucalyptus grandis]
Length=267

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 127/228 (56%), Gaps = 10/228 (4%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKAFRSGR  489
            L  +LAKRDG+DK +K  +Y +K+V  +  + ++ P L  R K +E + GLSRKAFR G+
Sbjct  40   LEAYLAKRDGVDKALKISRYAAKIVLASSLLPETLP-LHRRLKSFESSVGLSRKAFRFGK  98

Query  488  FLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSA  309
            F+   NA R SP  +    +L+L+A  GE +Y+F +  +WL++ G++D + +R +S +SA
Sbjct  99   FVQDVNAFRASPLDSGQDLILSLIAYGGEGIYYFVEQFVWLAKSGLIDGRHSRLLSKISA  158

Query  308  FGESVGYVFFV---ISDFILISRG---IQAERKLRHSKVAEEDENEEQIKKIRADRVM-R  150
            + E VGYV  V   I D  ++      +++  ++  S+  +  + E +++K+R  ++M +
Sbjct  159  WAEFVGYVGSVNLKIRDLRMLREDEACVESSIEIATSRGVDCKDEELKLRKLREKKLMKK  218

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            L  +      L+      +        + +  +GLVSA    ++NW S
Sbjct  219  LSIIQDLADGLMALADIRDGKGRLSGPLLMSCAGLVSALISTHKNWVS  266



>ref|XP_002302475.2| hypothetical protein POPTR_0002s13510g [Populus trichocarpa]
 gb|EEE81748.2| hypothetical protein POPTR_0002s13510g [Populus trichocarpa]
Length=283

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 86/134 (64%), Gaps = 5/134 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L ++LAKRDG+DKL+K  +Y +K++        PE   L  R K +E + GLSRK
Sbjct  23   DFLNHLEVYLAKRDGVDKLLKISRYATKII--LASSLLPETLILTKRLKSFESSVGLSRK  80

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR SP  T    +L+++A  GE +Y+F +  +WL++ G++D K ++ 
Sbjct  81   AFRLGKFVQDVNALRDSPFDTKQETILSIIAYGGEGLYYFVEQFVWLAKSGLIDSKHSKS  140

Query  326  MSFVSAFGESVGYV  285
            +  VSA+ E VGY+
Sbjct  141  LGKVSAWAEFVGYI  154



>gb|KDP38472.1| hypothetical protein JCGZ_04397 [Jatropha curcas]
Length=322

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 127/239 (53%), Gaps = 12/239 (5%)
 Frame = -2

Query  692  PVAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVAS  522
            P    D +++L  +LAKRDG+DKL+K  +Y SK++      + PE   L  R K +E + 
Sbjct  85   PTKDRDFLNRLEAYLAKRDGVDKLLKISRYASKII--LASSALPESLILTQRLKSFESSV  142

Query  521  GLSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDP  342
            GLSRKAFR G+F+   NALR S   +    +L+++A  GE +Y+F +  +WL++ G++D 
Sbjct  143  GLSRKAFRVGKFVQDVNALRNSHLDSKQQIILSIIAFGGEGLYYFVEQFVWLAKAGLIDS  202

Query  341  KLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQI  180
            K ++ +  +SA+ E +GY+  +   F  +   ++ E  L+ +      +     E EE++
Sbjct  203  KHSKFLGKISAWTEFIGYIGSISLKFRDLKNLLEDEVCLKSTIEVAIARGVGYQEEEERM  262

Query  179  KKIRADRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +K+R   +M +L  V      L+      +        + +  +GL+SA    ++NW S
Sbjct  263  RKLREKTLMKKLSIVQDFADGLMAFADIRDGKGPLSAPLLVSSAGLLSALISTHKNWVS  321



>ref|XP_011017298.1| PREDICTED: peroxisomal membrane protein 11A-like [Populus euphratica]
Length=255

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 104/185 (56%), Gaps = 11/185 (6%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L ++LAKRDG+DKL+K  +Y +K++        PE   L  R K +E + GLSRK
Sbjct  23   DFLNHLEVYLAKRDGVDKLLKISRYATKII--LASSLLPETLILTKRLKSFESSVGLSRK  80

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR  P  T    +L++ A  GE +Y+F +  +WL++ G++D K ++ 
Sbjct  81   AFRLGKFVQDVNALRDCPFDTKQETILSIFAYGGEGLYYFVEQFVWLAKSGLIDSKHSKS  140

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRA  165
            +  VSA+ E VGY+  +   F  + +  + E  L  S      +     E E ++ K+R 
Sbjct  141  LGKVSAWAEFVGYIGSISLKFRDLKKLSEEEVCLESSIAVTVTRGVRCQEGERRLWKLRE  200

Query  164  DRVMR  150
             ++M+
Sbjct  201  KKLMK  205



>ref|XP_006393523.1| hypothetical protein EUTSA_v10011736mg [Eutrema salsugineum]
 gb|ESQ30809.1| hypothetical protein EUTSA_v10011736mg [Eutrema salsugineum]
Length=249

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 107/199 (54%), Gaps = 35/199 (18%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L  +LAKRDG+DKL+K  +Y +K++        PE   L  R K +E + G+SRK
Sbjct  17   DFLNHLETYLAKRDGVDKLLKISRYATKII--LASSLIPETGSLNTRLKSFESSVGVSRK  74

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR S   T    L+ ++A  GE +Y+F +  +WL++ G++D K ++ 
Sbjct  75   AFRLGKFVQDINALRASRWDTNRDLLMLIIAYGGEGLYYFVEQFIWLAKSGLIDAKHSKW  134

Query  326  MSFVSAFGESVGYVFFV---ISDF---------------ILISRGIQAERKLRHSKVAEE  201
            +  +SA+ E +GYV  V   I D                I +SRGI  E           
Sbjct  135  LQRISAWAELIGYVGSVSLKIKDLRKIKEEETCVASTIEISVSRGISCE-----------  183

Query  200  DENEEQIKKIRADRVMRLM  144
             E +E+IKK+R  + ++++
Sbjct  184  -EEDEKIKKLREKKTLKVL  201



>ref|XP_007017468.1| Peroxin 11A isoform 1 [Theobroma cacao]
 gb|EOY14693.1| Peroxin 11A isoform 1 [Theobroma cacao]
Length=251

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 124/233 (53%), Gaps = 10/233 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +L+KRDG+DKL+K  +Y +K++  +  + ++ P L  R K +E + GLSRKA
Sbjct  19   DFLNHLEAYLSKRDGVDKLLKISRYATKIILASSVLPETVP-LTRRLKSFESSVGLSRKA  77

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +     L+++A  GE +Y+F +  +WL++ G++D K +R +
Sbjct  78   FRLGKFVQDVNALRNSHLDSKQEIFLSIIAYGGEGLYYFVEQFIWLAKSGLIDAKHSRNL  137

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRH------SKVAEEDENEEQIKKIRAD  162
              +SA+ E +GY+  +   F  + R  + E  L        S+ A   E EE+  K+R  
Sbjct  138  QKLSAWAEFIGYIGSISLKFRDLKRINEDEACLNSSIEIAVSRGAGCKEEEERRNKLREK  197

Query  161  RVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             +M +L  V      L+      +        + +  +GL+SA    ++NW S
Sbjct  198  ELMKKLSVVQDLADGLMALADIQDGKGRFSDPLVVSCAGLLSALISTHKNWVS  250



>ref|XP_010543082.1| PREDICTED: peroxisomal membrane protein 11A isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543083.1| PREDICTED: peroxisomal membrane protein 11A isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010543085.1| PREDICTED: peroxisomal membrane protein 11A isoform X2 [Tarenaya 
hassleriana]
Length=258

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 104/186 (56%), Gaps = 9/186 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D ++ L  +LAKRDG+DKL+K  +Y SK++    +   +  L  R K +E + GLSRKAF
Sbjct  26   DFLNHLETYLAKRDGVDKLLKISRYASKIILASSVLSENVTLNRRLKSFESSVGLSRKAF  85

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NALR S   +    L +++A  GE +Y+F +  +WLS+ G++D + AR + 
Sbjct  86   RLGKFVQDVNALRSSRWDSNHEVLFSIVAYGGEGLYYFVEQFIWLSKSGLIDARHARWLQ  145

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKV-------AEEDENEEQIKKIRAD  162
             +SA+ E VGY+   IS  I   R I+ E     S +             EE++KK+R  
Sbjct  146  GISAWAEFVGYI-GSISMKIRDLRTIREEEACLASTMEISVTRGVSCRAEEEKMKKVREK  204

Query  161  RVMRLM  144
            + M+ +
Sbjct  205  KTMKAL  210



>ref|XP_002510349.1| peroxisomal biogenesis factor, putative [Ricinus communis]
 gb|EEF52536.1| peroxisomal biogenesis factor, putative [Ricinus communis]
Length=261

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 126/246 (51%), Gaps = 26/246 (11%)
 Frame = -2

Query  692  PVAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVAS  522
            P    D ++ L  +LAKRDG+DKL+K  +Y SK++      + PE   L  R K +E + 
Sbjct  24   PSKEKDFLNHLETYLAKRDGVDKLLKISRYASKII--LASNTLPETLILTQRLKSFESSV  81

Query  521  GLSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDP  342
            GLSRKAFR G+F+   N++R S   T    +L+++A  GE +Y+F +  +WL + G++D 
Sbjct  82   GLSRKAFRLGKFVQDINSIRNSHFDTKQEVVLSIIAYGGEGLYYFVEQFVWLVKAGLIDG  141

Query  341  KLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEE-------------  201
            K  +++  +SA+ E VGY+         IS  ++  +KL  ++V                
Sbjct  142  KHTKKLGKISAWAEFVGYIGS-------ISIKLRDLKKLNENEVCLGSSIEVAAVRGNGF  194

Query  200  DENEEQIKKIRADRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGW  24
            +E E++++K+R  ++M +L         L+      +        + + ++GL+SA    
Sbjct  195  EEEEKRMRKLREKKLMKKLSIAQDFADGLMALADIRDGKGRLSGPLWVSVAGLLSALIST  254

Query  23   YRNWPS  6
             +NW S
Sbjct  255  RKNWVS  260



>ref|XP_002467997.1| hypothetical protein SORBIDRAFT_01g037780 [Sorghum bicolor]
 gb|EER94995.1| hypothetical protein SORBIDRAFT_01g037780 [Sorghum bicolor]
Length=242

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 124/225 (55%), Gaps = 7/225 (3%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            D +  L  +LA+RDG+DKL+K  +Y ++L         P  + R K +E + GLSRKAFR
Sbjct  23   DFLAHLEAYLARRDGVDKLLKISRYAARLALAAGPPLPPGASARLKSFESSVGLSRKAFR  82

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
             G+F+   NALR  P P PA   LALLA  GE VY+F +  +WL++ G++   L  R+  
Sbjct  83   LGKFVQSLNALRAHPHPPPA---LALLAYGGEGVYYFVEQFVWLAKAGLLPAHLLPRLQR  139

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SA+ E  GYV  +    I +    + E  ++     + D+  E +K ++   +++ M+V
Sbjct  140  LSAWAELPGYVGSIA---IKLEEVAKIESSIKKRLAEDCDKESEAVKTMQGKLLLKRMSV  196

Query  137  aaniadliialadIEPNPFCCHTVTLGIS-GLVSAWAGWYRNWPS  6
              ++AD ++AL D+        + TL  S GL+SA    ++NW S
Sbjct  197  VQDVADAVMALGDVTDGKGLLGSSTLMASAGLLSALISTHKNWNS  241



>ref|XP_010905683.1| PREDICTED: peroxisomal membrane protein 11-3-like [Elaeis guineensis]
Length=259

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 124/228 (54%), Gaps = 16/228 (7%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE--LAHRAKLWEVASGLSRKAFRSGR  489
            L  +LA+RDG+DKL+K  +Y SK+V   +  S P   LA R K +E + GLSRKAFR G+
Sbjct  38   LEAYLARRDGVDKLLKISRYASKIV---LSTSLPSEALAPRLKAFESSVGLSRKAFRVGK  94

Query  488  FLTGFNALRRSPGPTPAFR----LLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            F+   NA R +     +      LLA +A  GE +Y+F +  +WLS+ G++    +RR+ 
Sbjct  95   FVQDVNAFRSASAAGASPSSVDLLLAAVAYGGEGLYYFVEQFVWLSKAGLIPSHHSRRLQ  154

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKV--AEEDENEEQIKKIRADRVMR-  150
             +SA+ E VGY    +    L ++ ++  R L  SKV   +  E+EE+I+K+R   +++ 
Sbjct  155  KISAWAELVGY----LGSISLKAKELRKIRFLLESKVRGTKSSEDEEEIRKLRVKLLLKQ  210

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            L  V      L+      +   F  + + +  +GL+SA    ++NW +
Sbjct  211  LSIVQDLADGLMALGDVSDGKGFLSNPLLMASAGLLSALISTHKNWTA  258



>gb|KFM25604.1| Peroxisomal membrane protein 11A [Auxenochlorella protothecoides]
Length=241

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 128/238 (54%), Gaps = 14/238 (6%)
 Frame = -2

Query  683  MNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRK  507
            M+ T++    FLAKRDGIDK +K  +Y S+L+    + +  PEL  + K  E + G +RK
Sbjct  1    MSLTLNNATDFLAKRDGIDKTLKVIRYTSRLLLAGSLPRYAPELGAQLKALEGSLGTTRK  60

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            A + G+FL G   LR S  P  +   L L+A  G+ VY F + + W+ ++G++  + A  
Sbjct  61   ALKLGKFLGGVKNLR-SITPRTSHAALKLVAGVGDTVYLFMEQLQWMIKVGLLSKRHADS  119

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQAERK----LRHSKVAEE-----DENEEQ--I  180
            +S+VSA+ E VGY   +    +L    ++ E K    L  S+  +E     DE++ Q  +
Sbjct  120  LSYVSAWFELVGYCGSITLATLLQQESLELELKILDDLARSRQTDESWGPQDEHKVQARL  179

Query  179  KKIRADRVMRLMavaaniadliialadIEPNPFCCHTVTL-GISGLVSAWAGWYRNWP  9
             ++RA R +R +++  + AD  +ALADI+ +        L   +GL+SA    Y  WP
Sbjct  180  SELRAVRTLRTLSILQDAADSFLALADIQKSGKLLQNPALQAAAGLLSAVISGYTKWP  237



>ref|XP_007017469.1| Peroxin 11A isoform 2, partial [Theobroma cacao]
 gb|EOY14694.1| Peroxin 11A isoform 2, partial [Theobroma cacao]
Length=228

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 121/228 (53%), Gaps = 10/228 (4%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKAFRSGR  489
            L  +L+KRDG+DKL+K  +Y +K++  +  + ++ P L  R K +E + GLSRKAFR G+
Sbjct  1    LEAYLSKRDGVDKLLKISRYATKIILASSVLPETVP-LTRRLKSFESSVGLSRKAFRLGK  59

Query  488  FLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSA  309
            F+   NALR S   +     L+++A  GE +Y+F +  +WL++ G++D K +R +  +SA
Sbjct  60   FVQDVNALRNSHLDSKQEIFLSIIAYGGEGLYYFVEQFIWLAKSGLIDAKHSRNLQKLSA  119

Query  308  FGESVGYVFFVISDFILISRGIQAERKLRH------SKVAEEDENEEQIKKIRADRVM-R  150
            + E +GY+  +   F  + R  + E  L        S+ A   E EE+  K+R   +M +
Sbjct  120  WAEFIGYIGSISLKFRDLKRINEDEACLNSSIEIAVSRGAGCKEEEERRNKLREKELMKK  179

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            L  V      L+      +        + +  +GL+SA    ++NW S
Sbjct  180  LSVVQDLADGLMALADIQDGKGRFSDPLVVSCAGLLSALISTHKNWVS  227



>emb|CDY25676.1| BnaC05g25550D [Brassica napus]
Length=223

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 83/132 (63%), Gaps = 4/132 (3%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D ++ L  +LAKRDG+DKL+K  +Y +K++    +      L HR K +E + G+SRKAF
Sbjct  7    DFLNHLETYLAKRDGVDKLLKISRYTTKIILASSLLPESGSLTHRLKSFESSVGVSRKAF  66

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NALR SP  +    LL ++A  GE +Y+F +  +WL++ G++D K  ++  
Sbjct  67   RLGKFVQDINALRASPRDSSRDLLLLVIAYGGEGLYYFVEQFIWLAKSGLIDAKWLQK--  124

Query  320  FVSAFGESVGYV  285
             +SA+ E VGYV
Sbjct  125  -ISAWAELVGYV  135



>gb|EPS72971.1| hypothetical protein M569_01784, partial [Genlisea aurea]
Length=264

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 120/230 (52%), Gaps = 7/230 (3%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
             D + +L I+LAKRDG+DKL+K  +Y +++V      S   L  R K +E + G+SRKAF
Sbjct  36   KDFLTQLEIYLAKRDGVDKLLKISRYATRIVLSSSIVSDDSLIGRLKSFESSVGVSRKAF  95

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NA+R      P+  LLAL+A+ GE +Y+F +  +WL + G++D +    + 
Sbjct  96   RLGKFVQNINAVRSISRSNPSL-LLALIAHGGEGLYYFIEQFVWLGKSGLIDKRHLPWLQ  154

Query  320  FVSAFGESVGY---VFFVISDFILI-SRGIQAERKLRHSKVAEEDENEEQIKKIRADRVM  153
              SA+ E +GY   V   + +  +I  R  + E  +    +  E E EE ++++R  + M
Sbjct  155  RWSAWSEFIGYFGSVGLKLGELKIIDDRERRVEIAISRGIIGCEAEQEE-LRRLREKKTM  213

Query  152  -RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             RL  +      L+      +        V +  +GL+SA    ++NW S
Sbjct  214  KRLSVIQDFADGLMALADIRDGRGRLSAPVIVSFAGLLSAVISTHKNWVS  263



>gb|KFK29076.1| hypothetical protein AALP_AA7G085700 [Arabis alpina]
Length=245

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 81/133 (61%), Gaps = 2/133 (2%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K++     I ++   L  R K +E   G+SRKA
Sbjct  12   DFLNHLETYLAKRDGVDKLLKISRYATKIILSTSLIPETSQSLTTRLKTFESNVGISRKA  71

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    LL L+A  GE +Y+F +  +WL + G++D K  + +
Sbjct  72   FRLGKFVQDINALRISRWDSNQDLLLVLVAYGGEGLYYFVEQFIWLVKSGLIDAKHGKWL  131

Query  323  SFVSAFGESVGYV  285
              +SA+ E VGY+
Sbjct  132  QRISAWAELVGYI  144



>ref|XP_009107407.1| PREDICTED: peroxisomal membrane protein 11A [Brassica rapa]
Length=247

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 105/188 (56%), Gaps = 15/188 (8%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K++  +  I +++P L HR K +E + G+SRKA
Sbjct  16   DFLNHLETYLAKRDGVDKLLKISRYTTKIILASSLIPQTNP-LTHRLKSFESSVGVSRKA  74

Query  503  FRSGRFLTGFNALRRSPGPTP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            FR G+F+   N+LR S   +     LL +LA  GE VY+F + ++WLS+ G++D K  ++
Sbjct  75   FRLGKFVQDINSLRASRHDSNRGLALLPILAYGGEGVYYFVEQLVWLSKSGLIDAKWLQK  134

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEE-------DENEEQIKKIR  168
            +S        VG V   + D     R I+ E     S +             EE+++K++
Sbjct  135  ISAWQGLVGYVGSVSLKVRDL----REIKKEEACVASTIEISVTRGIACGGEEEKMRKLK  190

Query  167  ADRVMRLM  144
              + M+++
Sbjct  191  EKKTMKVL  198



>gb|KDO84453.1| hypothetical protein CISIN_1g039694mg, partial [Citrus sinensis]
Length=235

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 89/135 (66%), Gaps = 5/135 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K++  +  + ++ P L  R K +E + GLSRKA
Sbjct  25   DFLNHLEAYLAKRDGVDKLLKLSRYATKIILASSVLPETLP-LTGRLKSFESSVGLSRKA  83

Query  503  FRSGRFLTGFNALRRSPGPTPAFR--LLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            FR G+F+   NALR S   + +    +L+++A  GE +Y+F +  +WL++ G++DPK +R
Sbjct  84   FRLGKFVQDVNALRNSHLDSLSREDLILSVIAYGGEGLYYFVEQFIWLAKSGLIDPKQSR  143

Query  329  RMSFVSAFGESVGYV  285
             +  +SA+ E +GY+
Sbjct  144  SLQKISAWAEFIGYI  158



>ref|XP_002281733.1| PREDICTED: peroxisomal membrane protein 11A [Vitis vinifera]
Length=260

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 122/234 (52%), Gaps = 12/234 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L  +LAKRDG+DKL+K  +Y ++++        PE   L  R K +E + G+SRK
Sbjct  28   DFLNHLEAYLAKRDGVDKLLKISRYATRII--LASSLLPETLTLNRRLKSFESSVGVSRK  85

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR +   +    +L+++A  GE +Y F +  +W  + G++D K +R 
Sbjct  86   AFRLGKFVQDLNALRNTCFDSKEDVILSIIAYGGEGLYMFIEQFVWFVKSGLIDAKHSRN  145

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQAERKLRH------SKVAEEDENEEQIKKIRA  165
            +  +SA+ E VGY+  +      + R  + E +L        S+  + DE  ++I+K++ 
Sbjct  146  LQKISAWAEFVGYIGSISLKIRDLKRINEDESRLLSTIEISISRGLKYDEEAKKIQKMKE  205

Query  164  DRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             R+M RL  V      L+      +        + +  +GL+SA    ++NW S
Sbjct  206  KRLMKRLSIVQDLADGLMALADIRDGKGRLSGPLLMSSAGLLSALISAHKNWLS  259



>ref|XP_002985810.1| hypothetical protein SELMODRAFT_234888 [Selaginella moellendorffii]
 gb|EFJ12987.1| hypothetical protein SELMODRAFT_234888 [Selaginella moellendorffii]
Length=247

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 124/237 (52%), Gaps = 15/237 (6%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELA-HRAKLWEVASGLSRKAFRS  495
            ++ L  +LA+RDG+DKL+K  +Y +K+         P+ A  R +L+E + G SRKAFR 
Sbjct  10   LEHLESYLARRDGVDKLLKIARYAAKIAVAAQPSPLPDGALDRLRLFEASVGTSRKAFRL  69

Query  494  GRFLTGFNALRR---SPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            G+F+   NAL R   SP       +L L+A  GE +Y+F +  +WL++ G++D   ++++
Sbjct  70   GKFVQDVNALLRASKSPHRDRQRWILELIAYGGEGLYYFVEQFVWLAKTGLIDKHHSKKL  129

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLR--HSKVAEED--ENEE------QIKK  174
              +SA+ E VGY   VI  +  IS  I  E+ L   H +   ED    EE      QI+ 
Sbjct  130  QKISAWTEFVGYFGSVILKYQEISAMIAREKALTDAHRRHKREDAASREEIVSLKSQIQS  189

Query  173  IRADRVMRLMavaan-iadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            + + R+++ +++  +    L+      +        + L  +GLVSA    ++NW S
Sbjct  190  LHSKRLLKTLSLIQDFADSLLALSDIRDGRGVLSAPLLLASAGLVSATISAHKNWNS  246



>ref|XP_006473464.1| PREDICTED: peroxisomal membrane protein 11A-like [Citrus sinensis]
Length=259

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 89/135 (66%), Gaps = 5/135 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K++  +  + ++ P L  R K +E + GLSRKA
Sbjct  25   DFLNHLEAYLAKRDGVDKLLKLSRYATKIILASSVLPETLP-LTGRLKSFESSVGLSRKA  83

Query  503  FRSGRFLTGFNALRRSPGPTPAFR--LLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            FR G+F+   NALR S   + +    +L+++A  GE +Y+F +  +WL++ G++DPK +R
Sbjct  84   FRLGKFVQDVNALRNSHLDSLSREDLILSVIAYGGEGLYYFVEQFIWLAKSGLIDPKQSR  143

Query  329  RMSFVSAFGESVGYV  285
             +  +SA+ E +GY+
Sbjct  144  SLQKISAWAEFIGYI  158



>emb|CDY17001.1| BnaA08g03650D [Brassica napus]
Length=240

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 107/192 (56%), Gaps = 22/192 (11%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K++  +  I +++P L  R K +E + G+SRKA
Sbjct  8    DILNHLETYLAKRDGVDKLLKISRYTTKIILASSLIPQTNP-LTPRLKSFESSVGVSRKA  66

Query  503  FRSGRFLTGFNALRRSP--GPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            FR G+F+   N+LR S          LL +LA  GE VY+F +  +WLS+ G++D K  +
Sbjct  67   FRLGKFVQDINSLRASRWRDSNRGLALLPILAYGGEGVYYFVEQFVWLSKSGLIDAKWLQ  126

Query  329  RMSFVSAFGESVGYVFFV---ISDFILISRGIQAERKLRHSKVAEE-------DENEEQI  180
            +M   SA+ E VGYV  V   + D     R I+ E     S +             EE++
Sbjct  127  KM---SAWAELVGYVGSVSLKVRDL----REIKKEEACVASTIEISVTRGIACGGEEEKM  179

Query  179  KKIRADRVMRLM  144
            +K++  + M+++
Sbjct  180  RKLKEKKTMKVL  191



>ref|XP_010479175.1| PREDICTED: peroxisomal membrane protein 11A [Camelina sativa]
Length=243

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 86/133 (65%), Gaps = 3/133 (2%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K+V  +  I ++ P +  R K +E + G+SRKA
Sbjct  11   DFLNHLETYLAKRDGVDKLLKISRYATKIVLASSLIPETKP-IVPRLKSFESSVGVSRKA  69

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +L L+A  GE +Y+F +  +WL++ G++D K ++ +
Sbjct  70   FRLGKFVQDINALRSSRWDSNRELVLILIAYGGEGLYYFVEQFIWLAKSGLIDAKHSKWL  129

Query  323  SFVSAFGESVGYV  285
              +SA+ E VGYV
Sbjct  130  QKISAWAELVGYV  142



>ref|XP_006434939.1| hypothetical protein CICLE_v10002211mg [Citrus clementina]
 gb|ESR48179.1| hypothetical protein CICLE_v10002211mg [Citrus clementina]
Length=259

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 89/135 (66%), Gaps = 5/135 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K++  +  + ++ P L  R K +E + GLSRKA
Sbjct  25   DFLNHLEAYLAKRDGVDKLLKLSRYATKIILASSVLPETLP-LTGRLKSFESSVGLSRKA  83

Query  503  FRSGRFLTGFNALRRSPGPTPAFR--LLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            FR G+F+   NALR S   + +    +L+++A  GE +Y+F +  +WL++ G++DPK +R
Sbjct  84   FRLGKFVQDVNALRNSHLDSLSREDLILSVIAYGGEGLYYFVEQFIWLAKSGLIDPKHSR  143

Query  329  RMSFVSAFGESVGYV  285
             +  +SA+ E +GY+
Sbjct  144  SLQKISAWAEFIGYI  158



>ref|XP_011031523.1| PREDICTED: peroxisomal membrane protein 11A-like [Populus euphratica]
Length=255

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 122/234 (52%), Gaps = 12/234 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L ++LAKRDG+DKL+K  +Y +K++        PE   +  R K +E + GLSRK
Sbjct  23   DFLNHLEVYLAKRDGVDKLLKISRYATKII--LASSVLPETLIVTKRLKSFESSVGLSRK  80

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR S   +    +L+ +A  GE +Y+F +  +WL++ G++D K ++ 
Sbjct  81   AFRLGKFVQDVNALRGSHFDSKQEIVLSFIAYGGEGLYYFVEQFVWLAKSGLIDSKHSKS  140

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRA  165
            +  +SA+ E +GYV  +   F  + +  + E  L  S      +     E E ++ K+R 
Sbjct  141  LGKISAWAEFIGYVGSISLKFRDLKKLSEDEACLESSVEIAVTRGVGRQEEERRLWKLRE  200

Query  164  DRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             ++M +L  V      L+      +        + +  +GL+SA    ++NW S
Sbjct  201  KKLMKKLSIVQDFADGLMALADIRDGRGQFSGPLLVSCAGLLSALISTHKNWVS  254



>ref|XP_010320374.1| PREDICTED: peroxisomal membrane protein 11A [Solanum lycopersicum]
Length=256

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = -2

Query  653  FLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            +LAKRDG+DKL+K  +Y SK++  +  I  S P L+ R K +E + G+SRKAFR G+F+ 
Sbjct  32   YLAKRDGVDKLLKISRYASKIILASSVIPDSLP-LSQRLKSFESSVGVSRKAFRLGKFVQ  90

Query  479  GFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGE  300
              NALR +   +    LL++LA  GE +Y+F +  +WL + G++D K    +  +SA+ E
Sbjct  91   DVNALRSANISSKEDLLLSILAYGGEGLYYFVEQFIWLGKAGLIDKKNLNSLQKISAWCE  150

Query  299  SVGYV  285
             +GY+
Sbjct  151  FIGYI  155



>ref|XP_006375076.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa]
 gb|ERP52873.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa]
Length=255

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 122/234 (52%), Gaps = 12/234 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L ++LAKRDG+DKL+K  +Y +K++        PE   +  R K +E + GLSRK
Sbjct  23   DFLNHLEVYLAKRDGVDKLLKISRYATKII--LASSVLPETLIVTKRLKSFESSVGLSRK  80

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR S   +    +L+ +A  GE +Y+F +  +WL++ G++D K ++ 
Sbjct  81   AFRLGKFVQDVNALRGSHFDSKQEIILSFIAYGGEGLYYFVEQFVWLAKSGLIDSKHSKS  140

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRA  165
            +  +SA+ E VGY+  +   F  + +  + E  L  S      +     E E ++ K+R 
Sbjct  141  LGKISAWAEFVGYIGSISLKFRDLKKLSEDEVCLESSVEIAVTRGVGRQEEERRLWKLRE  200

Query  164  DRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             ++M +L  V      L+      +        + +  +GL+SA    ++NW S
Sbjct  201  KKLMKKLSIVQDFADGLMALADIRDGRGQFSGPLLVSCAGLLSALISTHKNWVS  254



>ref|XP_009608297.1| PREDICTED: peroxisomal membrane protein 11A [Nicotiana tomentosiformis]
Length=239

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 102/176 (58%), Gaps = 9/176 (5%)
 Frame = -2

Query  653  FLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            +L+KRDG+DKL+K  +Y SK++     I +S P L+ R K +E + G+SRKAFR G+F+ 
Sbjct  15   YLSKRDGVDKLLKISRYASKVIIAASVIPESLP-LSRRLKSFESSVGVSRKAFRLGKFVQ  73

Query  479  GFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGE  300
              NALR +   +    +L++LA  GE +Y+F +  +WL + G++D K    +  +SA+ E
Sbjct  74   DVNALRSANISSKEELILSILAYGGEGLYYFVEQFVWLGKAGLIDKKYLSNLQKISAWCE  133

Query  299  SVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRADRVMR  150
             +GY+  V      + +  + E  L  +      +    +E EE+I+K+R  ++M+
Sbjct  134  FIGYIGSVSLKVKELKKISEDEACLVSTIEVSIIRGIGYNEEEEKIRKLRMKKLMK  189



>ref|XP_009782199.1| PREDICTED: peroxisomal membrane protein 11A [Nicotiana sylvestris]
Length=239

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 106/184 (58%), Gaps = 9/184 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D +  L  +L+KRDG+DKL+K  +Y SK++  +  I +S P L+ R K +E + G+SRKA
Sbjct  7    DFLIHLEAYLSKRDGVDKLLKISRYASKIIIASSVIPESLP-LSRRLKSFESSVGVSRKA  65

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR +   +    +L++LA  GE +Y+F +  +WL + G++D K    +
Sbjct  66   FRLGKFVQDLNALRSANISSKEELILSILAYGGEGLYYFVEQFVWLGKAGLIDKKNLSNL  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQIKKIRAD  162
              +SA+ E +GY+  V      + +  + E  L  +      +    +E EE+++K+R  
Sbjct  126  QKISAWCEFIGYIGSVSLKVKELKKISEDEACLVSTIEISIIRGIGYNEEEEKLRKLRMK  185

Query  161  RVMR  150
            ++M+
Sbjct  186  KLMK  189



>ref|XP_010461571.1| PREDICTED: peroxisomal membrane protein 11A-like [Camelina sativa]
Length=243

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 86/133 (65%), Gaps = 3/133 (2%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +L+KRDG+DKL+K  +Y +K+V  +  I ++ P +  R K +E + G+SRKA
Sbjct  11   DFLNHLETYLSKRDGVDKLLKISRYATKIVLASSLIPETKP-IVPRLKSFESSVGVSRKA  69

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +L L+A  GE +Y+F +  +WL++ G++D K ++ +
Sbjct  70   FRLGKFVQDINALRSSRWDSNRDLVLILIAYGGEGLYYFVEQFIWLAKSGLIDAKHSKWL  129

Query  323  SFVSAFGESVGYV  285
              +SA+ E VGYV
Sbjct  130  QKISAWAELVGYV  142



>gb|AID68437.1| putative peroxisomal membrane protein 11A-like protein, partial 
[Hypericum perforatum]
Length=154

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSK-LVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D +  L ++LAKRDG+DKL+K  +Y +K L+   +      L  R + +E + GLSRKAF
Sbjct  18   DFLTHLEVYLAKRDGVDKLLKISRYAAKILLASSVLPDTIPLTRRLRSFESSVGLSRKAF  77

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NALR S   +    ++A +A  GE +Y+F + ++WLS+ G++  + AR + 
Sbjct  78   RLGKFVQDVNALRGSRLDSREEIIIAAVAYGGEGIYYFVEQLVWLSKTGLIGDRHARALG  137

Query  320  FVSAFGESVGYV  285
             VSA+ E VGY+
Sbjct  138  RVSAWAEFVGYL  149



>ref|XP_006305998.1| hypothetical protein CARUB_v10011277mg, partial [Capsella rubella]
 gb|EOA38896.1| hypothetical protein CARUB_v10011277mg, partial [Capsella rubella]
Length=263

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D ++ L  +L+KRDG+DKL+K  +Y +K++    +      +  R K +E + G+SRKAF
Sbjct  31   DFLNHLETYLSKRDGVDKLLKISRYATKIILASSLIPETKSIVPRLKTFESSVGVSRKAF  90

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NALR S   +    +L L+A  GE +Y+F +  +WL++ G++D K ++ + 
Sbjct  91   RLGKFVQDINALRSSRWESNQELVLILIAYGGEGLYYFVEQFIWLTKSGLIDAKYSKLLQ  150

Query  320  FVSAFGESVGYV  285
             +SA+ E VGYV
Sbjct  151  KISAWAELVGYV  162



>ref|XP_002984748.1| hypothetical protein SELMODRAFT_121160 [Selaginella moellendorffii]
 gb|EFJ13998.1| hypothetical protein SELMODRAFT_121160 [Selaginella moellendorffii]
Length=247

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 120/237 (51%), Gaps = 15/237 (6%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELA-HRAKLWEVASGLSRKAFRS  495
            ++ L  +LA+RDG+DKL+K  +Y +K+         P+ A  R +L+E + G SRKAFR 
Sbjct  10   LEHLESYLARRDGVDKLLKIARYAAKIAVAAQPSPLPDGALDRLRLFEASVGTSRKAFRL  69

Query  494  GRFLTGFNALRR---SPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            G+F+   NAL R   SP       +L L+A  GE +Y+F +  +WL++ G+++   ++++
Sbjct  70   GKFVQDVNALLRASKSPHRDRQRWILELIAYGGEGLYYFVEQFVWLAKTGLINKHHSKKL  129

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKL----RHSKVAEEDENEE------QIKK  174
              +SA+ E VGY   VI  +  IS  I  E+ L    R  K  +    EE      QI+ 
Sbjct  130  QKISAWTEFVGYFGSVILKYQEISAMIAREKALIDAHRRHKREDAASREEIVSLKSQIQS  189

Query  173  IRADRVMR-LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            + + R ++ L  +      L+      +        + L  +GLVSA    ++NW S
Sbjct  190  LHSKRFLKTLSLIQDFADSLLALSDIRDGRGVLSAPLLLASAGLVSATISAHKNWNS  246



>ref|XP_002281759.1| PREDICTED: peroxisomal membrane protein 11A [Vitis vinifera]
 emb|CBI19654.3| unnamed protein product [Vitis vinifera]
Length=260

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 120/234 (51%), Gaps = 12/234 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L  +LAKRDG+DKL+K  +Y +K++        PE   L  R K +E + G+SRK
Sbjct  28   DFLNHLEAYLAKRDGVDKLLKISRYATKII--LASSLLPETLTLNRRLKSFESSVGVSRK  85

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR S   +    +L+++A  GE +Y F +  +W  + G++D K +R 
Sbjct  86   AFRLGKFVQDLNALRNSCFDSKEDVILSIIAYGGEGLYMFVEQFVWFVKSGLIDAKHSRN  145

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQAERKLRH------SKVAEEDENEEQIKKIRA  165
            +  +SA+   VG++  +      + R  + E +L        S+  + DE  ++I K++ 
Sbjct  146  LQKISAWAGFVGHIGSISLKIRDLKRINEDESRLLSTIEISISRGLKYDEEAKKIHKLKE  205

Query  164  DRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             R+M RL  V      L+      +        + +  +GL+SA    ++NW S
Sbjct  206  KRLMKRLSIVQDLADGLMALADIRDGKGRLSGPLLMSSAGLLSALTSAHKNWLS  259



>ref|XP_010254932.1| PREDICTED: peroxisomal membrane protein 11A [Nelumbo nucifera]
Length=251

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 87/132 (66%), Gaps = 3/132 (2%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K++  +  + +S P L  R + +E + G+SRKA
Sbjct  19   DFLNHLEAYLAKRDGVDKLLKISRYATKIILASSVLPQSLP-LNRRLRSFESSVGVSRKA  77

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR +   +   R+L++LA  GE  Y+F + ++WL++ G++D K + ++
Sbjct  78   FRLGKFVQDLNALRNASFDSNVERILSVLAYGGEGFYYFVEQLVWLNKAGLLDSKYSLKL  137

Query  323  SFVSAFGESVGY  288
              ++A+ E +G+
Sbjct  138  QKIAAWAEFIGF  149



>ref|XP_002894067.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH70326.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=248

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 85/133 (64%), Gaps = 3/133 (2%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +LAKRDG+DKL+K  +Y +K++  +  I +S   +  R K +E + G+SRKA
Sbjct  16   DFLNHLETYLAKRDGVDKLLKISRYATKIILASSLIPESR-SIIPRLKSFESSVGVSRKA  74

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +L L+A  GE +Y+F +  +WL++ G++D K ++ +
Sbjct  75   FRLGKFVQDINALRSSRWDSNHELVLLLIAYGGEGLYYFVEQFIWLTKSGLIDAKHSKWL  134

Query  323  SFVSAFGESVGYV  285
              +SA+ E VGYV
Sbjct  135  QKISAWAELVGYV  147



>ref|XP_001766434.1| predicted protein [Physcomitrella patens]
 gb|EDQ68762.1| predicted protein [Physcomitrella patens]
Length=240

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 123/233 (53%), Gaps = 19/233 (8%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAFRS  495
            ++ L  +LA+RDG+DK +K  +Y +KL+    I    PE+  R K ++ + G SRKAFR 
Sbjct  11   LEHLEAYLARRDGVDKALKILRYSTKLLLASPIAPKDPEVYGRLKDFDASVGSSRKAFRL  70

Query  494  GRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFV  315
            G+F+   N L+++   T     L L+A  GE  Y+F +  +WL + G++D + ++R++ +
Sbjct  71   GKFIQDVNVLKKTNFNTRD-GFLELVATGGEGFYYFVEQFVWLVKAGLIDKRHSKRLTKI  129

Query  314  SAFGESVGYVFFVISDFILISRGIQAERKLRHS--KVAEEDENE-EQIKKIRADRVMRLM  144
            SA+ E +GY   V    I +S  ++ E KL     K AE   +   +IK+++A +  RLM
Sbjct  130  SAWAEFIGYFGSVALKSIQVSIYLEQEAKLLQGMRKKAEGGISPVSEIKELQALQGKRLM  189

Query  143  avaaniadliialadIE---------PNPFCCHTVTLGISGLVSAWAGWYRNW  12
               + I DL  +L  +           NPF      L  +GL+SA     +NW
Sbjct  190  KTLSIIQDLADSLLALTDIRETKGVLDNPFL-----LAFAGLLSALISAQKNW  237



>ref|NP_001049868.1| Os03g0302000 [Oryza sativa Japonica Group]
 sp|Q10MN2.1|PX113_ORYSJ RecName: Full=Peroxisomal membrane protein 11-3; AltName: Full=OsPEX11-3; 
AltName: Full=Peroxin-11-3 [Oryza sativa Japonica 
Group]
 sp|A2XFQ8.1|PX113_ORYSI RecName: Full=Peroxisomal membrane protein 11-3; AltName: Full=OsPEX11-3; 
AltName: Full=Peroxin-11-3 [Oryza sativa Indica 
Group]
 gb|ABF95493.1| Peroxisomal biogenesis factor 11 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11782.1| Os03g0302000 [Oryza sativa Japonica Group]
 gb|EAY89668.1| hypothetical protein OsI_11201 [Oryza sativa Indica Group]
 gb|EAZ26627.1| hypothetical protein OsJ_10530 [Oryza sativa Japonica Group]
Length=242

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 121/217 (56%), Gaps = 8/217 (4%)
 Frame = -2

Query  653  FLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLTGF  474
            +L++RDG+DKL+K     +  +        P  + R K +E + GLSRKAFR G+F+   
Sbjct  32   YLSRRDGVDKLLK-ISRYAARLALAAGPLPPAASARLKSFESSVGLSRKAFRLGKFVQNV  90

Query  473  NALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGESV  294
            NALR  P P PA   +ALLA  GE VY+F +  +WL++ G++   L  R+  +SA+ E +
Sbjct  91   NALRAHPHPPPA---VALLAYGGEGVYYFLEQFVWLAKAGLLPAHLLPRLQRLSAWAELL  147

Query  293  GYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMavaaniadli  114
            GYV  +      I + +++  K+R  +   E+ +   ++ +R   +++ M+V  ++AD +
Sbjct  148  GYVGSITIKLEEIGK-LESSVKMRLKEGCREESD--VVRTLRVKLLLKRMSVVQDVADAV  204

Query  113  ialadIEPNPFCCHTVTLGIS-GLVSAWAGWYRNWPS  6
            +AL D+        + TL  S GL+SA    ++NW S
Sbjct  205  MALGDVTDGKGLLGSSTLMASAGLLSALISAHKNWNS  241



>ref|XP_006367303.1| PREDICTED: peroxisomal membrane protein 11A-like [Solanum tuberosum]
Length=258

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = -2

Query  653  FLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            +LAKRDG+DKL+K  +Y SK++  +  I +S P L+ R K +E + G+SRKAFR G+F+ 
Sbjct  34   YLAKRDGVDKLLKISRYASKIILASSVIPESLP-LSLRLKSFESSVGVSRKAFRLGKFVQ  92

Query  479  GFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGE  300
              NALR +   +    LL++LA  GE +Y+F +  +W  + G++D K    +  +SA+ E
Sbjct  93   DVNALRSANISSKEDLLLSILAYGGEGLYYFVEQFVWFGKAGLIDKKNLNSLQKISAWCE  152

Query  299  SVGYV  285
             +GY+
Sbjct  153  FIGYI  157



>emb|CBI19655.3| unnamed protein product [Vitis vinifera]
Length=241

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 81/134 (60%), Gaps = 5/134 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L  +LAKRDG+DKL+K  +Y ++++        PE   L  R K +E + G+SRK
Sbjct  28   DFLNHLEAYLAKRDGVDKLLKISRYATRII--LASSLLPETLTLNRRLKSFESSVGVSRK  85

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR +   +    +L+++A  GE +Y F +  +W  + G++D K +R 
Sbjct  86   AFRLGKFVQDLNALRNTCFDSKEDVILSIIAYGGEGLYMFIEQFVWFVKSGLIDAKHSRN  145

Query  326  MSFVSAFGESVGYV  285
            +  +SA+ E VGY+
Sbjct  146  LQKISAWAEFVGYI  159



>ref|XP_008807786.1| PREDICTED: peroxisomal membrane protein 11A-like [Phoenix dactylifera]
Length=322

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 118/224 (53%), Gaps = 17/224 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE--LAHRAKLWEVASGLSRKAFRSGR  489
            L  +LA+RDG+DKL+K  +Y +K+    +  S P   L+ R + +E + GLSRKAFR G+
Sbjct  106  LEAYLARRDGVDKLLKLSRYAAKIA---LSTSLPSESLSPRLRAFESSVGLSRKAFRLGK  162

Query  488  FLTGFNALRRSPG-PTPAFRLLALLAN-SGEMVYFFFDHILWLSRIGVVDPKLARRMSFV  315
            F+   NALR + G PT A RLL   A   GE +YFF D  +WLS+ G++    +RR   V
Sbjct  163  FVHDVNALRAAAGSPTSADRLLLAAAAYGGEGLYFFVDQFVWLSKAGLIPSGYSRRPHKV  222

Query  314  SAFGESVGYVFFVISDFILISRGIQAERKLRH--SKVAEEDENEEQIKKIRADRVMRLM-  144
             A+ E       V++ F  I+   +  RK+R   +K  +   N+E+  K+R    ++ M 
Sbjct  223  GAWAE-------VVAHFGSITLKARELRKIRSCLAKSMDGRGNDEETSKLREKLSLQAMW  275

Query  143  avaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNW  12
             V      L++     +      + + +   G++SA  G Y+NW
Sbjct  276  LVQDLADSLMVIAEVSDGKGLLSNPLLMASVGILSAVIGAYKNW  319



>ref|XP_011083729.1| PREDICTED: peroxisomal membrane protein 11A [Sesamum indicum]
Length=261

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 122/240 (51%), Gaps = 11/240 (5%)
 Frame = -2

Query  692  PVAMN--DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASG  519
            P + N  D + +L I+LAKRDG+DKL+K  +Y +K++      +   L  R K +E + G
Sbjct  21   PTSKNQKDFLTQLEIYLAKRDGVDKLLKISRYATKIILASSLIAQEPLVTRLKSFESSVG  80

Query  518  LSRKAFRSGRFLTGFNALRRS--PGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVD  345
            +SRKAFR G+F+   NALR +     +    +L ++A  GE +Y+F +  +WL + G++D
Sbjct  81   VSRKAFRLGKFVQDVNALRSTHFTSHSDLNFVLNVIAYGGEGLYYFIEQFVWLGKAGLID  140

Query  344  PKLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS------KVAEEDENEEQ  183
             +    +   SA+ E VGY   V    I + +  + ER L  S      +  E  E  ++
Sbjct  141  KRRLPALQKWSAWCEFVGYFGSVSLKVIELRKIDEEERCLVASIDLAVLRGIECREEHDK  200

Query  182  IKKIRADRVM-RLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            ++K+R  ++M RL  V      L+      +        + +  +GL+SA    ++NW S
Sbjct  201  LRKLREKKMMKRLSMVQDLADGLMALADIRDGRGRLSAPLVVSSAGLLSALISTHKNWIS  260



>ref|NP_564514.1| peroxisomal membrane protein 11A [Arabidopsis thaliana]
 sp|Q9FZF1.1|PX11A_ARATH RecName: Full=Peroxisomal membrane protein 11A; AltName: Full=Peroxin-11A; 
Short=AtPEX11a [Arabidopsis thaliana]
 gb|AAF99792.1|AC012463_9 T2E6.18 [Arabidopsis thaliana]
 gb|ABD19655.1| At1g47750 [Arabidopsis thaliana]
 dbj|BAE99108.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32208.1| peroxisomal membrane protein 11A [Arabidopsis thaliana]
Length=248

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 83/134 (62%), Gaps = 5/134 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L  +L+KRDG+DKL+K  +Y +K++        PE   +  R K +E + G+SRK
Sbjct  16   DFLNHLETYLSKRDGVDKLLKISRYATKII--LASSLIPETRSIIPRLKSFESSVGVSRK  73

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR S   +    +L ++A  GE +Y+F +  +WL++ G++D K ++ 
Sbjct  74   AFRLGKFVQDINALRSSRWDSNHELVLLIIAYGGEGLYYFVEQFIWLTKSGLIDAKHSKW  133

Query  326  MSFVSAFGESVGYV  285
            +  +SA+ E VGYV
Sbjct  134  LQKISAWAELVGYV  147



>gb|AAM60843.1| unknown [Arabidopsis thaliana]
 emb|CAD58677.1| putative PEX11-3 protein [Arabidopsis thaliana]
Length=248

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 83/134 (62%), Gaps = 5/134 (4%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE---LAHRAKLWEVASGLSRK  507
            D ++ L  +L+KRDG+DKL+K  +Y +K++        PE   +  R K +E + G+SRK
Sbjct  16   DFLNHLETYLSKRDGVDKLLKISRYATKII--LASSLIPETRSIIPRLKSFESSVGVSRK  73

Query  506  AFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            AFR G+F+   NALR S   +    +L ++A  GE +Y+F +  +WL++ G++D K ++ 
Sbjct  74   AFRLGKFVQDINALRSSRWDSNHELVLLIIAYGGEGLYYFVEQFIWLTKSGLIDAKHSKW  133

Query  326  MSFVSAFGESVGYV  285
            +  +SA+ E VGYV
Sbjct  134  LQKISAWAELVGYV  147



>emb|CDP07555.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 86/138 (62%), Gaps = 2/138 (1%)
 Frame = -2

Query  692  PVAMN-DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE-LAHRAKLWEVASG  519
            P++ N D + +L  +LA+RDG+DKL+K  +Y +K++      S  + +  R K +E + G
Sbjct  14   PISKNRDFLLRLEAYLARRDGVDKLLKISRYATKIILASSFLSDGQTITPRLKSFESSVG  73

Query  518  LSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK  339
            LSRKAFR G+F+   NALR S   +    + +++A  GE +Y+F +  +WL++ G++D K
Sbjct  74   LSRKAFRLGKFVQDVNALRSSCFSSHQDLIFSIIAYGGEGLYYFIEQFVWLAKAGLIDKK  133

Query  338  LARRMSFVSAFGESVGYV  285
               R+  +SA+ E +GY+
Sbjct  134  NLSRLQKMSAWLEFIGYI  151



>ref|XP_010462528.1| PREDICTED: peroxisomal membrane protein 11A-like [Camelina sativa]
Length=138

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV--NWRIEKSHPELAHRAKLWEVASGLSRKA  504
            D ++ L  +L+KRDG+DKL+K  +Y +K+V  +  I ++ P L  R K +E + G+SRKA
Sbjct  11   DFLNHLETYLSKRDGVDKLLKISRYATKIVLASSLIPETKPILP-RLKSFESSVGVSRKA  69

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            FR G+F+   NALR S   +    +L L+A  GE +Y+F +  +WL++ G++D K ++ +
Sbjct  70   FRLGKFVQDINALRSSRWDSNRDLVLILIAYGGEGLYYFVEQFIWLTKSGLIDAKHSKWL  129

Query  323  SFVSAFGE  300
              +SA+ E
Sbjct  130  QKISAWAE  137



>ref|XP_006651300.1| PREDICTED: peroxisomal membrane protein 11-3-like, partial [Oryza 
brachyantha]
Length=215

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 117/215 (54%), Gaps = 10/215 (5%)
 Frame = -2

Query  644  KRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLTGFNAL  465
            +RDG+DKL+K     +  +        P  + R K +E + GLSRKAFR G+F+   NAL
Sbjct  8    RRDGVDKLLK-ISRYAARLALAAGPLPPAASARLKPFESSVGLSRKAFRLGKFVQNVNAL  66

Query  464  RRSPGP-TPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGESVGY  288
            R  P P TP    L LLA  GE VY+F +  +WL++ G++   L  R+  +SA+ E +GY
Sbjct  67   RAHPHPSTP----LVLLAYGGEGVYYFLEQFVWLAKAGLLPKHLLPRLQLLSAWAELLGY  122

Query  287  VFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMavaaniadliia  108
            V  +      I++ +++  K+R  +     E  E ++ +R   +++ M+V  ++AD ++A
Sbjct  123  VGSITIKLEEIAK-LESSVKMRLKEGC--GEKSEAVRTLRGKLLLKRMSVVQDVADAVMA  179

Query  107  ladIEPNPFCCHTVTLGIS-GLVSAWAGWYRNWPS  6
            L D+        + TL  S GL+SA    ++NW S
Sbjct  180  LGDVTDGKGLLGSSTLMASAGLLSALISAHKNWNS  214



>gb|ABK21595.1| unknown [Picea sitchensis]
Length=275

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 107/186 (58%), Gaps = 10/186 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D  + L  +LA+RDG+DK++K  +Y +K++    +      LA R K ++ + G+SRKAF
Sbjct  44   DFAEHLEAYLARRDGVDKVLKIARYSAKIILASSVVSKDALLAKRLKDFDASLGVSRKAF  103

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+  +NAL++    +    +L ++A  G+ +Y+F +   WL + G++D + + ++ 
Sbjct  104  RLGKFIQDYNALKKVSLDSKE-GILEIVAYGGDGIYYFVEQFTWLIKAGLIDDRYSAKLQ  162

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAE-------EDENEEQIKKIRAD  162
             +SA+ E +GY   + +  + IS  ++ ++ +  SK++         D+   +I ++R  
Sbjct  163  MLSAWTELIGYCGSIAAKGLQIS-ALRKKQSVLASKISGVTGEAQISDKYAAEISQLREK  221

Query  161  RVMRLM  144
            +V++++
Sbjct  222  QVLKVV  227



>gb|KDD72469.1| peroxisomal biogenesis factor 11, partial [Helicosporidium sp. 
ATCC 50920]
Length=197

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 104/189 (55%), Gaps = 12/189 (6%)
 Frame = -2

Query  542  KLWEVASGLSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLS  363
            K +E + G SRKA+R G+FL+G N++R++P   P   LL + +  G+++Y+F + + WL 
Sbjct  7    KNFESSIGTSRKAYRLGKFLSGVNSIRKTPLRAP-HALLEITSAGGDVIYYFTEQLQWLV  65

Query  362  RIGVVDPKLARRMSFVSAFGESVGYV----FFVISDFILISRGIQAERKL-RHSKVAEED  198
            + GV+    A  ++  SA+GE VGY        +    L  R +   R+L R  +  + D
Sbjct  66   KTGVLPAHWAPTLTKFSAWGELVGYSASIWLTCLRMNTLTERELALRRELFRRQRAGDGD  125

Query  197  EN-----EEQIKKIRADRVMRLMavaaniadliialadIEPNPFCCHT-VTLGISGLVSA  36
                   +E+I  +RA RV+R + +  +++DL++ALAD+       H    L ++GLVS 
Sbjct  126  AGVDKALQEEIAGLRARRVLRTLELVQDLSDLLLALADVRARGRLLHNDALLALAGLVSG  185

Query  35   WAGWYRNWP  9
                Y+NWP
Sbjct  186  SISAYKNWP  194



>ref|XP_003561709.1| PREDICTED: peroxisomal membrane protein 11-3 [Brachypodium distachyon]
Length=238

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 120/225 (53%), Gaps = 6/225 (3%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            D +  L  +LA+RDG+DKL+K  +Y ++L        H   A R K +E + GLSRKAFR
Sbjct  18   DFLVHLEAYLARRDGVDKLLKISRYAARLALAAGPLPHAASA-RLKSFESSVGLSRKAFR  76

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSF  318
             G+F+   NALR  P       ++ LLA  GE VY+F +  +WL++ G++   L  R+  
Sbjct  77   LGKFVQDVNALRAHPNLL-PPPVVLLLAYGGEGVYYFLEQFVWLAKAGLLPAHLLPRLQR  135

Query  317  VSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMav  138
            +SA+ E +GYV  +      +S+    E  +R        E  + ++ +RA  +++ ++V
Sbjct  136  LSAWAELLGYVGSITIKLEEVSK---MESSIRMRLTDGCGEENDAVRAMRAKLLLKRLSV  192

Query  137  aaniadliialadIEPNPFCCHTVTLGIS-GLVSAWAGWYRNWPS  6
              ++AD  +AL D+        + TL  S GL+SA    ++NW S
Sbjct  193  VQDVADAFMALGDVTDGKGLLGSSTLTASAGLLSALISAHKNWNS  237



>ref|XP_010905698.1| PREDICTED: peroxisomal membrane protein 11-3-like [Elaeis guineensis]
Length=293

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 79/136 (58%), Gaps = 9/136 (7%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPE--LAHRAKLWEVASGLSRKA  504
            D +  L  +LA+RDG+DKL+K  +Y +K+V   +  + P   L+ R + +E + GLS KA
Sbjct  70   DFLLHLEAYLARRDGVDKLLKISRYAAKIV---LSTTLPSDSLSPRLRAFESSVGLSHKA  126

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLAN----SGEMVYFFFDHILWLSRIGVVDPKL  336
            FR G+F+   NALR + G   +  LL   A      GE +YFF +  +WLS+ G++  + 
Sbjct  127  FRLGKFVHDVNALRATAGSPASADLLLAAAAAAAYGGEGLYFFLEQFVWLSKAGLIPSEY  186

Query  335  ARRMSFVSAFGESVGY  288
            +RR+  V A+ E V +
Sbjct  187  SRRLHKVGAWAELVAH  202



>ref|XP_010501868.1| PREDICTED: peroxisomal membrane protein 11A-like [Camelina sativa]
Length=273

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 75/139 (54%), Gaps = 20/139 (14%)
 Frame = -2

Query  521  GLSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDP  342
            G+SRKAFR G+F+   NALR S   +    +L L+A  GE +Y+F +  +WL++ G++D 
Sbjct  94   GVSRKAFRLGKFVQDINALRSSRWDSNRDLVLILIAYGGEGLYYFVEQFIWLTKSGLIDA  153

Query  341  KLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRH-------------SKVAEE  201
            K ++ +  +SA+ E VGYV  V       S  ++  RKLR              S+    
Sbjct  154  KHSKWLQKISAWAELVGYVGSV-------SMKVRDLRKLREEETCVASTIEISVSRGIAC  206

Query  200  DENEEQIKKIRADRVMRLM  144
            D  +E++K I+  + ++++
Sbjct  207  DGEDEKMKMIKGKKTLKVL  225



>gb|EYU45116.1| hypothetical protein MIMGU_mgv1a023225mg [Erythranthe guttata]
Length=230

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 79/162 (49%), Gaps = 27/162 (17%)
 Frame = -2

Query  692  PVAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSH-PELAHRAKLWEVASGL  516
            P    D +  L I+LAKRDG+DKL+K  +Y +K+V       H P L  R K +E + G+
Sbjct  18   PAKSKDFLTHLEIYLAKRDGVDKLLKISRYATKIVIASAVLDHSPPLTARLKSFESSVGV  77

Query  515  SRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKL  336
            SRKAFR G+F+                          + +YFF +  +WL + G++D + 
Sbjct  78   SRKAFRLGKFIQ-------------------------DGLYFFLEQFVWLGKSGLIDKRH  112

Query  335  ARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKV  210
               +  +SA+ E +GY F  +S  ++  R I  E +   S V
Sbjct  113  LPALQKLSAWFEFIGY-FGSVSLKVIELRKIDEEERCLASTV  153



>gb|KHN20996.1| Peroxisomal membrane protein 11A [Glycine soja]
Length=230

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/230 (30%), Positives = 116/230 (50%), Gaps = 33/230 (14%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLV-NWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            D +  +  +LAKRDG+DKL+K  +Y +KL+    + +S+P L+HR K +E + G+SRKAF
Sbjct  27   DLLSHVEAYLAKRDGVDKLLKISRYATKLILASSLLQSNPTLSHRLKSFESSVGVSRKAF  86

Query  500  RSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
            R G+F+   NAL+ +   +     L+LLA                        KL+    
Sbjct  87   RLGKFVQDLNALKTTHPHSKRQLFLSLLAYG----------------------KLSAWAE  124

Query  320  FVSAFGE---SVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMR  150
            FV  FG     +G +  +  +   +   ++  R LR S   +E   E ++ K+R  ++M+
Sbjct  125  FVGYFGSVALKLGDLQEIAKEEACLKSSVEITR-LRGSGCVDE---EVRLGKLREKKMMK  180

Query  149  LMavaaniadliial--adIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
             ++V  ++AD ++AL        PF    V + ++GL+SA    ++NW S
Sbjct  181  RLSVVQDLADAVMALDDILDGKGPF-SKPVLMALAGLLSALISSHKNWIS  229



>ref|NP_001173387.1| Os03g0301950 [Oryza sativa Japonica Group]
 sp|Q10MN3.1|PX112_ORYSJ RecName: Full=Peroxisomal membrane protein 11-2; AltName: Full=OsPEX11-2; 
AltName: Full=OsPEX11-5; AltName: Full=Peroxin-11-2 
[Oryza sativa Japonica Group]
 gb|ABF95492.1| Peroxisomal biogenesis factor 11 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH92115.1| Os03g0301950 [Oryza sativa Japonica Group]
Length=254

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/237 (28%), Positives = 116/237 (49%), Gaps = 22/237 (9%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAH----RAKLWEVASGLSR  510
            D +  +  +L++RDG+D L+K     +  +   +    P L H    R + +E + GLSR
Sbjct  26   DILVHIEAYLSRRDGVDNLLKV-SLYAARLALALAAGQPPLPHAATARLRSFESSVGLSR  84

Query  509  KAFRSGRFLTGFNALRRSP-GPTPAFR-LLALLANSGEMVYFFFDHILWLSRIGVVDPK-  339
            KAFR G+F+   NALR +   P P    LL LLA  G+ VY F +   WL++ G++  + 
Sbjct  85   KAFRLGKFVQSINALRAAAYHPHPHVHPLLVLLAYGGQGVYNFLEQFAWLAKAGLLPARL  144

Query  338  LARRMSFVSAFGE---SVGYVFFVISDFILISRGIQAERKLRHSKVAEE--DENEEQIKK  174
            L RR+  +  + +    VG +   + +   +  G++A          EE   E  E ++ 
Sbjct  145  LPRRLHRIGVWAQLLAHVGSIAIKLEEVAELECGVEAR--------LEEGCGEESEVVRT  196

Query  173  IRADRVMRLMavaaniadliialadIEPNPFCCHTVTLGIS-GLVSAWAGWYRNWPS  6
            +    +++LM++  ++ D  + + D+        + TL  S GL+SA    ++NW S
Sbjct  197  LSRKLLLKLMSLVQDMVDSAMTVGDVTGRKGLLGSSTLMASAGLLSALISVHKNWNS  253



>dbj|GAM18062.1| hypothetical protein SAMD00019534_012370, partial [Acytostelium 
subglobosum LB1]
Length=275

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/247 (26%), Positives = 113/247 (46%), Gaps = 22/247 (9%)
 Frame = -2

Query  689  VAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLW---EVASG  519
            ++MN  ++ LV   A+  G DKL K  QY +KL     ++     A    +W   E ++G
Sbjct  26   ISMNSFIESLVKLFAQTAGKDKLAKILQYGAKLFGHMCQQRKK--AEWTGIWKKIETSAG  83

Query  518  LSRKAFRSGRFLTGFNALRRSPGPTPAFRLLALLA---NSGEMVYFFFDHILWLSRIGVV  348
             +RK +R G   +    + +       F++L LLA    +G   Y+ FDH++W + +GV 
Sbjct  84   GARKVWRLGNTFSEQQKILQIIKAGNVFQILNLLALCRQTGMYFYWVFDHLVWTTSVGVT  143

Query  347  DPKLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKL---RHSKVAEEDENEEQI-  180
                A ++S+ S+    +G +  +I D   ++  I+ ER+L     S    + E +  I 
Sbjct  144  KLDTA-KLSWYSSVSWFIGLLCSIIIDIQTLNLTIKKERQLIVALTSAPTPQQEGDSAIV  202

Query  179  ----KKIRAD--RVMRLMavaaniadliialadIEPNP---FCCHTVTLGISGLVSAWAG  27
                 K++A+   V +             A + +  N    +     T+G++GLVSA  G
Sbjct  203  PVDNTKLKAELTTVQKKKNELYLNCIKNGADSIVAANLLKFYQTSQGTVGMAGLVSAIIG  262

Query  26   WYRNWPS  6
             Y+ WP+
Sbjct  263  GYQMWPA  269



>gb|EAY89667.1| hypothetical protein OsI_11200 [Oryza sativa Indica Group]
Length=237

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 74/138 (54%), Gaps = 8/138 (6%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAH----RAKLWEVASGLSR  510
            D +  +  +L++RDG+D L+K     +  +   +    P L H    R + +E + GLSR
Sbjct  26   DILVHIEAYLSRRDGVDNLLKV-SLYAARLALALAAGQPPLPHAATARLRSFESSVGLSR  84

Query  509  KAFRSGRFLTGFNALRRSP-GPTPAFR-LLALLANSGEMVYFFFDHILWLSRIGVVDPK-  339
            KAFR G+F+   NALR +   P P    LL LLA  G+ VY F +   WL++ G++  + 
Sbjct  85   KAFRLGKFVQSINALRAAAYHPHPHVHPLLVLLAYGGQGVYNFLEQFAWLAKAGLLPARL  144

Query  338  LARRMSFVSAFGESVGYV  285
            L RR+  +  + + + +V
Sbjct  145  LPRRLHRIGVWAQLLAHV  162



>ref|XP_009044052.1| hypothetical protein LOTGIDRAFT_208523 [Lottia gigantea]
 gb|ESP05507.1| hypothetical protein LOTGIDRAFT_208523 [Lottia gigantea]
Length=250

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 86/181 (48%), Gaps = 11/181 (6%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKS--HPELAHRAKLWEVASGLSRKAFRSGR  489
            +V F A+  G DKL +  QY SK V W ++K+    EL  + K  E +   +RK  R G+
Sbjct  9    VVKFNAQTAGRDKLCRLCQYGSKFVWWNLQKTGQSEELVKKLKNLEASVSTTRKLLRFGK  68

Query  488  FLTGFNALRRSPG-PTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVS  312
             +    A  +S       ++L   L+   +  Y  FDHI++  RIGV +   AR+   +S
Sbjct  69   SIDFIQAALKSIHISNTVWKLTITLSKINQACYLLFDHIIYAGRIGVANVD-ARKWKDLS  127

Query  311  AFGESVGYVFFVISDFILISRGIQAERKLRHSKV-------AEEDENEEQIKKIRADRVM  153
            A    V  +  ++ DF  I      E KLR+SK+        + D  ++Q K ++   +M
Sbjct  128  ARFWLVSLILNLVRDFYDIYHIFLHEVKLRNSKLNKSLYMNGDSDHKDKQKKILKNSELM  187

Query  152  R  150
            +
Sbjct  188  Q  188



>ref|XP_636138.1| transmembrane protein [Dictyostelium discoideum AX4]
 sp|Q54H86.1|PEX11_DICDI RecName: Full=Peroxisomal membrane protein 11 homolog; AltName: 
Full=Peroxin-11 [Dictyostelium discoideum]
 gb|EAL62629.1| transmembrane protein [Dictyostelium discoideum AX4]
Length=254

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 111/246 (45%), Gaps = 25/246 (10%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAF  501
            N  ++ L+  LA+  G DK+ K  QY +KL+ +   K         K  E  SG +RK +
Sbjct  11   NQFLESLIKLLAQTSGKDKIAKILQYGAKLLGYIFLKRSKHWVDVMKKLETTSGSARKVW  70

Query  500  RSGRFLT---GFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR  330
            R G  L       AL +   P     +LAL+  SG   Y+ FDH++  + IG+       
Sbjct  71   RLGNTLAEQQKILALFKVKNPFAFLNILALIRQSGMYFYWVFDHLILGTNIGLCKFDTV-  129

Query  329  RMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHS----------------KVAEED  198
            ++ + S+     G +  +I D   ++  ++ E+ LR +                 +  E 
Sbjct  130  KLGWYSSVSWFFGLLCSIIIDLNTLAIMLKKEKSLRLTITQNKINANNNNIDTHTITSEV  189

Query  197  ENE---EQIKKIRADRVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAG  27
            EN+   +Q  ++   +    +  A N +DLIIA   ++  PF   T+  GISG++SA  G
Sbjct  190  ENKAIIDQFNEVIKKKNEIYLNCAKNGSDLIIASTLLKIYPFSQGTI--GISGIISALIG  247

Query  26   WYRNWP  9
             Y+ WP
Sbjct  248  AYQMWP  253



>ref|XP_006840348.1| hypothetical protein AMTR_s00045p00107790 [Amborella trichopoda]
 gb|ERN02023.1| hypothetical protein AMTR_s00045p00107790 [Amborella trichopoda]
Length=235

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 107/227 (47%), Gaps = 20/227 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            L+++L K +  DK+V+T QY SK V+       P +A      + +S L+RK FR  +F+
Sbjct  14   LILYLNKAETRDKIVRTIQYGSKFVS----DGRPGIAQNV---DKSSSLARKVFRLAKFV  66

Query  482  TGFNALRRSP---GPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRM  324
               +AL   P    P P   LL    N+    + F D I+WL R G+   K    L  R+
Sbjct  67   NDLHALISPPVKGTPLPVV-LLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERTDLIARI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRVMRL  147
            +     G S       +++   +S  I+  E++L+H+   ++  NE+   K++     RL
Sbjct  126  ALYCWLGSSACSSVVELAELGRLSASIKKLEKELKHT---DKHSNEQYALKLKQSN-ERL  181

Query  146  MavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +A+     D+++A+  +E  P       +G  G +S+    Y+  PS
Sbjct  182  LALVKASMDIVVAVGLLELAPKKVTPRVIGAFGFISSLISCYQLLPS  228



>ref|XP_006649948.1| PREDICTED: peroxisomal membrane protein 11-2-like [Oryza brachyantha]
Length=259

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 94/224 (42%), Gaps = 14/224 (6%)
 Frame = -2

Query  653  FLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVAS--GLSRKAFRSGRFLT  480
            +L++RDG+D L K   Y ++L               A+L    S  GLSR A R G+F+ 
Sbjct  41   YLSRRDGVDSLQKISLYAARLALAVGPPPPLPAYAAARLRSFGSSVGLSRTALRLGKFVQ  100

Query  479  GFNALR--RSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAF  306
              NALR  R  G      LL LLA  G+ VYFF +   WL++ G++   L  R+  +  +
Sbjct  101  SVNALRAHRRHGGGHVPPLLVLLAYGGQGVYFFLEQFAWLAKTGLLPAHLLPRLHRLGVW  160

Query  305  GE---SVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRAD-RVMRLMav  138
             +    VG +   + +   +   ++  RK          E  E ++ +R    V RL  V
Sbjct  161  AQLPAHVGSIAIKLEEVAKLESSVETRRK------EGFGEESEVVRALRGKLLVKRLSVV  214

Query  137  aaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
                  ++              +  +  +G +SA    +RNW S
Sbjct  215  QDVADSVMTLGDVTGGKGLLGSSTFMASAGFLSALISAHRNWNS  258



>gb|ACJ84112.1| unknown [Medicago truncatula]
Length=178

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 81/172 (47%), Gaps = 14/172 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P  A      +  + L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKIRRAIQYGSKF----LSNGEPGKAQNV---DKTTSLARKVFRLFKFV  66

Query  482  TGFNAL-RRSPGPTP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   SP  TP    LL    N+    + F D  +WL R GV+D K    L  R+S
Sbjct  67   NDLHALISPSPQGTPLPLILLGKSKNALLSTFLFLDQFVWLGRTGVIDNKERTELVGRIS  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIR  168
                 G S+      + +   +S   +  ER++++S   + ++ + ++KKI+
Sbjct  127  LYCWLGSSICTSLVELGELGRLSGSTKKIEREIKNSNKYDNEQYQAKLKKIK  178



>ref|XP_009389495.1| PREDICTED: peroxisomal membrane protein 11-5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389503.1| PREDICTED: peroxisomal membrane protein 11-5-like [Musa acuminata 
subsp. malaccensis]
Length=236

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 81/171 (47%), Gaps = 14/171 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK ++       P  A      +  + L+RK FR  +F+
Sbjct  15   LVLYLNKAEARDKICRAIQYGSKFLS----NGKPGTAQNV---DKTTSLARKVFRLFKFV  67

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   P P  +  ++ L  +   ++  + F D I+W SR G+   K    L  R+S
Sbjct  68   NDLHALITPPSPGSSLPVILLGKSKNALLSTFLFLDQIVWASRTGIYKNKERAELLGRIS  127

Query  320  FVSAFGESVGYVFFVISDFILISRGI-QAERKLRHSKVAEEDENEEQIKKI  171
                 G S       + +   IS  + + E++L+H   +++++   +IK++
Sbjct  128  LYCWMGSSACTTLLELGELGRISSAVTKLEKELKHVDRSKDEQYHNKIKQL  178



>ref|XP_787666.1| PREDICTED: peroxisomal membrane protein 11B-like [Strongylocentrotus 
purpuratus]
Length=266

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 58/110 (53%), Gaps = 3/110 (3%)
 Frame = -2

Query  665  KLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKS--HPELAHRAKLWEVASGLSRKAFRSG  492
             ++ FL K  G DK  +T QY S+LV W I++S   P+L  + +  +     SRK  R G
Sbjct  8    NIISFLNKTGGRDKFYRTCQYGSRLVWWCIQESKRDPDLVKKLQGLDSHLSTSRKLLRIG  67

Query  491  RFLTGFNALRRSPGPT-PAFRLLALLANSGEMVYFFFDHILWLSRIGVVD  345
            + +  F A ++S   + P  +     AN  +  Y   DH+LW+ RIG+V+
Sbjct  68   KSVEFFRAAQKSVHLSDPFLQFTITFANINKASYLLIDHLLWMHRIGLVE  117



>ref|XP_002503548.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64806.1| predicted protein [Micromonas sp. RCC299]
Length=315

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 81/180 (45%), Gaps = 27/180 (15%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEV--ASGLSRKA  504
            D +D  V FL +RDG+DK +K  +YVS +  + I    P      KL ++  ++G++RK 
Sbjct  5    DALDHSVAFLKQRDGLDKTLKLMRYVSAIAAYNILADDPSSVTGTKLRKLDKSTGITRKY  64

Query  503  FRSGRFLTGFNALR-------------------RSPGPTPAFRL-----LALLANSGEMV  396
             + G+FL     LR                   R+P    A        L + +   ++V
Sbjct  65   LKLGKFLGNLKELRALLRAGEIASRQRIAPAGNRTPDAALASAAAFANRLNIASQLAQLV  124

Query  395  YFFFDHILWLSRIGVV-DPKLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRH  219
            Y F + + W ++IG++ D +  R++   ++  E   YVF +    + + R  Q E + R 
Sbjct  125  YNFAEQLNWAAKIGLIRDARRRRKIERWTSVAELATYVFTINVSMLTLWRCAQRETRARR  184



>ref|XP_004350943.1| transmembrane protein [Dictyostelium fasciculatum]
 gb|EGG14234.1| transmembrane protein [Dictyostelium fasciculatum]
Length=237

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 97/228 (43%), Gaps = 10/228 (4%)
 Frame = -2

Query  689  VAMNDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNW-RIEKSHPELAHRAKLWEVASGLS  513
            V+MN   + LV   A+  G DKL K  QY +KL  +  + + +       K  E +SG +
Sbjct  10   VSMNSYTETLVKLFAQTSGKDKLAKILQYGAKLFGYIALRQKNKHWMEVMKKLETSSGSA  69

Query  512  RKAFRSGRFLTGFN---ALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDP  342
            RK +R G  +        + R         +LAL+   G   Y+ FD+++W + IG    
Sbjct  70   RKVWRLGNTMQEQQKILQMLRQGNCHQFLNMLALIRQLGMYFYWVFDNLIWSTNIGFTKL  129

Query  341  KLARRMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRAD  162
              A R+ + S+     G V  +I D   +S  ++ E++L    V    +    + K + +
Sbjct  130  DTA-RLGWYSSISWLFGLVSSIIIDMNALSVTLRKEKQLIKDGVDINSDQYVAVLKKKHE  188

Query  161  RVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYR  18
              +      A+       L   + N       T+G  GL+SA+ G Y+
Sbjct  189  LYLNCFKNGADSVIAANLLKIYQTNQG-----TVGTCGLISAFIGAYQ  231



>ref|XP_004343743.1| predicted protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW41887.1| hypothetical protein CAOG_07019 [Capsaspora owczarzaki ATCC 30864]
Length=237

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 103/237 (43%), Gaps = 20/237 (8%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLS--RKA  504
            D    ++   +K  G DK+ +T QY SKL+ W + ++        K  ++ S LS  RK 
Sbjct  2    DVASSIIALQSKTVGRDKVYRTVQYASKLIGWYLARTSASKGTIEKFSKLESNLSLARKL  61

Query  503  FRSGRFLTGF-NALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARR  327
            FR G+ +  F   LR+     P  R       +    +   DH+LW ++ G+V+   A++
Sbjct  62   FRVGKPIDFFVEILRQVKNADPVLRNTLTGRAACLSGWLLIDHLLWFAKAGIVNVD-AKK  120

Query  326  MSFVSAFGESVGYVFFVISDFILISRGIQA-----ERKLRHSKVAEEDE------NEEQI  180
             S  SA+    G +  V+ D     R  QA     +R L     AE+ +        +Q 
Sbjct  121  WSRRSAWFWLAGLILAVVRDIYQYMRVEQARARYIQRSLNQPNSAEQAQTVLSSPTVQQF  180

Query  179  KKIRADRVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWP  9
             K  A   + L+    ++     +L  I+P+        +G+ GL+S+  G ++ WP
Sbjct  181  DKDLATHRLELIKDVCDLIIPSSSLELIQPSAGL-----VGLLGLISSLIGLHQVWP  232



>ref|XP_003623838.1| Peroxisomal membrane protein 11-1 [Medicago truncatula]
 gb|ABN08828.1| Peroxisomal biogenesis factor 11 [Medicago truncatula]
 gb|AES80056.1| peroxisomal biogenesis factor 11 family protein [Medicago truncatula]
Length=236

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 87/180 (48%), Gaps = 15/180 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P    +A+  +  + L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKF----LSNGEP---GKAQNVDKTTSLARKVFRLFKFV  66

Query  482  TGFNAL-RRSPGPTP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   SP  TP    LL    N+    + F D  +WL R GV+D K    L  R+S
Sbjct  67   NDLHALISPSPQGTPLPLILLGKSKNALLSTFLFLDQFVWLGRTGVIDNKERTELVGRIS  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
                 G S+      + +   +S  ++  ER++++S   + ++ + ++KK   +R + L+
Sbjct  127  LYCWLGSSICTSLVELGELGRLSGSMKKIEREIKNSNKYDNEQYQAKLKK-SNERTLSLI  185



>gb|AFK43968.1| unknown [Medicago truncatula]
Length=236

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 87/180 (48%), Gaps = 15/180 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P    +A+  +  + L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKF----LSNGEP---GKAQNVDKTTSLARKVFRLFKFV  66

Query  482  TGFNAL-RRSPGPTP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   SP  TP    LL    N+    + F D  +WL R GV+D K    L  R+S
Sbjct  67   NDLHALISPSPQGTPLPLILLGKSKNALLSTFLFLDQFVWLGRTGVIDNKERTELVGRIS  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
                 G S+      + +   +S  ++  ER++++S   + ++ + ++KK   +R + L+
Sbjct  127  LYCWLGSSICTSLVELGELGRLSGSMKKIEREIKNSNKYDNEQYQAKLKK-SNERTLSLI  185



>ref|XP_009138795.1| PREDICTED: peroxisomal membrane protein 11E [Brassica rapa]
 ref|XP_009138796.1| PREDICTED: peroxisomal membrane protein 11E [Brassica rapa]
 ref|XP_009138798.1| PREDICTED: peroxisomal membrane protein 11E [Brassica rapa]
 emb|CDX89096.1| BnaA04g00900D [Brassica napus]
Length=236

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 106/236 (45%), Gaps = 27/236 (11%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFR  498
            D +  ++++L K +  DK+ +  Q+ SK ++      HP  A      +  + L+RK FR
Sbjct  9    DELALIILYLNKAEARDKICRAIQFGSKFLS----GGHPGTAQTV---DKNTSLARKVFR  61

Query  497  SGRFLTGFNALRRSPGPTPAFRLLALL-----ANSGEMVYFFFDHILWLSRIGVVDPK--  339
              +FL  F+ L    GP P    L L+      N+    Y+F D  +WL R G+   K  
Sbjct  62   LFKFLNDFHLL---IGPVPKGTPLPLVLLGKSKNALLCTYYFLDQFVWLGRSGIYKNKLL  118

Query  338  --LARRMSFVSAFGESVGYVFFVISDFILISRGI-QAERKLRHSKVAEEDENEEQIKKIR  168
              L R  +     G S+  +   I + I+ S  + + E++L+  +  E+D+  ++  K++
Sbjct  119  TDLIRSFAIFCWLGSSLCNIAIQIGELIMHSSSMKKMEKELKDDE--EQDKEMDRAAKLQ  176

Query  167  --ADRVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
               DR++ L+  + +    I  L  +   PF   T   G  G V++    Y+  P 
Sbjct  177  KSKDRILALIKSSMDTVVAIGLLHLV---PFIVTTRVTGAFGFVTSLISCYQLLPG  229



>gb|EYU32055.1| hypothetical protein MIMGU_mgv1a012957mg [Erythranthe guttata]
 gb|EYU32056.1| hypothetical protein MIMGU_mgv1a012957mg [Erythranthe guttata]
Length=235

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 77/169 (46%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L+K +  DK+ +  QY SK V+       P  A      +  + L+RK FR  +F+ 
Sbjct  15   VLYLSKGEARDKICRAIQYGSKFVS----NGEPGTAQNV---DKTTSLARKVFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              +AL    +PG      LL    N+    + F D I+WL R G+   K    L  R+S 
Sbjct  68   DLHALVSPNAPGTPLPLILLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERTELLGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
                G SV      I +   +S   +  E+ L+++   + +E + ++KK
Sbjct  128  FCWLGSSVCTTLVEIGEIGRLSASTKKLEKALKNTDKYKNEEYQSKVKK  176



>ref|XP_002131580.1| PREDICTED: peroxisomal membrane protein 11A-like [Ciona intestinalis]
Length=219

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/227 (26%), Positives = 94/227 (41%), Gaps = 27/227 (12%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVAS--GLSRKAFR  498
            +D  + + +K  G DKL +  QY  K++ W ++ S       AKL +V S    +RK FR
Sbjct  1    MDFFIEYTSKTTGRDKLYRVTQYACKVIGWSLQNSSGYEDVVAKLAKVESHSSTTRKFFR  60

Query  497  SGRFLTGF-NALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
             GR L    NA +      P  R    +A+    ++   DH LWL R+GVV  K+ ++  
Sbjct  61   LGRSLESLRNAQKTVHLADPVLRTTLTIAHLNRALFLAIDHYLWLGRVGVV--KVDKKWD  118

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMRLMa  141
              ++       +  ++ D   I  G+  ER  R  K              R+  ++RL  
Sbjct  119  LSASRYYLASIIITLVRDLYAIYVGM--ERSKREGK--------------RSSFLVRLCY  162

Query  140  vaaniadliialadIEPNP------FCCHTVTLGISGLVSAWAGWYR  18
                    ++      P P      F  H   +G+ GL+S+  G Y+
Sbjct  163  ADPAATVDLVRNVCDYPIPASKLGFFPKHNGLVGVLGLISSILGAYQ  209



>gb|KDP28689.1| hypothetical protein JCGZ_14460 [Jatropha curcas]
Length=235

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 79/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKF----LSDGKPGTAQNV---DKSTSLARKVFRLLKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  67   NDLHAL-ISPVPQGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  I+  E++L++S   + D+   +++K
Sbjct  126  SLYCWMGSSVCTTLVEIGELGRLSASIKKLEKELKNSDKHQNDQYRSKLQK  176



>ref|XP_005094067.1| PREDICTED: peroxisomal membrane protein 11B-like isoform X1 [Aplysia 
californica]
 ref|XP_005094068.1| PREDICTED: peroxisomal membrane protein 11B-like isoform X2 [Aplysia 
californica]
Length=252

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 7/115 (6%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLS--RK  507
            +D +D LV F +   G DKL +  QY +K   W +EK+       A+L +++S LS  RK
Sbjct  5    SDFMDNLVKFNSSASGRDKLFRLVQYCTKFSWWYLEKAGVHAEAIARLQKLSSSLSTTRK  64

Query  506  AFRSGR---FLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGV  351
              R G+   F+ G  ALR         R    L+   + VY  FDHI+W  R+G+
Sbjct  65   FLRLGKSVDFMHG--ALRSIHLTDSVLRYTITLSKLNQAVYLLFDHIIWAGRVGL  117



>gb|EEE58900.1| hypothetical protein OsJ_10529 [Oryza sativa Japonica Group]
Length=396

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 98/199 (49%), Gaps = 21/199 (11%)
 Frame = -2

Query  563  PELAH----RAKLWEVASGLSRKAFRSGRFLTGFNALRRSP-GPTPAFR-LLALLANSGE  402
            P L H    R + +E + GLSRKAFR G+F+   NALR +   P P    LL LLA  G+
Sbjct  205  PPLPHAATARLRSFESSVGLSRKAFRLGKFVQSINALRAAAYHPHPHVHPLLVLLAYGGQ  264

Query  401  MVYFFFDHILWLSRIGVVDPK-LARRMSFVSAFGE---SVGYVFFVISDFILISRGIQAE  234
             VY F +   WL++ G++  + L RR+  +  + +    VG +   + +   +  G++A 
Sbjct  265  GVYNFLEQFAWLAKAGLLPARLLPRRLHRIGVWAQLLAHVGSIAIKLEEVAELECGVEAR  324

Query  233  RKLRHSKVAEE--DENEEQIKKIRADRVMRLMavaaniadliialadIEPNPFCCHTVTL  60
                     EE   E  E ++ +    +++LM++  ++ D  + + D+        + TL
Sbjct  325  --------LEEGCGEESEVVRTLSRKLLLKLMSLVQDMVDSAMTVGDVTGRKGLLGSSTL  376

Query  59   GIS-GLVSAWAGWYRNWPS  6
              S GL+SA    ++NW S
Sbjct  377  MASAGLLSALISVHKNWNS  395



>ref|XP_008795374.1| PREDICTED: peroxisomal membrane protein 11D-like [Phoenix dactylifera]
 ref|XP_008795375.1| PREDICTED: peroxisomal membrane protein 11D-like [Phoenix dactylifera]
 ref|XP_008795376.1| PREDICTED: peroxisomal membrane protein 11D-like [Phoenix dactylifera]
Length=235

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 17/181 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK V+    K  P  A      + ++ L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKFVS----KGEPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSP---GPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRM  324
               + L   P    P P   LL    N+    + F D ++W  R G+   K    L  ++
Sbjct  67   NDLHTLISPPPKGSPLPLI-LLGKSKNALLSTFLFLDQVVWAGRTGIYKNKERTELISKI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRVMRL  147
            S     G S       +++   IS  ++  E++L+ +   E+++   ++K+   DR++ L
Sbjct  126  SLFCWMGSSACTTLIELAELARISASLKKLEKELKRADKYEDEQYRNKLKQ-SNDRLLSL  184

Query  146  M  144
            +
Sbjct  185  V  185



>ref|XP_002741558.1| PREDICTED: peroxisomal membrane protein PMP27-like [Saccoglossus 
kowalevskii]
Length=227

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 80/171 (47%), Gaps = 10/171 (6%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSH---PELAHRAKLWEVASGLSRKAF  501
            V K + F +  DG DKL +T QY S+ + W    +     EL  R +  E A  +SRK F
Sbjct  10   VRKFIKFTSYTDGRDKLYRTAQYTSRWLIWYWNTTGVVPKELHIRIQNLEAALTMSRKLF  69

Query  500  RSGRFLTGFNALRRSPGPT-PAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRM  324
            R  + L     +  +   T    ++  +L  +G+  +   DH++W ++I V+   L    
Sbjct  70   RMAKTLDFLQKIADAMYITDDILKIFQILGMTGKAAWLVADHVIWFTKIKVIKADLL-MW  128

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRH-----SKVAEEDENEE  186
            S +SA+   +G +  V+ D   +   I+  + L++     +KVA E E E 
Sbjct  129  SKISAWTWFLGILALVLRDLRKLHNLIELAKGLKYGGEKRAKVALEKELES  179



>ref|XP_005107819.1| PREDICTED: peroxisomal membrane protein 11B-like [Aplysia californica]
Length=230

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 58/110 (53%), Gaps = 5/110 (5%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHP----ELAHRAKLWEVASGLSRKAFRS  495
            +V F A     DK+ +  QY S+L+ W++    P    E+  R +  E A  LSRK FR 
Sbjct  7    IVKFNAHTSARDKIFRFVQYGSRLLLWQLTYGSPDVQGEVVARLRKLESALSLSRKLFRL  66

Query  494  GRFLT-GFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVV  348
            G  +     AL     P  A  +LA+ ++S + ++   DH+LWL+++G+V
Sbjct  67   GNSVDLAHKALDSLSIPETALMVLAVTSHSFKAIWLLMDHLLWLAKVGLV  116



>gb|AEI25543.1| peroxin 11 alpha [Salmo trutta fario]
Length=246

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/166 (25%), Positives = 76/166 (46%), Gaps = 4/166 (2%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLS--RKAFR  498
            ++  V F  +  G D++ +T QY   LV + +  +        KL  + S +S  RK FR
Sbjct  1    MESFVKFTNQSQGRDRIFRTTQYACALVKYLLRNNSARKELVVKLQSLESNMSSGRKLFR  60

Query  497  SGRFLTGFNALRRSPGPT-PAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
             G  +   +A +R+   + P  RL   +AN    +YF  D++LW   +G+V      R S
Sbjct  61   LGNTVNSIDAAKRTLQLSDPVLRLCLTVANLNRALYFICDNVLWARNVGLVPGIDKERWS  120

Query  320  FVSAFGESVGYVFFVISDFILISRG-IQAERKLRHSKVAEEDENEE  186
              ++    +  V  +  D  +I+R  +Q  R+ +  +  ++  N+ 
Sbjct  121  LNASCCYFLSLVMSLTRDVYVITRTMVQRTRERQFQQKMDQHLNDN  166



>ref|XP_010255528.1| PREDICTED: peroxisomal membrane protein 11C-like [Nelumbo nucifera]
 ref|XP_010255529.1| PREDICTED: peroxisomal membrane protein 11C-like [Nelumbo nucifera]
 ref|XP_010255530.1| PREDICTED: peroxisomal membrane protein 11C-like [Nelumbo nucifera]
Length=235

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 87/180 (48%), Gaps = 15/180 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L+K +  DK+ +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  14   VVLYLSKSEARDKICRAIQYGSKFLS----NGEPGTAQNV---DKSTSLARKIFRLFKFV  66

Query  482  TGFNAL-RRSPGPTP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   +P  TP    LL    N+    + F D I+WL R G+   K    L  R+S
Sbjct  67   NDLHALISPTPKGTPLPIILLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERVELVGRIS  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRVMRLM  144
                 G S+      +++   +S  ++  E++L+++   E ++   ++K+   DR + L+
Sbjct  127  LFCWMGSSICTTLVELAELARLSASMKKLEKELKNTDKYENEQYRTKLKQ-SNDRSLALV  185



>ref|XP_009758497.1| PREDICTED: peroxisomal membrane protein 11C [Nicotiana sylvestris]
 ref|XP_009758498.1| PREDICTED: peroxisomal membrane protein 11C [Nicotiana sylvestris]
Length=235

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 79/169 (47%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK ++       P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSKFLS----DGQPGTAQNV---DKSTSLARKVFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              +AL    +PG      LL    N+    + F D I+WL R G+   K    L  R+S 
Sbjct  68   DLHALISPNAPGTPLPLILLGKSKNALLSTFLFLDQIVWLGRTGIYKNKEHTELIGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
                G S+      I +   +S  ++  E++L+++   + ++ + +I+K
Sbjct  128  FCWMGSSICTTLVEIGELGRLSGSLKKLEKELKYTDKHKNEQYQSKIQK  176



>ref|NP_001096590.1| peroxisomal membrane protein 11A [Danio rerio]
 gb|AAI51943.1| Si:dkeyp-84g1.1 protein [Danio rerio]
Length=246

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 72/166 (43%), Gaps = 4/166 (2%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLVNW--RIEKSHPELAHRAKLWEVASGLSRKAFR  498
            ++  + F  +  G D++ +  QY   L  +  R E    ELA + +L E      RK FR
Sbjct  1    METFISFTNQSQGRDRIFRATQYACALAKYLLRNEAKRKELAKKLQLLESNMSSGRKLFR  60

Query  497  SGRFLTGFNALRRSPGPT-PAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
             G  +    A + +   + P  R    +AN    +YF  D+ILW   IG++      R S
Sbjct  61   LGNTVNSVQAAKSTLHISDPVLRFCLTVANLNRALYFICDNILWARSIGLIRDIDKERWS  120

Query  320  FVSAFGESVGYVFFVISD-FILISRGIQAERKLRHSKVAEEDENEE  186
              S+    +  V  +  D + +I   +Q  R  R+ + A++  NE 
Sbjct  121  LNSSRFYFLSLVMNLTRDVYAIIQLMVQKSRDRRYQQKADQHLNES  166



>gb|ABK26140.1| unknown [Picea sitchensis]
Length=238

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 82/183 (45%), Gaps = 18/183 (10%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     I    P  A      + ++ L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKF----ISNGEPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  +P P      L LL  S   +   +   D I+W  R G+   K    L  R+
Sbjct  67   NDLHAL-LTPLPKSTPLPLVLLGKSKNALLSTFLALDQIVWAGRTGIYKNKERVDLISRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGI-QAERKLRHSKVAEEDENEEQIKKIRA--DRVM  153
            S       SV      IS+   ++  I + E+ L  +   E + NE+ I K++   +R++
Sbjct  126  SLYCWLSSSVCTTLIEISELGRLTVSIRKLEKALNQATYNEGNLNEQYISKLKQSNNRLL  185

Query  152  RLM  144
             L+
Sbjct  186  NLV  188



>ref|XP_006341731.1| PREDICTED: peroxisomal membrane protein 11C-like [Solanum tuberosum]
Length=235

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 78/169 (46%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY +K     +    P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGAKF----LSDGQPGTAQNV---DKSTSLARKLFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              +AL    +PG      LL    N+    Y F D  +WL R G+   K    L  R+SF
Sbjct  68   DLHALISPNAPGTPLPLILLGKSKNALLSTYLFLDQFVWLGRSGIYKNKEQTELIGRISF  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
             S  G S+      I +   +S  I+  E++L+++   + ++   +++K
Sbjct  128  FSWMGSSICTALVEIGELGRLSSSIKKLEKELKNTDKYKNEQYRSKLQK  176



>ref|XP_010518193.1| PREDICTED: peroxisomal membrane protein 11D [Camelina sativa]
 ref|XP_010518194.1| PREDICTED: peroxisomal membrane protein 11D [Camelina sativa]
 ref|XP_010518195.1| PREDICTED: peroxisomal membrane protein 11D [Camelina sativa]
 ref|XP_010518196.1| PREDICTED: peroxisomal membrane protein 11D [Camelina sativa]
 ref|XP_010518198.1| PREDICTED: peroxisomal membrane protein 11D [Camelina sativa]
Length=236

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  15   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTSLARKVFRLFKFV  67

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  68   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  126

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  ++  E+ L++    ++DE   ++KK
Sbjct  127  SLFCWMGSSVCTTLVEIGEIGRLSSSMKKIEKGLKNGNKYQDDEYRAKLKK  177



>ref|XP_011091593.1| PREDICTED: peroxisomal membrane protein 11C [Sesamum indicum]
 ref|XP_011091600.1| PREDICTED: peroxisomal membrane protein 11C [Sesamum indicum]
 ref|XP_011091609.1| PREDICTED: peroxisomal membrane protein 11C [Sesamum indicum]
 ref|XP_011091619.1| PREDICTED: peroxisomal membrane protein 11C [Sesamum indicum]
Length=235

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 77/169 (46%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKSTSLARKVFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              +AL    +PG      LL    N+    + F D I+WL R G+   K    L  R+S 
Sbjct  68   DLHALISPSAPGTPLPLILLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERTELIGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
                G SV      I +   +S  ++  E++L+++   + ++   ++KK
Sbjct  128  FCWLGSSVCTTLVEIGEIGRLSASVKKLEKELKNTDKYKNEQYRSKLKK  176



>ref|NP_001056660.2| Os06g0127000 [Oryza sativa Japonica Group]
 sp|Q5VRJ8.1|PX115_ORYSJ RecName: Full=Peroxisomal membrane protein 11-5; AltName: Full=OsPEX11-2; 
AltName: Full=OsPEX11-5; AltName: Full=Peroxin-11-5 
[Oryza sativa Japonica Group]
 dbj|BAD67743.1| peroxisomal biogenesis factor 11 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD67925.1| peroxisomal biogenesis factor 11 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAG87696.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94398.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94484.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87367.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF18574.2| Os06g0127000 [Oryza sativa Japonica Group]
Length=233

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 83/177 (47%), Gaps = 16/177 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            L+++L K +  DK+ +  QY SK V+       P  A      + ++ L+RK FR  +F+
Sbjct  14   LILYLNKAEARDKICRAIQYGSKFVS----NGQPGPAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPG---PTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRM  324
               +AL   P    P P   LL    N+    + F D I+W  R G+   K       ++
Sbjct  67   NDLHALISPPAKGTPLPLI-LLGKSKNALLSTFLFLDQIVWAGRTGIYKNKERAEFLSKI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRV  156
            +F    G +       +++   +S+ ++  E++L+H ++ + ++ + +++K    R+
Sbjct  126  AFYCFLGSNTCTSIIEVAELQRLSKSMKKLEKELKHQELLKNEQYQMKLQKCNERRL  182



>gb|ELU13421.1| hypothetical protein CAPTEDRAFT_154211 [Capitella teleta]
Length=228

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 57/122 (47%), Gaps = 6/122 (5%)
 Frame = -2

Query  677  DTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKS--HPELAHRAKLWEVASGLSRKA  504
            D V  +V + ++ +G DKL + FQY SK   W  EK     E   + K  E A   +RK 
Sbjct  2    DIVAHVVKYNSQTNGRDKLCRLFQYASKYAWWHCEKHGLSTEFIKKFKNLETALSSTRKV  61

Query  503  FRSGRFLTGFNALRRSPG-PTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVD---PKL  336
             R G+ L       +S   P    RL   +A   + +Y   DH +WL ++G++     KL
Sbjct  62   MRFGKSLDMIMGAWKSQNVPDILIRLTLTIAKLNQAMYLLLDHYVWLVKVGLLQGDSKKL  121

Query  335  AR  330
            A+
Sbjct  122  AK  123



>ref|XP_009601682.1| PREDICTED: peroxisomal membrane protein 11C [Nicotiana tomentosiformis]
 ref|XP_009601683.1| PREDICTED: peroxisomal membrane protein 11C [Nicotiana tomentosiformis]
 ref|XP_009601684.1| PREDICTED: peroxisomal membrane protein 11C [Nicotiana tomentosiformis]
Length=235

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 79/171 (46%), Gaps = 17/171 (10%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSKF----LSDGQPGTAQNV---DKSTSLARKVFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              +AL    +PG      LL    N+    + F D I+WL R G+   K    L  R+S 
Sbjct  68   DLHALISPNAPGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERTELIGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIR  168
                G S+      I +   +S  ++  E++L+++   ++ +NE+   KI+
Sbjct  128  FCWMGSSICTTLVEIGELGRLSGSLKKLEKELKNT---DKHKNEQYQSKIQ  175



>ref|XP_008375908.1| PREDICTED: peroxisomal membrane protein 11D-like [Malus domestica]
 ref|XP_008375909.1| PREDICTED: peroxisomal membrane protein 11D-like [Malus domestica]
 ref|XP_008375910.1| PREDICTED: peroxisomal membrane protein 11D-like [Malus domestica]
 ref|XP_008375911.1| PREDICTED: peroxisomal membrane protein 11D-like [Malus domestica]
Length=235

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 76/169 (45%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKSTSLARKVFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              + L    +PG      LL    N+    + F D I+WLSR G+   K    L  R+S 
Sbjct  68   DLHGLISPTAPGTPLPLVLLGKSKNALLSTFLFLDQIVWLSRTGIYKNKERADLIGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
                G S+      I +   IS  ++  E+ L++S+    ++   ++KK
Sbjct  128  FCWMGSSICTTLVEIGEIGRISGQLKKLEKDLKNSEKYHNEQYRAKLKK  176



>gb|EMS58459.1| Peroxisomal membrane protein 11-5 [Triticum urartu]
Length=369

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/170 (24%), Positives = 78/170 (46%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L+K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  54   VVLYLSKAEARDKICRAIQYGSKF----LSNGQPGPAQNV---DKSTSLARKVFRLFKFV  106

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMS  321
                AL   P       L+ L  +   M+  + F D I+W  R GV   K       R++
Sbjct  107  NDLQALISPPAKGTPLPLILLGKSKNAMLSTFLFLDQIVWAGRTGVYKNKERAEFLGRIA  166

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            F    G +       +++   +S+ ++  E+ L+H ++ + ++   ++KK
Sbjct  167  FYCFLGSNTCTTIIELAELQRLSKSMKKLEKDLKHQELYKNEQYRMKLKK  216



>emb|CDX74760.1| BnaA05g05060D [Brassica napus]
Length=237

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 79/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  16   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTTLARKVFRLFKFV  68

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      LALL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  69   NDLHGL-ISPVPKGTPLPLALLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  127

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  ++  E+ L++    ++D+   +IK+
Sbjct  128  SLFCWMGSSVCTTLVEIGEIGRLSSSMKKIEKGLKNGNKYQDDKYRAKIKE  178



>ref|XP_002862253.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH38511.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=244

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 77/171 (45%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  15   VVMYLNKAEARDKLCRAIQYGSKF----LSGGQPGTAQNV---DKSTSLARKVFRLFKFV  67

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  68   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  126

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E+ L+H    +++E   ++K+
Sbjct  127  SLFCWMGSSVCTTLVEVGEIGRLSSSMKKIEKGLKHGNKYQDEEYRAKLKQ  177



>ref|XP_009761323.1| PREDICTED: peroxisomal membrane protein 11D-like [Nicotiana sylvestris]
 ref|XP_009761324.1| PREDICTED: peroxisomal membrane protein 11D-like [Nicotiana sylvestris]
Length=234

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 78/169 (46%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK ++       P  A      + ++ L+RK FR  +F+ 
Sbjct  14   VLYLNKAEARDKICRAIQYGSKFLS----NGEPGTAQNV---DKSTSLARKVFRLFKFIN  66

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              + L    +PG      LL    N+    + F D I+WL R G+   K    L  R+S 
Sbjct  67   DLHGLISPTAPGTPLPLILLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERHELIGRISL  126

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
                G S+      I +  ++S  ++  E++L+++   + ++   +++K
Sbjct  127  FCWMGSSICTTLVEIGELAMLSASMKKLEKELKNTDKYKNEQYRSKLQK  175



>ref|XP_004492683.1| PREDICTED: peroxisomal membrane protein 11C-like isoform X1 [Cicer 
arietinum]
 ref|XP_004492684.1| PREDICTED: peroxisomal membrane protein 11C-like isoform X2 [Cicer 
arietinum]
Length=236

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 77/171 (45%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P  A      +  + L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKTTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGE---MVYFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S       + F D I+WL R G+   K    L  R+
Sbjct  67   NDLHAL-ISPTPQGTPLPLILLGKSKNGLLSTFLFLDQIVWLGRTGIYKNKERTELIGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G ++      + +   +S  ++  E++L+ S   + ++ + ++KK
Sbjct  126  SMYCWLGSTICTTLIELGELGRLSGSMKKLEKELKSSNKYDNEQYQAKLKK  176



>ref|XP_010053656.1| PREDICTED: peroxisomal membrane protein 11D-like [Eucalyptus 
grandis]
 ref|XP_010053657.1| PREDICTED: peroxisomal membrane protein 11D-like [Eucalyptus 
grandis]
 gb|KCW77997.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus grandis]
 gb|KCW77998.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus grandis]
 gb|KCW77999.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus grandis]
Length=235

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 78/172 (45%), Gaps = 19/172 (11%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY S+     + K  P  A      E ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSRF----LSKGEPSTAQNV---EKSTSLARKVFRLFKFIN  67

Query  479  GFNALRRSPGP--TP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMS  321
              +AL  SP P  TP A  LL    N+    + F D  +WL R G+   K    L  R+S
Sbjct  68   DLHALI-SPAPQGTPLALVLLGKSKNALLSTFLFLDQFVWLGRTGIYKNKERAELMGRVS  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHS-KVAEEDENEEQIKKIR  168
                 G SV      + +   +S  +   +KL +  K  E+  NE+   K+R
Sbjct  127  LFCWMGSSVCATLVELGELGRLSVSM---KKLENDLKKGEKYHNEQYRAKVR  175



>ref|XP_009047711.1| hypothetical protein LOTGIDRAFT_139407 [Lottia gigantea]
 gb|ESP01627.1| hypothetical protein LOTGIDRAFT_139407 [Lottia gigantea]
Length=233

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 3/101 (3%)
 Frame = -2

Query  629  DKLVKTFQYVSKLVNWRIEK--SHPELAHRAKLWEVASGLSRKAFRSGRFLTGFNALRRS  456
            DKL + FQY S+LV W   K  +   LA++ K  E A  LSRK FR G        ++ S
Sbjct  19   DKLFRIFQYGSRLVLWYFSKVGATGRLAYKVKKLEEAVSLSRKLFRMGNSFDLMIKVKDS  78

Query  455  -PGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKL  336
              GP     LL ++ +S + ++   DH++WL ++  V  ++
Sbjct  79   FKGPDAYQALLGVITHSFKALWLVMDHVIWLGKVETVQIQM  119



>gb|EMT21632.1| Peroxisomal membrane protein 11-5 [Aegilops tauschii]
Length=356

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/170 (24%), Positives = 78/170 (46%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L+K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   VVLYLSKAEARDKICRAIQYGSKF----LSNGQPGPAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMS  321
                AL   P       L+ L  +   M+  + F D I+W  R GV   K       R++
Sbjct  67   NDLQALISPPAKGTPLPLILLGKSKNAMLSTFLFLDQIVWAGRTGVYKNKERAEFLGRIA  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            F    G +       +++   +S+ ++  E+ L+H ++ + ++   ++KK
Sbjct  127  FYCFLGSNTCTTIIELAELQRLSKSMKKLEKDLKHQELYKNEQYRMKLKK  176



>ref|XP_006655734.1| PREDICTED: peroxisomal membrane protein 11-5-like isoform X1 
[Oryza brachyantha]
 ref|XP_006655735.1| PREDICTED: peroxisomal membrane protein 11-5-like isoform X2 
[Oryza brachyantha]
 ref|XP_006655736.1| PREDICTED: peroxisomal membrane protein 11-5-like isoform X3 
[Oryza brachyantha]
Length=233

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 83/177 (47%), Gaps = 16/177 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            L+++L K +  DK+ +  QY SK V+       P  A      + ++ L+RK FR  +F+
Sbjct  14   LILYLNKAEARDKICRAIQYGSKFVS----NGEPGPAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPG---PTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRM  324
               +AL   P    P P   LL    N+    + F D I+W  R G+   K       ++
Sbjct  67   NDLHALISPPAKGTPLPLI-LLGKSKNALLSTFLFLDQIVWAGRTGIYKNKERAEFLSKI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRV  156
            +F    G +       +++   +S+ ++  E++L+H ++ + ++ + +++K    R+
Sbjct  126  AFYCFLGSNTCTSIIELAELQRLSKSMKKLEKELKHQELHKNEQYQMKLQKCNERRL  182



>ref|XP_002880194.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56453.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=236

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  15   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTSLARKVFRLFKFV  67

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  68   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  126

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E+ L+H    +++E   ++K+
Sbjct  127  SLFCWMGSSVCTTLVEVGEIGRLSSSMKKIEKGLKHGNKYQDEEYRAKLKQ  177



>ref|XP_009143164.1| PREDICTED: peroxisomal membrane protein 11D-like [Brassica rapa]
Length=237

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 79/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  16   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTTLARKVFRLFKFV  68

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      LALL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  69   NDLHGL-ISPVPKGTPLPLALLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  127

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G S+      I +   +S  ++  E+ L++    ++D+   +IK+
Sbjct  128  SLFCWMGSSICTTLVEIGEIGRLSSSMKKIEKGLKNGNKYQDDKYRAKIKE  178



>emb|CDQ72339.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 76/166 (46%), Gaps = 4/166 (2%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLS--RKAFR  498
            ++  V F  +  G D++ +T QY   LV + +  +        KL  + S +S  RK FR
Sbjct  1    MESFVKFTNQSQGRDRIFRTTQYACALVKYLLRNNSARKELVVKLQSLESNMSSGRKLFR  60

Query  497  SGRFLTGFNALRRSPGPT-PAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMS  321
             G  +   +A +R+   + P  RL   +AN    +YF  D++LW   +G+V      R S
Sbjct  61   LGNTVNSIDAAKRTLQLSDPVLRLCLTVANINRALYFICDNVLWARNVGLVPGIDKERWS  120

Query  320  FVSAFGESVGYVFFVISDFILISRG-IQAERKLRHSKVAEEDENEE  186
              ++    +  V  +  D  +I++  +Q  R+ +  +  ++  N+ 
Sbjct  121  LNASCCYFMSLVMSLTRDVYVITQTMVQRTRERQFQEKMDQHLNDN  166



>ref|XP_011093177.1| PREDICTED: peroxisomal membrane protein 11C-like [Sesamum indicum]
Length=235

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 78/169 (46%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK     +    P  A      + ++ ++RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKSTSVARKVFRLFKFIN  67

Query  479  GFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMSF  318
            G +AL     P     L+ L  +   ++  + F D I+WL R G+   K    L  R+S 
Sbjct  68   GLHALISPNAPRTPLPLILLGKSKTALLSTFLFLDQIVWLGRTGIYKNKERTELIGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
                G SV      I +   +S  ++  E++L+++   + ++   +++K
Sbjct  128  FCWLGASVCTTLVEIGELGRLSASMKKLEKELKNTNKYKNEQYRSKLQK  176



>ref|XP_010091543.1| Peroxisomal membrane protein 11C [Morus notabilis]
 gb|EXB44728.1| Peroxisomal membrane protein 11C [Morus notabilis]
Length=235

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   VVLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  67   NDLHALI-SPTPQGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERAELIGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E+ L+++   + ++   ++KK
Sbjct  126  SLFCWMGSSVCTTLVEVGELGRLSASMKKLEKDLKNTDKYQNEQYRAKLKK  176



>ref|XP_006397755.1| hypothetical protein EUTSA_v10001566mg [Eutrema salsugineum]
 gb|ESQ39208.1| hypothetical protein EUTSA_v10001566mg [Eutrema salsugineum]
Length=297

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  76   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTSLARKVFRLFKFV  128

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  129  NDLHGL-ISPMPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  187

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  ++  E+ L++    +++E   ++KK
Sbjct  188  SLFCWMGSSVCTTLVEIGEIGRLSSSMKKIEKGLKNGNKYQDEEYRAKLKK  238



>gb|EEC79907.1| hypothetical protein OsI_21452 [Oryza sativa Indica Group]
 gb|EEE65010.1| hypothetical protein OsJ_19960 [Oryza sativa Japonica Group]
Length=287

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 83/177 (47%), Gaps = 16/177 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            L+++L K +  DK+ +  QY SK V+       P  A      + ++ L+RK FR  +F+
Sbjct  68   LILYLNKAEARDKICRAIQYGSKFVS----NGQPGPAQNV---DKSTSLARKVFRLFKFV  120

Query  482  TGFNALRRSPG---PTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRM  324
               +AL   P    P P   LL    N+    + F D I+W  R G+   K       ++
Sbjct  121  NDLHALISPPAKGTPLPLI-LLGKSKNALLSTFLFLDQIVWAGRTGIYKNKERAEFLSKI  179

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRV  156
            +F    G +       +++   +S+ ++  E++L+H ++ + ++ + +++K    R+
Sbjct  180  AFYCFLGSNTCTSIIEVAELQRLSKSMKKLEKELKHQELLKNEQYQMKLQKCNERRL  236



>ref|XP_009142360.1| PREDICTED: peroxisomal membrane protein 11D [Brassica rapa]
Length=237

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 79/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  16   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTSLARKVFRLFKFV  68

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  69   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  127

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E+ L++S   +++E   ++KK
Sbjct  128  SLFCWMGSSVCTTLVELGEIGRLSSSMKKIEKGLKNSNKYQDEEYRAKLKK  178



>ref|XP_006586626.1| PREDICTED: uncharacterized protein LOC100499755 isoform X1 [Glycine 
max]
 gb|KHN29407.1| Peroxisomal membrane protein 11C [Glycine soja]
Length=235

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P  A      +  + L+RK FR  +F+
Sbjct  14   LVLYLGKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKTTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      LALL  S   +   + F D  +WL R G+   K    L  R+
Sbjct  67   NDLHAL-ISPTPQGTPLPLALLGKSKNALLSTFLFLDQFVWLGRTGIYQNKERTELIGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E+ L++    ++++   ++ K
Sbjct  126  SLYCWLGSSVCATLVELGELGRLSASMKKLEKDLKNKNKYDDEQYRAKLNK  176



>ref|XP_002602123.1| hypothetical protein BRAFLDRAFT_97937 [Branchiostoma floridae]
 gb|EEN58135.1| hypothetical protein BRAFLDRAFT_97937 [Branchiostoma floridae]
Length=237

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 84/173 (49%), Gaps = 4/173 (2%)
 Frame = -2

Query  653  FLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLTGF  474
            F A+  G DKL +T QY S  +   +  ++ ++  + K  E    ++RK  R G  L   
Sbjct  7    FSAQTKGRDKLFRTVQYGSIFLRAVLGSTNTDVVGKMKKLESQVSMTRKLMRFGNSLNSV  66

Query  473  NALRR-SPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLARRMSFVSAFGES  297
            +A RR S       R+L   +++   ++  FDH++WL R GV+   +  + +++S     
Sbjct  67   DAARRASKLQDELLRVLLTASHTNRSIFLLFDHLVWLGRAGVLQTDV-DKWNWISLRFWF  125

Query  296  VGYVFFVISDFILISRGIQAERK-LRHSKVAEEDENEEQIK-KIRADRVMRLM  144
            +  V  ++ D   I + +Q + K L +       +N+  ++ K+R + + R++
Sbjct  126  LSTVLSLLRDLYGIQKALQIKHKHLSYPNGIGTIDNQLHLEAKVRQESMKRIL  178



>ref|XP_007051927.1| Peroxin 11c isoform 1 [Theobroma cacao]
 ref|XP_007051928.1| Peroxin 11c isoform 1 [Theobroma cacao]
 gb|EOX96084.1| Peroxin 11c isoform 1 [Theobroma cacao]
 gb|EOX96085.1| Peroxin 11c isoform 1 [Theobroma cacao]
Length=235

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 81/173 (47%), Gaps = 19/173 (11%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ ++ QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   IVLYLNKAEARDKICRSIQYGSKF----LSNGQPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  67   NDLHAL-VSPVPQGTSLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELIGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIR  168
            S     G SV      + +   +S  ++  E+ L+++   ++ +NEE   K++
Sbjct  126  SLFCWMGSSVCSTLVELGELGRLSTSMKKLEKDLKNN---DKYKNEEYCAKLQ  175



>ref|XP_010540271.1| PREDICTED: peroxisomal membrane protein 11C [Tarenaya hassleriana]
Length=235

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 80/171 (47%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  14   IVLYLNKAEARDKICRAIQYGSKFLS----NGQPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  67   NDLHALI-SPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERAELLGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G S+      I +   +S  ++  E++L+ S   +++E   +++K
Sbjct  126  SLFCWMGSSICTSLVEIGEIGRLSASMKKLEKELKESDKYQKEEYRAKLQK  176



>ref|XP_010933889.1| PREDICTED: peroxisomal membrane protein 11-5-like [Elaeis guineensis]
Length=235

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 83/181 (46%), Gaps = 17/181 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK V+       P  A      + ++ L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKFVS----NGQPGTAQNV---DKSTSLARKVFRLLKFV  66

Query  482  TGFNALRRSP---GPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRM  324
               + L   P    P P   LL    N+    + F D I+W  R G+   K    L  ++
Sbjct  67   NDLHTLISPPPRGSPLPLI-LLGKSKNALLSTFLFLDQIVWAGRTGIYKNKERAELISKI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRVMRL  147
            S     G S       +++   IS  ++  E++L+ +   ++++   ++K+   DR++ L
Sbjct  126  SLFCWMGSSACTTLIELAELARISASMKKLEKELKEADKYKDEQYRNKLKQ-SNDRLLSL  184

Query  146  M  144
            +
Sbjct  185  V  185



>ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11D [Solanum lycopersicum]
 ref|XP_004229846.1| PREDICTED: peroxisomal membrane protein 11D [Solanum lycopersicum]
Length=235

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 78/169 (46%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK V+       P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSKFVS----NGEPGTAQNV---DKSTSLARKVFRLFKFIN  67

Query  479  GFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMSF  318
              + L   P P     L+ L  +   ++  + F D  +WL R G+   K    L  R+S 
Sbjct  68   DLHGLISPPAPGTPLPLILLGKSKNALLSTFLFLDQFVWLGRTGIYKNKERTDLLGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
                G S+      I +   +S  ++  E++L++S   ++++   +++K
Sbjct  128  FCWMGSSICTTLVEIGEIGRLSASMKKLEKELKNSDKYKDEQYRIKLQK  176



>ref|XP_006418462.1| hypothetical protein EUTSA_v10008643mg [Eutrema salsugineum]
 gb|ESQ36815.1| hypothetical protein EUTSA_v10008643mg [Eutrema salsugineum]
Length=235

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 78/175 (45%), Gaps = 17/175 (10%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  14   VVVYLNKAEARDKICRAIQYGSKFLS----DGQPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  67   NDLHALI-SPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRTGIYKDKERAELLGRL  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADR  159
            S     G SV      I +   +S  I+   K   SK  ++ +NE+   K+   +
Sbjct  126  SLFCWMGSSVCTSLVEIGELGRLSASIKKLEKEMGSK--DKHQNEQYRAKLEKSK  178



>ref|XP_010506524.1| PREDICTED: peroxisomal membrane protein 11D-like [Camelina sativa]
Length=236

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  15   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTSLARKVFRLFKFV  67

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  68   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  126

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  ++  E+ L++    +++E   ++KK
Sbjct  127  SLFCWMGSSVCTTLVEIGEIGRLSSSMKKIEKGLKNGNKYQDEEYRAKLKK  177



>ref|XP_006294921.1| hypothetical protein CARUB_v10023974mg [Capsella rubella]
 gb|EOA27819.1| hypothetical protein CARUB_v10023974mg [Capsella rubella]
Length=236

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  15   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTSLARKVFRLFKFV  67

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  68   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  126

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  ++  E+ L++    +++E   ++KK
Sbjct  127  SLFCWMGSSVCTTLVEIGEIGRLSSSMKKIEKGLKNGNKYQDEEYRAKLKK  177



>emb|CDX95662.1| BnaC03g25430D [Brassica napus]
Length=238

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  17   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTSLARKVFRLFKFV  69

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  70   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  128

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  ++  E+ L++    +++E   +IK+
Sbjct  129  SLFCWMGSSVCTTLVEIGEIGRLSSSMKKIEKGLKNGNKYQDEEYRAKIKQ  179



>ref|XP_009118837.1| PREDICTED: peroxisomal membrane protein 11C [Brassica rapa]
Length=237

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 17/172 (10%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK V+       P  A      + ++ L+RK FR  +F+
Sbjct  16   LVVYLNKAEARDKICRAIQYGSKFVS----DGQPGTAQNV---DKSTSLARKVFRLFKFV  68

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      LALL  S   +   + F D I+WL+R G+   K    L  R+
Sbjct  69   NDLHAL-ISPVPKGTPLPLALLGKSKNALLSTFLFLDQIVWLNRTGIYKNKERAELLGRI  127

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIR  168
            S     G S       + +   +S  I+   K   +K  ++ +NE+   K++
Sbjct  128  SLFCWMGSSACTSLVELGELGRLSASIKKLEKEIGNK--DKHQNEQYRAKLQ  177



>gb|KCW78000.1| hypothetical protein EUGRSUZ_D02241 [Eucalyptus grandis]
Length=168

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 61/129 (47%), Gaps = 15/129 (12%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY S+ ++    K  P  A      E ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSRFLS----KGEPSTAQNV---EKSTSLARKVFRLFKFIN  67

Query  479  GFNALRRSPGP--TP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMS  321
              +AL  SP P  TP A  LL    N+    + F D  +WL R G+   K    L  R+S
Sbjct  68   DLHALI-SPAPQGTPLALVLLGKSKNALLSTFLFLDQFVWLGRTGIYKNKERAELMGRVS  126

Query  320  FVSAFGESV  294
                 G SV
Sbjct  127  LFCWMGSSV  135



>ref|XP_009343541.1| PREDICTED: peroxisomal membrane protein 11D-like [Pyrus x bretschneideri]
 ref|XP_009343543.1| PREDICTED: peroxisomal membrane protein 11D-like [Pyrus x bretschneideri]
 ref|XP_009343544.1| PREDICTED: peroxisomal membrane protein 11D-like [Pyrus x bretschneideri]
Length=235

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 77/171 (45%), Gaps = 17/171 (10%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKSTSLARKVFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              + L    +PG      LL    N+    + F D I+WLSR G+   K    L  R+S 
Sbjct  68   DLHGLISPTAPGTPLPLVLLGKSKNALLSTFLFLDQIVWLSRTGIYKNKERADLIGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIR  168
                G S+      + +   IS  ++  E+ L++S   E+  NE+   K++
Sbjct  128  FCWMGSSICTTLVEVGEIGRISGQLKKLEKDLKNS---EKYHNEQYRAKLK  175



>ref|XP_009104286.1| PREDICTED: peroxisomal membrane protein 11E [Brassica rapa]
 ref|XP_009104287.1| PREDICTED: peroxisomal membrane protein 11E [Brassica rapa]
 ref|XP_009104288.1| PREDICTED: peroxisomal membrane protein 11E [Brassica rapa]
 emb|CDX67850.1| BnaA07g18900D [Brassica napus]
Length=235

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 76/166 (46%), Gaps = 18/166 (11%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK V+       P     A++ +  + L+RK FR  +F+
Sbjct  14   IVLYLNKAEARDKICRAIQYGSKFVSG----GQP---GTAQIVDKNTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
              F+ L  SP P      LALL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  67   NDFHGL-ISPVPKGTPLPLALLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERTELLGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEE  186
            S     G SV      IS+   I R   + +K+      +E  ++E
Sbjct  126  SLFCWLGSSVCTTAVEISE---IGRLSSSMKKMEKEFKGDEKHHDE  168



>ref|NP_001234463.1| uncharacterized protein LOC543655 [Solanum lycopersicum]
 gb|AAF75750.1|AF261140_1 unknown [Solanum lycopersicum]
Length=235

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 77/169 (46%), Gaps = 14/169 (8%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY +K     +    P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGAKF----LSDGQPGTAQNV---DKSTSLARKLFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              +AL    +PG      LL    N+    Y F D  +WL R G+   K    L  R+SF
Sbjct  68   DLHALISPNAPGTPLPLILLGKSKNALLSTYLFLDQFVWLGRSGIYKNKEQTELIGRISF  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
             S  G S+      I +   +S  ++  E++L+++     ++   +++K
Sbjct  128  FSWMGSSICTALVEIGELGRLSSSMKKLEKELKNTDKYMNEQYRSKLQK  176



>gb|KDO85998.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis]
Length=232

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 79/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   VVLYLNKAEARDKICRAIQYGSKF----LSDGQPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D ++WL R G+   K    L  R+
Sbjct  67   NDLHAL-ISPVPQGTPLPLVLLGKSKNALLSTFLFLDQVVWLGRSGIYKNKERAELLGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E++L+ S   + ++ + ++KK
Sbjct  126  SLFCWMGSSVCSTLVELGELGRLSTSMKKLEKELKDSDKHKNEQYQAKLKK  176



>ref|XP_004133885.1| PREDICTED: peroxisomal membrane protein 11D-like [Cucumis sativus]
 gb|KGN56554.1| hypothetical protein Csa_3G124740 [Cucumis sativus]
Length=235

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 70/162 (43%), Gaps = 13/162 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   VVLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DRSTALARKVFRLCKFV  66

Query  482  TGFNAL-RRSPGPTP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMS  321
               + L   +P  TP    LL    N+    + F D I+WLSR G+   K    L  R+S
Sbjct  67   NDLHGLISPTPQGTPLPLVLLGKCKNALLSTFLFLDQIVWLSRTGIYKNKERAELIGRIS  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDE  195
                 G S+      + +   +S   +   K   +K   EDE
Sbjct  127  LFCWMGSSICSTLVELGELGRLSSARKKLEKDLKNKNKYEDE  168



>ref|XP_003291200.1| hypothetical protein DICPUDRAFT_49683 [Dictyostelium purpureum]
 gb|EGC32263.1| hypothetical protein DICPUDRAFT_49683 [Dictyostelium purpureum]
Length=245

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 58/235 (25%), Positives = 108/235 (46%), Gaps = 14/235 (6%)
 Frame = -2

Query  680  NDTVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHP--ELAHRAKLWEVASGLSRK  507
            N  ++KL+  LA+  G DK  K  QY +KL+ +   ++ P  +     K  E  SG +RK
Sbjct  13   NAFLEKLIKLLAQTSGKDKFAKILQYGAKLLGYIFLRNSPKGQWVGIMKKLETTSGSARK  72

Query  506  AFRSGRFLT---GFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKL  336
             +R G          +L +   P     +LAL+  SG   Y+ FDH++  + IG+     
Sbjct  73   VWRLGNTFAEQQKIISLFKVAKPFGFLNILALIRQSGMYFYWVFDHLILGTNIGICKFDT  132

Query  335  ARRMSFVSAFGESVGYVFFVISDFILISR----GIQAERKLRHSKVAEEDEN--EEQIKK  174
              ++ + S+     G +  ++ D   +S         +  + +++ ++ D    ++Q  +
Sbjct  133  V-KLGWYSSVSWFFGLLCSIVIDLNTLSTLLKKEKSLKLSITNNQASDTDNKTIQDQFNE  191

Query  173  IRADRVMRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWP  9
            ++  +    +    N +DL+IA   ++   F   TV  G +G+VSA  G Y+ WP
Sbjct  192  VQIKKNEIYLTCCKNASDLLIAATLLKFYSFSQGTV--GSAGIVSALIGAYQMWP  244



>gb|ACG35424.1| peroxisomal membrane protein PEX11-1 [Zea mays]
Length=235

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/170 (23%), Positives = 77/170 (45%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            L+++L K +  DK+ +  QY SK     I    P  A      + ++ L+RK FR  +F+
Sbjct  14   LILYLNKAEARDKICRAIQYGSKF----ISNGEPGPAQNV---DNSTSLARKVFRLCKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   P       L+ L  +   M+  + F D I+W  R G+   K       R++
Sbjct  67   NDLHALISPPAKGTPLPLILLGKSKNAMLSTFLFLDQIVWAGRTGIYKNKERAEFLGRIA  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            F    G +       +++   +S  ++  E++L+H ++ + ++   ++ K
Sbjct  127  FYCFLGSNTCTAIIELAELQRLSTSMKKLEKELKHQELYKNEQYRMKLHK  176



>gb|KDO85999.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis]
Length=240

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 79/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   VVLYLNKAEARDKICRAIQYGSKF----LSDGQPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D ++WL R G+   K    L  R+
Sbjct  67   NDLHAL-ISPVPQGTPLPLVLLGKSKNALLSTFLFLDQVVWLGRSGIYKNKERAELLGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E++L+ S   + ++ + ++KK
Sbjct  126  SLFCWMGSSVCSTLVELGELGRLSTSMKKLEKELKDSDKHKNEQYQAKLKK  176



>gb|AFW75334.1| hypothetical protein ZEAMMB73_104531 [Zea mays]
Length=307

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/170 (23%), Positives = 77/170 (45%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            L+++L K +  DK+ +  QY SK     I    P  A      + ++ L+RK FR  +F+
Sbjct  14   LILYLNKAEARDKICRAIQYGSKF----ISNGEPGPAQNV---DKSTSLARKVFRLCKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   P       L+ L  +   M+  + F D I+W  R G+   K       R++
Sbjct  67   NDLHALISPPAKGTPLPLILLGKSKNAMLSTFLFLDQIVWAGRTGIYKNKERAEFLGRIA  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            F    G +       +++   +S  ++  E++L+H ++ + ++   ++ K
Sbjct  127  FYCFLGSNTCTAIIELAELQRLSTSMKKLEKELKHQELYKNEQYRMKLHK  176



>ref|NP_001131375.1| peroxisomal membrane protein PEX11-1 isoform 1 [Zea mays]
 ref|XP_008647343.1| PREDICTED: peroxisomal membrane protein PEX11-1 isoform 1 isoform 
X1 [Zea mays]
 ref|XP_008647344.1| PREDICTED: peroxisomal membrane protein PEX11-1 isoform 1 isoform 
X1 [Zea mays]
 ref|XP_008647345.1| PREDICTED: peroxisomal membrane protein PEX11-1 isoform 1 isoform 
X1 [Zea mays]
 gb|ACF79762.1| unknown [Zea mays]
 gb|ACF80736.1| unknown [Zea mays]
 gb|ACF82575.1| unknown [Zea mays]
 gb|ACN35467.1| unknown [Zea mays]
 gb|AFW75330.1| peroxisomal membrane protein PEX11-1 isoform 1 [Zea mays]
 gb|AFW75331.1| peroxisomal membrane protein PEX11-1 isoform 2 [Zea mays]
 gb|AFW75332.1| peroxisomal membrane protein PEX11-1 isoform 3 [Zea mays]
 gb|AFW75333.1| peroxisomal membrane protein PEX11-1 isoform 4 [Zea mays]
Length=235

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/170 (23%), Positives = 77/170 (45%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            L+++L K +  DK+ +  QY SK     I    P  A      + ++ L+RK FR  +F+
Sbjct  14   LILYLNKAEARDKICRAIQYGSKF----ISNGEPGPAQNV---DKSTSLARKVFRLCKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   P       L+ L  +   M+  + F D I+W  R G+   K       R++
Sbjct  67   NDLHALISPPAKGTPLPLILLGKSKNAMLSTFLFLDQIVWAGRTGIYKNKERAEFLGRIA  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            F    G +       +++   +S  ++  E++L+H ++ + ++   ++ K
Sbjct  127  FYCFLGSNTCTAIIELAELQRLSTSMKKLEKELKHQELYKNEQYRMKLHK  176



>ref|XP_006445153.1| hypothetical protein CICLE_v10022007mg [Citrus clementina]
 ref|XP_006445154.1| hypothetical protein CICLE_v10022007mg [Citrus clementina]
 ref|XP_006445155.1| hypothetical protein CICLE_v10022007mg [Citrus clementina]
 ref|XP_006491010.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X1 [Citrus 
sinensis]
 ref|XP_006491011.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X2 [Citrus 
sinensis]
 ref|XP_006491012.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X3 [Citrus 
sinensis]
 ref|XP_006491013.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X4 [Citrus 
sinensis]
 gb|ESR58393.1| hypothetical protein CICLE_v10022007mg [Citrus clementina]
 gb|ESR58394.1| hypothetical protein CICLE_v10022007mg [Citrus clementina]
 gb|ESR58395.1| hypothetical protein CICLE_v10022007mg [Citrus clementina]
 gb|KDO85994.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis]
 gb|KDO85995.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis]
 gb|KDO85996.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis]
 gb|KDO85997.1| hypothetical protein CISIN_1g024612mg [Citrus sinensis]
Length=235

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 79/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   VVLYLNKAEARDKICRAIQYGSKF----LSDGQPGTAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D ++WL R G+   K    L  R+
Sbjct  67   NDLHAL-ISPVPQGTPLPLVLLGKSKNALLSTFLFLDQVVWLGRSGIYKNKERAELLGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E++L+ S   + ++ + ++KK
Sbjct  126  SLFCWMGSSVCSTLVELGELGRLSTSMKKLEKELKDSDKHKNEQYQAKLKK  176



>ref|XP_002511795.1| peroxisomal biogenesis factor, putative [Ricinus communis]
 gb|EEF50464.1| peroxisomal biogenesis factor, putative [Ricinus communis]
Length=235

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 77/170 (45%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKF----LSNGQPGTAQNV---DKSTSLARKVFRLLKFV  66

Query  482  TGFNALRR--SPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL    + G      LL    N+    + F D I+WL R G+   K    L  R+S
Sbjct  67   NDLHALISPVTQGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERADLIGRIS  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
                 G SV      I +   +S  ++  E++L++S   + ++   +++K
Sbjct  127  LYCWMGSSVCTTLVEIGELGRLSASLKKLEKELKNSDKHQNEQYRAKLQK  176



>ref|NP_001235577.1| uncharacterized protein LOC100499755 [Glycine max]
 gb|ACU13500.1| unknown [Glycine max]
Length=235

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P  A      +  + L+RK FR  +F+
Sbjct  14   LVLYLGKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKTTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      LALL  S   +   + F D  +WL R G+   K    L  R+
Sbjct  67   NDLHAL-ISPTPQGTPLPLALLGKSKNALLSTFLFLDQFVWLGRTGIYQNKERTELIGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E+ L++    ++++   ++ K
Sbjct  126  SLYCWLGSSVCATSVELGELGRLSASMKKLEKDLKNKNKYDDEQYRAKLNK  176



>ref|XP_004964390.1| PREDICTED: peroxisomal membrane protein 11-5-like [Setaria italica]
Length=233

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/170 (22%), Positives = 80/170 (47%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            ++++L K +  DK+ +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  14   VILYLNKAEARDKICRAIQYGSKFLS----NGQPGPAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   P       L+ L  +   M+  + F D I+W  R G+   K       R++
Sbjct  67   NDLHALISPPAKGTPLPLILLGKSKNAMLSTFLFLDQIVWAGRTGIYKNKERAEFLSRIA  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            F    G +       +++   +S+ ++  E++L+H ++ + ++   +++K
Sbjct  127  FYCFLGSNTCTTIIELAELQRLSKSMKKLEKELKHQELYKNEQYRMKLQK  176



>gb|ETI41008.1| hypothetical protein F443_13717 [Phytophthora parasitica P1569]
 gb|ETK81101.1| hypothetical protein L915_13376 [Phytophthora parasitica]
 gb|ETL87790.1| hypothetical protein L917_13081 [Phytophthora parasitica]
 gb|ETO69679.1| hypothetical protein F444_13775 [Phytophthora parasitica P1976]
 gb|ETP10782.1| hypothetical protein F441_13646 [Phytophthora parasitica CJ01A1]
 gb|ETP38932.1| hypothetical protein F442_13568 [Phytophthora parasitica P10297]
Length=268

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 97/230 (42%), Gaps = 23/230 (10%)
 Frame = -2

Query  638  DGIDKLVKTFQYVSKLVNWRIEKSHP--ELAHRAKLWEVASGLSRKAFRSGRFLTGFNAL  465
            +G DKL K  QY S+ + + +  + P  ++  R          SRKAFR G+ +T +  L
Sbjct  20   EGRDKLSKMLQYGSRALAFYVLSADPKSDVGQRLHALYKVMQQSRKAFRLGKSVTYYKKL  79

Query  464  RR---SPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVV---DPKLARRMSFVSAFG  303
            +    S   T   R L  + N G + YF  D++ + S+  V+      LARR   V  F 
Sbjct  80   QTLSSSKSLTETQRYLQFIQNLGMLGYFLADNVAFASKAKVLRFDADDLARRGG-VMWFC  138

Query  302  ESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDEN-----EEQIKKIRADR------V  156
             +V   F  +     ++  ++ E+ +R    +EED       + Q++ +R+ R      V
Sbjct  139  ANVAGFFNALES---LNADVEKEKCVRDILASEEDTARVETLQNQLETLRSGRFKKLLSV  195

Query  155  MRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +++M      ++               H   +G  G VSA    Y  WPS
Sbjct  196  LKVMCDLIVSSNTSGVRLAERITGTKLHDGIIGSVGCVSAAVVLYNTWPS  245



>ref|XP_008894594.1| hypothetical protein PPTG_03656 [Phytophthora parasitica INRA-310]
 gb|ETL34532.1| hypothetical protein L916_13256 [Phytophthora parasitica]
 gb|ETM41023.1| hypothetical protein L914_13167 [Phytophthora parasitica]
 gb|ETN20720.1| hypothetical protein PPTG_03656 [Phytophthora parasitica INRA-310]
Length=268

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 97/230 (42%), Gaps = 23/230 (10%)
 Frame = -2

Query  638  DGIDKLVKTFQYVSKLVNWRIEKSHP--ELAHRAKLWEVASGLSRKAFRSGRFLTGFNAL  465
            +G DKL K  QY S+ + + +  + P  ++  R          SRKAFR G+ +T +  L
Sbjct  20   EGRDKLSKMLQYGSRALAFYVLSADPKSDVGQRLHALYKVMQQSRKAFRLGKSVTYYKKL  79

Query  464  R---RSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVV---DPKLARRMSFVSAFG  303
            +    S   T   R L  + N G + YF  D++ + S+  V+      LARR   V  F 
Sbjct  80   QTLSSSKSLTETQRYLQFIQNLGMLGYFLADNVAFASKAKVLRFDADDLARRGG-VMWFC  138

Query  302  ESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDEN-----EEQIKKIRADR------V  156
             +V   F  +     ++  ++ E+ +R    +EED       + Q++ +R+ R      V
Sbjct  139  ANVAGFFNALES---LNADVEKEKCVRDILASEEDTARVETLQNQLETLRSGRFKKLLSV  195

Query  155  MRLMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWPS  6
            +++M      ++               H   +G  G VSA    Y  WPS
Sbjct  196  LKVMCDLIVSSNTSGVRLAERITGTKLHDGIIGSVGCVSAAVVLYNTWPS  245



>gb|EYU35059.1| hypothetical protein MIMGU_mgv1a012938mg [Erythranthe guttata]
 gb|EYU35060.1| hypothetical protein MIMGU_mgv1a012938mg [Erythranthe guttata]
Length=235

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 78/180 (43%), Gaps = 22/180 (12%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKSTSLARKVFRLFKFVN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              +AL     PG      LL    N+    + F D I+WL R G+   K    L  R+S 
Sbjct  68   DLHALVSPNVPGTPLPLILLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERAELLGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHS--------KVAEEDENEEQIKKIRA  165
                G SV      I +   +S  ++  E++L+++        K   ++ NE  +  ++A
Sbjct  128  FCWLGSSVCTTLVEIGEIGRLSSSMKKLEKELKNTNKYKNEQYKTKLQNSNERSLALVKA  187



>ref|XP_001752238.1| predicted protein [Physcomitrella patens]
 gb|EDQ82971.1| predicted protein [Physcomitrella patens]
Length=229

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 73/164 (45%), Gaps = 12/164 (7%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     I    P +A +    +  + L+RK FR  + L
Sbjct  14   LVMYLNKAEARDKICRAIQYGSKF----ISAGEPGVAQQV---DKTTSLARKVFRLAKTL  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVV-DPKLARRMSFVSAF  306
               NAL     P P    L +  N+    + F D I+W  R G+  D +    +S +S F
Sbjct  67   NELNALL---APPPKATPLPIAKNALVGTFLFLDQIVWAGRTGIYKDTERLNLISRISLF  123

Query  305  GESVGYVFFVISDFILISRGIQAERKLRHS-KVAEEDENEEQIK  177
                G     + +   I+R     +K+ +  K A+   + E++K
Sbjct  124  CWLAGTCCTTLVEVAEITRLGSTTKKVENELKKAQGSPSIEEMK  167



>ref|XP_002465980.1| hypothetical protein SORBIDRAFT_01g049450 [Sorghum bicolor]
 gb|EER92978.1| hypothetical protein SORBIDRAFT_01g049450 [Sorghum bicolor]
Length=237

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 78/170 (46%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK     I    P  A      + ++ L+RK FR  +++
Sbjct  14   VVLYLNKAEARDKICRAIQYGSKF----ISNGQPGTAQDV---DKSTTLARKVFRLLKWV  66

Query  482  TGFNALRRSPGP-TP-AFRLLALLANSGEMVYFFFDHILWLSRIGVVDPKLAR----RMS  321
               +AL   P   TP    LL    N+    + F D  +WL R G++  K A     R+S
Sbjct  67   NDLHALISPPAKGTPLTLVLLGKSKNALLSTFLFLDQFVWLGRTGIIKNKEATDRVARIS  126

Query  320  FVSAFGESVGYVFFVISDFILISRGI-QAERKLRHSKVAEEDENEEQIKK  174
                   SV      + +   +SR + +  R+LR++   E ++ + ++K+
Sbjct  127  LYCWMASSVCAGLVELGELKRLSRSMRKLARELRNTDKYENEQYQNKMKQ  176



>emb|CDY18905.1| BnaC04g04450D [Brassica napus]
Length=238

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 77/171 (45%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  17   VVMYLNKAEARDKLCRAIQYGSKF----LSDGQPGTAQNV---DKSTSLARKVFRLFKFV  69

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  70   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  128

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  ++  E+ L++    ++D+   ++K+
Sbjct  129  SLFCWMGSSVCTTLVEIGEIGRLSSSMKKIEKGLKNGNKYQDDKYRAKLKE  179



>ref|XP_008460171.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal membrane protein 
11C [Cucumis melo]
Length=242

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 76/175 (43%), Gaps = 16/175 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P  A      +  + L+RK FR  +F+
Sbjct  14   LVLYLNKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKTTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK-LARRMSFV  315
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    R+  +
Sbjct  67   NDLHGL-ISPVPQGTPLPLILLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERTERIGRI  125

Query  314  SAF---GESVGYVFFVISDFILISRGI-QAERKLRHSKVAEEDENEEQIKKIRAD  162
            S F   G S   V   I +   +S  I + E+ L+   + +      Q +K RA+
Sbjct  126  SLFCWLGASFCTVLVEIGEIARLSAAIKKQEKDLKDKNINQHQVCYHQDEKYRAN  180



>ref|XP_003564336.1| PREDICTED: peroxisomal membrane protein 11-5 [Brachypodium distachyon]
 ref|XP_010228045.1| PREDICTED: peroxisomal membrane protein 11-5 [Brachypodium distachyon]
Length=233

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 79/170 (46%), Gaps = 14/170 (8%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            ++++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+
Sbjct  14   VILYLNKAEARDKICRAIQYGSKF----LSNGEPGPAQNV---DKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV--YFFFDHILWLSRIGVVDPK----LARRMS  321
               +AL   P       L+ L  +   M+  + F D I+W  R GV   K       R++
Sbjct  67   NDLHALISPPAKGTPLPLILLGKSKNAMLSTFLFLDQIVWAGRTGVYKNKERAEFLGRIA  126

Query  320  FVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            F    G +       +++   +S+ ++  E++L+H ++ + ++   +++K
Sbjct  127  FYCFLGSNTCTTLIELAELQRLSKSMKKLEKELKHQELYKNEQYRMKLQK  176



>emb|CDY37060.1| BnaA04g26380D [Brassica napus]
Length=237

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  16   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQTV---DKSTSLARKVFRLFKFV  68

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  69   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  127

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E+ L++    +++E   ++KK
Sbjct  128  SLFCWMGSSVCTTLVELGEIGRLSSSMKKIEKGLKNGNKYQDEEYRAKLKK  178



>ref|XP_004344055.1| glycosomal membrane protein [Acanthamoeba castellanii str. Neff]
 gb|ELR20652.1| glycosomal membrane protein [Acanthamoeba castellanii str. Neff]
Length=219

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 106/227 (47%), Gaps = 16/227 (7%)
 Frame = -2

Query  674  TVDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLW-EVASGLS--RKA  504
            ++ K   FLA  DG DKL K F Y ++ ++W    +    A  AK W  + S +S  RK 
Sbjct  2    SLSKSCKFLAATDGRDKLYKFFHYGARFLSWFCLNTANN-AQWAKYWSNIDSVMSDGRKL  60

Query  503  FRSGRFLTGFNALRRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVV--DPKLAR  330
             R  +FL+    L       P   +  LL   G   YFFF+++ W  +  +V  D K   
Sbjct  61   LRLFKFLSEIEKLGTIREARPMLLVANLLKTLGMAGYFFFNNLSWAMKFNIVSGDEKKWG  120

Query  329  RMSFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEEQIKKIRADRVMR  150
            ++SF   +  +VG +F ++ D       ++     R  + A    ++ ++ +++ ++   
Sbjct  121  KLSF---WAWTVGLLFALVLDV------VKYRENSRRQQKALASSSQTELAQLKKEQREL  171

Query  149  LMavaaniadliialadIEPNPFCCHTVTLGISGLVSAWAGWYRNWP  9
              A+   +A+L I+ + +E NP     V +G++G+V A    Y+ W 
Sbjct  172  EYAMIREVANLQISTSLVEINPIKSAGV-VGLAGVVEAGLASYQIWK  217



>ref|XP_010899930.1| PREDICTED: peroxisomal membrane protein 11A [Esox lucius]
Length=246

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 53/111 (48%), Gaps = 3/111 (3%)
 Frame = -2

Query  671  VDKLVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLS--RKAFR  498
            ++  + F  +  G D++ +T QY   L  + +  +        KL  + S +S  RK FR
Sbjct  1    MESFIKFTNQSQGRDRIFRTTQYACALSKYLLRNNSARKGLVLKLQSLESNMSSGRKLFR  60

Query  497  SGRFLTGFNALRRSPGPT-PAFRLLALLANSGEMVYFFFDHILWLSRIGVV  348
             G  +   +A +R+   + P  RL   +AN     YF  D++LW S +G+V
Sbjct  61   LGNTVNSIDAAKRTLKLSDPVLRLCLTVANLNRACYFICDNLLWASNVGLV  111



>ref|NP_566055.1| peroxisomal membrane protein 11D [Arabidopsis thaliana]
 ref|NP_850441.1| peroxisomal membrane protein 11D [Arabidopsis thaliana]
 ref|NP_001031544.1| peroxisomal membrane protein 11D [Arabidopsis thaliana]
 sp|O80845.2|PX11D_ARATH RecName: Full=Peroxisomal membrane protein 11D; AltName: Full=Peroxin-11D; 
Short=AtPEX11d [Arabidopsis thaliana]
 gb|AAK96711.1| Unknown protein [Arabidopsis thaliana]
 gb|AAC28551.2| expressed protein [Arabidopsis thaliana]
 gb|AAM61504.1| unknown [Arabidopsis thaliana]
 gb|AEC10594.1| peroxisomal membrane protein 11D [Arabidopsis thaliana]
 gb|AEC10595.1| peroxisomal membrane protein 11D [Arabidopsis thaliana]
 gb|AEC10596.1| peroxisomal membrane protein 11D [Arabidopsis thaliana]
Length=236

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 78/171 (46%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P  A      + ++ L+RK FR  +F+
Sbjct  15   VVMYLNKAEARDKLCRAIQYGSKFLSG----GQPGTAQNV---DKSTSLARKVFRLFKFV  67

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               + L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  68   NDLHGL-ISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRI  126

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      + +   +S  ++  E+ L++    ++++   ++KK
Sbjct  127  SLFCWMGSSVCTTLVEVGEMGRLSSSMKKIEKGLKNGNKYQDEDYRAKLKK  177



>ref|XP_010523724.1| PREDICTED: peroxisomal membrane protein 11D-like [Tarenaya hassleriana]
 ref|XP_010523725.1| PREDICTED: peroxisomal membrane protein 11D-like [Tarenaya hassleriana]
Length=235

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 80/171 (47%), Gaps = 16/171 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DKL +  QY SK ++       P     AK  + ++ L+RK FR  +F+
Sbjct  14   IVLYLNKAEARDKLCRAIQYGSKFLSG----GQP---GTAKNVDKSTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVD----PKLARRM  324
               +AL  SP P      L LL  S   +   + F D I+WL R G+       +L  R+
Sbjct  67   NDLHAL-ISPMPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNEERTELIGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKK  174
            S     G SV      I +   +S  ++  E++L+ S   + ++   +++K
Sbjct  126  SLFCWMGSSVCTTLAEIGELGRLSSSMKKIEKELKGSDKYQNEQYRAKLQK  176



>emb|CDP08886.1| unnamed protein product [Coffea canephora]
Length=235

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 79/180 (44%), Gaps = 22/180 (12%)
 Frame = -2

Query  659  VIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFLT  480
            V++L K +  DK+ +  QY SK     +    P  A      + ++ L+RK FR  +F+ 
Sbjct  15   VLYLNKSEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKSTSLARKVFRLFKFIN  67

Query  479  GFNAL--RRSPGPTPAFRLLALLANSGEMVYFFFDHILWLSRIGVVDPK----LARRMSF  318
              + L    +PG   +  LL    N+    + F D I+WL R G+   K    L  R+S 
Sbjct  68   DLHGLISPNAPGTPLSLILLGKSKNALLSTFLFLDQIVWLGRTGIYKNKERTELIGRISL  127

Query  317  VSAFGESVGYVFFVISDFILISRGIQA-ERKLRHS--------KVAEEDENEEQIKKIRA  165
                G S+      + +   +S  ++  E++L+++        +V  +  NE  +  I+A
Sbjct  128  FCWMGSSICTTLVELGELGRLSASMKKLEKELKNTDKYKNEQYRVKLQKSNERSLALIKA  187



>ref|XP_010512437.1| PREDICTED: peroxisomal membrane protein 11E-like [Camelina sativa]
Length=235

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 17/181 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK ++       P  A      +  + L+RK FR  +F+
Sbjct  14   IVLYLNKAEARDKICRAIQYGSKFLSG----GQPGTAQTV---DKNTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
              F+ L  SP P      L LL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  67   NDFHGLI-SPVPKGTPLPLVLLGKSKNALVSTFLFLDQIVWLGRSGIYKNKERVELLGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRVMRL  147
            S     G SV      IS+   +S  ++  E++L+  +   ++    +++K + DR + L
Sbjct  126  SLFCWLGSSVCTTAVEISELGRLSSSMKKMEKELKDDEKHHDELYRAKLQKSK-DRTLAL  184

Query  146  M  144
            +
Sbjct  185  I  185



>emb|CDY45676.1| BnaCnng13410D [Brassica napus]
Length=235

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 75/166 (45%), Gaps = 18/166 (11%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            +V++L K +  DK+ +  QY SK V+       P     A++ +  + L+RK FR  +F+
Sbjct  14   IVLYLNKAEARDKICRAIQYGSKFVSG----GQP---GTAQIVDKNTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
              F+ L  SP P      LALL  S   +   + F D I+WL R G+   K    L  R+
Sbjct  67   NDFHGL-ISPVPKGTPLPLALLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERTELLGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQAERKLRHSKVAEEDENEE  186
            S     G SV      I +   I R   + +K+      +E  ++E
Sbjct  126  SLFCWLGSSVCTTAVEIGE---IGRLSSSMKKMEKEFKGDEKHHDE  168



>ref|NP_001235755.1| peroxisomal biogenesis factor 11 family protein [Glycine max]
 ref|XP_006601716.1| PREDICTED: peroxisomal biogenesis factor 11 family protein isoform 
X1 [Glycine max]
 ref|XP_006601717.1| PREDICTED: peroxisomal biogenesis factor 11 family protein isoform 
X2 [Glycine max]
 ref|XP_006601718.1| PREDICTED: peroxisomal biogenesis factor 11 family protein isoform 
X3 [Glycine max]
 dbj|BAH03205.1| peroxisomal biogenesis factor 11 family protein [Glycine max]
 gb|ACU16645.1| unknown [Glycine max]
Length=235

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 79/181 (44%), Gaps = 17/181 (9%)
 Frame = -2

Query  662  LVIFLAKRDGIDKLVKTFQYVSKLVNWRIEKSHPELAHRAKLWEVASGLSRKAFRSGRFL  483
            LV++L K +  DK+ +  QY SK     +    P  A      +  + L+RK FR  +F+
Sbjct  14   LVLYLGKAEARDKICRAIQYGSKF----LSNGEPGTAQNV---DKTTSLARKVFRLFKFV  66

Query  482  TGFNALRRSPGPTPAFRLLALLANSGEMV---YFFFDHILWLSRIGVVDPK----LARRM  324
               +AL  SP P      L LL  S   +   + F D  +WL R G+   K    L  R+
Sbjct  67   NDLHAL-ISPTPQGTPLPLILLGKSKNALLSTFLFLDQFVWLGRTGIYQNKERTELIGRI  125

Query  323  SFVSAFGESVGYVFFVISDFILISRGIQA-ERKLRHSKVAEEDENEEQIKKIRADRVMRL  147
            S     G SV      + +   +S  ++  E+ L++    + ++   ++ K   +R + L
Sbjct  126  SLYCWLGSSVCTTLVELGELGRLSSSMKKLEKDLKNKNKYDNEQYRAKLNK-SNERTLSL  184

Query  146  M  144
            +
Sbjct  185  I  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1272215339102