BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c65114_g1_i1 len=250 path=[1:0-249]

Length=250
                                                                      Score     E

ref|XP_004239680.1|  PREDICTED: caffeoylshikimate esterase              101   2e-24   
ref|XP_009616354.1|  PREDICTED: caffeoylshikimate esterase-like         102   4e-24   
ref|XP_006345805.1|  PREDICTED: caffeoylshikimate esterase-like       99.8    7e-24   
ref|XP_009611906.1|  PREDICTED: caffeoylshikimate esterase            95.9    2e-23   
ref|XP_009779135.1|  PREDICTED: caffeoylshikimate esterase            94.7    4e-23   
emb|CAN82378.1|  hypothetical protein VITISV_036229                   94.7    7e-23   Vitis vinifera
emb|CDP04353.1|  unnamed protein product                              94.0    1e-22   
ref|XP_010253670.1|  PREDICTED: caffeoylshikimate esterase-like       97.1    4e-22   
ref|XP_004307391.1|  PREDICTED: monoglyceride lipase-like             89.0    6e-22   
ref|XP_010420728.1|  PREDICTED: caffeoylshikimate esterase-like       89.4    6e-22   
ref|XP_003536355.1|  PREDICTED: caffeoylshikimate esterase-like       87.0    7e-22   
gb|AGV54710.1|  monoglyceride lipase                                  89.4    9e-22   
ref|XP_008347481.1|  PREDICTED: caffeoylshikimate esterase-like       94.7    1e-21   
ref|XP_010492984.1|  PREDICTED: caffeoylshikimate esterase-like       88.2    1e-21   
ref|NP_197430.1|  esterase/lipase/thioesterase family protein         87.8    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008367428.1|  PREDICTED: caffeoylshikimate esterase-like       91.7    2e-21   
ref|XP_007143700.1|  hypothetical protein PHAVU_007G094400g           89.4    2e-21   
ref|XP_007218284.1|  hypothetical protein PRUPE_ppa008391mg           90.1    3e-21   
emb|CDY44908.1|  BnaA02g04130D                                        87.4    3e-21   
ref|XP_010454199.1|  PREDICTED: caffeoylshikimate esterase-like i...  88.6    3e-21   
ref|XP_006400484.1|  hypothetical protein EUTSA_v10014061mg           87.0    3e-21   
ref|XP_010099613.1|  hypothetical protein L484_013404                 88.6    3e-21   
ref|XP_009349702.1|  PREDICTED: caffeoylshikimate esterase-like       90.9    3e-21   
emb|CDP04355.1|  unnamed protein product                              91.7    3e-21   
ref|XP_002871877.1|  esterase/lipase/thioesterase family protein      86.7    3e-21   
emb|CDY69863.1|  BnaCnng65700D                                        86.7    4e-21   
ref|XP_009126352.1|  PREDICTED: caffeoylshikimate esterase-like       86.7    4e-21   
gb|KFK26175.1|  hypothetical protein AALP_AA8G212500                  86.3    6e-21   
ref|XP_009344755.1|  PREDICTED: caffeoylshikimate esterase-like       89.7    6e-21   
ref|XP_002274887.1|  PREDICTED: caffeoylshikimate esterase            92.4    7e-21   Vitis vinifera
ref|XP_006436421.1|  hypothetical protein CICLE_v10033579mg           90.1    9e-21   
gb|KDO44719.1|  hypothetical protein CISIN_1g035721mg                 90.1    1e-20   
ref|XP_010067299.1|  PREDICTED: caffeoylshikimate esterase            82.0    5e-20   
ref|XP_009120902.1|  PREDICTED: caffeoylshikimate esterase-like       85.1    5e-20   
emb|CDX92543.1|  BnaA10g15820D                                        85.1    1e-19   
ref|XP_009345381.1|  PREDICTED: caffeoylshikimate esterase            89.7    2e-19   
emb|CDY13986.1|  BnaC09g38400D                                        85.1    2e-19   
ref|XP_009370931.1|  PREDICTED: uncharacterized protein LOC103960222  90.1    2e-19   
ref|XP_008446889.1|  PREDICTED: caffeoylshikimate esterase-like       88.6    4e-19   
ref|XP_002311094.2|  esterase/lipase/thioesterase family protein      85.5    6e-19   Populus trichocarpa [western balsam poplar]
ref|XP_004496283.1|  PREDICTED: monoglyceride lipase-like             79.0    8e-19   
gb|KFK26173.1|  hypothetical protein AALP_AA8G212300                  80.5    1e-18   
gb|EPS74573.1|  hypothetical protein M569_00182                       87.0    2e-18   
ref|XP_008776344.1|  PREDICTED: caffeoylshikimate esterase            82.0    2e-18   
ref|XP_011031746.1|  PREDICTED: caffeoylshikimate esterase-like       82.8    4e-18   
ref|XP_003591911.1|  Monoglyceride lipase                             82.4    4e-18   
ref|XP_010932980.1|  PREDICTED: caffeoylshikimate esterase-like       80.9    6e-18   
ref|XP_004157524.1|  PREDICTED: monoglyceride lipase-like             84.7    9e-18   
ref|XP_004142429.1|  PREDICTED: monoglyceride lipase-like             84.7    9e-18   
ref|XP_011084365.1|  PREDICTED: caffeoylshikimate esterase            84.7    1e-17   
gb|EYU39580.1|  hypothetical protein MIMGU_mgv1a009732mg              84.3    1e-17   
ref|XP_010534286.1|  PREDICTED: caffeoylshikimate esterase-like i...  80.5    2e-17   
ref|XP_009392259.1|  PREDICTED: caffeoylshikimate esterase-like       81.3    3e-17   
gb|KDP44357.1|  hypothetical protein JCGZ_20037                       80.5    3e-17   
ref|XP_011040996.1|  PREDICTED: caffeoylshikimate esterase            81.6    5e-17   
ref|XP_002316366.1|  esterase/lipase/thioesterase family protein      80.5    6e-17   Populus trichocarpa [western balsam poplar]
ref|XP_007009827.1|  Alpha/beta-Hydrolases superfamily protein        78.6    7e-17   
ref|XP_006854516.1|  hypothetical protein AMTR_s00175p00065840        82.0    1e-16   
emb|CDX91009.1|  BnaC02g05880D                                        76.3    1e-16   
dbj|BAK08241.1|  predicted protein                                    81.3    2e-16   
ref|XP_010524322.1|  PREDICTED: caffeoylshikimate esterase            72.8    3e-16   
ref|XP_010679109.1|  PREDICTED: caffeoylshikimate esterase-like       75.9    1e-15   
ref|XP_002871641.1|  esterase/lipase/thioesterase family protein      74.3    1e-15   
emb|CDX85571.1|  BnaA02g02420D                                        75.9    1e-15   
ref|XP_009126022.1|  PREDICTED: caffeoylshikimate esterase            75.5    2e-15   
ref|XP_006400019.1|  hypothetical protein EUTSA_v10014122mg           75.1    2e-15   
ref|XP_003567617.1|  PREDICTED: caffeoylshikimate esterase-like       78.2    2e-15   
ref|XP_010492319.1|  PREDICTED: caffeoylshikimate esterase-like       74.3    2e-15   
ref|XP_010420143.1|  PREDICTED: caffeoylshikimate esterase-like       74.3    2e-15   
gb|KFK25736.1|  hypothetical protein AALP_AA8G152900                  76.6    3e-15   
ref|NP_197002.1|  esterase/lipase/thioesterase family protein         73.9    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006846764.1|  hypothetical protein AMTR_s00148p00015200        74.7    6e-15   
ref|NP_001042883.1|  Os01g0317800                                     76.3    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006288192.1|  hypothetical protein CARUB_v10001430mg           73.2    2e-14   
gb|EEC70515.1|  hypothetical protein OsI_01618                        74.7    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002529580.1|  Monoglyceride lipase, putative                   74.3    3e-14   Ricinus communis
gb|EAY73742.1|  hypothetical protein OsI_01616                        75.1    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002300571.2|  hypothetical protein POPTR_0001s47090g           74.3    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011039896.1|  PREDICTED: caffeoylshikimate esterase-like       74.7    7e-14   
ref|XP_001752999.1|  predicted protein                                72.4    3e-13   
ref|XP_010558754.1|  PREDICTED: caffeoylshikimate esterase-like       66.2    9e-13   
ref|XP_010251778.1|  PREDICTED: caffeoylshikimate esterase-like       71.2    9e-13   
ref|XP_009381885.1|  PREDICTED: caffeoylshikimate esterase-like       69.3    1e-12   
ref|XP_001772196.1|  predicted protein                                70.5    2e-12   
ref|XP_002523188.1|  conserved hypothetical protein                   68.9    4e-12   Ricinus communis
ref|XP_008794508.1|  PREDICTED: caffeoylshikimate esterase-like       68.9    6e-12   
ref|XP_002263371.1|  PREDICTED: caffeoylshikimate esterase-like       68.6    1e-11   Vitis vinifera
emb|CAN63634.1|  hypothetical protein VITISV_009388                   67.8    2e-11   Vitis vinifera
tpg|DAA54424.1|  TPA: hypothetical protein ZEAMMB73_151003            67.0    4e-11   
ref|XP_004233162.1|  PREDICTED: caffeoylshikimate esterase-like       66.6    5e-11   
ref|XP_010245789.1|  PREDICTED: caffeoylshikimate esterase-like       66.2    7e-11   
ref|XP_002455554.1|  hypothetical protein SORBIDRAFT_03g013040        66.2    7e-11   Sorghum bicolor [broomcorn]
ref|XP_009587884.1|  PREDICTED: caffeoylshikimate esterase-like       66.2    7e-11   
ref|XP_008441075.1|  PREDICTED: caffeoylshikimate esterase-like       65.9    9e-11   
ref|XP_010923690.1|  PREDICTED: caffeoylshikimate esterase-like       65.5    1e-10   
ref|XP_006448890.1|  hypothetical protein CICLE_v10017467mg           64.3    3e-10   
ref|XP_006448889.1|  hypothetical protein CICLE_v10015863mg           64.3    4e-10   
emb|CDP17301.1|  unnamed protein product                              63.9    5e-10   
ref|XP_009800227.1|  PREDICTED: caffeoylshikimate esterase-like       63.2    9e-10   
ref|XP_004158692.1|  PREDICTED: monoglyceride lipase-like             62.8    1e-09   
gb|KGN49464.1|  hypothetical protein Csa_6G525500                     62.8    1e-09   
gb|EYU27946.1|  hypothetical protein MIMGU_mgv1a026912mg              62.4    1e-09   
ref|XP_006343251.1|  PREDICTED: caffeoylshikimate esterase-like i...  62.0    2e-09   
gb|EPS70994.1|  hypothetical protein M569_03765                       61.6    3e-09   
ref|XP_011096881.1|  PREDICTED: caffeoylshikimate esterase-like       61.2    4e-09   
ref|XP_009610353.1|  PREDICTED: caffeoylshikimate esterase            60.8    5e-09   
ref|XP_004234129.1|  PREDICTED: caffeoylshikimate esterase            59.7    1e-08   
gb|KDP34930.1|  hypothetical protein JCGZ_09218                       58.9    3e-08   
ref|XP_009782580.1|  PREDICTED: caffeoylshikimate esterase            58.9    3e-08   
ref|XP_007159280.1|  hypothetical protein PHAVU_002G224700g           58.9    3e-08   
ref|XP_002316636.1|  hydrolase family protein                         58.9    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011096267.1|  PREDICTED: caffeoylshikimate esterase            58.2    6e-08   
ref|XP_002990215.1|  hypothetical protein SELMODRAFT_447944           57.8    7e-08   
ref|XP_002992473.1|  hypothetical protein SELMODRAFT_186777           57.8    7e-08   
ref|XP_003634858.1|  PREDICTED: caffeoylshikimate esterase            57.4    1e-07   
emb|CBI18753.3|  unnamed protein product                              57.4    1e-07   
gb|EYU19116.1|  hypothetical protein MIMGU_mgv1a027063mg              57.0    1e-07   
ref|XP_006845999.1|  hypothetical protein AMTR_s00155p00055670        57.0    2e-07   
gb|KDP20918.1|  hypothetical protein JCGZ_21389                       56.6    2e-07   
ref|XP_011043243.1|  PREDICTED: caffeoylshikimate esterase            56.6    2e-07   
ref|XP_006841721.1|  hypothetical protein AMTR_s00003p00257040        55.8    4e-07   
ref|XP_010278298.1|  PREDICTED: caffeoylshikimate esterase            55.8    4e-07   
gb|AFK35254.1|  unknown                                               55.1    6e-07   
ref|XP_008442222.1|  PREDICTED: caffeoylshikimate esterase            53.9    8e-07   
ref|XP_004146590.1|  PREDICTED: monoglyceride lipase-like             53.5    8e-07   
emb|CDO99600.1|  unnamed protein product                              54.7    1e-06   
ref|NP_001240171.1|  uncharacterized protein LOC100793956             54.7    1e-06   
ref|XP_008224992.1|  PREDICTED: caffeoylshikimate esterase            51.2    1e-06   
ref|XP_007211531.1|  hypothetical protein PRUPE_ppa008252mg           51.6    1e-06   
ref|XP_009780674.1|  PREDICTED: caffeoylshikimate esterase-like i...  52.0    2e-06   
gb|ABR18313.1|  unknown                                               53.9    2e-06   Picea sitchensis
ref|XP_010686578.1|  PREDICTED: caffeoylshikimate esterase            53.5    2e-06   
ref|XP_008809309.1|  PREDICTED: caffeoylshikimate esterase            53.5    3e-06   
gb|AAT07463.1|  lysophospholipase-like protein                        51.2    3e-06   Mirabilis jalapa
ref|XP_002521403.1|  Monoglyceride lipase, putative                   53.1    4e-06   Ricinus communis
ref|XP_004134900.1|  PREDICTED: monoglyceride lipase-like             52.8    4e-06   
ref|XP_007199495.1|  hypothetical protein PRUPE_ppb012289mg           50.8    4e-06   
ref|XP_006467849.1|  PREDICTED: caffeoylshikimate esterase-like       52.8    4e-06   
ref|XP_006449284.1|  hypothetical protein CICLE_v10017806mg           52.8    5e-06   
ref|XP_008383790.1|  PREDICTED: caffeoylshikimate esterase-like       52.4    7e-06   
ref|XP_011070793.1|  PREDICTED: caffeoylshikimate esterase            52.0    1e-05   
ref|XP_006344132.1|  PREDICTED: caffeoylshikimate esterase-like       51.6    1e-05   
ref|XP_010905633.1|  PREDICTED: caffeoylshikimate esterase            51.2    2e-05   
ref|XP_004238932.1|  PREDICTED: caffeoylshikimate esterase            51.2    2e-05   
ref|WP_003446516.1|  lysophospholipase                                50.4    3e-05   
ref|XP_010475999.1|  PREDICTED: caffeoylshikimate esterase-like       50.1    3e-05   
ref|XP_009123831.1|  PREDICTED: caffeoylshikimate esterase            50.1    4e-05   
emb|CDY20979.1|  BnaA08g25460D                                        50.1    4e-05   
ref|XP_010107055.1|  hypothetical protein L484_002466                 50.1    4e-05   
ref|WP_015617138.1|  lysophospholipase                                49.7    5e-05   
emb|CDY20587.1|  BnaC08g14710D                                        49.7    5e-05   
gb|KFK43401.1|  hypothetical protein AALP_AA1G121200                  49.7    6e-05   
gb|KHG29426.1|  Monoglyceride lipase                                  49.7    6e-05   
emb|CDP00629.1|  unnamed protein product                              49.7    7e-05   
ref|XP_007025719.1|  Alpha/beta-Hydrolases superfamily protein        47.8    7e-05   
ref|WP_010239402.1|  alpha/beta hydrolase                             48.9    8e-05   
ref|XP_004505004.1|  PREDICTED: monoglyceride lipase-like             48.9    1e-04   
ref|XP_004140338.1|  PREDICTED: monoglyceride lipase-like             48.9    1e-04   
ref|XP_006665022.1|  PREDICTED: caffeoylshikimate esterase-like       48.5    1e-04   
ref|XP_008465780.1|  PREDICTED: caffeoylshikimate esterase            48.9    1e-04   
ref|XP_006417390.1|  hypothetical protein EUTSA_v10010022mg           48.1    2e-04   
ref|NP_172576.1|  alpha/beta-hydrolase-like protein                   48.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625969.1|  PREDICTED: caffeoylshikimate esterase            48.1    2e-04   
ref|XP_002889847.1|  hydrolase, alpha/beta fold family protein        47.8    2e-04   
ref|XP_004173007.1|  PREDICTED: monoglyceride lipase-like             47.4    2e-04   
ref|XP_009803215.1|  PREDICTED: caffeoylshikimate esterase            48.1    2e-04   
ref|XP_010458490.1|  PREDICTED: caffeoylshikimate esterase-like       47.8    2e-04   
ref|XP_010492320.1|  PREDICTED: caffeoylshikimate esterase-like       47.8    3e-04   
ref|XP_007025720.1|  Alpha/beta-Hydrolases superfamily protein        47.4    3e-04   
ref|XP_004958048.1|  PREDICTED: monoglyceride lipase-like             47.4    3e-04   
gb|ACJ85425.1|  unknown                                               47.0    3e-04   Medicago truncatula
ref|XP_002463034.1|  hypothetical protein SORBIDRAFT_02g036570        47.4    3e-04   Sorghum bicolor [broomcorn]
ref|XP_007044321.1|  Alpha/beta-Hydrolases superfamily protein is...  47.0    4e-04   
ref|XP_007044319.1|  Alpha/beta-Hydrolases superfamily protein is...  47.4    4e-04   
ref|XP_007044320.1|  Alpha/beta-Hydrolases superfamily protein is...  47.0    4e-04   
ref|NP_001130084.1|  hypothetical protein                             47.0    4e-04   Zea mays [maize]
ref|XP_007044318.1|  Alpha/beta-Hydrolases superfamily protein is...  47.4    4e-04   
ref|XP_009418746.1|  PREDICTED: caffeoylshikimate esterase            47.0    5e-04   
ref|XP_010533890.1|  PREDICTED: caffeoylshikimate esterase            45.8    5e-04   
ref|XP_002179050.1|  predicted protein                                46.2    6e-04   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_006303706.1|  hypothetical protein CARUB_v10011807mg           45.4    7e-04   
emb|CBI31463.3|  unnamed protein product                              34.7    7e-04   
gb|EYU29988.1|  hypothetical protein MIMGU_mgv1a007855mg              46.2    8e-04   
gb|EYU29987.1|  hypothetical protein MIMGU_mgv1a007855mg              46.2    8e-04   
ref|XP_001760039.1|  predicted protein                                46.2    9e-04   
ref|XP_002290401.1|  phospholipase                                    45.8    0.001   Thalassiosira pseudonana CCMP1335



>ref|XP_004239680.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=335

 Score =   101 bits (252),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P TK+IG+VC+V GFT +S+W +QLT +HI K GF+VCAIDHQGHG+++GL AHIP
Sbjct  48   WSPLPPTKIIGVVCVVHGFTGESSWFVQLTAVHIAKNGFIVCAIDHQGHGFSDGLIAHIP  107


 Score = 37.0 bits (84),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSV+H S F+TN RGLKLFT    P+P  K
Sbjct  26  HSVTHNSEFITNSRGLKLFTQWWSPLPPTK  55



>ref|XP_009616354.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana tomentosiformis]
Length=330

 Score =   102 bits (253),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P  K++G+VC+V GFT +S+W +QLT +HI K GF+VCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPAKIVGVVCVVHGFTGESSWFVQLTAVHIAKHGFIVCAIDHQGHGFSDGLAAHIP  107


 Score = 35.8 bits (81),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSV+H S F+TN RGLKLF     P+P  K
Sbjct  26  HSVTHNSEFITNSRGLKLFAQWWTPLPPAK  55



>ref|XP_006345805.1| PREDICTED: caffeoylshikimate esterase-like [Solanum tuberosum]
Length=335

 Score = 99.8 bits (247),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P  K+IG+VC+V GFT +S+W +QLT +HI K GF+VCAIDHQGHG+++GL AHIP
Sbjct  48   WSPLPPAKIIGVVCVVHGFTGESSWFVQLTAVHIAKNGFIVCAIDHQGHGFSDGLIAHIP  107


 Score = 37.4 bits (85),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSV+H S F+TN RGLKLFT    P+P  K
Sbjct  26  HSVTHNSEFITNSRGLKLFTQWWSPLPPAK  55



>ref|XP_009611906.1| PREDICTED: caffeoylshikimate esterase [Nicotiana tomentosiformis]
Length=338

 Score = 95.9 bits (237),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P T  IG+VC+V GFT +S+W +QLT +H  K GF VCAIDHQGHG+++GL AHIP
Sbjct  51   WTPLPPTNPIGVVCVVHGFTGESSWFVQLTAVHFAKHGFSVCAIDHQGHGFSDGLVAHIP  110


 Score = 39.3 bits (90),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSHGS F+TN RGLKLFT    P+P
Sbjct  29  HSVSHGSDFITNSRGLKLFTQWWTPLP  55



>ref|XP_009779135.1| PREDICTED: caffeoylshikimate esterase [Nicotiana sylvestris]
Length=335

 Score = 94.7 bits (234),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P    IG+VC+V GFT +S+W +QLT +H  K GF VCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPANPIGVVCVVHGFTGESSWFVQLTAVHFAKHGFAVCAIDHQGHGFSDGLVAHIP  107


 Score = 39.3 bits (90),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSHGS F+TN RGLKLFT    P+P
Sbjct  26  HSVSHGSEFITNSRGLKLFTQWWTPLP  52



>emb|CAN82378.1| hypothetical protein VITISV_036229 [Vitis vinifera]
Length=1395

 Score = 94.7 bits (234),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P TK+IG + +V GFT +S+W +QLT +H  K GF  CAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPTKIIGTLAVVHGFTGESSWFLQLTAVHFTKAGFATCAIDHQGHGFSDGLVAHIP  107


 Score = 38.9 bits (89),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSV+H S ++TN RG+KLFT    P+P  K
Sbjct  26  HSVTHSSEYITNSRGMKLFTQSWTPLPPTK  55



>emb|CDP04353.1| unnamed protein product [Coffea canephora]
Length=330

 Score = 94.0 bits (232),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 2/62 (3%)
 Frame = +1

Query  70   WTPFPLT--KVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAH  243
            W P P +   +IG+VC+V GFT +S+W +QLT +H+ KQGF VCAIDHQGHG++EGL+AH
Sbjct  49   WIPLPDSGKPLIGVVCVVHGFTGESSWFVQLTSVHLAKQGFAVCAIDHQGHGFSEGLQAH  108

Query  244  IP  249
            IP
Sbjct  109  IP  110


 Score = 38.5 bits (88),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H V+HG+ F+TNPRGLKLFT    P+P
Sbjct  27  HKVTHGTEFITNPRGLKLFTQWWIPLP  53



>ref|XP_010253670.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=339

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTPFP TKVIGIV +V GFT +S+W +QLT +   K GF  CAIDHQGHG++EGLK HIP
Sbjct  48   WTPFPPTKVIGIVAVVHGFTGESSWFVQLTSILFAKSGFATCAIDHQGHGFSEGLKNHIP  107



>ref|XP_004307391.1| PREDICTED: monoglyceride lipase-like [Fragaria vesca subsp. vesca]
Length=328

 Score = 89.0 bits (219),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P  +V+G++ IV GFT +++W +QLT ++  K GF VCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPAEVLGVLAIVHGFTGETSWFVQLTAVNFAKAGFAVCAIDHQGHGFSDGLVAHIP  107


 Score = 41.6 bits (96),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSHGS +VTNPRGLKLFT    P+P
Sbjct  26  HSVSHGSEYVTNPRGLKLFTQWWTPLP  52



>ref|XP_010420728.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=331

 Score = 89.4 bits (220),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P TK IGI+ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WTPLPPTKPIGIIAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIP  108


 Score = 40.8 bits (94),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSVSH S F+TNPRGLKLFT    P+P  K
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWTPLPPTK  56



>ref|XP_003536355.1| PREDICTED: caffeoylshikimate esterase-like [Glycine max]
Length=325

 Score = 87.0 bits (214),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P   +IG + +V G+T +S+WL+QLT +H  K GF  CA+DHQGHG+++GL AHIP
Sbjct  48   WTPLPPKTIIGTLAVVHGYTGESSWLLQLTAVHFAKAGFATCALDHQGHGFSDGLVAHIP  107


 Score = 43.1 bits (100),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSHGS FVTNPRGLKLFT    P+P
Sbjct  26  HSVSHGSEFVTNPRGLKLFTQWWTPLP  52



>gb|AGV54710.1| monoglyceride lipase [Phaseolus vulgaris]
Length=325

 Score = 89.4 bits (220),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P T ++G + +V GFT +S+WLIQLT +H  K GF  CAIDHQGHG+++GL AHIP
Sbjct  48   WLPLPPTTIVGTLAVVHGFTGESSWLIQLTAVHFAKAGFATCAIDHQGHGFSDGLIAHIP  107


 Score = 40.4 bits (93),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSH S F+TNPRGLKLFT    P+P
Sbjct  26  HSVSHASEFITNPRGLKLFTQWWLPLP  52



>ref|XP_008347481.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
 ref|XP_008357257.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=330

 Score = 94.7 bits (234),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P T+++G + IV GFT +++W +QLT +H  K GFVVCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPTEIVGTLAIVHGFTGETSWFVQLTAVHFAKSGFVVCAIDHQGHGFSDGLAAHIP  107


 Score = 34.7 bits (78),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H+VSH S + TNPRGLK FT    P+P
Sbjct  26  HNVSHASEYFTNPRGLKRFTQWWTPLP  52



>ref|XP_010492984.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=331

 Score = 88.2 bits (217),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P TK IGI+ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTKPIGIIAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIP  108


 Score = 41.2 bits (95),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSVSH S F+TNPRGLKLFT    P+P  K
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPLPPTK  56



>ref|NP_197430.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
 gb|AAL36164.1| putative phospholipase [Arabidopsis thaliana]
 gb|AAM63479.1| phospholipase-like protein [Arabidopsis thaliana]
 gb|AAN31882.1| putative phospholipase [Arabidopsis thaliana]
 gb|AAN86200.1| putative phospholipase [Arabidopsis thaliana]
 gb|AED92681.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
Length=330

 Score = 87.8 bits (216),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P TK IGI+ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTKPIGIIAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIP  108


 Score = 41.2 bits (95),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSVSH S F+TNPRGLKLFT    P+P  K
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPLPPTK  56



>ref|XP_008367428.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=329

 Score = 91.7 bits (226),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P T+++G + IV GFT +++W +QLT +H  K GF VCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPTEIVGTLAIVHGFTGETSWFVQLTAVHFAKSGFAVCAIDHQGHGFSDGLIAHIP  107


 Score = 37.0 bits (84),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H+VSH S + TNPRGLKLFT    P+P
Sbjct  26  HNVSHASEYTTNPRGLKLFTQWWTPLP  52



>ref|XP_007143700.1| hypothetical protein PHAVU_007G094400g [Phaseolus vulgaris]
 gb|ESW15694.1| hypothetical protein PHAVU_007G094400g [Phaseolus vulgaris]
Length=325

 Score = 89.4 bits (220),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P T ++G + +V GFT +S+WLIQLT +H  K GF  CAIDHQGHG+++GL AHIP
Sbjct  48   WLPLPPTTIVGTLAVVHGFTGESSWLIQLTAVHFAKAGFATCAIDHQGHGFSDGLIAHIP  107


 Score = 39.3 bits (90),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSV+H S F+TNPRGLKLFT    P+P
Sbjct  26  HSVNHASEFITNPRGLKLFTQWWLPLP  52



>ref|XP_007218284.1| hypothetical protein PRUPE_ppa008391mg [Prunus persica]
 gb|EMJ19483.1| hypothetical protein PRUPE_ppa008391mg [Prunus persica]
Length=333

 Score = 90.1 bits (222),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P T V+G + IV GFT +++W +QLT +H  K GF VCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPTPVLGTLAIVHGFTGETSWFVQLTAVHFAKSGFAVCAIDHQGHGFSDGLVAHIP  107


 Score = 38.1 bits (87),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H VSH S ++TNPRGLKLFT    P+P
Sbjct  26  HKVSHASEYITNPRGLKLFTQWWTPLP  52



>emb|CDY44908.1| BnaA02g04130D [Brassica napus]
Length=335

 Score = 87.4 bits (215),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P T  IGIV +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTPPIGIVAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLVAHIP  108


 Score = 40.8 bits (94),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSH S F+TNPRGLKLFT    P+P
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPLP  53



>ref|XP_010454199.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Camelina 
sativa]
 ref|XP_010454200.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Camelina 
sativa]
Length=331

 Score = 88.6 bits (218),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P TK IGI+ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTKPIGIIAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIP  108


 Score = 39.7 bits (91),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSVSH S F+ NPRGLKLFT    P+P  K
Sbjct  27  HSVSHSSAFINNPRGLKLFTQWWSPLPPTK  56



>ref|XP_006400484.1| hypothetical protein EUTSA_v10014061mg [Eutrema salsugineum]
 gb|ESQ41937.1| hypothetical protein EUTSA_v10014061mg [Eutrema salsugineum]
Length=335

 Score = 87.0 bits (214),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P  + IGIV +V GFT +S+WLIQLT +   K G++ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPARPIGIVAVVHGFTGESSWLIQLTSILFAKSGYITCAIDHQGHGFSDGLIAHIP  108


 Score = 40.8 bits (94),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSH S F+TNPRGLKLFT    P+P
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPLP  53



>ref|XP_010099613.1| hypothetical protein L484_013404 [Morus notabilis]
 gb|EXB80079.1| hypothetical protein L484_013404 [Morus notabilis]
Length=326

 Score = 88.6 bits (218),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P  +++GIV +V GFT +S+WL+QLT +   + GF VCAIDHQGHG+++GL AHIP
Sbjct  53   WTPLPPKEILGIVAVVHGFTGESSWLVQLTSIFFAEAGFAVCAIDHQGHGFSDGLIAHIP  112


 Score = 39.3 bits (90),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSV+H S ++TNPRGLKLFT    P+P
Sbjct  31  HSVAHSSAYITNPRGLKLFTQWWTPLP  57



>ref|XP_009349702.1| PREDICTED: caffeoylshikimate esterase-like [Pyrus x bretschneideri]
Length=329

 Score = 90.9 bits (224),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P T+++G + IV G+T +++W +QLT +H  K GF VCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPTEIVGTLAIVHGYTGETSWFVQLTAVHFAKSGFAVCAIDHQGHGFSDGLVAHIP  107


 Score = 37.4 bits (85),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H+VSH S + TNPRGLKLFT    P+P
Sbjct  26  HNVSHASEYTTNPRGLKLFTQWWTPLP  52



>emb|CDP04355.1| unnamed protein product [Coffea canephora]
Length=333

 Score = 91.7 bits (226),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +1

Query  70   WTPFPLT--KVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAH  243
            W P P +   + GIVC+V GFT +S+W +QLT +H+ KQGF VCAIDHQGHG++EGL+AH
Sbjct  49   WIPLPDSGKPLFGIVCVVHGFTCESSWFVQLTSVHLAKQGFAVCAIDHQGHGFSEGLQAH  108

Query  244  IP  249
            IP
Sbjct  109  IP  110


 Score = 36.2 bits (82),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPS  86
           H V+HG+ F+TN RGLKLFT    P+P 
Sbjct  27  HKVTHGAEFITNARGLKLFTQWWIPLPD  54



>ref|XP_002871877.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48136.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=326

 Score = 86.7 bits (213),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P TK IGI+ +V GFT +++W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTKPIGIIAVVHGFTGETSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIP  108


 Score = 41.2 bits (95),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSVSH S F+TNPRGLKLFT    P+P  K
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPLPPTK  56



>emb|CDY69863.1| BnaCnng65700D [Brassica napus]
Length=335

 Score = 86.7 bits (213),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P T  +GIV +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTPPVGIVAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLVAHIP  108


 Score = 40.8 bits (94),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSH S F+TNPRGLKLFT    P+P
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPLP  53



>ref|XP_009126352.1| PREDICTED: caffeoylshikimate esterase-like [Brassica rapa]
Length=335

 Score = 86.7 bits (213),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P T  IGIV +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTPPIGIVAVVYGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLVAHIP  108


 Score = 40.8 bits (94),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSH S F+TNPRGLKLFT    P+P
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPLP  53



>gb|KFK26175.1| hypothetical protein AALP_AA8G212500 [Arabis alpina]
Length=327

 Score = 86.3 bits (212),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P T  IGI+ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTTPIGIIAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLIAHIP  108


 Score = 40.8 bits (94),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSH S F+TNPRGLKLFT    P+P
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPLP  53



>ref|XP_009344755.1| PREDICTED: caffeoylshikimate esterase-like [Pyrus x bretschneideri]
Length=329

 Score = 89.7 bits (221),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P T+++G + IV G+T +++W +QLT +H  K GF VCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPTEIVGTLAIVHGYTGETSWSVQLTAVHFAKSGFAVCAIDHQGHGFSDGLVAHIP  107


 Score = 37.4 bits (85),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H+VSH S + TNPRGLKLFT    P+P
Sbjct  26  HNVSHASEYTTNPRGLKLFTQWWTPLP  52



>ref|XP_002274887.1| PREDICTED: caffeoylshikimate esterase [Vitis vinifera]
Length=329

 Score = 92.4 bits (228),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P TK+IG + +V GFT +S+W +QLT +H  K GF  CAIDHQGHG+++GL AHIP
Sbjct  48   WTPLPPTKIIGTLAVVHGFTGESSWFLQLTAVHFTKAGFATCAIDHQGHGFSDGLVAHIP  107


 Score = 34.3 bits (77),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSV+H S ++TN RG+KLFT    P+P  K
Sbjct  26  HSVTHSSEYITNSRGMKLFTQSWTPLPPTK  55



>ref|XP_006436421.1| hypothetical protein CICLE_v10033579mg [Citrus clementina]
 ref|XP_006485682.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 ref|XP_006485685.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 gb|ESR49661.1| hypothetical protein CICLE_v10033579mg [Citrus clementina]
Length=336

 Score = 90.1 bits (222),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P  K +G++C+V GFT +++W++QLT +   K GF  CAIDHQGHG+++GL AHIP
Sbjct  49   WTPLPPAKTLGVLCVVHGFTGETSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIP  108


 Score = 36.2 bits (82),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSVSH S ++TN RGL+LFT    P+P  K
Sbjct  27  HSVSHSSEYITNSRGLRLFTQWWTPLPPAK  56



>gb|KDO44719.1| hypothetical protein CISIN_1g035721mg, partial [Citrus sinensis]
Length=308

 Score = 90.1 bits (222),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P  K +G++C+V GFT +S+W++QLT +   K GF  CAIDHQGHG+++GL AHIP
Sbjct  49   WTPLPPAKTLGVLCVVHGFTGESSWIVQLTAVLFAKSGFATCAIDHQGHGFSDGLVAHIP  108


 Score = 36.2 bits (82),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSVSH S ++TN RGL+LFT    P+P  K
Sbjct  27  HSVSHSSEYITNSRGLRLFTQWWTPLPPAK  56



>ref|XP_010067299.1| PREDICTED: caffeoylshikimate esterase [Eucalyptus grandis]
 gb|KCW65403.1| hypothetical protein EUGRSUZ_G02828 [Eucalyptus grandis]
Length=336

 Score = 82.0 bits (201),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P    +G++ +V G+T +S+WL+QLT +   + GF  CA+DHQGHG+++GL AHIP
Sbjct  48   WTPLPPAPTLGVLAVVHGYTGESSWLVQLTSVFFARAGFATCALDHQGHGFSDGLVAHIP  107


 Score = 42.0 bits (97),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSHGS FVTNPRGL+LFT    P+P
Sbjct  26  HSVSHGSEFVTNPRGLRLFTQWWTPLP  52



>ref|XP_009120902.1| PREDICTED: caffeoylshikimate esterase-like [Brassica rapa]
Length=335

 Score = 85.1 bits (209),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P  + IGIV +V GFT +S+W +QLT +   K G++ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPARPIGIVAVVHGFTGESSWFLQLTSILFAKSGYITCAIDHQGHGFSDGLVAHIP  108


 Score = 38.9 bits (89),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSV+H S F+TNPRGLK+FT    P+P
Sbjct  27  HSVTHSSAFITNPRGLKIFTQWWSPLP  53



>emb|CDX92543.1| BnaA10g15820D [Brassica napus]
Length=339

 Score = 85.1 bits (209),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P T  +GIV +V GFT +S+W +QLT +   K G++ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPTTPVGIVAVVHGFTGESSWFLQLTSILFAKSGYITCAIDHQGHGFSDGLVAHIP  108


 Score = 37.4 bits (85),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSV+H S F TNPRGLK+FT    P+P
Sbjct  27  HSVTHSSAFTTNPRGLKIFTQWWSPLP  53



>ref|XP_009345381.1| PREDICTED: caffeoylshikimate esterase [Pyrus x bretschneideri]
Length=330

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP   T+++G + IV GFT +++W +QLT +H  + GFVVCAIDHQGHG+++GL AHIP
Sbjct  48   WTPLAPTQIVGTLAIVHGFTGETSWFVQLTAVHFAESGFVVCAIDHQGHGFSDGLAAHIP  107



>emb|CDY13986.1| BnaC09g38400D [Brassica napus]
Length=335

 Score = 85.1 bits (209),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P  + IGIV +V GFT +S+W +QLT +   K G++ CAIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPARPIGIVAVVHGFTGESSWFLQLTSILFAKSGYITCAIDHQGHGFSDGLVAHIP  108


 Score = 37.0 bits (84),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSV+  S F+TNPRGLK+FT    P+P
Sbjct  27  HSVTQSSAFITNPRGLKIFTQWWSPLP  53



>ref|XP_009370931.1| PREDICTED: uncharacterized protein LOC103960222 [Pyrus x bretschneideri]
Length=403

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP P T+++G + IV G+T +++W +QLT +H  K GF VCAIDHQ HG+++GL AHIP
Sbjct  90   WTPLPPTEIVGTLAIVHGYTGETSWFVQLTAVHFAKSGFAVCAIDHQDHGFSDGLVAHIP  149



>ref|XP_008446889.1| PREDICTED: caffeoylshikimate esterase-like [Cucumis melo]
Length=333

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P    IGI+ IV GFT +S+W IQLT +H  K GF+ CAIDHQGHG++EGL+ HIP
Sbjct  48   WIPQPPINPIGIIAIVHGFTGESSWFIQLTAVHFTKAGFITCAIDHQGHGFSEGLQYHIP  107



>ref|XP_002311094.2| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEE88461.2| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=338

 Score = 85.5 bits (210),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA---  240
            WTP P TK IG V +V GFT +S+W +QLT +   K GFVVCAIDHQGHG+++GL     
Sbjct  49   WTPLPPTKTIGCVAVVHGFTGESSWFVQLTSILFAKHGFVVCAIDHQGHGFSDGLDNLIY  108

Query  241  HIP  249
            HIP
Sbjct  109  HIP  111


 Score = 35.0 bits (79),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           H V+H S ++TN RGLKLFT    P+P  K
Sbjct  27  HQVTHNSEYITNSRGLKLFTQWWTPLPPTK  56



>ref|XP_004496283.1| PREDICTED: monoglyceride lipase-like [Cicer arietinum]
Length=322

 Score = 79.0 bits (193),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P T +IG + +V G+T +S+  IQLT ++  K GF  CAIDHQGHG+++GL AHIP
Sbjct  48   WIPQPPTNIIGTIAVVHGYTSESSSFIQLTAVYFTKAGFATCAIDHQGHGFSDGLIAHIP  107


 Score = 40.8 bits (94),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSHGS FVTNPRGLKLFT    P P
Sbjct  26  HSVSHGSEFVTNPRGLKLFTQWWIPQP  52



>gb|KFK26173.1| hypothetical protein AALP_AA8G212300 [Arabis alpina]
Length=332

 Score = 80.5 bits (197),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P   T  IGI+ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL  HIP
Sbjct  49   WSPLSPTTPIGIIAVVHGFTGESSWFLQLTSILFAKSGFITCAIDHQGHGFSDGLITHIP  108


 Score = 38.5 bits (88),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSVSH S F+TNPRGLKLFT    P+
Sbjct  27  HSVSHSSAFITNPRGLKLFTQWWSPL  52



>gb|EPS74573.1| hypothetical protein M569_00182, partial [Genlisea aurea]
Length=320

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P     + GIVC+V GFT +S+W +QLT +HI K GF VCAIDH GHG++EGL AHIP
Sbjct  47   WLPRDPVPINGIVCVVHGFTGESSWFVQLTAVHIAKHGFAVCAIDHTGHGFSEGLIAHIP  106



>ref|XP_008776344.1| PREDICTED: caffeoylshikimate esterase [Phoenix dactylifera]
Length=354

 Score = 82.0 bits (201),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  +V+G + +V GFT +S+WL+QLT ++  K GF V A+DHQGHG+++GL AHIP
Sbjct  48   WAPVPPAEVVGTIGVVHGFTGESSWLVQLTAVYFAKAGFAVGALDHQGHGFSDGLVAHIP  107


 Score = 36.2 bits (82),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSHGS    NPRGL++FT    P+P
Sbjct  26  HSVSHGSSSFVNPRGLRIFTQWWAPVP  52



>ref|XP_011031746.1| PREDICTED: caffeoylshikimate esterase-like [Populus euphratica]
Length=338

 Score = 82.8 bits (203),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA---  240
            WTP P TK IG V +V GFT +S+W +QLT +   + GFVVCAIDHQGHG+++GL     
Sbjct  49   WTPLPPTKTIGCVAVVHGFTGESSWFVQLTSILFAEHGFVVCAIDHQGHGFSDGLDNLIY  108

Query  241  HIP  249
            HIP
Sbjct  109  HIP  111


 Score = 34.7 bits (78),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           H V+H S ++TN RGLKLFT    P+P  K
Sbjct  27  HQVTHNSEYITNTRGLKLFTQWWTPLPPTK  56



>ref|XP_003591911.1| Monoglyceride lipase [Medicago truncatula]
 gb|AES62162.1| alpha/beta hydrolase family protein [Medicago truncatula]
Length=325

 Score = 82.4 bits (202),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P TK+IG + +V G+T +S+W +QL+ ++  K GF  CAIDHQGHG+++GL AHIP
Sbjct  48   WIPNPPTKLIGTLAVVHGYTGESSWTVQLSAVYFAKAGFATCAIDHQGHGFSDGLIAHIP  107


 Score = 35.0 bits (79),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSV+H S F+TN RGLKLFT    P P  K
Sbjct  26  HSVTHASEFITNSRGLKLFTQWWIPNPPTK  55



>ref|XP_010932980.1| PREDICTED: caffeoylshikimate esterase-like [Elaeis guineensis]
Length=354

 Score = 80.9 bits (198),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  +V+G + +V GFT +S+WL+QLT ++  K GF + A+DHQGHG+++GL AHIP
Sbjct  48   WAPVPPAEVVGTIGVVHGFTGESSWLVQLTAVYFAKAGFAMGALDHQGHGFSDGLVAHIP  107


 Score = 35.8 bits (81),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           HSVSHGS    NPRGL++FT    P+P
Sbjct  26  HSVSHGSSSFVNPRGLRIFTQWWAPVP  52



>ref|XP_004157524.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
Length=333

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P    IGI+ IV GFT +++W IQLT +H  K GF+ CAIDHQGHG++EGL  HIP
Sbjct  48   WIPQPPVNPIGIIGIVHGFTGETSWFIQLTAVHFTKAGFITCAIDHQGHGFSEGLLYHIP  107



>ref|XP_004142429.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 gb|KGN52274.1| hypothetical protein Csa_5G623380 [Cucumis sativus]
Length=333

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P    IGI+ IV GFT +++W IQLT +H  K GF+ CAIDHQGHG++EGL  HIP
Sbjct  48   WIPQPPVNPIGIIGIVHGFTGETSWFIQLTAVHFTKAGFITCAIDHQGHGFSEGLLYHIP  107



>ref|XP_011084365.1| PREDICTED: caffeoylshikimate esterase [Sesamum indicum]
Length=333

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPF-PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  P   + GIVC+V GFT +S+W +QLT +H+ K GF VCAIDH GHG++EGL AH+
Sbjct  52   WAPQEPAGPLKGIVCVVHGFTGESSWFVQLTAVHLAKHGFAVCAIDHMGHGFSEGLVAHL  111

Query  247  P  249
            P
Sbjct  112  P  112



>gb|EYU39580.1| hypothetical protein MIMGU_mgv1a009732mg [Erythranthe guttata]
Length=333

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPF-PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  P   + G+VC+V G+T +S+W +QLT +H+ K GF VCAIDH GHG++EGL AH+
Sbjct  51   WAPLQPAGPLKGVVCVVHGYTGESSWFVQLTAVHVAKHGFAVCAIDHMGHGFSEGLVAHV  110

Query  247  P  249
            P
Sbjct  111  P  111



>ref|XP_010534286.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534287.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Tarenaya 
hassleriana]
Length=329

 Score = 80.5 bits (197),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P P ++ +G+V +V GFT +S+W +QLT +   K GF+  AIDHQGHG+++GL AHIP
Sbjct  49   WSPLPPSRPLGLVAVVHGFTGESSWFLQLTSILFAKSGFIAVAIDHQGHGFSDGLGAHIP  108


 Score = 35.0 bits (79),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H V+H S F+TN RGLKLFT    P+P
Sbjct  27  HGVTHSSAFITNSRGLKLFTQWWSPLP  53



>ref|XP_009392259.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=336

 Score = 81.3 bits (199),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  + I  V +V GFT +S+WL+QLT +++ K GF V A+DHQGHG+++GL AHIP
Sbjct  53   WEPLPPARPIATVAVVHGFTGESSWLVQLTAVYLAKHGFAVGALDHQGHGFSDGLVAHIP  112


 Score = 33.5 bits (75),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H+VSH S    NPRGL++FT   +P+P
Sbjct  31  HAVSHASSSFVNPRGLRIFTQWWEPLP  57



>gb|KDP44357.1| hypothetical protein JCGZ_20037 [Jatropha curcas]
Length=339

 Score = 80.5 bits (197),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA---  240
            WTP P T++IG V +V G+T +S+W +QLT +   + GF VCAIDHQGHG+++GL     
Sbjct  50   WTPLPPTEIIGCVAMVHGYTGESSWFVQLTSILFAQSGFAVCAIDHQGHGFSDGLDGLIY  109

Query  241  HIP  249
            HIP
Sbjct  110  HIP  112


 Score = 33.9 bits (76),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIP  83
           H V+H S ++TN RGLKLFT    P+P
Sbjct  28  HRVTHSSEYITNSRGLKLFTQWWTPLP  54



>ref|XP_011040996.1| PREDICTED: caffeoylshikimate esterase [Populus euphratica]
Length=331

 Score = 81.6 bits (200),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA---  240
            WTP P TK IG V +V GFT +S+W IQLT +   K GF VCAIDHQGHG+++GL     
Sbjct  50   WTPLPPTKPIGCVAVVHGFTGESSWFIQLTSILFAKNGFSVCAIDHQGHGFSDGLDNLMY  109

Query  241  HIP  249
            HIP
Sbjct  110  HIP  112


 Score = 32.0 bits (71),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           H V+H S ++TN RG KLFT    P+P  K
Sbjct  28  HHVTHSSEYITNSRGFKLFTQRWTPLPPTK  57



>ref|XP_002316366.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEF02537.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=331

 Score = 80.5 bits (197),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA---  240
            WTP P +K IG V +V GFT +S+W IQLT +   ++GF VCAIDHQGHG+++GL     
Sbjct  50   WTPLPPSKTIGCVAVVHGFTGESSWFIQLTSILFAQKGFSVCAIDHQGHGFSDGLDNLMY  109

Query  241  HIP  249
            HIP
Sbjct  110  HIP  112


 Score = 33.1 bits (74),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           H V+H S ++TN RG KLFT    P+P  K
Sbjct  28  HQVTHSSEYITNSRGFKLFTQWWTPLPPSK  57



>ref|XP_007009827.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY18637.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=339

 Score = 78.6 bits (192),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 4/63 (6%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTE---GLKA  240
            WTP   T + GIV +V GFT +S+WL+QLT +   K GF  CAIDHQGHG++E   GL+A
Sbjct  49   WTPLN-TPISGIVAVVHGFTGESSWLLQLTSVLFAKSGFAACAIDHQGHGFSEGLDGLEA  107

Query  241  HIP  249
            HIP
Sbjct  108  HIP  110


 Score = 34.7 bits (78),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 20/30 (67%), Gaps = 4/30 (13%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLF----TPLVDPI  80
           HSVSH S F TN RGLKLF    TPL  PI
Sbjct  27  HSVSHSSEFFTNARGLKLFTQWWTPLNTPI  56



>ref|XP_006854516.1| hypothetical protein AMTR_s00175p00065840 [Amborella trichopoda]
 gb|ERN15983.1| hypothetical protein AMTR_s00175p00065840 [Amborella trichopoda]
Length=332

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  91   KVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            +V+GIVC+V GFT +S+W +QLT + + KQGF  CA+DHQGHG ++GL  HIP
Sbjct  63   QVMGIVCVVHGFTGESSWFVQLTAVAMAKQGFACCALDHQGHGLSDGLSTHIP  115



>emb|CDX91009.1| BnaC02g05880D [Brassica napus]
Length=1032

 Score = 76.3 bits (186),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 7/63 (11%)
 Frame = +1

Query  70   WTPF---PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA  240
            WTP    PL    G++ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG ++GL A
Sbjct  49   WTPLHRPPL----GLIAVVHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGLSDGLTA  104

Query  241  HIP  249
            HIP
Sbjct  105  HIP  107


 Score = 36.6 bits (83),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 15/26 (58%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S ++TNP GLKLFT    P+
Sbjct  27  HSVAHSSAYITNPTGLKLFTQWWTPL  52



>dbj|BAK08241.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P     V+G + +V GFT +S+W++ LT +H  KQGF V A+DHQGHG++EGL+AHIP
Sbjct  48   WVPSGDAPVLGAIAVVHGFTGESSWMVLLTAVHFAKQGFAVAAVDHQGHGFSEGLQAHIP  107



>ref|XP_010524322.1| PREDICTED: caffeoylshikimate esterase [Tarenaya hassleriana]
Length=325

 Score = 72.8 bits (177),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+P    + +G+V +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL  HIP
Sbjct  49   WSPLS-GRPLGLVAVVHGFTSESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLITHIP  107


 Score = 38.5 bits (88),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSVSH S FVTNPRGLKLFT    P+
Sbjct  27  HSVSHSSAFVTNPRGLKLFTQWWSPL  52



>ref|XP_010679109.1| PREDICTED: caffeoylshikimate esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=328

 Score = 75.9 bits (185),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 4/63 (6%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLK---A  240
            W P  L + IG++C+V G+T +++W +QLT ++  K GF+VC IDHQGHGY++ L    A
Sbjct  48   WAPL-LGERIGVICVVHGYTGETSWTVQLTSIYFAKAGFIVCGIDHQGHGYSDALNGYVA  106

Query  241  HIP  249
            HIP
Sbjct  107  HIP  109


 Score = 33.5 bits (75),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSVSH S ++TN RG+KLFT    P+
Sbjct  26  HSVSHSSEYITNSRGMKLFTQCWAPL  51



>ref|XP_002871641.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47900.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=324

 Score = 74.3 bits (181),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP      +G++ +V GFT +S+W +QLT +   K G++ CAIDHQGHG+++GL AHIP
Sbjct  49   WTPLNRPP-LGLIAVVHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSDGLTAHIP  107


 Score = 35.0 bits (79),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S FVTNP GLKLFT    P+
Sbjct  27  HSVAHSSAFVTNPTGLKLFTQWWTPL  52



>emb|CDX85571.1| BnaA02g02420D [Brassica napus]
Length=328

 Score = 75.9 bits (185),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 7/63 (11%)
 Frame = +1

Query  70   WTPF---PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA  240
            WTP    PL    G++ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL A
Sbjct  49   WTPLHRPPL----GLIAVVHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLTA  104

Query  241  HIP  249
            HIP
Sbjct  105  HIP  107


 Score = 33.1 bits (74),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S ++TNP GLKLFT    P+
Sbjct  27  HSVAHSSAYITNPTGLKLFTQWWTPL  52



>ref|XP_009126022.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=328

 Score = 75.5 bits (184),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 7/63 (11%)
 Frame = +1

Query  70   WTPF---PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA  240
            WTP    PL    G++ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL A
Sbjct  49   WTPLHRPPL----GLIAVVHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLTA  104

Query  241  HIP  249
            HIP
Sbjct  105  HIP  107


 Score = 33.1 bits (74),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S ++TNP GLKLFT    P+
Sbjct  27  HSVAHSSAYITNPTGLKLFTQWWTPL  52



>ref|XP_006400019.1| hypothetical protein EUTSA_v10014122mg [Eutrema salsugineum]
 gb|ESQ41472.1| hypothetical protein EUTSA_v10014122mg [Eutrema salsugineum]
Length=321

 Score = 75.1 bits (183),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP      +G++ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL AHIP
Sbjct  49   WTPLNRPP-LGLIAVVHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLTAHIP  107


 Score = 33.5 bits (75),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S +VTNP GLKLFT    P+
Sbjct  27  HSVTHSSAYVTNPTGLKLFTQWWTPL  52



>ref|XP_003567617.1| PREDICTED: caffeoylshikimate esterase-like [Brachypodium distachyon]
Length=326

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P     V+G + +V GFT +S W++ LT +H  K GF V A+DHQGHG++EGL+AHIP
Sbjct  48   WVPSGGAPVLGAIAVVHGFTGESGWMVLLTAVHFAKAGFAVAAVDHQGHGFSEGLQAHIP  107



>ref|XP_010492319.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=328

 Score = 74.3 bits (181),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP      +G++ +V GFT +S+W +QLT +   K G++ CAIDHQGHG+++GL AHIP
Sbjct  49   WTPLNRPP-LGLIAVVHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSDGLTAHIP  107


 Score = 33.9 bits (76),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S +VTNP GLKLFT    P+
Sbjct  27  HSVAHSSAYVTNPTGLKLFTQWWTPL  52



>ref|XP_010420143.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=328

 Score = 74.3 bits (181),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP      +G++ +V GFT +S+W +QLT +   K G++ CAIDHQGHG+++GL AHIP
Sbjct  49   WTPLNRPP-LGLIAVVHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSDGLTAHIP  107


 Score = 33.5 bits (75),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S +VTNP GLKLFT    P+
Sbjct  27  HSVAHSSAYVTNPTGLKLFTQWWTPL  52



>gb|KFK25736.1| hypothetical protein AALP_AA8G152900 [Arabis alpina]
Length=329

 Score = 76.6 bits (187),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 7/63 (11%)
 Frame = +1

Query  70   WTPF---PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA  240
            WTP    PL    GI+ +V GFT +S+W +QLT +   K GF+ CAIDHQGHG+++GL A
Sbjct  49   WTPLHRPPL----GIIAVVHGFTGESSWFLQLTSILFAKSGFLTCAIDHQGHGFSDGLTA  104

Query  241  HIP  249
            HIP
Sbjct  105  HIP  107


 Score = 31.2 bits (69),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
            SV+H S +VTNP GLKLFT    P+
Sbjct  27  RSVTHSSAYVTNPTGLKLFTQWWTPL  52



>ref|NP_197002.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
 emb|CAC01817.1| lysophospholipase-like protein [Arabidopsis thaliana]
 gb|AAY78825.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
 gb|AED92098.1| esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
Length=327

 Score = 73.9 bits (180),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP      +G++ +V GFT +S+W +QLT +   K G++ CAIDHQGHG+++GL AHIP
Sbjct  49   WTPLNRPP-LGLIAVVHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSDGLTAHIP  107


 Score = 33.5 bits (75),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S +VTNP GLKLFT    P+
Sbjct  27  HSVTHSSAYVTNPTGLKLFTQWWTPL  52



>ref|XP_006846764.1| hypothetical protein AMTR_s00148p00015200 [Amborella trichopoda]
 gb|ERN08345.1| hypothetical protein AMTR_s00148p00015200 [Amborella trichopoda]
Length=119

 Score = 74.7 bits (182),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  91   KVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            +V+GIVC+V G+T +S+W +QLT + I KQGF  CA+DHQGHG+++GL  HI
Sbjct  60   QVMGIVCLVHGYTGESSWFLQLTAVAIAKQGFACCALDHQGHGFSDGLSTHI  111



>ref|NP_001042883.1| Os01g0317800 [Oryza sativa Japonica Group]
 dbj|BAB62599.1| phospholipase-like protein [Oryza sativa Japonica Group]
 dbj|BAB93436.1| phospholipase-like protein [Oryza sativa Japonica Group]
 dbj|BAF04797.1| Os01g0317800 [Oryza sativa Japonica Group]
 gb|EAZ11646.1| hypothetical protein OsJ_01509 [Oryza sativa Japonica Group]
 dbj|BAG97428.1| unnamed protein product [Oryza sativa Japonica Group]
Length=329

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   VIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            ++G + +V GFT +S+W +QLT +H  K GF V A+DHQGHG++EGL+ HIP
Sbjct  57   LLGAIAVVHGFTGESSWTVQLTAVHFAKAGFAVAAVDHQGHGFSEGLQGHIP  108



>ref|XP_006288192.1| hypothetical protein CARUB_v10001430mg [Capsella rubella]
 gb|EOA21090.1| hypothetical protein CARUB_v10001430mg [Capsella rubella]
Length=328

 Score = 73.2 bits (178),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 7/63 (11%)
 Frame = +1

Query  70   WTPF---PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA  240
            WTP    PL    G++ +V GFT +S+W +QLT +   K G++ CAIDH+GHG+++GL A
Sbjct  49   WTPLNRPPL----GLIAVVHGFTGESSWFLQLTSVLFAKSGYLTCAIDHRGHGFSDGLTA  104

Query  241  HIP  249
            HIP
Sbjct  105  HIP  107


 Score = 32.0 bits (71),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPI  80
           HSV+H S + TNP GLKLFT    P+
Sbjct  27  HSVAHSSAYFTNPSGLKLFTQWWTPL  52



>gb|EEC70515.1| hypothetical protein OsI_01618 [Oryza sativa Indica Group]
Length=257

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   VIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            ++G + +V GFT +S+W +QLT +H  K GF V A+DHQGHG++EGL+ HIP
Sbjct  65   LLGAIAVVHGFTGESSWTVQLTAVHFAKAGFAVAAVDHQGHGFSEGLQGHIP  116



>ref|XP_002529580.1| Monoglyceride lipase, putative [Ricinus communis]
 gb|EEF32814.1| Monoglyceride lipase, putative [Ricinus communis]
Length=300

 Score = 74.3 bits (181),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKA---  240
            WTP P TK+   V ++ GFT +S+W +QLT +   + GF VCAIDHQGHG+++GL     
Sbjct  52   WTPLPPTKITACVAVIHGFTGESSWFVQLTSILFAQSGFAVCAIDHQGHGFSDGLDGLIY  111

Query  241  HIP  249
            HIP
Sbjct  112  HIP  114


 Score = 29.6 bits (65),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           H+V+  S ++TN RG KLFT    P+P  K
Sbjct  30  HNVTCSSEYITNSRGFKLFTQWWTPLPPTK  59



>gb|EAY73742.1| hypothetical protein OsI_01616 [Oryza sativa Indica Group]
Length=322

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPFPL-TKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  +   ++G + +V GFT +S+W++QLT +H  K GF V A+DHQGHG +EGL+ HI
Sbjct  48   WVPAGVDAPLLGAIAVVHGFTGESSWMVQLTAVHFAKAGFAVAAVDHQGHGLSEGLQDHI  107

Query  247  P  249
            P
Sbjct  108  P  108



>ref|XP_002300571.2| hypothetical protein POPTR_0001s47090g [Populus trichocarpa]
 gb|EEE85376.2| hypothetical protein POPTR_0001s47090g [Populus trichocarpa]
Length=333

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPF-PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  P +++ GIV +V G++ +S+WL +LT + I K GF+VCA+D QGHGY++GL+ HI
Sbjct  49   WRPDDPTSQLKGIVAMVHGYSSESSWLNELTAIAIAKAGFLVCALDLQGHGYSDGLRGHI  108

Query  247  P  249
            P
Sbjct  109  P  109



>ref|XP_011039896.1| PREDICTED: caffeoylshikimate esterase-like [Populus euphratica]
Length=356

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPF-PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  P +++ GIV +V G++ +S+WL +LT + I K GF+VCA+D QGHGY++GL+ HI
Sbjct  80   WRPDDPSSQLEGIVAMVHGYSSESSWLNELTAIAIAKAGFLVCALDLQGHGYSDGLRGHI  139

Query  247  P  249
            P
Sbjct  140  P  140



>ref|XP_001752999.1| predicted protein [Physcomitrella patens]
 gb|EDQ82040.1| predicted protein [Physcomitrella patens]
Length=320

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    +V G+VC+  G+  D+ WL+QLT + I K+G+ V AIDHQGHG +EGLK H+P
Sbjct  51   WVPVD-REVRGVVCVCHGYGADAGWLVQLTCIAIAKEGYAVYAIDHQGHGKSEGLKGHVP  109



>ref|XP_010558754.1| PREDICTED: caffeoylshikimate esterase-like [Tarenaya hassleriana]
Length=321

 Score = 66.2 bits (160),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            WTP   ++ IG+V ++ GFT +S+W ++LT +   + GF+  AID QGHG+++GL  ++P
Sbjct  49   WTPRSPSRPIGLVAVLHGFTFESSWFVELTSILFAESGFITVAIDLQGHGFSDGLTGYVP  108


 Score = 33.1 bits (74),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFT  62
           H VSH S F+TN RGLKLFT
Sbjct  27  HGVSHSSDFITNSRGLKLFT  46



>ref|XP_010251778.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=331

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    +  G+V +V G+T DS+W+ +LT + I K GF V A+D QGHG++EGL  HIP
Sbjct  48   WGPDSTIRPRGVVAMVHGYTSDSSWIFELTAVAIAKSGFYVTALDLQGHGFSEGLSGHIP  107



>ref|XP_009381885.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=177

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPF-PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  P   V G+V ++ G+  +S+W+ QLT + I K+GFVVCA+D +GHG +EG + HI
Sbjct  48   WRPASPSAAVHGLVAMIHGYASESSWVFQLTAVAIAKRGFVVCALDLRGHGRSEGRRGHI  107

Query  247  P  249
            P
Sbjct  108  P  108



>ref|XP_001772196.1| predicted protein [Physcomitrella patens]
 gb|EDQ63009.1| predicted protein [Physcomitrella patens]
Length=324

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  91   KVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            ++ G+VC+  G+  DS WL+QLT + I K+G+ V AIDHQGHG +EGLK HIP
Sbjct  57   ELRGVVCVCHGYGADSGWLVQLTCIAIAKEGYAVYAIDHQGHGKSEGLKGHIP  109



>ref|XP_002523188.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39219.1| conserved hypothetical protein [Ricinus communis]
Length=290

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W+    ++  G+V +V G++ +S+W+ +LT + I K GF+VCA+D QGHGY++GL  HIP
Sbjct  48   WSQDSASQPKGLVAMVHGYSSESSWINELTAVAIAKAGFLVCALDLQGHGYSDGLPGHIP  107



>ref|XP_008794508.1| PREDICTED: caffeoylshikimate esterase-like [Phoenix dactylifera]
Length=326

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPF-PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  P +++ G+V +V G+  +S+W+ QLT + I K GF+ CA+D  GHGY+EG + HI
Sbjct  48   WRPASPSSELKGVVAMVHGYNSESSWIFQLTAVAIAKLGFLACALDLPGHGYSEGQRGHI  107

Query  247  P  249
            P
Sbjct  108  P  108



>ref|XP_002263371.1| PREDICTED: caffeoylshikimate esterase-like [Vitis vinifera]
Length=328

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    +  G+V +V G+T +S+WL  LT + I K GF+V A+D QGHGY+EGL  HIP
Sbjct  48   WCPDSTLQPKGLVAMVHGYTSESSWLFGLTAVAIAKAGFLVYALDLQGHGYSEGLPGHIP  107



>emb|CAN63634.1| hypothetical protein VITISV_009388 [Vitis vinifera]
Length=328

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    +  G+V +V G+T +S+WL  LT + I K GF V A+D QGHGY+EGL  HIP
Sbjct  48   WCPDSTLQPKGLVAMVHGYTSESSWLFGLTAVAIAKAGFFVYALDLQGHGYSEGLPGHIP  107



>tpg|DAA54424.1| TPA: hypothetical protein ZEAMMB73_151003 [Zea mays]
Length=328

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P     V+G V +V GFT +S+W IQLT +H+   GF V A+DHQGHG++EGL+ H+P
Sbjct  48   WVPSGDAPVLGAVAVVHGFTGESSWTIQLTAVHLAAAGFAVAALDHQGHGFSEGLQGHLP  107



>ref|XP_004233162.1| PREDICTED: caffeoylshikimate esterase-like [Solanum lycopersicum]
Length=344

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    ++ G+V ++ G+T +S+WL +L  + +VK GF VC++D QGHGY+EG   +IP
Sbjct  73   WQPESSNQLRGLVGMIHGYTSESSWLFELNAVAMVKAGFFVCSLDLQGHGYSEGSPGYIP  132



>ref|XP_010245789.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=330

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +1

Query  70   WTP--FPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAH  243
            W P    + ++ G+V +V G+T +S+W+ +LT + I K    VCA+D QGHGY+EGL  H
Sbjct  48   WRPANTAMAELRGLVAMVHGYTSESSWVFELTAVAIAKARLYVCALDLQGHGYSEGLSGH  107

Query  244  IP  249
            IP
Sbjct  108  IP  109



>ref|XP_002455554.1| hypothetical protein SORBIDRAFT_03g013040 [Sorghum bicolor]
 gb|EES00674.1| hypothetical protein SORBIDRAFT_03g013040 [Sorghum bicolor]
Length=330

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  91   KVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            +V+G V +V GFT +S+W++QLT +H+   GF V A+DHQGHG++EGL+ H+P
Sbjct  56   RVLGAVAVVHGFTGESSWMVQLTAVHLAAAGFAVAALDHQGHGFSEGLQCHVP  108



>ref|XP_009587884.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana tomentosiformis]
Length=319

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    ++ G+V ++ G+T +S+WL +L  + + K GF VCA+D QGHGY+EG   +IP
Sbjct  48   WQPESSNQLRGLVGMIHGYTSESSWLFELNAVTMAKAGFFVCALDLQGHGYSEGSPGYIP  107



>ref|XP_008441075.1| PREDICTED: caffeoylshikimate esterase-like [Cucumis melo]
Length=330

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   TK+ G+V +V G+T DS W+ +LT + I K GF+VC++D QGHG +EG    IP
Sbjct  48   WRPDSDTKLKGVVAMVHGYTCDSGWIFELTGVAIAKLGFLVCSLDLQGHGRSEGAPGSIP  107



>ref|XP_010923690.1| PREDICTED: caffeoylshikimate esterase-like [Elaeis guineensis]
Length=326

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPF-PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  P  K+ GIV +V G+  +S+W+ QLT + I K GF+ CA+D  GHG+++G + HI
Sbjct  48   WRPASPSVKLNGIVAMVHGYNSESSWIFQLTAVAIAKLGFLACALDLPGHGHSQGPRGHI  107

Query  247  P  249
            P
Sbjct  108  P  108



>ref|XP_006448890.1| hypothetical protein CICLE_v10017467mg [Citrus clementina]
 gb|ESR62130.1| hypothetical protein CICLE_v10017467mg [Citrus clementina]
Length=330

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G+V +V G+T DS+W+ +LT + I K GF+VCA+D QGHG ++G   HIP
Sbjct  66   GLVAMVHGYTADSSWISELTAVAIAKLGFLVCALDLQGHGQSDGYPGHIP  115



>ref|XP_006448889.1| hypothetical protein CICLE_v10015863mg [Citrus clementina]
 gb|ESR62129.1| hypothetical protein CICLE_v10015863mg [Citrus clementina]
Length=336

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G+V +V G+T DS+W+ +LT + I K GF+VCA+D QGHG ++G   HIP
Sbjct  68   GLVAMVHGYTADSSWISELTAVAIAKLGFLVCALDLQGHGQSDGYPGHIP  117



>emb|CDP17301.1| unnamed protein product [Coffea canephora]
Length=322

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P    ++ G+V ++ G++ +S+WL +L  + I K G+ VCA+D +GHGY+EGL   I
Sbjct  50   WQPDSTARLKGLVGMIHGYSSESSWLFELNAVAIAKAGYFVCALDLEGHGYSEGLPGQI  108



>ref|XP_009800227.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana sylvestris]
Length=319

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W      ++ G+V ++ G+T +S+WL +L  + + K GF VCA+D QGHGY+EG   +IP
Sbjct  48   WQSESSNQLRGLVGMIHGYTSESSWLFELNAVAMAKAGFFVCALDLQGHGYSEGSPGYIP  107



>ref|XP_004158692.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
Length=328

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P   +K+ G+V +V G+T DS W+ +LT + I K GF+VC++D QGHG +EG    I
Sbjct  48   WQPDSDSKLKGVVAMVHGYTCDSGWIFELTGIAIAKLGFLVCSLDLQGHGRSEGAPGSI  106



>gb|KGN49464.1| hypothetical protein Csa_6G525500 [Cucumis sativus]
Length=328

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P   +K+ G+V +V G+T DS W+ +LT + I K GF+VC++D QGHG +EG    I
Sbjct  48   WQPDSDSKLKGVVAMVHGYTCDSGWIFELTGIAIAKLGFLVCSLDLQGHGRSEGAPGSI  106



>gb|EYU27946.1| hypothetical protein MIMGU_mgv1a026912mg [Erythranthe guttata]
Length=316

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   +   G+VC+V G+ +D +W  Q T + + + GF   A+D +GHG +EGLKA++P
Sbjct  46   WQPLQSSHTRGVVCMVHGYGNDISWTFQATPIFLAQNGFACFALDIEGHGRSEGLKAYVP  105



>ref|XP_006343251.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343252.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Solanum 
tuberosum]
Length=317

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T   GI+ +V G+ +D++W  Q T +H+ K+GF   A+D +GHG ++GLKA++P
Sbjct  48   WLPPTKTPPKGIIFMVHGYGNDTSWTFQATPIHLAKKGFACFALDLEGHGQSQGLKAYVP  107



>gb|EPS70994.1| hypothetical protein M569_03765, partial [Genlisea aurea]
Length=314

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  70   WTPF-PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P  P   +  ++ ++ G+T +S+WL +L  +   K GF VCA+D QGHGY+EG   HI
Sbjct  48   WQPSDPTVPLKALIAMIHGYTSESSWLSELNSVAFAKAGFFVCALDLQGHGYSEGPPDHI  107

Query  247  P  249
            P
Sbjct  108  P  108



>ref|XP_011096881.1| PREDICTED: caffeoylshikimate esterase-like [Sesamum indicum]
Length=320

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  88   TKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            +++ G+V ++ G+T +S WL +L+ + I K GF+VC++D QGHG++EG + HI
Sbjct  56   SQLKGVVGMIHGYTSESGWLFELSAVGIAKAGFLVCSLDLQGHGFSEGPRDHI  108



>ref|XP_009610353.1| PREDICTED: caffeoylshikimate esterase [Nicotiana tomentosiformis]
Length=321

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T   GI+ +V G+ +D +W  Q T +H+ K GF   A+D +GHG ++GLKA++P
Sbjct  52   WLPSAKTPPRGIIFMVHGYGNDISWTFQATPIHLAKNGFACFALDLEGHGQSQGLKAYVP  111



>ref|XP_004234129.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=317

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T   GI+ ++ G+ +D +W  Q T +H+ K+GF   A+D +GHG ++GLKA++P
Sbjct  48   WLPPTKTPPKGIIFMIHGYGNDISWTFQATPIHLAKKGFACFALDLEGHGQSQGLKAYVP  107



>gb|KDP34930.1| hypothetical protein JCGZ_09218 [Jatropha curcas]
Length=295

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G+V ++ G++ +S+W+ +LT + I K GF+V A+D QGHG ++GL  HIP
Sbjct  58   GLVAMIHGYSSESSWVNELTAIAIAKLGFLVFALDLQGHGRSDGLPGHIP  107



>ref|XP_009782580.1| PREDICTED: caffeoylshikimate esterase [Nicotiana sylvestris]
Length=321

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P       GI+ +V G+ +D +W  Q T +H+ K GF   A+D +GHG ++GLKA++P
Sbjct  52   WLPSAKNPPRGIIFMVHGYGNDISWTFQATPIHLAKNGFACFALDLEGHGQSQGLKAYVP  111



>ref|XP_007159280.1| hypothetical protein PHAVU_002G224700g [Phaseolus vulgaris]
 gb|ESW31274.1| hypothetical protein PHAVU_002G224700g [Phaseolus vulgaris]
Length=326

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P T    +V +V G+ +D +W  Q T + + + GF   A+D QGHG++EGLKA +P
Sbjct  53   WLPNPSTTPRAVVFMVHGYGNDISWTFQATPIFLAQSGFACFAVDLQGHGHSEGLKAFVP  112



>ref|XP_002316636.1| hydrolase family protein [Populus trichocarpa]
 gb|EEE97248.1| hydrolase family protein [Populus trichocarpa]
Length=323

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P     V+G++C+V G+ +D +W  Q T + + + GF    +D +GHG ++GLK ++P
Sbjct  50   WLPISTDPVLGVMCMVHGYGNDISWTFQSTAIFLAQMGFACFGLDIEGHGKSQGLKGYVP  109



>ref|XP_011096267.1| PREDICTED: caffeoylshikimate esterase [Sesamum indicum]
Length=330

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P       GI+C+V G+ +D +W  Q T + + + GF   A+D +GHG + GLKA++P
Sbjct  49   WQPLQSEPPRGIICMVHGYGNDISWTFQGTAIFLAQNGFACFALDLEGHGRSRGLKAYVP  108



>ref|XP_002990215.1| hypothetical protein SELMODRAFT_447944 [Selaginella moellendorffii]
 gb|EFJ08775.1| hypothetical protein SELMODRAFT_447944 [Selaginella moellendorffii]
Length=329

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 4/63 (6%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYT---EGLKA  240
            W P    +V  +V +  G+  DS W +QLT + I ++GF V AIDHQGHG +   +GL+A
Sbjct  48   WLP-TRERVKALVMVCHGYGADSGWFVQLTAIGIAQRGFAVHAIDHQGHGRSQDWQGLRA  106

Query  241  HIP  249
            ++P
Sbjct  107  YVP  109



>ref|XP_002992473.1| hypothetical protein SELMODRAFT_186777 [Selaginella moellendorffii]
 gb|EFJ06411.1| hypothetical protein SELMODRAFT_186777 [Selaginella moellendorffii]
Length=328

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 4/63 (6%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYT---EGLKA  240
            W P    +V  +V +  G+  DS W +QLT + I ++GF V AIDHQGHG +   +GL+A
Sbjct  48   WLP-TRERVKALVMVCHGYGADSGWFVQLTAIGIAQRGFAVHAIDHQGHGRSQDWQGLRA  106

Query  241  HIP  249
            ++P
Sbjct  107  YVP  109



>ref|XP_003634858.1| PREDICTED: caffeoylshikimate esterase [Vitis vinifera]
 emb|CAN82216.1| hypothetical protein VITISV_020423 [Vitis vinifera]
Length=314

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T    ++C+V G+ +D +W  Q T + + + GF   A+D QGHG +EGLKA++P
Sbjct  47   WQPLS-TPPRALICMVHGYGNDISWTFQATPIFLAQMGFACFALDLQGHGQSEGLKAYVP  105



>emb|CBI18753.3| unnamed protein product [Vitis vinifera]
Length=341

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T    ++C+V G+ +D +W  Q T + + + GF   A+D QGHG +EGLKA++P
Sbjct  47   WQPLS-TPPRALICMVHGYGNDISWTFQATPIFLAQMGFACFALDLQGHGQSEGLKAYVP  105



>gb|EYU19116.1| hypothetical protein MIMGU_mgv1a027063mg [Erythranthe guttata]
Length=322

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            G V ++ G+T +S+WL +L  + I K GF VCA+D QGHG ++G   HI
Sbjct  64   GFVGMIHGYTSESSWLFELNAVAIAKAGFFVCALDLQGHGLSQGPHDHI  112



>ref|XP_006845999.1| hypothetical protein AMTR_s00155p00055670 [Amborella trichopoda]
 gb|ERN07674.1| hypothetical protein AMTR_s00155p00055670 [Amborella trichopoda]
Length=323

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G+VC++ GF   S    +LT + +VKQGF V A+D QGHG +EGL+ +IP
Sbjct  58   GLVCMIHGFMVHSGGPWELTAIAMVKQGFAVYALDLQGHGRSEGLRGYIP  107



>gb|KDP20918.1| hypothetical protein JCGZ_21389 [Jatropha curcas]
Length=318

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W     T   GI+C+V G+ +D +W  Q T + + ++GF    ID +GHG ++GLKA++P
Sbjct  50   WLSSSTTPPRGILCMVHGYGNDISWTFQSTAIFLAQKGFACFGIDIEGHGRSQGLKAYVP  109



>ref|XP_011043243.1| PREDICTED: caffeoylshikimate esterase [Populus euphratica]
Length=323

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P      +G++C+V G+ +D +W  Q T + + + GF    +D +GHG ++GLK ++P
Sbjct  50   WLPISTDPPLGVMCMVHGYGNDISWTFQSTAIFLAQMGFACFGLDIEGHGKSQGLKGYVP  109



>ref|XP_006841721.1| hypothetical protein AMTR_s00003p00257040 [Amborella trichopoda]
 gb|ERN03396.1| hypothetical protein AMTR_s00003p00257040 [Amborella trichopoda]
Length=329

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 7/78 (9%)
 Frame = +1

Query  16   TAPSSSPILAVSSCSPH*WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVC  195
            T+P S  +   S      W P   +    I+ ++ G+ +D +W  Q T +H+ + GF   
Sbjct  33   TSPRSLSLFTRS------WLPLS-SSTRAIILMLHGYGNDISWTFQATAIHLARNGFACF  85

Query  196  AIDHQGHGYTEGLKAHIP  249
            A+D +GHG ++GLKA++P
Sbjct  86   ALDLEGHGRSQGLKAYVP  103



>ref|XP_010278298.1| PREDICTED: caffeoylshikimate esterase [Nelumbo nucifera]
Length=360

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   +   GIVC+V G+ +D +W  Q T + + ++GF   A+D +GHG +EGLK  +P
Sbjct  74   WLPLS-SHPRGIVCMVHGYGNDISWTFQSTPIFLAQKGFASFALDLEGHGRSEGLKGFVP  132



>gb|AFK35254.1| unknown [Medicago truncatula]
 gb|AFK64818.1| unknown [Medicago truncatula]
 gb|KEH31129.1| alpha/beta hydrolase family protein [Medicago truncatula]
Length=325

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P T    ++ ++ G+ +D +W  Q T + + + GF   ++D QGHG+++GLKA +P
Sbjct  56   WLPNPTTPPRALIFMIHGYGNDISWTFQSTPIFLAQMGFACFSLDLQGHGHSQGLKAFVP  115



>ref|XP_008442222.1| PREDICTED: caffeoylshikimate esterase [Cucumis melo]
Length=319

 Score = 53.9 bits (128),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P T    ++ +V G+ ++ +W  Q T + + + GF   A+D +GHG ++GLKA +P
Sbjct  48   WLPLPPTPPRALIFMVHGYGNNISWTFQATSIFLAQMGFACFALDLEGHGRSQGLKAFVP  107


 Score = 25.4 bits (54),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +3

Query  27  FVTNPRGLKLFTPLVDPIP  83
           F T+PRGLKLFT    P+P
Sbjct  34  FYTSPRGLKLFTRSWLPLP  52



>ref|XP_004146590.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 ref|XP_004158035.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 gb|KGN64644.1| hypothetical protein Csa_1G073040 [Cucumis sativus]
Length=319

 Score = 53.5 bits (127),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P T    ++ +V G+ ++ +W  Q T + + + GF   A+D +GHG ++GLKA +P
Sbjct  48   WLPLPPTPPRALIFMVHGYGNNISWTFQATSIFLAQMGFACFALDLEGHGRSQGLKAFVP  107


 Score = 25.4 bits (54),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +3

Query  27  FVTNPRGLKLFTPLVDPIP  83
           F T+PRGLKLFT    P+P
Sbjct  34  FYTSPRGLKLFTRSWLPLP  52



>emb|CDO99600.1| unnamed protein product [Coffea canephora]
Length=318

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  +  G++ +V G+ +D +W  Q T + + + G+   A+D +GHG +EGLKA++P
Sbjct  50   WLP-PNNQPRGVIFMVHGYGNDISWTFQATTIFLAQNGYACFAVDLEGHGKSEGLKAYVP  108



>ref|NP_001240171.1| uncharacterized protein LOC100793956 [Glycine max]
 gb|ACU24156.1| unknown [Glycine max]
 gb|KHN46325.1| Monoglyceride lipase [Glycine soja]
Length=324

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P T    ++ +V G+ +D +W  Q T + + +  F   A+D QGHG+++GLKA++P
Sbjct  51   WLPNPNTPPRALIFMVHGYGNDISWTFQSTPIFLAQNSFSCFALDLQGHGHSQGLKAYVP  110



>ref|XP_008224992.1| PREDICTED: caffeoylshikimate esterase [Prunus mume]
Length=322

 Score = 51.2 bits (121),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P  L+   G++ +V G+ +D +W  Q T + + +QGF   A+D +GHG + GL+A +P
Sbjct  52   WLPL-LSPPRGLIFMVHGYGNDISWTFQATPIFLAQQGFACFALDLEGHGQSHGLRAFVP  110


 Score = 26.9 bits (58),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 13/21 (62%), Positives = 15/21 (71%), Gaps = 4/21 (19%)
 Frame = +3

Query  27  FVTNPRGLKLFT----PLVDP  77
           F T+PRGLKLFT    PL+ P
Sbjct  38  FYTSPRGLKLFTRQWLPLLSP  58



>ref|XP_007211531.1| hypothetical protein PRUPE_ppa008252mg [Prunus persica]
 gb|EMJ12730.1| hypothetical protein PRUPE_ppa008252mg [Prunus persica]
Length=339

 Score = 51.6 bits (122),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P  L+   G++ +V G+ +D +W  Q T + + +QGF   A+D +GHG + GL+A +P
Sbjct  63   WLPL-LSPPRGLIFMVHGYGNDISWTFQATPIFLAQQGFACFALDLEGHGQSHGLRAFVP  121


 Score = 26.9 bits (58),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 13/21 (62%), Positives = 15/21 (71%), Gaps = 4/21 (19%)
 Frame = +3

Query  27  FVTNPRGLKLFT----PLVDP  77
           F T+PRGLKLFT    PL+ P
Sbjct  49  FYTSPRGLKLFTRQWLPLLSP  69



>ref|XP_009780674.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Nicotiana 
sylvestris]
Length=323

 Score = 52.0 bits (123),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            GI+ +V G+ +D +W+ Q T + + K GF   A+D +GHG ++G+K+++P
Sbjct  64   GIIFMVHGYGNDISWIFQETPIFLAKNGFACFALDIEGHGLSQGIKSYVP  113


 Score = 26.2 bits (56),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 14/27 (52%), Positives = 16/27 (59%), Gaps = 4/27 (15%)
 Frame = +3

Query  27  FVTNPRGLKLFT----PLVDPIPSYKG  95
           F T+PRGL LFT    P     P+YKG
Sbjct  38  FFTSPRGLSLFTKSWLPKNISSPNYKG  64



>gb|ABR18313.1| unknown [Picea sitchensis]
Length=325

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             ++C++ G+ +D +W  Q T +H  + GF   A+D +GHG ++GL+A++P
Sbjct  53   ALICMLHGYGNDISWTFQNTAIHFAQIGFAAVALDLEGHGRSDGLRAYVP  102



>ref|XP_010686578.1| PREDICTED: caffeoylshikimate esterase [Beta vulgaris subsp. vulgaris]
Length=308

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 8/78 (10%)
 Frame = +1

Query  16   TAPSSSPILAVSSCSPH*WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVC  195
            T+PS   +   S      W   PL+   G +C+V G+ +D +W  Q T + + + GF   
Sbjct  33   TSPSGQTLFTRS------W--IPLSPPRGNICMVHGYGNDISWTFQSTPIFLAQNGFSCF  84

Query  196  AIDHQGHGYTEGLKAHIP  249
            A+D  GHG ++GLKA +P
Sbjct  85   ALDLPGHGQSDGLKAFVP  102



>ref|XP_008809309.1| PREDICTED: caffeoylshikimate esterase [Phoenix dactylifera]
Length=330

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             +VC++ G+ +D +W  Q T + +   GF  CAID  GHG + GL+A +P
Sbjct  64   ALVCMIHGYGNDISWTFQATPIFLASHGFACCAIDLPGHGRSPGLRAFLP  113



>gb|AAT07463.1| lysophospholipase-like protein [Mirabilis jalapa]
Length=155

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            GI+C+V G+ +D +W  Q T + + + GF   A+D  GHG++ GLKA +P
Sbjct  40   GIICMVHGYGNDISWTFQATPISLAQHGFYCFALDLPGHGHSYGLKAFVP  89



>ref|XP_002521403.1| Monoglyceride lipase, putative [Ricinus communis]
 gb|EEF40893.1| Monoglyceride lipase, putative [Ricinus communis]
Length=323

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   +    I+C+V G+ +D +W  Q T + + + GF    ID +GHG ++GLK ++P
Sbjct  50   WFPDSSSPPRSILCMVHGYGNDISWTFQSTAIFLAQMGFACFGIDIEGHGRSQGLKGYVP  109



>ref|XP_004134900.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
Length=267

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  112  IVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            +V G+T DS W+ +LT + I K GF+VC++D QGHG +EG    I
Sbjct  1    MVHGYTCDSGWIFELTGIAIAKLGFLVCSLDLQGHGRSEGAPGSI  45



>ref|XP_007199495.1| hypothetical protein PRUPE_ppb012289mg, partial [Prunus persica]
 gb|EMJ00694.1| hypothetical protein PRUPE_ppb012289mg, partial [Prunus persica]
Length=128

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P  L+   G++ +V G+ +D +W  Q T + + +QGF   A+D +GHG + GL+A +P
Sbjct  55   WLPL-LSPPRGLIFMVHGYGNDISWTFQATPIFLAQQGFACFALDLEGHGQSHGLRAFVP  113



>ref|XP_006467849.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 gb|KDO75845.1| hypothetical protein CISIN_1g021066mg [Citrus sinensis]
Length=317

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T   GI+C+V G+ +D +W  Q   + + + GF   A+D +GHG ++GLKA++P
Sbjct  49   WLPIN-TPPRGILCMVHGYGNDISWTFQGISVFLAQMGFACFALDLEGHGKSQGLKAYVP  107



>ref|XP_006449284.1| hypothetical protein CICLE_v10017806mg [Citrus clementina]
 gb|ESR62524.1| hypothetical protein CICLE_v10017806mg [Citrus clementina]
Length=336

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T   GI+C+V G+ +D +W  Q   + + + GF   A+D +GHG ++GLKA++P
Sbjct  49   WLPIN-TPPRGILCMVHGYGNDISWTFQGISVFLAQMGFACFALDIEGHGKSQGLKAYVP  107



>ref|XP_008383790.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=342

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  79   FPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             PL +  GI+ +V G+ +D +W  Q T + + + GF   A+D +GHG ++GL+A +P
Sbjct  65   LPLRRPRGIIFMVHGYGNDISWTFQATPIFLAQNGFACFALDLEGHGGSDGLRAFVP  121



>ref|XP_011070793.1| PREDICTED: caffeoylshikimate esterase [Sesamum indicum]
Length=393

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 31/60 (52%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  ++ G +C   G+ D   +  +    HI   G+ V AIDH G G +EGL  ++P
Sbjct  122  WLPKPGVRIKGALCFCHGYGDTCTFFFEGIAKHIAASGYGVYAIDHPGFGLSEGLHGYVP  181



>ref|XP_006344132.1| PREDICTED: caffeoylshikimate esterase-like [Solanum tuberosum]
Length=397

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 31/60 (52%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  ++ G +C   G+ D   +  +    HI   G+ V AIDH G G ++GL  +IP
Sbjct  126  WLPKPGIRIKGALCFSHGYGDTCTFFFEGIAKHIAAAGYAVYAIDHPGFGLSDGLHGYIP  185



>ref|XP_010905633.1| PREDICTED: caffeoylshikimate esterase [Elaeis guineensis]
Length=324

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             +VC++ G+ +D +W  Q T + +   GF  CA+D  GHG + GL+A +P
Sbjct  60   ALVCMIHGYGNDISWTFQATPIFLACHGFACCALDLPGHGRSPGLRAFLP  109



>ref|XP_004238932.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=397

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 31/60 (52%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  ++ G +C   G+ D   +  +    HI   G+ V AIDH G G ++GL  +IP
Sbjct  126  WLPKPGIRIKGALCFSHGYGDTCTFFFEGIAKHIAAAGYAVYAIDHPGFGLSDGLHGYIP  185



>ref|WP_003446516.1| lysophospholipase [Clostridium pasteurianum]
 gb|ELP58476.1| lysophospholipase [Clostridium pasteurianum DSM 525 = ATCC 6013]
 gb|KER12873.1| Acylglycerol lipase [Clostridium pasteurianum DSM 525 = ATCC 
6013]
 gb|AJA49408.1| lysophospholipase [Clostridium pasteurianum DSM 525 = ATCC 6013]
 gb|AJA53396.1| lysophospholipase [Clostridium pasteurianum DSM 525 = ATCC 6013]
Length=293

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 1/56 (2%)
 Frame = +1

Query  82   PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            P   + G++CI+ G  D SNW   L V +I K  F V A D +GHG +EG + H P
Sbjct  23   PNGDIKGVLCIIHGLGDHSNWYSGL-VNYINKNKFAVIAFDLRGHGKSEGKRGHTP  77



>ref|XP_010475999.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/60 (32%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   +   G++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  48   WLPSASSPPRGLIFMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVP  107



>ref|XP_009123831.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=321

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            GI+ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  58   GIIFMVHGYGNDISWTFQSTAIFLAQNGFACFALDIEGHGRSDGVRAYVP  107



>emb|CDY20979.1| BnaA08g25460D [Brassica napus]
Length=322

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            GI+ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  59   GIIFMVHGYGNDISWTFQSTAIFLAQNGFACFALDIEGHGRSDGVRAYVP  108



>ref|XP_010107055.1| hypothetical protein L484_002466 [Morus notabilis]
 gb|EXC53896.1| hypothetical protein L484_002466 [Morus notabilis]
Length=329

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             +V +V G+ +D +W  Q T + + + GF   A+D QGHG ++GL+A +P
Sbjct  59   ALVFMVHGYGNDISWTFQATAIFLARHGFACFALDLQGHGRSDGLRAFVP  108



>ref|WP_015617138.1| lysophospholipase [Clostridium pasteurianum]
 ref|YP_007942540.1| lysophospholipase [Clostridium pasteurianum BC1]
 gb|AGK98863.1| lysophospholipase [Clostridium pasteurianum BC1]
Length=289

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 30/56 (54%), Gaps = 1/56 (2%)
 Frame = +1

Query  82   PLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            P   V G+VCI+ G  D SNW  Q  V +     F V A D +GHG +EG + H P
Sbjct  23   PDGNVKGVVCIIHGLGDHSNWY-QGLVNYFNTNNFAVAAFDLRGHGKSEGKRGHTP  77



>emb|CDY20587.1| BnaC08g14710D [Brassica napus]
Length=321

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            GI+ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  58   GIIFMVHGYGNDISWTFQSTAIFLAQNGFACFALDIEGHGRSDGVRAYVP  107



>gb|KFK43401.1| hypothetical protein AALP_AA1G121200, partial [Arabis alpina]
Length=319

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/60 (32%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   +   G++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G +A++P
Sbjct  45   WLPSSQSPPRGLIFMVHGYGNDISWTFQSTPIFLAQMGFACFALDIEGHGRSDGTRAYVP  104



>gb|KHG29426.1| Monoglyceride lipase [Gossypium arboreum]
Length=384

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 30/59 (51%), Gaps = 0/59 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P P  K+ G+VC   G+ D   +  +     I   G+ V AIDH G G +EGL  +I
Sbjct  116  WMPEPGVKIKGVVCFSHGYGDTCTFFFEGIARFIAASGYGVYAIDHPGFGLSEGLHGYI  174



>emb|CDP00629.1| unnamed protein product [Coffea canephora]
Length=395

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 31/60 (52%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  ++ G +C   G+ D   +  +    +I   G+ V AIDH G G +EGL  ++P
Sbjct  123  WLPKPGVRIKGALCFCHGYGDTCTFFFEGIAKYIAASGYGVYAIDHPGFGLSEGLHGYVP  182



>ref|XP_007025719.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28341.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=315

 Score = 47.8 bits (112),  Expect(2) = 7e-05, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G++  V G+  D++W  Q T + + ++GF   A+D +GHG ++GL+ ++P
Sbjct  53   GVIFGVHGYGSDTSWTFQSTPIFLAQKGFACFALDIEGHGRSQGLRGYVP  102


 Score = 24.6 bits (52),  Expect(2) = 7e-05, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = +3

Query  27  FVTNPRGLKLFTPLVDPI  80
           F T+PRGL LFT  + PI
Sbjct  30  FYTSPRGLSLFTRSLLPI  47



>ref|WP_010239402.1| alpha/beta hydrolase [Clostridium arbusti]
Length=289

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 30/57 (53%), Gaps = 1/57 (2%)
 Frame = +1

Query  79   FPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             P   V  +VCIV G  D SNW   L V +  K  F V A D +GHG +EG + H P
Sbjct  22   LPDGNVKAVVCIVHGLGDHSNWYKGL-VDYFNKNNFAVLAFDLRGHGKSEGKRGHTP  77



>ref|XP_004505004.1| PREDICTED: monoglyceride lipase-like [Cicer arietinum]
Length=333

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T    ++ +V G+ +D +W  Q T +   + GF   ++D QGHG ++GLKA +P
Sbjct  64   WLPNLTTPPRALIFMVHGYGNDISWTFQSTPIFFAQMGFACFSLDLQGHGRSQGLKAFVP  123



>ref|XP_004140338.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 gb|KGN50951.1| hypothetical protein Csa_5G365670 [Cucumis sativus]
Length=400

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P   + G VC   G+ D   +       HI   G+ V A+D+ G G +EGL  +IP
Sbjct  129  WFPEPDVHIKGAVCFCHGYGDTCTFFFDGIARHIAASGYAVYAMDYPGFGLSEGLHGYIP  188



>ref|XP_006665022.1| PREDICTED: caffeoylshikimate esterase-like, partial [Oryza brachyantha]
Length=290

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/66 (32%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = +1

Query  52   SCSPH*WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEG  231
            +CS   W P   TK  G+VC+  G+  + +  ++ T   + + G+ V  ID++GHG+++G
Sbjct  26   TCS---WIP---TKPRGVVCLCHGYAVECSVTMRGTAERLARAGYAVYGIDYEGHGHSDG  79

Query  232  LKAHIP  249
            L+ ++P
Sbjct  80   LQGYVP  85



>ref|XP_008465780.1| PREDICTED: caffeoylshikimate esterase [Cucumis melo]
Length=436

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P   + G VC   G+ D   +       HI   G+ V A+D+ G G +EGL  +IP
Sbjct  165  WFPEPDVHIKGAVCFCHGYGDTCTFFFDGIARHIAASGYAVYAMDYPGFGLSEGLHGYIP  224



>ref|XP_006417390.1| hypothetical protein EUTSA_v10010022mg [Eutrema salsugineum]
 gb|ESQ35743.1| hypothetical protein EUTSA_v10010022mg [Eutrema salsugineum]
Length=392

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  77   GLIFMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVP  126



>ref|NP_172576.1| alpha/beta-hydrolase-like protein [Arabidopsis thaliana]
 gb|AAB65474.1| lysophospholipase isolog; 25331-24357 [Arabidopsis thaliana]
 dbj|BAC42367.1| putative lysophospholipase isolog [Arabidopsis thaliana]
 gb|AAP68220.1| At1g11090 [Arabidopsis thaliana]
 gb|AEE28682.1| alpha/beta-hydrolase-like protein [Arabidopsis thaliana]
Length=324

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  57   GLIFMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVP  106



>ref|XP_009625969.1| PREDICTED: caffeoylshikimate esterase [Nicotiana tomentosiformis]
Length=393

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  ++ G +C   G+ D   +  +     I   G+ V AIDH G G ++GL  +IP
Sbjct  122  WLPKPGVRIKGALCFCHGYGDTCTFFFEGIARFISASGYAVYAIDHPGFGLSDGLHGYIP  181



>ref|XP_002889847.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66106.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=323

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  57   GLIFMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVP  106



>ref|XP_004173007.1| PREDICTED: monoglyceride lipase-like, partial [Cucumis sativus]
Length=247

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P   + G VC   G+ D   +       HI   G+ V A+D+ G G +EGL  +IP
Sbjct  129  WFPEPDVHIKGAVCFCHGYGDTCTFFFDGIARHIAASGYAVYAMDYPGFGLSEGLHGYIP  188



>ref|XP_009803215.1| PREDICTED: caffeoylshikimate esterase [Nicotiana sylvestris]
Length=393

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  ++ G +C   G+ D   +  +     I   G+ V AIDH G G ++GL  +IP
Sbjct  122  WLPKPGVRIKGALCFCHGYGDTCTFFFEGIARFISASGYAVYAIDHPGFGLSDGLHGYIP  181



>ref|XP_010458490.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  58   GLIFMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVP  107



>ref|XP_010492320.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            G++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  58   GLIFMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVP  107



>ref|XP_007025720.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=315

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P   T   G++  V G+ +D +W  Q T + + ++GF   A+D +GHG ++GL+ ++P
Sbjct  44   WLPISGTPR-GVIFGVHGYGNDMSWTFQSTPIFLAQKGFACFALDLEGHGRSQGLRGYVP  102



>ref|XP_004958048.1| PREDICTED: monoglyceride lipase-like [Setaria italica]
Length=335

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    +   +V +V G+ +D +W  Q T + + + GF   A D  GHG + GL+A +P
Sbjct  53   WRPRAPARPKALVFMVHGYGNDISWTFQSTAVFLARSGFACFAADLPGHGRSHGLRAFVP  112



>gb|ACJ85425.1| unknown [Medicago truncatula]
Length=256

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/46 (37%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  112  IVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            ++ G+ +D +W  Q T + + + GF   ++D QGHG+++GLKA +P
Sbjct  1    MIHGYGNDISWTFQSTPIFLAQMGFACFSLDLQGHGHSQGLKAFVP  46



>ref|XP_002463034.1| hypothetical protein SORBIDRAFT_02g036570 [Sorghum bicolor]
 gb|EER99555.1| hypothetical protein SORBIDRAFT_02g036570 [Sorghum bicolor]
Length=338

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    +   +V +V G+ +D +W  Q T + + + GF   A D  GHG + GL+A +P
Sbjct  55   WRPRAPERPRALVFMVHGYGNDVSWTFQSTAVFLARSGFACFAADLPGHGRSHGLRAFVP  114



>ref|XP_007044321.1| Alpha/beta-Hydrolases superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY00153.1| Alpha/beta-Hydrolases superfamily protein isoform 4 [Theobroma 
cacao]
Length=347

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 0/59 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P P  K  G VC   G+ D   +  +     I   G+ V AIDH G G +EGL  +I
Sbjct  125  WMPEPGVKTKGAVCFCHGYGDTCTFFFEGIARFIAASGYGVYAIDHPGFGLSEGLHGYI  183



>ref|XP_007044319.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY00151.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=393

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 0/59 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P P  K  G VC   G+ D   +  +     I   G+ V AIDH G G +EGL  +I
Sbjct  125  WMPEPGVKTKGAVCFCHGYGDTCTFFFEGIARFIAASGYGVYAIDHPGFGLSEGLHGYI  183



>ref|XP_007044320.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY00152.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
Length=326

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 0/59 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P P  K  G VC   G+ D   +  +     I   G+ V AIDH G G +EGL  +I
Sbjct  108  WMPEPGVKTKGAVCFCHGYGDTCTFFFEGIARFIAASGYGVYAIDHPGFGLSEGLHGYI  166



>ref|NP_001130084.1| hypothetical protein [Zea mays]
 ref|XP_008666998.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008666999.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF78208.1| unknown [Zea mays]
 gb|ACL52908.1| unknown [Zea mays]
 tpg|DAA41128.1| TPA: hypothetical protein ZEAMMB73_741871 [Zea mays]
Length=334

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P    +   +V +V G+ +D +W  Q T + + + GF   A D  GHG + GL+A +P
Sbjct  53   WRPRAPERPRALVFMVHGYGNDISWTFQSTAVFLARSGFACFAADLPGHGRSHGLRAFVP  112



>ref|XP_007044318.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY00150.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=403

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 0/59 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            W P P  K  G VC   G+ D   +  +     I   G+ V AIDH G G +EGL  +I
Sbjct  125  WMPEPGVKTKGAVCFCHGYGDTCTFFFEGIARFIAASGYGVYAIDHPGFGLSEGLHGYI  183



>ref|XP_009418746.1| PREDICTED: caffeoylshikimate esterase [Musa acuminata subsp. 
malaccensis]
Length=336

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +1

Query  73   TPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHI  246
            T  P  +   ++C++ G+ +D +W  Q T + + + GF   A+D  GHG ++GL+A +
Sbjct  57   TSSPPGRPRALICMIHGYGNDISWTFQATPIFLAQHGFACFALDLPGHGRSQGLRAFV  114



>ref|XP_010533890.1| PREDICTED: caffeoylshikimate esterase [Tarenaya hassleriana]
Length=323

 Score = 45.8 bits (107),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             ++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++ ++P
Sbjct  59   ALIFMVHGYGNDVSWTFQATAIFLAQMGFACFALDLEGHGRSDGVRGYVP  108


 Score = 23.9 bits (50),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 13/21 (62%), Gaps = 4/21 (19%)
 Frame = +3

Query  27  FVTNPRGLKLFT----PLVDP  77
           F  +PRGL LFT    P+ DP
Sbjct  36  FFNSPRGLNLFTRSWLPISDP  56



>ref|XP_002179050.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49748.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=280

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  88   TKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEG  231
            T +  +VC   G+TD+ +++ ++  M +V++G   CAI+++GHG ++G
Sbjct  13   TAIRSVVCFCHGYTDNVSFMKRVENMRLVEEGIAFCAIEYEGHGKSDG  60



>ref|XP_006303706.1| hypothetical protein CARUB_v10011807mg [Capsella rubella]
 gb|EOA36604.1| hypothetical protein CARUB_v10011807mg [Capsella rubella]
Length=322

 Score = 45.4 bits (106),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             ++ +V G+ +D +W  Q T + + + GF   A+D +GHG ++G++A++P
Sbjct  57   ALIFMVHGYGNDVSWTFQSTPIFLAQMGFACFALDIEGHGRSDGVRAYVP  106


 Score = 23.5 bits (49),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = +3

Query  27  FVTNPRGLKLFT  62
           F T+PRGL LFT
Sbjct  33  FFTSPRGLNLFT  44



>emb|CBI31463.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 34.7 bits (78),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   HSVSHGS*FVTNPRGLKLFTPLVDPIPSYK  92
           HSV+H S ++TN RG+KLFT    P+P  K
Sbjct  26  HSVTHSSEYITNSRGMKLFTQSWTPLPPTK  55


 Score = 34.7 bits (78),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDS  138
            WTP P TK+IG + +V GFT +S
Sbjct  48   WTPLPPTKIIGTLAVVHGFTGES  70



>gb|EYU29988.1| hypothetical protein MIMGU_mgv1a007855mg [Erythranthe guttata]
Length=383

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/60 (32%), Positives = 30/60 (50%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  ++ G +    G+ D   +  +    HI   G+ V A+DH G G +EGL  ++P
Sbjct  112  WLPKPGVRIKGSLFFCHGYGDTCTFFFEGIAKHIAASGYGVYAVDHPGFGLSEGLHGYVP  171



>gb|EYU29987.1| hypothetical protein MIMGU_mgv1a007855mg [Erythranthe guttata]
Length=393

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/60 (32%), Positives = 30/60 (50%), Gaps = 0/60 (0%)
 Frame = +1

Query  70   WTPFPLTKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            W P P  ++ G +    G+ D   +  +    HI   G+ V A+DH G G +EGL  ++P
Sbjct  122  WLPKPGVRIKGSLFFCHGYGDTCTFFFEGIAKHIAASGYGVYAVDHPGFGLSEGLHGYVP  181



>ref|XP_001760039.1| predicted protein [Physcomitrella patens]
 gb|EDQ75164.1| predicted protein [Physcomitrella patens]
Length=333

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  GIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
             ++ +V G+ +DS+W+ Q T +   + G+   A+D  GHG +EGL  +IP
Sbjct  63   ALILMVHGYGNDSSWVFQNTAILFTEMGYAAFALDLYGHGRSEGLLGYIP  112



>ref|XP_002290401.1| phospholipase [Thalassiosira pseudonana CCMP1335]
 gb|EED92153.1| phospholipase [Thalassiosira pseudonana CCMP1335]
Length=300

 Score = 45.8 bits (107),  Expect = 0.001, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  88   TKVIGIVCIVQGFTDDSNWLIQLTVMHIVKQGFVVCAIDHQGHGYTEGLKAHIP  249
            T++  +V    GF   S++LI+     +VK+G     ID++GHG ++GL+  IP
Sbjct  32   TRIRAVVFFCHGFLGSSSYLIRCEYQRLVKEGIAFVGIDYEGHGQSDGLQGLIP  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510865472736