BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6501_g2_i1 len=798 path=[776:0-797]

Length=798
                                                                      Score     E

ref|XP_002510929.1|  r2r3-myb transcription factor, putative          99.0    2e-21   Ricinus communis
ref|XP_009374509.1|  PREDICTED: protein ODORANT1-like                 95.9    6e-20   
ref|XP_004307827.1|  PREDICTED: protein ODORANT1-like                 95.1    1e-19   
ref|XP_008234380.1|  PREDICTED: protein ODORANT1-like                 90.9    3e-18   
emb|CAN60750.1|  hypothetical protein VITISV_043464                   90.1    4e-18   Vitis vinifera
emb|CBI24555.3|  unnamed protein product                              90.1    8e-18   
ref|XP_002321838.2|  hypothetical protein POPTR_0015s14600g           90.1    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002266019.2|  PREDICTED: protein ODORANT1-like                 89.7    1e-17   Vitis vinifera
gb|ACN91625.1|  transcription factor MYBL1                            89.0    2e-17   Populus x canadensis [Canadian poplar]
ref|XP_011041720.1|  PREDICTED: protein ODORANT1-like                 89.0    2e-17   
gb|AAZ20435.1|  MYB19                                                 88.2    3e-17   Malus domestica [apple tree]
ref|XP_008376445.1|  PREDICTED: protein ODORANT1-like                 88.2    4e-17   
ref|XP_007038425.1|  Myb domain protein 42                            87.4    6e-17   
ref|XP_008376253.1|  PREDICTED: protein ODORANT1-like                 86.3    1e-16   
ref|XP_002318878.1|  hypothetical protein POPTR_0012s14540g           85.5    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011029963.1|  PREDICTED: protein ODORANT1-like                 85.5    3e-16   
ref|XP_009372900.1|  PREDICTED: protein ODORANT1-like                 85.1    5e-16   
ref|XP_009370487.1|  PREDICTED: protein ODORANT1-like                 85.1    5e-16   
ref|XP_010101097.1|  Protein ODORANT1                                 84.3    7e-16   
emb|CDP09898.1|  unnamed protein product                              80.1    2e-14   
gb|AGN52048.1|  MYB-related transcription factor                      79.0    4e-14   
ref|NP_001106007.1|  LOC100101510                                     79.3    4e-14   Zea mays [maize]
ref|XP_008650756.1|  PREDICTED: LOC100101510 isoform X1               79.3    5e-14   
gb|AGV22119.1|  MYB transcription factor 2                            77.8    1e-13   
ref|XP_011081193.1|  PREDICTED: protein ODORANT1                      77.0    3e-13   
ref|XP_010264189.1|  PREDICTED: protein ODORANT1-like                 75.9    7e-13   
dbj|BAJ61450.1|  R2R3-MYB transcription factor                        74.3    1e-12   
ref|XP_010035019.1|  PREDICTED: protein ODORANT1                      74.7    1e-12   
gb|KHG25520.1|  Protein ODORANT1                                      74.3    2e-12   
ref|XP_002462722.1|  hypothetical protein SORBIDRAFT_02g030900        74.3    2e-12   Sorghum bicolor [broomcorn]
gb|KHG16103.1|  Protein ODORANT1                                      73.9    2e-12   
ref|XP_004298679.1|  PREDICTED: protein ODORANT1-like isoform 1       73.9    4e-12   
ref|XP_009595050.1|  PREDICTED: protein ODORANT1-like                 73.6    4e-12   
ref|XP_010093656.1|  Protein ODORANT1                                 73.9    5e-12   
ref|XP_004173287.1|  PREDICTED: protein ODORANT1-like                 71.6    6e-12   
gb|ABR92760.1|  transcription factor TF1                              72.8    7e-12   Gossypium hirsutum [American cotton]
emb|CDY42188.1|  BnaC03g65090D                                        72.0    8e-12   
ref|XP_010277005.1|  PREDICTED: protein ODORANT1-like                 72.8    8e-12   
ref|NP_001062432.1|  Os08g0548000                                     71.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KCW46285.1|  hypothetical protein EUGRSUZ_K00153                   71.2    1e-11   
ref|XP_010676207.1|  PREDICTED: protein ODORANT1-like                 72.4    1e-11   
gb|KDO48409.1|  hypothetical protein CISIN_1g024441mg                 72.0    1e-11   
ref|XP_006477265.1|  PREDICTED: protein ODORANT1-like                 72.0    1e-11   
ref|XP_006490087.1|  PREDICTED: protein ODORANT1-like                 72.0    1e-11   
ref|XP_008437136.1|  PREDICTED: protein ODORANT1-like                 71.6    1e-11   
gb|KHG18117.1|  Protein ODORANT1                                      72.0    1e-11   
ref|XP_008443380.1|  PREDICTED: transcription factor MYB76-like i...  70.5    2e-11   
gb|KGN50209.1|  hypothetical protein Csa_5G160120                     71.6    2e-11   
emb|CDX76358.1|  BnaA08g10420D                                        71.6    2e-11   
gb|AAF22256.1|  myb-related transcription factor                      71.6    2e-11   Spuriopimpinella brachycarpa
gb|KDP25612.1|  hypothetical protein JCGZ_20768                       71.6    2e-11   
ref|XP_006440395.1|  hypothetical protein CICLE_v10021695mg           71.2    2e-11   
ref|XP_006421721.1|  hypothetical protein CICLE_v10005666mg           71.2    3e-11   
ref|XP_008810422.1|  PREDICTED: protein ODORANT1-like                 70.9    3e-11   
ref|XP_011069675.1|  PREDICTED: protein ODORANT1                      71.2    3e-11   
ref|XP_007218420.1|  hypothetical protein PRUPE_ppa011549mg           70.1    3e-11   
emb|CDX82958.1|  BnaC01g14080D                                        70.9    4e-11   
ref|XP_009616533.1|  PREDICTED: protein ODORANT1-like                 71.2    4e-11   
dbj|BAD10751.1|  putative Myb13 protein                               70.5    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008467265.1|  PREDICTED: protein ODORANT1                      70.1    4e-11   
ref|XP_006400198.1|  hypothetical protein EUTSA_v10014086mg           71.2    6e-11   
ref|XP_010934413.1|  PREDICTED: protein ODORANT1-like                 69.7    7e-11   
ref|XP_010053417.1|  PREDICTED: protein ODORANT1-like                 70.5    7e-11   
ref|XP_003516672.1|  PREDICTED: protein ODORANT1                      70.1    7e-11   
ref|XP_008238636.1|  PREDICTED: protein ODORANT1                      70.1    8e-11   
gb|AFW80944.1|  hypothetical protein ZEAMMB73_172211                  68.2    8e-11   
ref|XP_007210741.1|  hypothetical protein PRUPE_ppa021568mg           70.1    9e-11   
emb|CDX96511.1|  BnaA07g31220D                                        70.5    9e-11   
ref|XP_009412832.1|  PREDICTED: protein ODORANT1-like                 69.3    9e-11   
ref|XP_004515780.1|  PREDICTED: protein ODORANT1-like                 69.7    9e-11   
gb|KEH31681.1|  myb transcription factor                              69.7    9e-11   
ref|XP_007039958.1|  Myb domain protein 42                            70.1    9e-11   
ref|XP_004245722.1|  PREDICTED: protein ODORANT1                      70.1    9e-11   
ref|XP_009628634.1|  PREDICTED: protein ODORANT1-like                 69.7    1e-10   
emb|CDX94109.1|  BnaC07g37430D                                        69.7    1e-10   
ref|XP_004162772.1|  PREDICTED: protein ODORANT1-like                 68.9    1e-10   
ref|XP_004143714.1|  PREDICTED: protein ODORANT1-like                 68.9    1e-10   
emb|CDY64316.1|  BnaA03g58600D                                        69.7    1e-10   
ref|XP_003538655.1|  PREDICTED: protein ODORANT1-like                 69.7    1e-10   
gb|EMT18012.1|  Protein ODORANT1                                      69.7    1e-10   
ref|XP_009788709.1|  PREDICTED: protein ODORANT1-like                 69.7    1e-10   
ref|XP_009137269.1|  PREDICTED: protein ODORANT1-like                 69.3    1e-10   
ref|XP_008369511.1|  PREDICTED: protein ODORANT1                      69.7    1e-10   
sp|Q50EX6.1|ODO1_PETHY  RecName: Full=Protein ODORANT1; AltName: ...  69.7    1e-10   Petunia x hybrida [garden petunia]
gb|AEC11888.1|  MYB transcription factor ODO1                         69.7    1e-10   
gb|AEC11889.1|  MYB transcription factor ODO1                         69.7    1e-10   
gb|AEC11890.1|  MYB transcription factor ODO1                         69.7    1e-10   
ref|XP_009108579.1|  PREDICTED: protein ODORANT1-like                 69.3    1e-10   
emb|CAC85051.1|  Myb13 protein                                        69.3    1e-10   Oryza sativa [red rice]
ref|NP_001063765.1|  Os09g0532900                                     69.3    1e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDX73043.1|  BnaC06g34910D                                        70.1    2e-10   
ref|XP_009106064.1|  PREDICTED: transcription factor MYB122-like      70.1    2e-10   
ref|XP_006660886.1|  PREDICTED: protein ODORANT1-like                 69.3    2e-10   
ref|XP_004957458.1|  PREDICTED: protein ODORANT1-like                 69.3    2e-10   
emb|CDY69554.1|  BnaAnng30810D                                        69.3    2e-10   
ref|XP_006413635.1|  hypothetical protein EUTSA_v10027281mg           68.9    2e-10   
ref|XP_008443378.1|  PREDICTED: transcription factor MYB76-like i...  68.2    2e-10   
ref|XP_008443377.1|  PREDICTED: transcription factor MYB76-like i...  68.2    2e-10   
ref|XP_008443379.1|  PREDICTED: transcription factor MYB76-like i...  68.2    2e-10   
ref|XP_009362121.1|  PREDICTED: LOW QUALITY PROTEIN: protein ODOR...  69.3    2e-10   
ref|XP_004973482.1|  PREDICTED: myb-related protein 315-like          69.3    2e-10   
ref|XP_002509589.1|  ODORANT1 protein, putative                       68.9    2e-10   Ricinus communis
ref|XP_007157323.1|  hypothetical protein PHAVU_002G060500g           68.6    2e-10   
ref|XP_002303526.2|  myb family transcription factor family protein   68.6    3e-10   Populus trichocarpa [western balsam poplar]
dbj|BAJ97263.1|  predicted protein                                    68.6    3e-10   
ref|XP_007155582.1|  hypothetical protein PHAVU_003G214300g           68.9    3e-10   
emb|CDY49137.1|  BnaA02g16690D                                        68.9    3e-10   
ref|XP_009354562.1|  PREDICTED: protein ODORANT1-like                 68.9    3e-10   
ref|XP_011033909.1|  PREDICTED: protein ODORANT1-like                 68.2    3e-10   
gb|EYU26820.1|  hypothetical protein MIMGU_mgv1a027167mg              68.6    3e-10   
ref|NP_001241087.1|  protein ODORANT1-like                            68.2    3e-10   
ref|XP_009407976.1|  PREDICTED: protein ODORANT1-like                 68.2    3e-10   
gb|KDO50806.1|  hypothetical protein CISIN_1g021498mg                 68.9    3e-10   
ref|XP_006482113.1|  PREDICTED: protein ODORANT1-like                 68.9    3e-10   
ref|XP_006430591.1|  hypothetical protein CICLE_v10012265mg           68.9    3e-10   
ref|XP_011001567.1|  PREDICTED: protein ODORANT1-like                 68.9    3e-10   
gb|ABK25487.1|  unknown                                               67.8    4e-10   Picea sitchensis
ref|XP_010062268.1|  PREDICTED: protein ODORANT1-like isoform X2      67.8    4e-10   
ref|XP_009128025.1|  PREDICTED: transcription factor MYB122-like      68.9    4e-10   
ref|XP_008670915.1|  PREDICTED: protein ODORANT1-like                 67.0    4e-10   
gb|EMT20029.1|  Protein ODORANT1                                      68.2    4e-10   
ref|XP_010529493.1|  PREDICTED: protein ODORANT1-like                 67.8    5e-10   
emb|CAN68308.1|  hypothetical protein VITISV_043506                   66.6    5e-10   Vitis vinifera
ref|XP_006659660.1|  PREDICTED: protein ODORANT1-like                 67.8    5e-10   
ref|XP_009136061.1|  PREDICTED: protein ODORANT1                      67.8    5e-10   
ref|XP_006284312.1|  hypothetical protein CARUB_v10005483mg           67.8    5e-10   
gb|AGN52115.1|  MYB-related transcription factor                      67.8    5e-10   
ref|XP_003578505.1|  PREDICTED: protein ODORANT1-like                 67.8    6e-10   
ref|XP_006355506.1|  PREDICTED: protein ODORANT1-like                 67.8    6e-10   
gb|AGN52067.1|  MYB-related transcription factor                      67.4    6e-10   
ref|NP_001169938.1|  putative MYB DNA-binding domain superfamily ...  67.4    7e-10   Zea mays [maize]
ref|XP_010062267.1|  PREDICTED: protein ODORANT1-like isoform X1      67.8    7e-10   
ref|XP_006600811.1|  PREDICTED: protein ODORANT1-like                 67.4    7e-10   
ref|XP_010539859.1|  PREDICTED: protein ODORANT1-like                 67.4    7e-10   
ref|XP_010525304.1|  PREDICTED: protein ODORANT1-like                 65.5    8e-10   
ref|XP_003538391.1|  PREDICTED: protein ODORANT1                      68.2    8e-10   
ref|XP_004136689.1|  PREDICTED: transcription factor MYB76-like       66.6    8e-10   
ref|XP_006368692.1|  hypothetical protein POPTR_0001s07830g           67.0    8e-10   
ref|XP_002264150.2|  PREDICTED: protein ODORANT1                      67.0    8e-10   Vitis vinifera
ref|XP_010556068.1|  PREDICTED: transcription factor MYB122-like      65.1    9e-10   
ref|XP_003574901.1|  PREDICTED: protein ODORANT1-like                 67.0    9e-10   
ref|XP_011018242.1|  PREDICTED: protein ODORANT1-like                 67.0    1e-09   
ref|XP_010032717.1|  PREDICTED: protein ODORANT1-like                 67.4    1e-09   
ref|XP_009410072.1|  PREDICTED: protein ODORANT1-like                 67.0    1e-09   
ref|XP_010539990.1|  PREDICTED: transcription factor MYB51-like       67.8    1e-09   
emb|CDX79170.1|  BnaA01g12370D                                        66.6    1e-09   
emb|CDX69440.1|  BnaA10g17890D                                        67.4    1e-09   
ref|XP_006372565.1|  myb family transcription factor family protein   67.4    1e-09   
ref|XP_009121472.1|  PREDICTED: protein ODORANT1                      67.4    1e-09   
ref|XP_008679710.1|  PREDICTED: protein ODORANT1                      66.6    1e-09   
gb|ABK28645.1|  unknown                                               66.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567664.1|  myb domain protein 85                               66.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416242.1|  PREDICTED: transcription factor MYB122-like      66.2    1e-09   
ref|XP_004974136.1|  PREDICTED: protein ODORANT1-like isoform X1      66.2    1e-09   
ref|NP_001061847.1|  Os08g0428200                                     67.0    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07061.1|  hypothetical protein OsI_29307                        67.0    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_008343128.1|  PREDICTED: protein ODORANT1-like                 66.6    2e-09   
ref|XP_010439306.1|  PREDICTED: protein ODORANT1                      66.2    2e-09   
ref|XP_002887017.1|  hypothetical protein ARALYDRAFT_894261           66.6    2e-09   
ref|XP_002444623.1|  hypothetical protein SORBIDRAFT_07g024970        65.9    2e-09   Sorghum bicolor [broomcorn]
gb|ACT82838.1|  transcription factor MYB047                           65.1    2e-09   
ref|XP_004956766.1|  PREDICTED: protein ODORANT1-like                 66.2    2e-09   
gb|KHN33675.1|  Myb-related protein 308                               65.1    2e-09   
ref|XP_004956767.1|  PREDICTED: protein ODORANT1-like                 66.2    2e-09   
gb|AAL84764.1|AF474131_1  typical P-type R2R3 Myb protein             64.3    2e-09   Sorghum bicolor [broomcorn]
ref|NP_197163.1|  myb domain protein 43                               66.6    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176797.1|  myb domain protein 20                               65.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EMT08335.1|  Transcription factor MYB39                            66.2    2e-09   
emb|CDY45857.1|  BnaC02g22630D                                        66.6    2e-09   
ref|XP_002867757.1|  hypothetical protein ARALYDRAFT_492601           65.9    2e-09   
ref|XP_009401426.1|  PREDICTED: protein ODORANT1-like                 65.1    3e-09   
gb|KFK28838.1|  hypothetical protein AALP_AA7G055500                  65.9    3e-09   
ref|XP_009105194.1|  PREDICTED: protein ODORANT1                      65.9    3e-09   
ref|XP_010474190.1|  PREDICTED: protein ODORANT1-like                 65.9    3e-09   
ref|XP_008803910.1|  PREDICTED: protein ODORANT1-like                 65.9    3e-09   
gb|KHN19997.1|  Myb-related protein 308                               65.1    3e-09   
gb|EPS58402.1|  hypothetical protein M569_16412                       65.1    3e-09   
ref|XP_009381446.1|  PREDICTED: protein ODORANT1-like                 65.9    3e-09   
ref|XP_004240108.1|  PREDICTED: protein ODORANT1-like                 66.2    3e-09   
ref|XP_006844225.1|  hypothetical protein AMTR_s00006p00267240        65.1    3e-09   
ref|XP_010470497.1|  PREDICTED: protein ODORANT1-like                 65.9    3e-09   
ref|NP_001236232.1|  uncharacterized protein LOC100306265             64.3    3e-09   
ref|XP_010415165.1|  PREDICTED: protein ODORANT1-like                 65.9    3e-09   
ref|XP_004490820.1|  PREDICTED: protein ODORANT1-like                 65.9    3e-09   
ref|XP_010511551.1|  PREDICTED: protein ODORANT1-like                 65.5    3e-09   
ref|XP_006289620.1|  hypothetical protein CARUB_v10003172mg           65.5    4e-09   
ref|XP_002452601.1|  hypothetical protein SORBIDRAFT_04g028850        63.5    4e-09   Sorghum bicolor [broomcorn]
ref|XP_006302662.1|  hypothetical protein CARUB_v10020766mg           65.5    4e-09   
ref|XP_006391368.1|  hypothetical protein EUTSA_v10019852mg           65.5    4e-09   
ref|XP_010448861.1|  PREDICTED: protein ODORANT1-like                 65.5    4e-09   
emb|CDX83837.1|  BnaC08g18080D                                        63.5    4e-09   
ref|XP_009370048.1|  PREDICTED: protein ODORANT1-like                 65.1    4e-09   
dbj|BAJ98593.1|  predicted protein                                    65.5    4e-09   
ref|XP_008227926.1|  PREDICTED: protein ODORANT1-like                 65.1    4e-09   
ref|XP_007215806.1|  hypothetical protein PRUPE_ppa009966mg           65.1    4e-09   
gb|KHG13514.1|  Protein ODORANT1                                      65.5    5e-09   
ref|XP_010428376.1|  PREDICTED: transcription factor MYB122-like      64.7    5e-09   
ref|XP_007032972.1|  Myb domain protein 20                            65.5    5e-09   
emb|CDY49639.1|  BnaCnng17910D                                        64.7    5e-09   
ref|XP_009370562.1|  PREDICTED: protein ODORANT1-like                 65.1    5e-09   
ref|XP_010547741.1|  PREDICTED: transcription factor MYB34-like       65.9    5e-09   
gb|EMT12444.1|  Protein ODORANT1                                      64.7    5e-09   
ref|XP_010471501.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  65.9    5e-09   
ref|XP_002871726.1|  hypothetical protein ARALYDRAFT_909643           65.5    6e-09   
ref|XP_010926121.1|  PREDICTED: protein ODORANT1-like                 65.1    6e-09   
ref|NP_001149774.1|  odorant 1 protein                                64.7    6e-09   Zea mays [maize]
ref|XP_002305215.1|  hypothetical protein POPTR_0004s08480g           65.1    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_003553077.1|  PREDICTED: protein ODORANT1-like                 65.5    7e-09   
gb|KHN07541.1|  Protein ODORANT1                                      65.5    7e-09   
ref|XP_010917650.1|  PREDICTED: protein ODORANT1-like                 65.1    7e-09   
ref|XP_011007235.1|  PREDICTED: protein ODORANT1-like                 65.1    7e-09   
gb|KHG02341.1|  Protein ODORANT1                                      65.1    7e-09   
gb|KHG06720.1|  Protein ODORANT1                                      65.1    7e-09   
ref|XP_010932583.1|  PREDICTED: protein ODORANT1-like                 64.7    7e-09   
dbj|BAF80451.1|  MYB-related transcription factor                     65.1    7e-09   Nicotiana tabacum [American tobacco]
ref|XP_009589696.1|  PREDICTED: protein ODORANT1                      65.1    7e-09   
ref|XP_009603939.1|  PREDICTED: myb-related protein 308-like          64.3    7e-09   
ref|XP_010433580.1|  PREDICTED: protein ODORANT1                      64.7    8e-09   
ref|XP_003572214.1|  PREDICTED: protein ODORANT1                      64.7    8e-09   
emb|CDX85496.1|  BnaA02g03170D                                        65.1    8e-09   
ref|XP_004965175.1|  PREDICTED: protein ODORANT1-like                 64.7    8e-09   
gb|ABD60286.2|  R2R3-MYB transcription factor MYB11                   64.3    8e-09   
ref|XP_010537410.1|  PREDICTED: transcription factor MYB51            65.1    8e-09   
ref|XP_008381375.1|  PREDICTED: protein ODORANT1-like                 64.3    8e-09   
gb|AIT13038.1|  myb-related transcription factor                      64.7    9e-09   
ref|XP_008803475.1|  PREDICTED: protein ODORANT1-like                 64.7    9e-09   
ref|XP_010916181.1|  PREDICTED: protein ODORANT1-like                 64.7    9e-09   
tpg|DAA61360.1|  TPA: LOW QUALITY PROTEIN: putative MYB DNA-bindi...  63.2    9e-09   
gb|AAL84615.1|AF474118_1  typical P-type R2R3 Myb protein             63.2    9e-09   Zea mays [maize]
gb|AFX96281.1|  R2R3 DNA binding transcription factor MYB28-1         65.1    9e-09   
ref|XP_004289590.1|  PREDICTED: protein ODORANT1-like                 64.3    9e-09   
gb|AFK47512.1|  unknown                                               64.7    1e-08   
ref|XP_002460189.1|  hypothetical protein SORBIDRAFT_02g024250        64.3    1e-08   Sorghum bicolor [broomcorn]
gb|AGN52100.1|  MYB-related transcription factor                      63.5    1e-08   
gb|AGN52052.1|  MYB-related transcription factor                      63.2    1e-08   
ref|XP_004231815.2|  PREDICTED: myb-related protein 315-like          65.1    1e-08   
ref|XP_010660298.1|  PREDICTED: protein ODORANT1                      64.3    1e-08   
emb|CBI33476.3|  unnamed protein product                              64.3    1e-08   
ref|XP_010525098.1|  PREDICTED: myb-related protein 306 isoform X2    64.7    1e-08   
ref|XP_010525095.1|  PREDICTED: transcription factor MYB122 isofo...  64.7    1e-08   
ref|XP_007046023.1|  Myb domain protein 16, putative                  64.7    1e-08   
ref|XP_008652684.1|  PREDICTED: protein ODORANT1-like                 63.9    1e-08   
ref|XP_004953828.1|  PREDICTED: protein ODORANT1-like                 63.9    1e-08   
ref|XP_004147038.1|  PREDICTED: myb-related protein 308-like          63.5    1e-08   
gb|AAL90658.1|AF470090_1  P-type R2R3 Myb protein                     62.0    1e-08   Zea mays [maize]
gb|AFW63820.1|  putative MYB DNA-binding domain superfamily protein   63.9    1e-08   
ref|XP_009110339.1|  PREDICTED: transcription factor MYB51-like       64.3    1e-08   
ref|NP_001063118.1|  Os09g0401000                                     63.9    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006396775.1|  hypothetical protein EUTSA_v10028864mg           63.9    1e-08   
gb|EAZ09037.1|  hypothetical protein OsI_31298                        63.9    1e-08   Oryza sativa Indica Group [Indian rice]
gb|ABQ81931.1|  transcription factor MYB4                             63.9    1e-08   Brassica rapa var. purpuraria [purple stem mustard]
ref|NP_001234300.1|  myb-related transcription factor                 63.9    1e-08   
emb|CDX72743.1|  BnaC07g47650D                                        63.9    1e-08   
gb|ADG46002.1|  MYB4                                                  63.2    1e-08   
gb|ACF82542.1|  unknown                                               64.7    1e-08   Zea mays [maize]
ref|XP_009101934.1|  PREDICTED: transcription repressor MYB4          63.9    1e-08   
gb|KDP25786.1|  hypothetical protein JCGZ_22508                       64.3    1e-08   
ref|XP_010528552.1|  PREDICTED: protein ODORANT1-like                 63.9    1e-08   
ref|XP_010551759.1|  PREDICTED: protein ODORANT1-like                 63.9    1e-08   
ref|XP_007141914.1|  hypothetical protein PHAVU_008G236500g           64.3    1e-08   
ref|XP_010271304.1|  PREDICTED: myb-related protein 315               64.3    2e-08   
emb|CDP01637.1|  unnamed protein product                              64.3    2e-08   
gb|KHG02160.1|  Transcription factor MYB76 -like protein              63.9    2e-08   
ref|XP_002460190.1|  hypothetical protein SORBIDRAFT_02g024260        63.9    2e-08   Sorghum bicolor [broomcorn]
ref|XP_010312447.1|  PREDICTED: myb-related transcription factor ...  63.9    2e-08   
ref|XP_006288141.1|  hypothetical protein CARUB_v10001378mg           64.3    2e-08   
ref|XP_006345595.1|  PREDICTED: protein ODORANT1-like                 63.9    2e-08   
emb|CDY49650.1|  BnaC09g41280D                                        63.9    2e-08   
ref|XP_009792876.1|  PREDICTED: protein ODORANT1-like                 63.9    2e-08   
ref|NP_001281099.1|  uncharacterized protein LOC100216895             63.5    2e-08   
ref|XP_003567025.1|  PREDICTED: transcription repressor MYB5-like     63.2    2e-08   
ref|XP_006364618.1|  PREDICTED: protein ODORANT1-like                 63.9    2e-08   
gb|EMT17735.1|  Protein ODORANT1                                      61.2    2e-08   
ref|XP_002890285.1|  hypothetical protein ARALYDRAFT_472077           63.9    2e-08   
ref|NP_001053719.2|  Os04g0593200                                     63.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010108985.1|  Protein ODORANT1                                 63.9    2e-08   
ref|XP_010525072.1|  PREDICTED: myb-related protein 330-like          63.5    2e-08   
ref|XP_003616278.1|  P-type R2R3 Myb protein                          63.9    2e-08   
ref|XP_003560842.1|  PREDICTED: protein ODORANT1-like                 63.2    2e-08   
gb|KHG07216.1|  Myb-related protein                                   62.4    2e-08   
ref|NP_001105856.1|  transcription factor MYB2                        63.9    2e-08   
emb|CDP01404.1|  unnamed protein product                              63.5    2e-08   
emb|CDY38100.1|  BnaC02g06730D                                        63.5    2e-08   
ref|XP_010268020.1|  PREDICTED: protein ODORANT1-like                 63.5    2e-08   
emb|CAB45982.1|  putative transcription factor                        62.8    2e-08   
ref|NP_001242827.1|  uncharacterized protein LOC100800494             63.5    2e-08   
emb|CDX83836.1|  BnaC08g18090D                                        63.9    2e-08   
gb|AEX59918.1|  MYB family transcription factor                       61.6    2e-08   
gb|AHI18167.1|  Mixta-like1                                           60.5    2e-08   
ref|XP_009409253.1|  PREDICTED: protein ODORANT1-like                 63.5    2e-08   
ref|XP_004956764.1|  PREDICTED: myb-related protein 315-like          63.2    2e-08   
ref|XP_007159923.1|  hypothetical protein PHAVU_002G279000g           63.5    2e-08   
gb|AEX59925.1|  MYB family transcription factor                       61.6    2e-08   
gb|KHN39463.1|  Protein ODORANT1                                      63.5    2e-08   
ref|XP_003578088.1|  PREDICTED: protein ODORANT1-like                 63.2    2e-08   
ref|XP_004956765.1|  PREDICTED: protein ODORANT1-like                 62.8    2e-08   
gb|AEX59957.1|  MYB family transcription factor                       61.6    3e-08   
gb|AEX59920.1|  MYB family transcription factor                       61.6    3e-08   
ref|XP_009757133.1|  PREDICTED: protein ODORANT1-like                 63.2    3e-08   
gb|AEX59902.1|  MYB family transcription factor                       61.6    3e-08   
gb|AEX59886.1|  MYB family transcription factor                       61.6    3e-08   
gb|AEX59939.1|  MYB family transcription factor                       61.6    3e-08   
gb|AFW59301.1|  putative MYB DNA-binding domain superfamily protein   63.5    3e-08   
gb|AEX59953.1|  MYB family transcription factor                       61.6    3e-08   
gb|AEX59900.1|  MYB family transcription factor                       61.6    3e-08   
ref|XP_004976658.1|  PREDICTED: transcription factor MYB39-like       63.5    3e-08   
gb|ACN12965.1|  R2R3-MYB transcription factor MYB22                   62.0    3e-08   
gb|AEX59896.1|  MYB family transcription factor                       61.6    3e-08   
gb|AEX59895.1|  MYB family transcription factor                       61.6    3e-08   
ref|XP_010060488.1|  PREDICTED: protein ODORANT1                      63.5    3e-08   
gb|AEX59924.1|  MYB family transcription factor                       61.6    3e-08   
gb|AEX59910.1|  MYB family transcription factor                       61.2    3e-08   
gb|AAL84763.1|AF474130_1  typical P-type R2R3 Myb protein             61.6    3e-08   
gb|AGS48990.1|  R2R3 MYB transcription factor 39                      62.4    3e-08   
ref|XP_006647848.1|  PREDICTED: protein ODORANT1-like                 62.8    3e-08   
gb|AEX59909.1|  MYB family transcription factor                       61.2    3e-08   
emb|CDX81067.1|  BnaC03g03210D                                        63.2    3e-08   
tpg|DAA61361.1|  TPA: putative MYB DNA-binding domain superfamily...  63.2    3e-08   
ref|XP_009408320.1|  PREDICTED: protein ODORANT1-like                 62.8    3e-08   
ref|XP_008457024.1|  PREDICTED: protein ODORANT1-like                 62.8    3e-08   
dbj|BAM78212.1|  Myb transcription factor BoMyb29                     63.2    3e-08   
gb|AIS35923.1|  MYB transcription factor 6                            62.8    3e-08   
gb|AAL84766.1|AF474133_1  typical P-type R2R3 Myb protein             61.6    3e-08   
gb|ABQ51227.1|  R2R3-MYB transcription factor MYB11                   63.5    3e-08   
ref|XP_008652685.1|  PREDICTED: protein ODORANT1-like                 63.2    3e-08   
ref|XP_006346756.1|  PREDICTED: protein ODORANT1-like                 62.8    4e-08   
ref|XP_002872653.1|  hypothetical protein ARALYDRAFT_327351           62.8    4e-08   
gb|AAC83604.1|  putative transcription factor                         61.6    4e-08   
emb|CDY04798.1|  BnaC05g17910D                                        62.4    4e-08   
gb|EAY87414.1|  hypothetical protein OsI_08821                        62.4    4e-08   
ref|NP_001048028.1|  Os02g0732600                                     62.4    4e-08   
ref|XP_004236690.1|  PREDICTED: protein ODORANT1-like                 62.8    4e-08   
gb|AAS10075.1|  MYB transcription factor                              62.4    4e-08   
gb|AEX59903.1|  MYB family transcription factor                       60.8    4e-08   
ref|NP_567390.4|  myb domain protein 42                               62.4    4e-08   
gb|AAU13905.1|  MYB transcription factor MYBML3                       61.6    4e-08   
ref|XP_009409374.1|  PREDICTED: transcription repressor MYB5-like     62.8    5e-08   
ref|XP_010491389.1|  PREDICTED: transcription factor MYB29-like i...  62.4    5e-08   
gb|KHN14496.1|  Transcription factor MYB28                            60.8    5e-08   
gb|AIU99478.1|  MYB29-2 transcription factor                          62.8    5e-08   
gb|AGS49160.1|  MYB51 protein                                         62.8    5e-08   
ref|XP_007046025.1|  Myb domain 16-like protein                       62.8    5e-08   
ref|XP_009130172.1|  PREDICTED: transcription factor MYB28-like       62.8    5e-08   
gb|ACR48180.1|  MYB domain protein 28-3                               62.8    5e-08   
ref|XP_003519327.1|  PREDICTED: protein ODORANT1-like                 62.8    6e-08   
gb|AGZ16414.1|  MYB15                                                 62.0    6e-08   
ref|XP_009353208.1|  PREDICTED: protein ODORANT1-like                 62.8    6e-08   
ref|XP_008457683.1|  PREDICTED: myb-related protein 308-like          61.6    6e-08   
gb|AFX96283.1|  R2R3 DNA binding transcription factor MYB28-3         62.4    6e-08   
ref|XP_003541861.1|  PREDICTED: transcription factor MYB34-like       62.8    6e-08   
gb|EYU22559.1|  hypothetical protein MIMGU_mgv1a017664mg              61.2    6e-08   
ref|XP_006288096.1|  hypothetical protein CARUB_v10001328mg           62.4    6e-08   
ref|XP_010528356.1|  PREDICTED: transcription factor MYB32-like       62.4    6e-08   
ref|XP_006284260.1|  hypothetical protein CARUB_v10005426mg           62.0    6e-08   
ref|XP_006412992.1|  hypothetical protein EUTSA_v10027463mg           62.0    6e-08   
ref|XP_003520086.2|  PREDICTED: myb-related protein Zm38-like         62.4    6e-08   
gb|AGT16957.1|  hypothetical protein SHCRBa_121_P14_F_10              62.4    6e-08   
gb|ABD60279.1|  R2R3-MYB transcription factor MYB14                   61.2    7e-08   
ref|XP_003539577.1|  PREDICTED: transcription factor RAX1             62.4    7e-08   
gb|EMS63576.1|  Transcription factor MYB39                            62.0    7e-08   
ref|XP_006288195.1|  hypothetical protein CARUB_v10001433mg           61.6    7e-08   
gb|AAC83629.1|  putative transcription factor                         61.6    7e-08   
gb|KHN28009.1|  Transcription factor MYB39                            62.4    7e-08   
ref|XP_004487648.1|  PREDICTED: transcription factor MYB86-like       62.4    7e-08   
ref|XP_010522455.1|  PREDICTED: transcription factor MYB34            62.4    7e-08   
gb|KDP38959.1|  hypothetical protein JCGZ_00716                       62.0    7e-08   
ref|XP_004232212.1|  PREDICTED: myb-related protein 306               62.4    7e-08   
gb|AAZ20432.1|  MYB13                                                 62.0    8e-08   
ref|XP_006838010.1|  hypothetical protein AMTR_s00091p00025820        62.0    8e-08   
emb|CDX90998.1|  BnaC02g05990D                                        62.4    8e-08   
ref|XP_010908498.1|  PREDICTED: transcription factor MYB39            62.4    8e-08   
gb|AGD80148.1|  mixta-like 3 protein                                  60.8    8e-08   
dbj|BAM78213.1|  Myb transcription factor BoMyb28-1                   62.0    8e-08   
ref|XP_006408465.1|  hypothetical protein EUTSA_v10021048mg           62.0    8e-08   
gb|AIU99475.1|  MYB28-1 transcription factor                          62.0    8e-08   
gb|AGD80146.1|  mixta-like 3 protein                                  60.8    8e-08   
emb|CAE05467.3|  OSJNBa0006A01.3                                      62.0    8e-08   
ref|XP_002871285.1|  hypothetical protein ARALYDRAFT_487604           62.0    8e-08   
dbj|BAM78215.1|  Myb transcription factor BoMyb28-3                   62.0    9e-08   
gb|KDO74266.1|  hypothetical protein CISIN_1g045387mg                 61.2    9e-08   
gb|AHI18166.1|  Mixta-like1                                           58.9    9e-08   
gb|AHI18165.1|  Mixta-like1                                           58.9    9e-08   
gb|AGD80147.1|  mixta-like 3 protein                                  60.8    9e-08   
ref|XP_006338434.1|  PREDICTED: myb-related protein 306-like          62.0    9e-08   
gb|KFK30463.1|  hypothetical protein AALP_AA7G264300                  61.6    9e-08   
gb|AGC92177.1|  myeloblastosis protein                                60.8    9e-08   
ref|XP_010105966.1|  Protein ODORANT1                                 62.0    9e-08   
gb|EMT17303.1|  Transcription factor MYB39                            62.0    9e-08   
gb|AEG64799.1|  R2R3 MYB transcriptional factor                       60.8    9e-08   
ref|XP_009792075.1|  PREDICTED: myb-related protein 306-like          62.0    1e-07   
ref|XP_010469050.1|  PREDICTED: transcription repressor MYB5-like     61.6    1e-07   
gb|ABK23961.1|  unknown                                               60.8    1e-07   
gb|ABD60296.2|  R2R3-MYB transcription factor MYB1                    59.3    1e-07   
ref|XP_006464660.1|  PREDICTED: transcription factor MYB39-like       62.0    1e-07   
ref|XP_010424105.1|  PREDICTED: myb-related protein Hv1-like          61.6    1e-07   
ref|XP_002867465.1|  AtMYB41                                          61.6    1e-07   
ref|XP_007021241.1|  MYB-like 102, putative                           62.0    1e-07   
ref|XP_010453666.1|  PREDICTED: myb-related protein Hv1-like          61.6    1e-07   
ref|XP_009624863.1|  PREDICTED: myb-related protein 306               62.0    1e-07   
emb|CDX85555.1|  BnaA02g02580D                                        62.0    1e-07   
ref|XP_008232794.1|  PREDICTED: transcription factor MYB3             62.0    1e-07   
ref|XP_007218142.1|  hypothetical protein PRUPE_ppa007268mg           62.0    1e-07   
emb|CBI18519.3|  unnamed protein product                              60.8    1e-07   
ref|XP_009126044.1|  PREDICTED: transcription factor MYB34-like       61.6    1e-07   
gb|KFK44357.1|  hypothetical protein AALP_AA1G246900                  60.8    1e-07   
gb|EAZ19817.1|  hypothetical protein OsJ_35399                        58.9    1e-07   
ref|XP_009115618.1|  PREDICTED: transcription factor MYB3             61.2    1e-07   
ref|XP_009393912.1|  PREDICTED: myb-related protein Hv1-like          60.5    1e-07   
ref|XP_006352596.1|  PREDICTED: protein ODORANT1-like                 61.6    1e-07   
gb|AHN60122.1|  MYB transcription factor 16                           61.6    1e-07   
ref|XP_006302618.1|  hypothetical protein CARUB_v10020723mg           61.6    1e-07   
ref|XP_009418701.1|  PREDICTED: myb-related protein Zm38-like         60.1    1e-07   
emb|CDX78625.1|  BnaA03g05370D                                        61.6    1e-07   
ref|XP_010529388.1|  PREDICTED: transcription factor MYB3-like        61.6    1e-07   
gb|AEO27487.1|  MIXTA-like transcription factor                       62.0    1e-07   
gb|AEV91143.1|  R2R3-MYB protein                                      60.8    1e-07   
ref|XP_006452016.1|  hypothetical protein CICLE_v10009050mg           61.6    1e-07   
ref|XP_002273328.1|  PREDICTED: transcription repressor MYB6          60.5    1e-07   
ref|XP_009131458.1|  PREDICTED: myb-related protein Hv1-like          61.6    1e-07   
emb|CDP11902.1|  unnamed protein product                              61.6    1e-07   
ref|XP_009414444.1|  PREDICTED: myb-related protein Zm38-like         60.5    1e-07   
ref|XP_002866812.1|  hypothetical protein ARALYDRAFT_490626           61.2    1e-07   
ref|XP_006288196.1|  hypothetical protein CARUB_v10001433mg           61.6    1e-07   
ref|XP_010519490.1|  PREDICTED: transcription factor MYB39            61.6    1e-07   
ref|XP_010492363.1|  PREDICTED: myb-related protein Hv1-like isof...  61.6    1e-07   
ref|XP_006305192.1|  hypothetical protein CARUB_v10009563mg           61.6    1e-07   
gb|ABH02890.1|  MYB transcription factor MYB77                        60.1    1e-07   
ref|XP_008783569.1|  PREDICTED: transcription factor MYB39-like       61.6    1e-07   
ref|XP_006400051.1|  hypothetical protein EUTSA_v10014101mg           61.6    1e-07   
gb|EMT02284.1|  Transcription factor MYB39                            61.6    1e-07   
ref|XP_009121584.1|  PREDICTED: myb-related protein Hv1               61.6    1e-07   
gb|AAN28271.1|  myb-like transcription factor 1                       60.8    1e-07   
emb|CDY64136.1|  BnaCnng43220D                                        61.6    1e-07   
ref|XP_010492364.1|  PREDICTED: myb-related protein Hv1-like isof...  61.6    1e-07   
ref|XP_007163381.1|  hypothetical protein PHAVU_001G229900g           61.6    1e-07   
ref|XP_003621270.1|  MYB transcription factor                         61.2    1e-07   
emb|CAA78386.1|  protein 1                                            61.6    1e-07   
ref|XP_007149649.1|  hypothetical protein PHAVU_005G087400g           61.6    1e-07   
gb|EMT01348.1|  Transcription factor MYB39                            60.5    1e-07   
emb|CDX70606.1|  BnaC03g06900D                                        61.2    1e-07   
emb|CDY26411.1|  BnaC09g42570D                                        61.2    1e-07   
ref|XP_008802445.1|  PREDICTED: protein ODORANT1-like                 61.2    1e-07   
ref|XP_002887524.1|  MYB122                                           61.6    1e-07   
ref|XP_003554566.1|  PREDICTED: transcription factor MYB51            61.6    1e-07   
gb|EAZ04319.1|  hypothetical protein OsI_26460                        61.2    1e-07   
gb|EAZ40276.1|  hypothetical protein OsJ_24718                        61.2    1e-07   
gb|AGD80160.1|  mixta-like 1 protein                                  61.6    1e-07   
gb|AGS49159.1|  MYB51 protein                                         61.2    1e-07   
ref|XP_009382811.1|  PREDICTED: transcription factor MYB39-like       61.6    1e-07   
ref|XP_002871660.1|  AtMIXTA/AtMYB16                                  61.2    1e-07   
ref|XP_009761686.1|  PREDICTED: protein ODORANT1-like                 61.2    1e-07   
gb|KHG22733.1|  Transcription factor MYB39 -like protein              61.2    1e-07   
ref|XP_009108500.1|  PREDICTED: myb-related protein 315-like          61.6    1e-07   
gb|KHN45518.1|  Transcription factor MYB39                            61.6    1e-07   
gb|AEC32977.1|  transcription factor MYB3                             60.1    1e-07   
gb|ABP04051.1|  R2R3MYB                                               61.6    1e-07   
ref|XP_011085743.1|  PREDICTED: myb-related protein 306-like          61.6    1e-07   
gb|EMT13107.1|  Transcription factor MYB39                            61.2    2e-07   
gb|AAN28270.1|  myb-like transcription factor 1                       61.2    2e-07   
emb|CDX89203.1|  BnaA01g16900D                                        60.8    2e-07   
dbj|BAJ96650.1|  predicted protein                                    61.2    2e-07   
ref|XP_006648783.1|  PREDICTED: transcription factor MYB28-like       61.2    2e-07   
gb|AEC32978.1|  transcription factor MYB3                             59.7    2e-07   
ref|XP_008230200.1|  PREDICTED: myb-related protein 315               61.2    2e-07   
ref|XP_002868036.1|  hypothetical protein ARALYDRAFT_493095           61.2    2e-07   
gb|ACN12954.1|  R2R3-MYB transcription factor MYB15                   60.1    2e-07   
gb|EMT21654.1|  Transcription factor MYB39                            61.2    2e-07   
ref|XP_003572652.1|  PREDICTED: myb-related protein Zm38-like         61.2    2e-07   
gb|KHG06894.1|  Transcription factor MYB39 -like protein              61.2    2e-07   
ref|XP_010455843.1|  PREDICTED: myb-related protein 315-like          61.2    2e-07   
ref|XP_002305647.1|  putative MYB transcription factor family pro...  61.2    2e-07   
gb|AFK38734.1|  unknown                                               61.2    2e-07   
ref|XP_010937203.1|  PREDICTED: myb-related protein Pp2-like          61.2    2e-07   
gb|EEC80245.1|  hypothetical protein OsI_22196                        60.8    2e-07   
ref|XP_009600051.1|  PREDICTED: myb-related protein 308               61.2    2e-07   
gb|AAN28273.1|  myb-like transcription factor 1                       60.5    2e-07   
ref|XP_004952890.1|  PREDICTED: transcription factor MYB28-like       61.2    2e-07   
gb|KFK32225.1|  hypothetical protein AALP_AA6G214100                  61.2    2e-07   
gb|KDP28653.1|  hypothetical protein JCGZ_14424                       60.8    2e-07   
ref|XP_004144840.1|  PREDICTED: myb-related protein 308-like          60.5    2e-07   
gb|ADF57329.1|  R2R3 MYB transcription factor                         61.2    2e-07   
ref|XP_004504959.1|  PREDICTED: transcription factor MYB39-like       61.2    2e-07   
gb|ACA33850.1|  R2R3-Myb14 transcription factor                       59.3    2e-07   
ref|XP_003560902.1|  PREDICTED: myb-related protein Hv1-like          61.2    2e-07   
ref|XP_006288136.1|  hypothetical protein CARUB_v10001366mg           61.2    2e-07   
gb|ACN12953.1|  R2R3-MYB transcription factor MYB14                   60.1    2e-07   
ref|XP_010434009.1|  PREDICTED: protein ODORANT1-like                 60.8    2e-07   
gb|AAD53094.1|AF175989_1  putative transcription factor               61.2    2e-07   
gb|EMS50780.1|  Transcription factor MYB39                            61.2    2e-07   
ref|XP_008795437.1|  PREDICTED: transcription factor MYB39            61.2    2e-07   
ref|XP_010538235.1|  PREDICTED: myb-related protein 315-like          61.2    2e-07   
gb|AFD36431.1|  R2R3 MYB transcription factor                         61.2    2e-07   
gb|ADV29940.1|  MYB transcription factor MIXTA-like 3 protein         59.3    2e-07   
gb|EAY82442.1|  hypothetical protein OsI_37656                        60.1    2e-07   
ref|XP_010520889.1|  PREDICTED: transcription repressor MYB6          61.2    2e-07   
ref|XP_010431743.1|  PREDICTED: transcription factor MYB39-like       61.2    2e-07   
ref|XP_008447966.1|  PREDICTED: myb-related protein 308-like          60.5    2e-07   
emb|CDX94036.1|  BnaC07g36700D                                        61.2    2e-07   
ref|NP_567540.2|  transcription factor MYB39                          61.2    2e-07   
ref|XP_007216934.1|  hypothetical protein PRUPE_ppa016708mg           61.2    2e-07   



>ref|XP_002510929.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF51531.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=188

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 89/158 (56%), Gaps = 11/158 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPP----SSLSLHSGDDQKLK  169
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K  + + L P    SS + H   DQKL 
Sbjct  23   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLNKQVNPQELVPYDHHSSNNSHDHRDQKLP  82

Query  170  PAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLSWSF-  346
               N D            + CS  E   +  P    +D DP M+ +LS+TF  D +W+F 
Sbjct  83   KTNNCDHSSSSDNSSTPPENCSIDECR-STNPN---SDDDPLMNYILSETFLEDSTWNFP  138

Query  347  -GGDECSDFAMsssshgsssEWLMDLQDFGEDQSWALL  457
               +E  +F   SSS   +S WL+DL++  +D  +  L
Sbjct  139  MTREEYCEFG-KSSSSEGNSPWLLDLKNIEDDHHFGFL  175



>ref|XP_009374509.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=251

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 89/158 (56%), Gaps = 25/158 (16%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K    ++  P  +   + +    +PA +
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPITHEPLHK----QVTTPQEMPREASN----QPANS  150

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAA-------------GPQVEEADYDPWMSQLLSDTF  322
            D ++++    + EH  C++ +   A+              P   E D DP +S +LSDTF
Sbjct  151  DMNIQQINTNIPEHGICTNSDGNSASENSPSDDSEPAEPNPNCSEED-DPLVSFILSDTF  209

Query  323  FNDLSWSFGGDECSDFAMs-ssshgsssEWLMDLQDFG  433
              DL+W F     S+++ + + +  +S  W MD  DFG
Sbjct  210  LEDLTWDFSTS--SEYSSADNPTEENSLAWFMDCNDFG  245



>ref|XP_004307827.1| PREDICTED: protein ODORANT1-like [Fragaria vesca subsp. vesca]
Length=250

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 83/147 (56%), Gaps = 9/147 (6%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+TH PLQK   +    P      +   Q +   E+
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHVPLQK---QVTTTPQETPCEANIQQSVNIPEH  155

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLSWSFGG--D  355
                 E      E+   +  +++  A   VE+   DP +S +LSDTF  D SWSF    D
Sbjct  156  GVSGNENGSSATENSTSNEAQSLIEADANVED---DPLVSYILSDTFLEDWSWSFPAVED  212

Query  356  ECSDFAM-sssshgsssEWLMDLQDFG  433
              +D  + S+SS  SSS W MD +DFG
Sbjct  213  GYNDLGLSSTSSEDSSSAWFMDCKDFG  239



>ref|XP_008234380.1| PREDICTED: protein ODORANT1-like [Prunus mume]
Length=245

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 82/150 (55%), Gaps = 19/150 (13%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL+K    ++ PP         +   KP   
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLRK----QVTPP---------EMPCKPNNP  145

Query  182  DDDLE--EELPKMEEHQQCSSKEAMFAAGPQVEEADY----DPWMSQLLSDTFFNDLSWS  343
              DLE  ++   + EH   S+ E+  +   Q  E +     DP MS +LSDTF  DL+W 
Sbjct  146  PADLEMNQQNVNIPEHGISSAAESSSSNESQPLEPNLKSEDDPLMSYILSDTFLEDLTWD  205

Query  344  FGGDECSDFAMsssshgsssEWLMDLQDFG  433
            F           + +  +S  W +D +DFG
Sbjct  206  FSASSEDSSPADNPAEDNSLAWFLDCKDFG  235



>emb|CAN60750.1| hypothetical protein VITISV_043464 [Vitis vinifera]
Length=208

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 87/147 (59%), Gaps = 13/147 (9%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL     E + PP   +L   + Q+L  ++ 
Sbjct  47   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLH----EHVTPPEMPTLVDTEHQEL--SKT  100

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPW-MSQLLSDTFFNDLSWSF--GG  352
            +D+L           + +S +     GP  E+   DP  MS + SD F +++SWSF   G
Sbjct  101  NDNLITSDANSSSTLENNSTDEHRPLGPASED---DPLMMSYIWSDEFLSNVSWSFLAQG  157

Query  353  DECSDFAMsssshgs-ssEWLMDLQDF  430
            +ECS+   SS++     S W +D +DF
Sbjct  158  EECSELGFSSTTPSEDGSSWWLDYEDF  184



>emb|CBI24555.3| unnamed protein product [Vitis vinifera]
Length=274

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 87/147 (59%), Gaps = 13/147 (9%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL     E + PP   +L   + Q+L  ++ 
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLH----EHVTPPEMPTLVDTEHQEL--SKT  152

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPW-MSQLLSDTFFNDLSWSF--GG  352
            +D+L           + +S +     GP  E+   DP  MS + SD F +++SWSF   G
Sbjct  153  NDNLITSDANSSSTLENNSTDEHRPLGPASED---DPLMMSYIWSDEFLSNVSWSFLAQG  209

Query  353  DECSDFAMssss-hgsssEWLMDLQDF  430
            +ECS+   SS++     S W +D +DF
Sbjct  210  EECSELGFSSTTPSEDGSSWWLDYEDF  236



>ref|XP_002321838.2| hypothetical protein POPTR_0015s14600g [Populus trichocarpa]
 gb|EEF05965.2| hypothetical protein POPTR_0015s14600g [Populus trichocarpa]
Length=274

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 91/162 (56%), Gaps = 23/162 (14%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+TH  L K    +    S++S H+  DQ +  A+N
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHGSLSKQVSPQ---ESTVSCHTNYDQPIINADN  155

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGP----QVEEA--------DYDPWMSQLLSDTFF  325
                ++ LPK+  H    +  +     P     V+E         D DP MS + S+ F 
Sbjct  156  ----QQVLPKICAHASSRTDNSSTTTTPTENSSVDECVGSSEPNNDNDPTMSFIWSEAFL  211

Query  326  NDLSWSFGG--DECSDFAMssssh--gsssEWLMDLQDFGED  439
            +D SW+F    ++ S+F +S+SS    S S W +D +D G++
Sbjct  212  DDSSWNFQATREDYSEFGVSNSSSDQDSYSTWFLDCKDLGDE  253



>ref|XP_002266019.2| PREDICTED: protein ODORANT1-like [Vitis vinifera]
Length=290

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 87/147 (59%), Gaps = 13/147 (9%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL     E + PP   +L   + Q+L  ++ 
Sbjct  129  RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLH----EHVTPPEMPTLVDTEHQEL--SKT  182

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPW-MSQLLSDTFFNDLSWSF--GG  352
            +D+L           + +S +     GP  E+   DP  MS + SD F +++SWSF   G
Sbjct  183  NDNLITSDANSSSTLENNSTDEHRPLGPASED---DPLMMSYIWSDEFLSNVSWSFLAQG  239

Query  353  DECSDFAMsssshgs-ssEWLMDLQDF  430
            +ECS+   SS++     S W +D +DF
Sbjct  240  EECSELGFSSTTPSEDGSSWWLDYEDF  266



>gb|ACN91625.1| transcription factor MYBL1 [Populus x canadensis]
Length=276

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 92/166 (55%), Gaps = 29/166 (17%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K +  +    S +  H+  DQ   P  N
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLNKQESPQ---ESIVPCHTNYDQ---PNFN  152

Query  182  DDDLEEELPKMEEH---------------QQCSSKEAMFAAGPQVEEADYDPWMSQLLSD  316
             D  ++ LP+   H               +  S  E + ++ P     D DP MS L S+
Sbjct  153  ADG-QQVLPQNSGHASSSTTDNSSTTTPTENSSVDECIGSSEPN-STTDSDPLMSCLWSE  210

Query  317  TFFNDLSWSF----GGDECSDFAMsssshgsssE-WLMDLQDFGED  439
             F +D SW+F    GGD  S+F +S SS   S+  W++D QD G++
Sbjct  211  VFLDDSSWNFQATRGGDY-SEFGLSKSSSEDSNSPWVLDSQDLGDE  255



>ref|XP_011041720.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=273

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPP-SSLSLHSGDDQKLKPAE  178
            RTDNEIKNHWNTHIKKKLIKMG+DP+TH  L K    ++ P  S++S H+  DQ +  A+
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHGSLSK----QVTPIESTVSCHTNYDQPIINAD  154

Query  179  NDDDLEEELPKMEEHQQCSSKEAM--------FAAGPQVEEADYDPWMSQLLSDTFFNDL  334
            N   L +           SS               G      D DP MS + SD F +D 
Sbjct  155  NQQVLPKICANASSRTDNSSTPTTPTENSSVDVCVGSSEPNKDNDPTMSFIWSDAFLDDS  214

Query  335  SWSFGG--DECSDFAM-sssshgsssEWLMDLQDFGED  439
            SW+F    D+ S+F + +SSS  S S W +D +D G++
Sbjct  215  SWNFPATRDDYSEFGVSNSSSEDSDSTWFLDCKDLGDE  252



>gb|AAZ20435.1| MYB19 [Malus domestica]
 dbj|BAG48172.1| myb-related transcription factor [Malus domestica]
Length=251

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 86/157 (55%), Gaps = 23/157 (15%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K    ++  P  +   + +    +PA +
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPITHEPLHK----QVTTPQEMPCEASN----QPANS  150

Query  182  DDDLEEELPKMEEHQQCSSKEAMFA--------AGPQVEEADY----DPWMSQLLSDTFF  325
            D  +++    + EH   ++ +            + P     +Y    DP +S +LSDTF 
Sbjct  151  DMSIQQMNTNIPEHGISTNSDGNSTSENSPSNDSEPAEPNPNYSEEEDPLVSFILSDTFL  210

Query  326  NDLSWSFGGDECSDFAMs-ssshgsssEWLMDLQDFG  433
             DL+W F     S+++ + + +  +S  W MD  DFG
Sbjct  211  EDLTWDFSTS--SEYSSADNPTEENSLAWFMDCNDFG  245



>ref|XP_008376445.1| PREDICTED: protein ODORANT1-like [Malus domestica]
Length=279

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 88/178 (49%), Gaps = 37/178 (21%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD-DEEMLPPSSLSLHSGDDQKL----  166
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K     E +P  + +  +G D  +    
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLHKQAITPEEMPCEASNQPAGSDVNIPQNM  158

Query  167  ---------------KPAENDDDLEEELPKMEEHQQCSSKEAMFAAG-------------  262
                           +PA  D ++   +  + EH+  S+ +   +A              
Sbjct  159  DIPEHEVYSNSEASNQPAGLDMNIPRNM-NIPEHEISSNSDGGGSASENSPSNESQSAEP  217

Query  263  -PQVEEADYDPWMSQLLSDTFFNDLSWSFGGDECSDFAMsssshgsssEWLMDLQDFG  433
             P   E D DP +S +LSDTF  DL+W F      D +  + +  +S  W MD +DFG
Sbjct  218  NPNYSEED-DPLLSFILSDTFLEDLTWDFSTSS-EDGSADNPTEENSLAWFMDCKDFG  273



>ref|XP_007038425.1| Myb domain protein 42 [Theobroma cacao]
 gb|EOY22926.1| Myb domain protein 42 [Theobroma cacao]
Length=271

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 89/159 (56%), Gaps = 23/159 (14%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPLQK        P++ +  +   +  +P  N
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLQK--------PAATAQDATCQENDQP--N  148

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAA---------GPQVEEADYDPWMSQLLSDTFFNDL  334
             D  + ELPK   H   S+ E                    +D DP M+ + S++F NDL
Sbjct  149  LDPNQLELPKNSGHVSPSTDEFCTPTENSSTDESRSSSESGSDDDPLMNLIWSESFLNDL  208

Query  335  SWSFGG----DECSDFAMsssshgsssEWLMDLQDFGED  439
            SW+F G    +E S+   SSSS  +S  WL+D  + G+D
Sbjct  209  SWNFPGPDSREEYSELGFSSSSEENSLSWLLDYPNIGDD  247



>ref|XP_008376253.1| PREDICTED: protein ODORANT1-like [Malus domestica]
Length=251

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 82/158 (52%), Gaps = 25/158 (16%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K        P   S         +PA +
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPITHEPLHKQVTTXQEMPCEAS--------NQPANS  150

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAA-------------GPQVEEADYDPWMSQLLSDTF  322
            D  +++    + EH   ++ +    +              P   E + DP +S +LSDTF
Sbjct  151  DMSIQQMNTNIPEHGISTNSDGNSTSENSPSNDSEPAEPNPNYSEEE-DPLVSFILSDTF  209

Query  323  FNDLSWSFGGDECSDFAMs-ssshgsssEWLMDLQDFG  433
              DL+W F     S+++ + + +  +S  W MD  DFG
Sbjct  210  LEDLTWDFSTS--SEYSSADNPTEENSLAWFMDCNDFG  245



>ref|XP_002318878.1| hypothetical protein POPTR_0012s14540g [Populus trichocarpa]
 gb|EEE97098.1| hypothetical protein POPTR_0012s14540g [Populus trichocarpa]
Length=276

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 90/165 (55%), Gaps = 27/165 (16%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K +  +    S++  H+  DQ   P  N
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLNKLESPQ---ESTVPCHTNYDQ---PNFN  152

Query  182  DDDLEEELPKMEEH---------------QQCSSKEAMFAAGPQVEEADYDPWMSQLLSD  316
             D  ++ LP+   H               +  S  E + ++ P     D DP MS + S+
Sbjct  153  ADG-QQVLPQNCGHASSSTTDNSSTTTPTENSSVDECIGSSEPN-STPDSDPLMSCIWSE  210

Query  317  TFFNDLSWSFGGDECSDFA----MsssshgsssEWLMDLQDFGED  439
             F +D SW+F      DF+      SSS  S+S W++D +D G++
Sbjct  211  VFLDDSSWNFQASRGGDFSEFGLSKSSSEDSNSPWVLDSKDLGDE  255



>ref|XP_011029963.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=276

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 27/165 (16%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K    +    S +  H+  DQ   P  N
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLNKQGSPQ---ESIVPCHTNYDQ---PNFN  152

Query  182  DDDLEEELPKMEEH---------------QQCSSKEAMFAAGPQVEEADYDPWMSQLLSD  316
             D  ++ LP+   H               +  S  E + ++ P     D DP MS + S+
Sbjct  153  ADG-QQVLPQNCGHASSSTTDNSSSTTPTENSSVDECIGSSEPN-STTDSDPLMSCIWSE  210

Query  317  TFFNDLSWSFGGDECSDFA----MsssshgsssEWLMDLQDFGED  439
             F +D SW+F      DF+      SSS  S+S W++D +D G++
Sbjct  211  VFLDDSSWNFQATRGGDFSEFGLSKSSSEDSNSPWVLDSKDLGDE  255



>ref|XP_009372900.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=279

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 88/181 (49%), Gaps = 43/181 (24%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD--DDEEMLPPSSLS------------  139
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K     EEM  P   S            
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLHKQVITPEEM--PCEASDQPAGSDVNIPQ  156

Query  140  --------LHSGDDQKLKPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQ---------  268
                    ++S  +   +PA  D ++   +  + EH+  S+ +   +A            
Sbjct  157  NMGIPEHEVYSNSEASNQPAGLDMNIPRNM-NIPEHEISSNSDGGGSASENSPSNESQSA  215

Query  269  ------VEEADYDPWMSQLLSDTFFNDLSWSFGGDECSDFAMsssshgsssEWLMDLQDF  430
                  +EE D  P +S +LSDTF  DL+W F      D +  + +  +S  W MD +DF
Sbjct  216  EPNPNYIEEGD--PLVSFILSDTFLEDLTWDFSTSS-EDGSADNPTEENSLAWFMDCKDF  272

Query  431  G  433
            G
Sbjct  273  G  273



>ref|XP_009370487.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=279

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 88/181 (49%), Gaps = 43/181 (24%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD--DDEEMLPPSSLS------------  139
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K     EEM  P   S            
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLHKQVITPEEM--PCEASDQPAGSDVNIPQ  156

Query  140  --------LHSGDDQKLKPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQ---------  268
                    ++S  +   +PA  D ++   +  + EH+  S+ +   +A            
Sbjct  157  NMDIPEHEVYSNSEASNQPAGLDMNIPRNM-NIPEHEISSNSDGGGSASENSPSNESQSA  215

Query  269  ------VEEADYDPWMSQLLSDTFFNDLSWSFGGDECSDFAMsssshgsssEWLMDLQDF  430
                  +EE D  P +S +LSDTF  DL+W F      D +  + +  +S  W MD +DF
Sbjct  216  EPNPNYIEEGD--PLVSFILSDTFLEDLTWDFSTSS-EDGSADNPTEENSLAWFMDCKDF  272

Query  431  G  433
            G
Sbjct  273  G  273



>ref|XP_010101097.1| Protein ODORANT1 [Morus notabilis]
 gb|EXB86983.1| Protein ODORANT1 [Morus notabilis]
Length=258

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 86/162 (53%), Gaps = 18/162 (11%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL    D+     +S S    DDQK   A +
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLNGQKDK--YSSTSTSTPQDDDQKPCEANS  156

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEE---------ADYDP--WMSQLLSDTFFN  328
              + +E +   E H    +   +  +   ++              P   MS LLS+ F  
Sbjct  157  SSNQQEMIIAEENHVMLGTNSNVDNSNVSIQTDQNSSSSTDDQSQPLDLMSYLLSENFLE  216

Query  329  DLSWSFGGDECSDFAMsssshgsssEWLMDLQDFGED-QSWA  451
            D SW+F     SDF + +SS   SS WL+  +D G+D + WA
Sbjct  217  DSSWNF---PTSDFGV-TSSSEESSTWLLSSKDLGDDGELWA  254



>emb|CDP09898.1| unnamed protein product [Coffea canephora]
Length=292

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 74/155 (48%), Gaps = 14/155 (9%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLK-PAE  178
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPLQK   E  +  +S    S   QKL+ P  
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLQK---ETKVAETSPDAESEKHQKLELPEI  155

Query  179  NDDDLEEELPKMEEHQQC------SSKEAMFAAGPQVEEADYDPWMSQLLSDTF----FN  328
            N           E+   C      SS E+          +DYDP +S LL +        
Sbjct  156  NSGSTISASASSEDQNSCSPTENSSSDESRLLDNILENVSDYDPLISYLLEEEAPVPPVV  215

Query  329  DLSWSFGGDECSDFAMsssshgsssEWLMDLQDFG  433
            D  W F     +           +  WL+D QDFG
Sbjct  216  DAPWEFPAAAQNFDNPGMPLLDDNCSWLLDCQDFG  250



>gb|AGN52048.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52158.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=252

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 74/147 (50%), Gaps = 27/147 (18%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE--MLPPSSLSLHSGDDQKLKPA  175
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL KD  EE    PP      +GD+    P 
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLNKDQTEEKQQTPPPPDVPFAGDETSCSPT  158

Query  176  ENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFN-DLSWSFGG  352
            + +   +E    M E+                     DP +S L  D     D  W F  
Sbjct  159  DQNSSSDESNSNMYEN---------------------DPLISCLFRDDPPQMDFPWEFPS  197

Query  353  DECSDFAMsssshgsssEWLMDLQDFG  433
             E     +++S+   S +WL+D QDFG
Sbjct  198  AE---EGVAASAWDHSCQWLLDCQDFG  221



>ref|NP_001106007.1| LOC100101510 [Zea mays]
 gb|AAS45643.1| MYB-like protein 1 [Zea mays]
 gb|AAS45644.1| MYB-like protein 2 [Zea mays]
 gb|ACN27134.1| unknown [Zea mays]
 gb|ADX60109.1| MYB transcription factor [Zea mays]
 tpg|DAA62458.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=275

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 78/159 (49%), Gaps = 19/159 (12%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL +         +S S  S +  K +  +N
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLDRKTTSSGPATTSQSTKSDEATKEQSPQN  158

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEA-------DYDPWMSQLL------SDTF  322
            DD +  ++P       CS  E+          +       D DP +  LL       D  
Sbjct  159  DDAVIRDVPA----DGCSPTESSTNTVSTGGSSSSGGGGHDQDPLVKWLLEEEPATGDEA  214

Query  323  FNDLSWSFGGDECSDFAMsssshg--sssEWLMDLQDFG  433
            + + + S   DE S  A          +++WL+D QDFG
Sbjct  215  WLNFTGSVDVDEFSSIAAGPELLPWDGATDWLLDYQDFG  253



>ref|XP_008650756.1| PREDICTED: LOC100101510 isoform X1 [Zea mays]
 ref|XP_008650757.1| PREDICTED: LOC100101510 isoform X1 [Zea mays]
 ref|XP_008650758.1| PREDICTED: LOC100101510 isoform X1 [Zea mays]
 gb|ACF86776.1| unknown [Zea mays]
 tpg|DAA62459.1| TPA: putative MYB DNA-binding domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA62460.1| TPA: putative MYB DNA-binding domain superfamily protein isoform 
2 [Zea mays]
Length=299

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 77/155 (50%), Gaps = 11/155 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL +         +S S  S +  K +  +N
Sbjct  123  RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLDRKTTSSGPATTSQSTKSDEATKEQSPQN  182

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEA---DYDPWMSQLL------SDTFFNDL  334
            DD +  ++P        SS   +   G         D DP +  LL       D  + + 
Sbjct  183  DDAVIRDVPADGCSPTESSTNTVSTGGSSSSGGGGHDQDPLVKWLLEEEPATGDEAWLNF  242

Query  335  SWSFGGDECSDFAMsssshg--sssEWLMDLQDFG  433
            + S   DE S  A          +++WL+D QDFG
Sbjct  243  TGSVDVDEFSSIAAGPELLPWDGATDWLLDYQDFG  277



>gb|AGV22119.1| MYB transcription factor 2 [Betula luminifera]
Length=252

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 65/113 (58%), Gaps = 14/113 (12%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DPLTHEPLQK+D      P     HS        A++
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPLTHEPLQKED-----TPQQTFCHS------TTADD  147

Query  182  DDDLEEELPKMEEHQQ-CSSKEAMFA--AGPQVEEADYDPWMSQLLSDTFFND  331
            D DLE    + EE Q+ C+  E      +    +  D D  MS + S+T F D
Sbjct  148  DLDLEVINHEQEESQKICAPTENSSTDESRSLSDPGDDDLLMSYIWSETIFLD  200



>ref|XP_011081193.1| PREDICTED: protein ODORANT1 [Sesamum indicum]
Length=277

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 83/157 (53%), Gaps = 19/157 (12%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE-------MLPPSSLSLHSGDDQ  160
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K+ D++          P S S H  DDQ
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLHKETDQDPQQSHAAQKSPQSDSNH--DDQ  156

Query  161  KLKPAEN--DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLL---SDTFF  325
               P  +    +L+E      +   CS +  +    P     + DP +S L    +D   
Sbjct  157  TQLPGADVVPVNLDENSYSPTDQNSCSDESNL----PDANLYENDPLISCLFQDDNDPPQ  212

Query  326  NDLSWSFGGDECSDF-AMsssshgsssEWLMDLQDFG  433
             D+SW        +F ++ ++S   +  WL+D QDFG
Sbjct  213  ADVSWELFPSPEENFDSLFATSWEENCPWLLDCQDFG  249



>ref|XP_010264189.1| PREDICTED: protein ODORANT1-like [Nelumbo nucifera]
Length=277

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 78/165 (47%), Gaps = 26/165 (16%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQ-------  160
            RTDNEIKNHWNTHIKKKL KMG+DP+THEPL K          + S+ S D         
Sbjct  99   RTDNEIKNHWNTHIKKKLTKMGIDPVTHEPLHKHAATTTATQVTSSITSADRHPDSSKKT  158

Query  161  -KLKPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFND--  331
             +L   EN+  L          Q+ SS  A   +G +   +D +     L+S   + D  
Sbjct  159  LRLPSPENNGRL------TTPDQENSSSAAENCSGDESRLSDNNGGQGSLMSCLLWGDDK  212

Query  332  ----LSWSF----GGDECSDFAMsssshgsssEWLMDLQDFGEDQ  442
                 SW F     G+  +D    S S   +  WL+D QDFG ++
Sbjct  213  PLVEASWKFPTTSAGETYNDVG--SLSWEENCAWLLDYQDFGVEE  255



>dbj|BAJ61450.1| R2R3-MYB transcription factor [Lupinus albus]
Length=201

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 74/157 (47%), Gaps = 31/157 (20%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK--------DDDEEMLPPSSLS---LHS  148
            RTDNEIKNHWNTHIKKKL+K+G+DP+THE L K          D E LPP + +    +S
Sbjct  42   RTDNEIKNHWNTHIKKKLLKIGIDPVTHESLNKQVSSKGSSTSDAENLPPKASNDEVRNS  101

Query  149  GDDQKLKPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFN  328
             ++    PAEN    E+ +          S E++                S  L +T  N
Sbjct  102  DENSSTSPAENSSSCEDSILM----DSICSDESLIN--------------SLWLDETLLN  143

Query  329  DLSWSFG--GDECSDFAMsssshgsssEWLMDLQDFG  433
            D  W      D  ++  M   +   +  WL++ QDFG
Sbjct  144  DALWDIAPKADNINNNDMGLPTWEDNCAWLLECQDFG  180



>ref|XP_010035019.1| PREDICTED: protein ODORANT1 [Eucalyptus grandis]
 gb|KCW46286.1| hypothetical protein EUGRSUZ_K00153 [Eucalyptus grandis]
Length=269

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 69/121 (57%), Gaps = 14/121 (12%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLH-----SGDDQKL  166
            RTDNEIKNHWNTHIKKKLI+MG+DP+TH+PLQ+  +E++  PS  +       S  +  +
Sbjct  99   RTDNEIKNHWNTHIKKKLIRMGIDPVTHKPLQEQANEQV--PSKANEQAKFEVSNHETPV  156

Query  167  KPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFF-NDLSWS  343
             P +   D     P ++     + K   F   P +   D DPWM+ +  +TF  N  SW+
Sbjct  157  YPCDGSSD-NFSSPIIDNFS--TGKSPSF--DPNISSFD-DPWMNHVRWETFLGNPSSWN  210

Query  344  F  346
            F
Sbjct  211  F  211



>gb|KHG25520.1| Protein ODORANT1 [Gossypium arboreum]
Length=256

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 49/77 (64%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLP------PSSL--------S  139
            RTDNEIKNHWNTHIKKKLIKMG+DP THEPLQK D  E  P      P +L        S
Sbjct  110  RTDNEIKNHWNTHIKKKLIKMGIDPATHEPLQKPDTPENKPNLDPNQPENLSKSCAHEFS  169

Query  140  LHSGDDQKLKPAENDDD  190
            L +G D+     E+DDD
Sbjct  170  LPTGTDEWRSSWESDDD  186



>ref|XP_002462722.1| hypothetical protein SORBIDRAFT_02g030900 [Sorghum bicolor]
 gb|EER99243.1| hypothetical protein SORBIDRAFT_02g030900 [Sorghum bicolor]
Length=275

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 82/168 (49%), Gaps = 17/168 (10%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLK---P  172
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL +        P++ S  +  D+  K   P
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLDRKTSSS---PATTSQSAKSDEATKQQSP  155

Query  173  AENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEA---DYDPWMSQLL------SDTFF  325
              +D  +  ++P        SS   +   G     +   D DP +  LL       D  +
Sbjct  156  ENDDVVVMRDVPADGCSPTESSTNTVSTGGSSSSSSGGHDQDPLVKWLLEEEPPTGDEPW  215

Query  326  NDLSWSFGGDECSDFAMsssshg--sssEWLMDLQDFGEDQSWALLPG  463
             + S S   DE S  A          +++WL+D QDFG   S  L+ G
Sbjct  216  LNFSGSVDVDEFSSIAAGPELLPWDGATDWLLDYQDFGLGDSATLVDG  263



>gb|KHG16103.1| Protein ODORANT1 [Gossypium arboreum]
Length=262

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 72/147 (49%), Gaps = 7/147 (5%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K+   E    SS + HS D+   +    
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLNKEAKTE--ESSSHAHHSADNHTTENDGI  156

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLSW-SFGGDE  358
             +  E+      E+   +    +  A    E      WM +        D+SW S    E
Sbjct  157  ANSSEDNSSSPTENCSTTDDPNLLDAICNDESLLNSLWMDE----PPLVDVSWTSISAGE  212

Query  359  CSDFAMsssshgsssEWLMDLQDFGED  439
             +    S  S      WL+D QDFG +
Sbjct  213  SNCNLTSLPSWEEDCAWLLDYQDFGTN  239



>ref|XP_004298679.1| PREDICTED: protein ODORANT1-like isoform 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_004298680.1| PREDICTED: protein ODORANT1-like isoform 2 [Fragaria vesca subsp. 
vesca]
Length=279

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 80/161 (50%), Gaps = 22/161 (14%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHS-----------  148
            RTDNEIKNHWNTHIKKKL++MG+DP+THE L KD D+     +++S H+           
Sbjct  99   RTDNEIKNHWNTHIKKKLLRMGIDPVTHELLHKDQDDLANKETTISSHTDPANSNLPQST  158

Query  149  --GDDQKLKPAENDDDLE--EELPKMEEHQQCSSKEAMFAAGPQVEEADYDP-WMSQL-L  310
                     PAEN   +    E P   + Q       +  +   ++E+  +  W+ +  L
Sbjct  159  AENSSSNSSPAENSSSISSPNENPSTGDDQS-----TLIDSICNIDESLMNSLWVDETPL  213

Query  311  SDTFFNDLSWSFGGDECSDFAMsssshgsssEWLMDLQDFG  433
             D  +N+   + GG+   +     S+   +  WL+D QDFG
Sbjct  214  IDALWNNDQVADGGNYIENGMGMVSNWEENCSWLLDCQDFG  254



>ref|XP_009595050.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=277

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 76/160 (48%), Gaps = 24/160 (15%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKN+WNTHIKKKL+KMG+DP+THEPL K+       PS+ S  +G  Q     E+
Sbjct  99   RTDNEIKNNWNTHIKKKLLKMGIDPITHEPLHKETK-----PSNQSTTTGHQQVHVVPES  153

Query  182  DDDLEEELPKMEEHQQCSS--------KEAMFAAGPQVEEADYDPWM---SQLLSDTF--  322
             + + +    + E    +           ++F+        +    +   +QL+ DTF  
Sbjct  154  TNVIAQSTNVVAESTNVTKASTSLELENSSIFSYDLSFSPNENSSCITDETQLVLDTFTD  213

Query  323  ---FNDLSWSFGGDECSDFAMsssshgsssEWLMDLQDFG  433
                 D  W F     S  A   +    +  WL+D QDFG
Sbjct  214  VAHLIDSPWEFSA---SATAQKQNFDNENFNWLLDCQDFG  250



>ref|XP_010093656.1| Protein ODORANT1 [Morus notabilis]
 gb|EXB54436.1| Protein ODORANT1 [Morus notabilis]
Length=318

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLP  124
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K++ ++ LP
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPVTHEPLHKENVDDQLP  139



>ref|XP_004173287.1| PREDICTED: protein ODORANT1-like [Cucumis sativus]
Length=181

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEP+QK  + E
Sbjct  22   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPIQKQPENE  59



>gb|ABR92760.1| transcription factor TF1 [Gossypium hirsutum]
Length=256

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 48/77 (62%), Gaps = 14/77 (18%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLP------PSSL--------S  139
            RTDNEIKNHWN HIKKKLIKMG+DP THEPLQK D  E  P      P +L        S
Sbjct  110  RTDNEIKNHWNAHIKKKLIKMGIDPATHEPLQKPDTPENKPNLDPNQPENLSKSCAHEFS  169

Query  140  LHSGDDQKLKPAENDDD  190
            L +G D+     E+DDD
Sbjct  170  LPTGTDEWRSSWESDDD  186



>emb|CDY42188.1| BnaC03g65090D [Brassica napus]
Length=237

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSL  142
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL +D +    P +S S+
Sbjct  68   RTDNEIKNHWNTHIKKKLVKMGIDPVTHQPLNQDPNSTDNPKNSCSV  114



>ref|XP_010277005.1| PREDICTED: protein ODORANT1-like [Nelumbo nucifera]
Length=274

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 77/158 (49%), Gaps = 15/158 (9%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K   +     + L     D  +L  + N
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLHK---QAAATTTELPSSPADHHELTESNN  155

Query  182  --DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFND------LS  337
                   E   ++      SS  A   +G +   +D + W+   L    + D       S
Sbjct  156  HGSSSSSEAGGRVISEDNSSSSTAENCSGDESRLSDNN-WVDGSLMSCLWGDDEPPQEAS  214

Query  338  WS---FGGDECSDFAMsssshgsssEWLMDLQDFGEDQ  442
            W+     G+  ++  +   S   +  WL+D QDFG ++
Sbjct  215  WNKSPVTGETYNNVDVGLPSWEDNCAWLLDCQDFGVEE  252



>ref|NP_001062432.1| Os08g0548000 [Oryza sativa Japonica Group]
 dbj|BAF24346.1| Os08g0548000, partial [Oryza sativa Japonica Group]
Length=183

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 72/152 (47%), Gaps = 8/152 (5%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP TH+PL           S+LS  + +  K      
Sbjct  20   RTDNEIKNHWNTHIKKKLIKMGIDPATHQPLPNTKVVSQTRTSTLSTATTESAKSNGMAY  79

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLSW----SFG  349
              D E    +          ++M  +         DP ++ LL      D  W    S  
Sbjct  80   PFDPEGGCSR----DMSVPTDSMEQSSRNTSSHGLDPLVNWLLEAELPADEPWLNFTSSN  135

Query  350  GDECSDFAMsssshgsssEWLMDLQDFGEDQS  445
             D+ S     S+  GS+++WL+D QDF  D S
Sbjct  136  EDDFSGIVKQSAWDGSTTDWLLDYQDFSMDDS  167



>gb|KCW46285.1| hypothetical protein EUGRSUZ_K00153 [Eucalyptus grandis]
Length=206

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEM  118
            RTDNEIKNHWNTHIKKKLI+MG+DP+TH+PLQ+  +E++
Sbjct  99   RTDNEIKNHWNTHIKKKLIRMGIDPVTHKPLQEQANEQV  137



>ref|XP_010676207.1| PREDICTED: protein ODORANT1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010676208.1| PREDICTED: protein ODORANT1-like [Beta vulgaris subsp. vulgaris]
Length=294

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 2/43 (5%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD--DEEMLP  124
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL KD   + +++P
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLNKDQSPNNQIIP  141



>gb|KDO48409.1| hypothetical protein CISIN_1g024441mg [Citrus sinensis]
Length=267

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD-EEMLPPSS  133
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K+   E+ LPP S
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLHKETKAEDNLPPDS  143



>ref|XP_006477265.1| PREDICTED: protein ODORANT1-like [Citrus sinensis]
Length=267

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD-EEMLPPSS  133
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K+   E+ LPP S
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLHKETKAEDNLPPDS  143



>ref|XP_006490087.1| PREDICTED: protein ODORANT1-like [Citrus sinensis]
 gb|KDO65428.1| hypothetical protein CISIN_1g024849mg [Citrus sinensis]
Length=261

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 81/155 (52%), Gaps = 24/155 (15%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPLQ+   +  +      ++S DD   + A +
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLQQ---QANITEDQAPINSHDDH--QQAAS  153

Query  182  DDDLEEELPKMEEHQQCSSKEAMF----AAGPQVEEADYDPWM----SQLLSDTFFNDLS  337
            + D+     + E+ + CS K           P   + D   +M    +  L+DTF    S
Sbjct  154  NFDIANVGEQQEKPRICSEKNYSTDHESKNRPTTSDDDLMSYMWSSDTFDLADTF---TS  210

Query  338  WSFGGDECSDFAMsssshgsssEWLMDL-QDFGED  439
            W+F     S+          SS WLMD  Q FG+D
Sbjct  211  WNFPTASSSE-------GNPSSPWLMDYHQGFGDD  238



>ref|XP_008437136.1| PREDICTED: protein ODORANT1-like [Cucumis melo]
Length=258

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEP+QK  + E
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPIQKQPENE  136



>gb|KHG18117.1| Protein ODORANT1 [Gossypium arboreum]
Length=263

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLP  124
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K    E  P
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPVTHEPLNKQSKTEQSP  139



>ref|XP_008443380.1| PREDICTED: transcription factor MYB76-like isoform X4 [Cucumis 
melo]
Length=189

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLH  145
            RTDNEIKN+WNTH+KKKLIKMG+DP+TH+P+ K+++EEM    SL LH
Sbjct  99   RTDNEIKNYWNTHLKKKLIKMGIDPITHKPM-KNNNEEMKAEWSLQLH  145



>gb|KGN50209.1| hypothetical protein Csa_5G160120 [Cucumis sativus]
Length=258

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEP+QK  + E
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPIQKQPENE  136



>emb|CDX76358.1| BnaA08g10420D [Brassica napus]
Length=264

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSL  142
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL +D +    P +S S+
Sbjct  95   RTDNEIKNHWNTHIKKKLVKMGIDPVTHQPLNQDPNSTDNPKNSCSV  141



>gb|AAF22256.1| myb-related transcription factor [Spuriopimpinella brachycarpa]
Length=269

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 73/154 (47%), Gaps = 21/154 (14%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K++            +S  +  L+P ++
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLHKEE-----------TNSQKEILLQPFQS  147

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLSWSFGGD--  355
              + E  +P +      +S E       Q    D    +S +      + +S+ F  D  
Sbjct  148  PAETENHVPPIPHTNDMASSENSCTPTDQNSSGDESNSLSAICDQIDDSLISYLFEDDTP  207

Query  356  --------ECSDFAMsssshgsssEWLMDLQDFG  433
                      +   M   S   S  WL+D QDFG
Sbjct  208  GLVDAPWENFNKVDMVLPSWDESFPWLLDCQDFG  241



>gb|KDP25612.1| hypothetical protein JCGZ_20768 [Jatropha curcas]
 gb|AIT52314.1| MYB family protein [Jatropha curcas]
Length=282

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 6/68 (9%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPLQK+   E     S S+   D    +PA N
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLQKEAKTE----ESSSVSQTDHLLPEPANN  154

Query  182  --DDDLEE  199
              +D ++E
Sbjct  155  SSNDSIQE  162



>ref|XP_006440395.1| hypothetical protein CICLE_v10021695mg [Citrus clementina]
 gb|ESR53635.1| hypothetical protein CICLE_v10021695mg [Citrus clementina]
Length=267

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 2/46 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE--MLPPSS  133
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K+   E  +LP SS
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLHKETKAEDNLLPDSS  144



>ref|XP_006421721.1| hypothetical protein CICLE_v10005666mg [Citrus clementina]
 gb|ESR34961.1| hypothetical protein CICLE_v10005666mg [Citrus clementina]
Length=261

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 82/155 (53%), Gaps = 24/155 (15%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPLQ+   +  +      ++S DD   + A +
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLQQ---QANITEDQAPINSHDDH--QQAAS  153

Query  182  DDDLEEELPKMEEHQQCS----SKEAMFAAGPQVEEADYDPWM----SQLLSDTFFNDLS  337
            + D+     + E+ + CS    S +      P   + D   +M    +  L+DTF    S
Sbjct  154  NFDIANVGEQQEKPRICSEQNYSTDHESKNRPTTSDDDLMSYMWSSDTFDLADTF---TS  210

Query  338  WSFGGDECSDFAMsssshgsssEWLMDL-QDFGED  439
            W+F     S+          SS WLMD  Q FG+D
Sbjct  211  WNFPTASSSE-------GNPSSPWLMDYHQGFGDD  238



>ref|XP_008810422.1| PREDICTED: protein ODORANT1-like [Phoenix dactylifera]
Length=245

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 78/150 (52%), Gaps = 22/150 (15%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEP+   D +  L  SS S  + + +       
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPI---DRQPSLQKSSQSTAATESK-------  148

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADY---DPWMSQLL-SDTFFNDLSWSFG  349
             DDL+ +    E     S   +     P  E ++    DP +  L   D    D SW F 
Sbjct  149  SDDLQLQSQGCEGQNHSSENSS-----PPEESSNTSSNDPVVGSLWEEDIPLIDESWMFP  203

Query  350  GDECSDFA--MsssshgsssEWLMDLQDFG  433
             +E  D++  +       SSEWL+D QDFG
Sbjct  204  CNE-DDYSSVVGPLPWEGSSEWLLDYQDFG  232



>ref|XP_011069675.1| PREDICTED: protein ODORANT1 [Sesamum indicum]
Length=269

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 80/157 (51%), Gaps = 28/157 (18%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDD----QKL-  166
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K+ ++          H+ D+    +K+ 
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLHKEHEKS-------ESHAADNFPESEKMN  151

Query  167  KPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFN------  328
            +  E ++DL    P   E Q  SS E+     P     + DP +S L  D   +      
Sbjct  152  QLQETNNDLGSGSP---EDQNSSSDESNL---PDRNLYENDPLISCLFRDDDHDQDNDPD  205

Query  329  --DLSWSFGGDECSDFAMsssshgsssEWLMDLQDFG  433
               + W F  +    F    +S   S  WL+D QDFG
Sbjct  206  QLQVPWEFQSENLGSFC--PTSWDESCSWLLDCQDFG  240



>ref|XP_007218420.1| hypothetical protein PRUPE_ppa011549mg [Prunus persica]
 gb|EMJ19619.1| hypothetical protein PRUPE_ppa011549mg [Prunus persica]
Length=206

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLP  124
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K      +P
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLCKQATPPEMP  139



>emb|CDX82958.1| BnaC01g14080D [Brassica napus]
Length=267

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKP  172
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL ++ +    P S  S  + DD  +KP
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPMTHQPLNQEPNNTNNPQSLSS--TSDDISMKP  153



>ref|XP_009616533.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=290

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 12/75 (16%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL------------QKDDDEEMLPPSSLSLH  145
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL            Q++  +E++PP +++  
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPLSTNIEQPENLPIQQEKVQEIMPPCTVNYV  158

Query  146  SGDDQKLKPAENDDD  190
            S D   +   + DDD
Sbjct  159  SIDQSAITEIKLDDD  173



>dbj|BAD10751.1| putative Myb13 protein [Oryza sativa Japonica Group]
 dbj|BAD09945.1| putative Myb13 protein [Oryza sativa Japonica Group]
 gb|EAZ07894.1| hypothetical protein OsI_30149 [Oryza sativa Indica Group]
 gb|EAZ43562.1| hypothetical protein OsJ_28183 [Oryza sativa Japonica Group]
Length=262

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 72/152 (47%), Gaps = 8/152 (5%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP TH+PL           S+LS  + +  K      
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPATHQPLPNTKVVSQTRTSTLSTATTESAKSNGMAY  158

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLSW----SFG  349
              D E    +          ++M  +         DP ++ LL      D  W    S  
Sbjct  159  PFDPEGGCSR----DMSVPTDSMEQSSRNTSSHGLDPLVNWLLEAELPADEPWLNFTSSN  214

Query  350  GDECSDFAMsssshgsssEWLMDLQDFGEDQS  445
             D+ S     S+  GS+++WL+D QDF  D S
Sbjct  215  EDDFSGIVKQSAWDGSTTDWLLDYQDFSMDDS  246



>ref|XP_008467265.1| PREDICTED: protein ODORANT1 [Cucumis melo]
Length=236

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDE  112
            RTDNEIKNHWNTHIKKKLIKMG+DP+TH+PL+K   E
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHQPLKKQQTE  135



>ref|XP_006400198.1| hypothetical protein EUTSA_v10014086mg [Eutrema salsugineum]
 gb|ESQ41651.1| hypothetical protein EUTSA_v10014086mg [Eutrema salsugineum]
Length=329

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL + +  E    S  SL   DD+  K    
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSEQEGSEQAQGSKKSLVPHDDKNRKQDHE  158

Query  182  DDDLEEELPKMEEHQ  226
            D   ++   K E+HQ
Sbjct  159  DQQTKD---KQEQHQ  170



>ref|XP_010934413.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=246

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 74/147 (50%), Gaps = 15/147 (10%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+P+ +       P SS S  + + +       
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHKPINRQPS----PKSSQSTATTESK-------  147

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLL-SDTFFNDLSWSFGGDE  358
             DD + +    E   Q S              +  D  +  L   D    + SW+F  +E
Sbjct  148  SDDHQLQSQGYEGQNQSSENSRSSPPEESSNTSSNDLLVGSLWEEDIPLINESWTFPCNE  207

Query  359  CSDFA--MsssshgsssEWLMDLQDFG  433
              D++  ++      SSEWL+D QDFG
Sbjct  208  -EDYSSVVAPLPWEGSSEWLLDYQDFG  233



>ref|XP_010053417.1| PREDICTED: protein ODORANT1-like [Eucalyptus grandis]
 gb|KCW77710.1| hypothetical protein EUGRSUZ_D02014 [Eucalyptus grandis]
Length=301

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK--DDDEEMLPPSSLSLHSGDDQKLKPA  175
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K      E  P +SLS    D     PA
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLNKPQKTPSEHDPEASLSSSQADPTSESPA  158



>ref|XP_003516672.1| PREDICTED: protein ODORANT1 [Glycine max]
 gb|KHN42714.1| Protein ODORANT1 [Glycine soja]
Length=269

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 72/158 (46%), Gaps = 28/158 (18%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K    +     +      ++  +   E 
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLNKQVSSKDSSSPAEHFSQVNNINIHQVEQ  158

Query  182  DDDL--EEELPKMEEHQQCSSKEAMFAAGPQVEEA-------DYDPWMSQLLSDT-----  319
            +D +   EE       +  S +E++       + +       D  P M  L  +T     
Sbjct  159  NDGVLNSEENSTSSPAENSSGEESLLVDSICSDVSLINSMWLDETPLMDTLWDNTPKVEN  218

Query  320  FFNDLSWSFGGDECSDFAMsssshgsssEWLMDLQDFG  433
              N++    G D C+              WL+D QDFG
Sbjct  219  ANNNMGLPIGEDNCA--------------WLLDCQDFG  242



>ref|XP_008238636.1| PREDICTED: protein ODORANT1 [Prunus mume]
Length=291

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD  106
            RTDNEIKNHWNTHIKKKL++MG+DP+THEPL K+D
Sbjct  99   RTDNEIKNHWNTHIKKKLLRMGIDPVTHEPLHKED  133



>gb|AFW80944.1| hypothetical protein ZEAMMB73_172211 [Zea mays]
Length=165

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL+KMG+DP TH+PL
Sbjct  86   RTDNEIKNHWNTHIKKKLVKMGIDPATHQPL  116



>ref|XP_007210741.1| hypothetical protein PRUPE_ppa021568mg [Prunus persica]
 gb|EMJ11940.1| hypothetical protein PRUPE_ppa021568mg [Prunus persica]
Length=291

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD  106
            RTDNEIKNHWNTHIKKKL++MG+DP+THEPL K+D
Sbjct  99   RTDNEIKNHWNTHIKKKLLRMGIDPVTHEPLHKED  133



>emb|CDX96511.1| BnaA07g31220D [Brassica napus]
Length=326

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQK  163
            RTDNEIKNHWNTHIKK+LIK G+DPLTH+ L   D  E LP  S+     DDQK
Sbjct  99   RTDNEIKNHWNTHIKKRLIKKGIDPLTHKSL---DQSETLPDKSIGHQEDDDQK  149



>ref|XP_009412832.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=234

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 75/149 (50%), Gaps = 18/149 (12%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKN WNTHIKKKL+KMGVDP+TH+PL +  +  +   S+ +  S  DQ+L+    
Sbjct  99   RTDNEIKNLWNTHIKKKLVKMGVDPVTHKPLDRKAN-SVSSQSTATTESKSDQQLQSRGT  157

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSD-TFFNDLSWSFGGDE  358
            D  ++       E+    ++ +  A G        DP +S L  D T   D  W F  +E
Sbjct  158  DGQIQS-----SENTSSPTEASSNADG-------ADPLLSCLWEDNTSLLDELWQFPSNE  205

Query  359  CSDFAMssssh----gsssEWLMDLQDFG  433
              D+   +         S EWL+D Q  G
Sbjct  206  DVDYGSVAGPVWPWDEGSCEWLLDDQALG  234



>ref|XP_004515780.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=275

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLNK  131



>gb|KEH31681.1| myb transcription factor [Medicago truncatula]
Length=272

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL K
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLNK  131



>ref|XP_007039958.1| Myb domain protein 42 [Theobroma cacao]
 gb|EOY24459.1| Myb domain protein 42 [Theobroma cacao]
Length=285

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 4/61 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THE L K+   E    SS + HS D+Q     EN
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHESLNKEAKAE--ESSSHADHSADNQ--NTTEN  154

Query  182  D  184
            D
Sbjct  155  D  155



>ref|XP_004245722.1| PREDICTED: protein ODORANT1 [Solanum lycopersicum]
Length=287

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL+K+++
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLKKEEN  134



>ref|XP_009628634.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=281

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD--EEMLPPSSLSLHSGDDQ  160
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL+K+ +  ++ +P S  + ++G  Q
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLKKEANLIDQPIPESDQNKNNGHQQ  153



>emb|CDX94109.1| BnaC07g37430D [Brassica napus]
Length=269

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLS  139
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL ++ +    P SS S
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPVTHQPLNQEPNNTDNPKSSSS  144



>ref|XP_004162772.1| PREDICTED: protein ODORANT1-like, partial [Cucumis sativus]
Length=229

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDE  112
            RTDNEIKNHWNTHIKKKLIKMG+DP TH+PL+K   E
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPATHQPLKKQQTE  135



>ref|XP_004143714.1| PREDICTED: protein ODORANT1-like [Cucumis sativus]
Length=236

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDE  112
            RTDNEIKNHWNTHIKKKLIKMG+DP TH+PL+K   E
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPATHQPLKKQQTE  135



>emb|CDY64316.1| BnaA03g58600D [Brassica napus]
Length=269

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLS  139
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL ++ +    P SS S
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPVTHQPLNQEPNNTDNPNSSSS  144



>ref|XP_003538655.1| PREDICTED: protein ODORANT1-like [Glycine max]
 gb|KHN34962.1| Protein ODORANT1 [Glycine soja]
Length=264

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL+KMG+DPLTHEPL K
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPLTHEPLNK  131



>gb|EMT18012.1| Protein ODORANT1 [Aegilops tauschii]
Length=287

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHS  148
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL+     +    S+ S  S
Sbjct  100  RTDNEIKNHWNTHIKKKLIKMGIDPITHEPLEVRKQPQQASLSTTSAQS  148



>ref|XP_009788709.1| PREDICTED: protein ODORANT1-like [Nicotiana sylvestris]
Length=284

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD--EEMLPPSSLSLHSGDDQ  160
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL+K+ +  ++ +P S  + ++G  Q
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLKKEANLIDQPIPESDQNKNNGHQQ  153



>ref|XP_009137269.1| PREDICTED: protein ODORANT1-like [Brassica rapa]
Length=269

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLS  139
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL ++ +    P SS S
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPVTHQPLNQEPNNTDNPNSSSS  144



>ref|XP_008369511.1| PREDICTED: protein ODORANT1 [Malus domestica]
Length=302

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 3/43 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPS  130
            RTDNEIKNHWNTHIKKKL++MG+DP+THEPL K   EE LP +
Sbjct  99   RTDNEIKNHWNTHIKKKLLRMGIDPVTHEPLHK---EEELPSN  138



>sp|Q50EX6.1|ODO1_PETHY RecName: Full=Protein ODORANT1; AltName: Full=MYB-like protein 
ODO1 [Petunia x hybrida]
 gb|AAV98200.1| MYB-like protein ODORANT1 [Petunia x hybrida]
Length=294

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL+K+
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLKKE  132



>gb|AEC11888.1| MYB transcription factor ODO1 [Petunia axillaris]
Length=294

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL+K+
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLKKE  132



>gb|AEC11889.1| MYB transcription factor ODO1 [Petunia axillaris]
Length=294

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL+K+
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLKKE  132



>gb|AEC11890.1| MYB transcription factor ODO1 [Petunia exserta]
Length=294

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL+K+
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLKKE  132



>ref|XP_009108579.1| PREDICTED: protein ODORANT1-like [Brassica rapa]
Length=268

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNT IKKKL+KMG+DP+TH+PL +D +    P +S S+ S D   +  + +
Sbjct  99   RTDNEIKNHWNTRIKKKLVKMGIDPVTHQPLNQDPNSTDNPKNSCSV-SDDISMVTKSSS  157

Query  182  DDDLEEELPKMEE  220
              ++E    + E+
Sbjct  158  TKNIETNGTRTED  170



>emb|CAC85051.1| Myb13 protein [Oryza sativa]
 emb|CAC85052.1| Myb15 protein [Oryza sativa]
Length=285

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL +
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLDR  131



>ref|NP_001063765.1| Os09g0532900 [Oryza sativa Japonica Group]
 dbj|BAD33318.1| putative myb-related transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAD46027.1| putative myb-related transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF25679.1| Os09g0532900 [Oryza sativa Japonica Group]
 dbj|BAG97524.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99392.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84939.1| hypothetical protein OsI_32154 [Oryza sativa Indica Group]
 gb|EEE70106.1| hypothetical protein OsJ_30116 [Oryza sativa Japonica Group]
Length=285

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL +
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLDR  131



>emb|CDX73043.1| BnaC06g34910D [Brassica napus]
Length=370

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQK  163
            RTDNEIKNHWNTHIKK+LIK G+DPLTH+ L   D  E LP  S+     DDQK
Sbjct  143  RTDNEIKNHWNTHIKKRLIKKGIDPLTHKSL---DHSETLPDKSIGHQEDDDQK  193



>ref|XP_009106064.1| PREDICTED: transcription factor MYB122-like [Brassica rapa]
Length=375

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQK  163
            RTDNEIKNHWNTHIKK+LIK G+DPLTH+ L   D  E LP  S+     DDQK
Sbjct  148  RTDNEIKNHWNTHIKKRLIKKGIDPLTHKSL---DQSETLPDKSIGHQEDDDQK  198



>ref|XP_006660886.1| PREDICTED: protein ODORANT1-like [Oryza brachyantha]
Length=275

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL            S    SG+  + +  + 
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLDLKQASPTTTSQSTVTESGEATRQQSPQL  158

Query  182  DD  187
            DD
Sbjct  159  DD  160



>ref|XP_004957458.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=278

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL +
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLDR  131



>emb|CDY69554.1| BnaAnng30810D, partial [Brassica napus]
Length=289

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ-KDDDEEMLPPSSLSLHSGDD  157
            RTDNE+KNHWNTHIKK+LIK G+DPLTH+ L  K  D    PP   S+H  DD
Sbjct  54   RTDNEVKNHWNTHIKKRLIKKGIDPLTHKSLNGKSSDHPETPPDKSSVHQDDD  106



>ref|XP_006413635.1| hypothetical protein EUTSA_v10027281mg [Eutrema salsugineum]
 gb|ESQ55088.1| hypothetical protein EUTSA_v10027281mg [Eutrema salsugineum]
Length=270

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKP  172
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL ++ +     P+++S  S D   ++P
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPVTHQPLNQEPNSTA-NPNNISSTSDDIISMEP  154



>ref|XP_008443378.1| PREDICTED: transcription factor MYB76-like isoform X2 [Cucumis 
melo]
Length=233

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLS  139
            RTDNEIKN+WNTH+KKKLIKMG+DP+TH+P+ K+++EEM   S+++
Sbjct  99   RTDNEIKNYWNTHLKKKLIKMGIDPITHKPM-KNNNEEMKVKSNMN  143



>ref|XP_008443377.1| PREDICTED: transcription factor MYB76-like isoform X1 [Cucumis 
melo]
Length=234

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLS  139
            RTDNEIKN+WNTH+KKKLIKMG+DP+TH+P+ K+++EEM   S+++
Sbjct  99   RTDNEIKNYWNTHLKKKLIKMGIDPITHKPM-KNNNEEMKVKSNMN  143



>ref|XP_008443379.1| PREDICTED: transcription factor MYB76-like isoform X3 [Cucumis 
melo]
Length=232

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLS  139
            RTDNEIKN+WNTH+KKKLIKMG+DP+TH+P+ K+++EEM   S+++
Sbjct  99   RTDNEIKNYWNTHLKKKLIKMGIDPITHKPM-KNNNEEMKVKSNMN  143



>ref|XP_009362121.1| PREDICTED: LOW QUALITY PROTEIN: protein ODORANT1 [Pyrus x bretschneideri]
Length=304

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL++MG+DP+THEPL K+++
Sbjct  101  RTDNEIKNHWNTHIKKKLLRMGIDPVTHEPLHKEEE  136



>ref|XP_004973482.1| PREDICTED: myb-related protein 315-like [Setaria italica]
Length=304

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSS  133
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL    + +  PP +
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPLSPPQEHQQSPPPA  142



>ref|XP_002509589.1| ODORANT1 protein, putative [Ricinus communis]
 gb|EEF50976.1| ODORANT1 protein, putative [Ricinus communis]
Length=281

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 76/162 (47%), Gaps = 21/162 (13%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLP-------PSSLSLHSGDDQ  160
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEP  K+   E +        P + +    ++ 
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPFHKEAKTEQISSHADNFLPETTNNMDNNNN  158

Query  161  KLKPAENDDDLEEELPKMEE--HQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDL  334
                  ND ++           H+ C S E++       +E   +   S  + + F  D 
Sbjct  159  NNSQENNDGNVNSSEDNSSSSPHENCCSDESVLLDSICNDETLLN---SLWMDEPFLVDA  215

Query  335  SWSFGGD---------ECSDFAMsssshgsssEWLMDLQDFG  433
            SWS   D         E +D     SS   +  WL+D QDFG
Sbjct  216  SWSHNNDINNNNPPAMENTDMGFPYSSWEDNCTWLLDCQDFG  257



>ref|XP_007157323.1| hypothetical protein PHAVU_002G060500g [Phaseolus vulgaris]
 gb|ESW29317.1| hypothetical protein PHAVU_002G060500g [Phaseolus vulgaris]
Length=267

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLNK  131



>ref|XP_002303526.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE78505.2| myb family transcription factor family protein [Populus trichocarpa]
Length=270

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 49/85 (58%), Gaps = 17/85 (20%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE--------MLPPSSLS------  139
            RTDNEIKNHWNTHIKKKL+K G+DP+THEPL K+   E        +LP SS +      
Sbjct  99   RTDNEIKNHWNTHIKKKLLKRGIDPVTHEPLHKEAKPEESSSSPADLLPESSNNNDMQEK  158

Query  140  ---LHSGDDQKLKPAENDDDLEEEL  205
               + + DD    P EN    E+ L
Sbjct  159  DGIVINSDDNSRSPTENSCSTEDSL  183



>dbj|BAJ97263.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ  97
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL+
Sbjct  100  RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLE  131



>ref|XP_007155582.1| hypothetical protein PHAVU_003G214300g [Phaseolus vulgaris]
 gb|ESW27576.1| hypothetical protein PHAVU_003G214300g [Phaseolus vulgaris]
Length=319

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL+KMGVDP+THEPL K
Sbjct  148  RTDNEIKNHWNTHIKKKLLKMGVDPVTHEPLNK  180



>emb|CDY49137.1| BnaA02g16690D [Brassica napus]
Length=318

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ-KDDDEEMLPPSSLSLHSGDD  157
            RTDNE+KNHWNTHIKK+LIK G+DPLTH+ L  K  D    PP   S+H  DD
Sbjct  99   RTDNEVKNHWNTHIKKRLIKKGIDPLTHKSLNGKSSDHPETPPDKSSVHQDDD  151



>ref|XP_009354562.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
 ref|XP_009354566.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=300

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD  106
            RTDNEIKNHWNTHIKKKL++MG+DP+THEPL K++
Sbjct  99   RTDNEIKNHWNTHIKKKLLRMGIDPVTHEPLHKEE  133



>ref|XP_011033909.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=270

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 49/85 (58%), Gaps = 17/85 (20%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE--------MLPPSSLS------  139
            RTDNEIKNHWNTHIKKKL+K G+DP+THEPL K+   E        +LP SS +      
Sbjct  99   RTDNEIKNHWNTHIKKKLLKSGIDPVTHEPLHKEAKPEESSSYPADLLPESSNNNDMQEK  158

Query  140  ---LHSGDDQKLKPAENDDDLEEEL  205
               + + DD    P EN    E+ L
Sbjct  159  DGIVINSDDNSRSPTENSCSTEDSL  183



>gb|EYU26820.1| hypothetical protein MIMGU_mgv1a027167mg [Erythranthe guttata]
Length=288

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKLIKMG+DP+THEPL  +
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPVTHEPLHNE  132



>ref|NP_001241087.1| protein ODORANT1-like [Glycine max]
 gb|ACU24041.1| unknown [Glycine max]
 gb|AGO06072.1| transcription factor MYBJ1 [Glycine max]
 gb|KHN34452.1| Protein ODORANT1 [Glycine soja]
Length=271

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLNK  131



>ref|XP_009407976.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=251

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQ  160
            RTDNEIKN WNTHIKKKL+KMG+DP+TH PL +    E   PS+++    DDQ
Sbjct  99   RTDNEIKNLWNTHIKKKLLKMGIDPVTHRPLHRQASPEA-SPSTVTTDKSDDQ  150



>gb|KDO50806.1| hypothetical protein CISIN_1g021498mg [Citrus sinensis]
Length=311

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   DD++
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSTTDDQQ  136



>ref|XP_006482113.1| PREDICTED: protein ODORANT1-like [Citrus sinensis]
Length=311

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   DD++
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSTTDDQQ  136



>ref|XP_006430591.1| hypothetical protein CICLE_v10012265mg [Citrus clementina]
 gb|ESR43831.1| hypothetical protein CICLE_v10012265mg [Citrus clementina]
Length=311

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   DD++
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSTTDDQQ  136



>ref|XP_011001567.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=321

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 48/79 (61%), Gaps = 13/79 (16%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   +     PP          Q++K  EN
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSTIETPPSPPPR---------QEVKVQEN  149

Query  182  DDDLEEELPKMEEHQQCSS  238
              ++E++       Q CS+
Sbjct  150  IQEIEQQ----AVQQSCST  164



>gb|ABK25487.1| unknown [Picea sitchensis]
Length=242

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLS  139
            RTDNEIKN+WN+H+K+KLI MGVDPLTH P Q++   ++  P ++S
Sbjct  99   RTDNEIKNYWNSHLKRKLISMGVDPLTHRPFQRNSRRDLSLPGNVS  144



>ref|XP_010062268.1| PREDICTED: protein ODORANT1-like isoform X2 [Eucalyptus grandis]
Length=257

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDE--EMLPPSSLSLH  145
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL  ++D   +  PP +   H
Sbjct  56   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPLVTNNDNTTDQQPPQAAQTH  105



>ref|XP_009128025.1| PREDICTED: transcription factor MYB122-like [Brassica rapa]
Length=334

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ-KDDDEEMLPPSSLSLHSGDD  157
            RTDNE+KNHWNTHIKK+LIK G+DPLTH+ L  K  D    PP   S+H  DD
Sbjct  99   RTDNEVKNHWNTHIKKRLIKKGIDPLTHKSLNGKSSDHPETPPDKSSVHQDDD  151



>ref|XP_008670915.1| PREDICTED: protein ODORANT1-like [Zea mays]
 ref|XP_008655982.1| PREDICTED: protein ODORANT1-like [Zea mays]
 gb|AFW80943.1| hypothetical protein ZEAMMB73_126482 [Zea mays]
 gb|AIB04565.1| MYB-related transcription factor, partial [Zea mays]
Length=214

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
           RTDNEIKNHWNTHIKKKL+KMG+DP TH+PL
Sbjct  49  RTDNEIKNHWNTHIKKKLVKMGIDPATHQPL  79



>gb|EMT20029.1| Protein ODORANT1 [Aegilops tauschii]
Length=281

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 54/108 (50%), Gaps = 19/108 (18%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DP TH+PLQ         P++ + H    Q  +P   
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPATHKPLQ---------PAAAATH---QQPQRPTGG  146

Query  182  DDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFF  325
            D   ++         Q  ++E MF         D  P M QLL +   
Sbjct  147  DSPEQKVPAAAATGSQSGAEEDMFC-------PDEVPTMMQLLDNIIL  187



>ref|XP_010529493.1| PREDICTED: protein ODORANT1-like [Tarenaya hassleriana]
Length=278

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL K+
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPMTHQPLNKE  132



>emb|CAN68308.1| hypothetical protein VITISV_043506 [Vitis vinifera]
Length=203

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSS  133
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEP  K    +   P +
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPFHKQAAAKETSPRA  142



>ref|XP_006659660.1| PREDICTED: protein ODORANT1-like [Oryza brachyantha]
Length=262

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 74/153 (48%), Gaps = 10/153 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG+DP TH+PL           S+ S  + +      A++
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPATHQPLANTKAISQTGTSTQSTVTTES-----AKS  153

Query  182  DDDLEEELPKMEEHQQCSS-KEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLSW----SF  346
            +D      PK    +  S   +++  +         DP ++ LL      D  W    S 
Sbjct  154  NDMAYPVDPKGGCSRSMSVPTDSLEQSSRNTSSQGLDPLLNWLLETELPADEPWLNFTSS  213

Query  347  GGDECSDFAMsssshgsssEWLMDLQDFGEDQS  445
              D+       S+  GS+++WL+D QDF    S
Sbjct  214  NDDDLCGIVKQSALDGSTTDWLLDYQDFSMGNS  246



>ref|XP_009136061.1| PREDICTED: protein ODORANT1 [Brassica rapa]
Length=267

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKP  172
            RTDNEIKNHWNT IKKKL+KMG+DP+TH+PL ++ +    P +  S  + DD  +KP
Sbjct  99   RTDNEIKNHWNTRIKKKLVKMGIDPMTHQPLNQEPNNTYNPQNLSS--TSDDISMKP  153



>ref|XP_006284312.1| hypothetical protein CARUB_v10005483mg [Capsella rubella]
 gb|EOA17210.1| hypothetical protein CARUB_v10005483mg [Capsella rubella]
Length=271

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKLIKMG+DP+TH+PL ++
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPMTHQPLNQE  132



>gb|AGN52115.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52225.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=288

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 18/93 (19%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL-----------QKDDDEEMLPPSSLSL--  142
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL           + +  E+++ P++ S   
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLPPPTVEQPPPEESNKVEQVINPAAESATD  158

Query  143  ---HSGDDQKLKPAE--NDDDLEEELPKMEEHQ  226
                  D  K  P E  N+D   +E+P ME H+
Sbjct  159  EVNEIVDSFKFDPMELVNNDFCIDEIPVMEPHE  191



>ref|XP_003578505.1| PREDICTED: protein ODORANT1-like [Brachypodium distachyon]
Length=274

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ  97
            RTDNEIKNHWNTHIKKKLIKMG+DP+TH+PL 
Sbjct  102  RTDNEIKNHWNTHIKKKLIKMGIDPVTHQPLH  133



>ref|XP_006355506.1| PREDICTED: protein ODORANT1-like [Solanum tuberosum]
Length=281

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEPL K ++
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPLIKAEN  134



>gb|AGN52067.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52177.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=271

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 53/93 (57%), Gaps = 18/93 (19%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEP---------LQKDDDEEMLPPSSLSL-HSG  151
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+P         L   +       S++S   S 
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHQPLPPPTAVDELGATESTTTFEQSTISTDESN  158

Query  152  DDQKLKPAENDDDL--------EEELPKMEEHQ  226
            DD+ + P E+ D L         +E+P ME H+
Sbjct  159  DDKIMSPFESSDVLLVNSSDFCIDEIPVMEPHE  191



>ref|NP_001169938.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 ref|XP_008645558.1| PREDICTED: putative MYB DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 ref|XP_008645563.1| PREDICTED: putative MYB DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|ACN35307.1| unknown [Zea mays]
 tpg|DAA48759.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05136.1| MYB transcription factor, partial [Zea mays]
Length=261

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 79/152 (52%), Gaps = 17/152 (11%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKLIKMG++P TH+PL    + +  P  S    +G D+  K ++ 
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGINPATHQPLA---NSKAAPSHS----TGTDESAKSSDT  151

Query  182  -------DDDLEEELP-KMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLS  337
                   DD+   E+P   +  +Q S  E     G Q  E   + W S+       + L 
Sbjct  152  REELSLKDDNHHREVPLSTDSSEQSSWPEPGSNVGDQDPELLVN-WPSETDLSVDESWLG  210

Query  338  WSFGGDECSDFAMsssshgsssEWLMDLQDFG  433
            +   G+E  D    +S    +++WL+D QDFG
Sbjct  211  FMSNGNELGDVE-GTSPWDGTTDWLLDYQDFG  241



>ref|XP_010062267.1| PREDICTED: protein ODORANT1-like isoform X1 [Eucalyptus grandis]
 gb|KCW69381.1| hypothetical protein EUGRSUZ_F02864 [Eucalyptus grandis]
Length=300

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDE--EMLPPSSLSLH  145
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL  ++D   +  PP +   H
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPLVTNNDNTTDQQPPQAAQTH  148



>ref|XP_006600811.1| PREDICTED: protein ODORANT1-like [Glycine max]
 gb|KHN09750.1| Protein ODORANT1 [Glycine soja]
Length=274

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL+K+G+DP+THEPL+K
Sbjct  99   RTDNEIKNHWNTHIKKKLLKIGIDPVTHEPLKK  131



>ref|XP_010539859.1| PREDICTED: protein ODORANT1-like [Tarenaya hassleriana]
Length=286

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKL++MG+DP+TH+PL K+ +++
Sbjct  99   RTDNEIKNHWNTHIKKKLLRMGIDPVTHQPLTKEPNDQ  136



>ref|XP_010525304.1| PREDICTED: protein ODORANT1-like [Tarenaya hassleriana]
Length=159

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL   ++E   PP   +  + + +K K  +N
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPL--SEEEASQPPKHQNRKNTEMEKPKSIKN  156



>ref|XP_003538391.1| PREDICTED: protein ODORANT1 [Glycine max]
 gb|KHN17952.1| Protein ODORANT1 [Glycine soja]
Length=336

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 66/125 (53%), Gaps = 12/125 (10%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLK---P  172
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL    ++    P     H    ++ +   P
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHKPLSNKTEQTQAQPDEQQTHQPLQEQQEEPIP  158

Query  173  AENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFFNDLSWSFGG  352
             E D   E   P+ E++++    E+   +    EEA  +    Q+++  F    SW    
Sbjct  159  VEKDTKFE---PEKEQNKEPEKPESSIESLTITEEAKEE---DQIMTPLFD---SWELMN  209

Query  353  DECSD  367
            + C+D
Sbjct  210  EFCTD  214



>ref|XP_004136689.1| PREDICTED: transcription factor MYB76-like [Cucumis sativus]
 ref|XP_004159616.1| PREDICTED: transcription factor MYB76-like [Cucumis sativus]
 gb|KGN59540.1| hypothetical protein Csa_3G824850 [Cucumis sativus]
Length=233

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEM  118
            RTDNEIKN+WNTH+KKKLIKMG+DP+TH+P  K+++EEM
Sbjct  99   RTDNEIKNYWNTHLKKKLIKMGIDPITHKP-TKNNNEEM  136



>ref|XP_006368692.1| hypothetical protein POPTR_0001s07830g [Populus trichocarpa]
 gb|ERP65261.1| hypothetical protein POPTR_0001s07830g [Populus trichocarpa]
Length=270

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 17/85 (20%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE--------MLPPSSLS------  139
            RTDNEIKNHWNTHIKKKL+K G+DP+THEPL K+   E        +LP SS +      
Sbjct  99   RTDNEIKNHWNTHIKKKLLKRGIDPVTHEPLHKEARPEESSSSHADILPESSNNNVMQEN  158

Query  140  ---LHSGDDQKLKPAENDDDLEEEL  205
               + + DD    P EN    E+ +
Sbjct  159  DGIVINSDDNPRSPTENSSSPEDSI  183



>ref|XP_002264150.2| PREDICTED: protein ODORANT1 [Vitis vinifera]
 emb|CBI41085.3| unnamed protein product [Vitis vinifera]
Length=268

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+THEP  K    +   P +      D   L+  ++
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHEPFHKQAAAKETSPRADHFPENDTHNLQLPDS  158

Query  182  D  184
            D
Sbjct  159  D  159



>ref|XP_010556068.1| PREDICTED: transcription factor MYB122-like, partial [Tarenaya 
hassleriana]
Length=150

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 10/84 (12%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL   ++E   PP     HS      KP E 
Sbjct  14   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPL--SEEEASQPPK--PQHSKKKPLKKPQER  69

Query  182  DDDLEEELPKMEEHQQCSSKEAMF  253
             +       + +EHQ+  S   + 
Sbjct  70   KNG------ETQEHQERESVRLLI  87



>ref|XP_003574901.1| PREDICTED: protein ODORANT1-like [Brachypodium distachyon]
Length=268

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKLIKMG+DP TH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPATHQPL  129



>ref|XP_011018242.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=270

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 17/85 (20%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE--------MLPPSSLS------  139
            RTDNEIKNHWNTHIKKKL+K G+DP+THEPL K+   E        +LP SS +      
Sbjct  99   RTDNEIKNHWNTHIKKKLLKRGIDPVTHEPLHKEARPEESSSSHADILPESSNNNVMLEN  158

Query  140  ---LHSGDDQKLKPAENDDDLEEEL  205
               + + DD    P EN    E+ +
Sbjct  159  DGIVINSDDNPRSPTENSSSPEDSI  183



>ref|XP_010032717.1| PREDICTED: protein ODORANT1-like [Eucalyptus grandis]
 gb|KCW52162.1| hypothetical protein EUGRSUZ_J01601 [Eucalyptus grandis]
Length=321

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLH  145
            RTDNEIKNHWNTHIKKKL KMGVDP+TH+PL  +  +   PP SL  H
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGVDPVTHKPLVSNPSD---PPQSLQNH  143



>ref|XP_009410072.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=285

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 52/93 (56%), Gaps = 19/93 (20%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DPL H+PL        +P +S   H    Q    AE 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLLHKPL--------IPSASGVPHQEQQQAGALAE-  149

Query  182  DDDLEEELPKMEEHQQ-CSSKEAMFAAGPQVEE  277
                     +MEE ++ CS   +  AA  QVEE
Sbjct  150  ---------RMEEQEKPCSGSSSEKAAEGQVEE  173



>ref|XP_010539990.1| PREDICTED: transcription factor MYB51-like [Tarenaya hassleriana]
Length=375

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKK+LIK G+DPLTH P+  + D E
Sbjct  99   RTDNEIKNHWNTHIKKRLIKKGIDPLTHRPISGNSDSE  136



>emb|CDX79170.1| BnaA01g12370D [Brassica napus]
Length=267

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKP  172
            RTDNEIKNHWNTHIKKKL+K G+DP+TH+PL ++      P +  S  + DD  +KP
Sbjct  99   RTDNEIKNHWNTHIKKKLVKKGIDPMTHQPLNQEPYNTTNPKNISS--TSDDISMKP  153



>emb|CDX69440.1| BnaA10g17890D [Brassica napus]
Length=313

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL + D  +     S SL   DD+  K  + 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPMTHKPLPEQDGSQQ-AQGSKSLVPHDDKNKKQDQE  157

Query  182  DDDLEEELPKMEEHQ  226
            D   +E   K E HQ
Sbjct  158  DKQTKE---KQEHHQ  169



>ref|XP_006372565.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|ERP50362.1| myb family transcription factor family protein [Populus trichocarpa]
Length=321

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 48/79 (61%), Gaps = 13/79 (16%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   +     PP          Q+++  EN
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSTIETPPSPPPQ---------QEVQVQEN  149

Query  182  DDDLEEELPKMEEHQQCSS  238
              ++E++       Q CS+
Sbjct  150  IQEIEQQ----AVQQSCST  164



>ref|XP_009121472.1| PREDICTED: protein ODORANT1 [Brassica rapa]
Length=313

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL + D  +     S SL   DD+  K  + 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPMTHKPLPEQDGSQQ-AQGSKSLVPHDDKNKKQDQE  157

Query  182  DDDLEEELPKMEEHQ  226
            D   +E   K E HQ
Sbjct  158  DKQTKE---KQEHHQ  169



>ref|XP_008679710.1| PREDICTED: protein ODORANT1 [Zea mays]
 gb|AFW65654.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04818.1| MYB transcription factor, partial [Zea mays]
Length=264

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL+KMG+DP TH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLVKMGIDPATHQPL  129



>gb|ABK28645.1| unknown [Arabidopsis thaliana]
Length=267

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 12/62 (19%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL ++       PS++     D+ K  P+  
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPMTHQPLNQE-------PSNI-----DNSKTIPSNP  146

Query  182  DD  187
            DD
Sbjct  147  DD  148



>ref|NP_567664.1| myb domain protein 85 [Arabidopsis thaliana]
 gb|AAD53098.2|AF175993_1 putative transcription factor [Arabidopsis thaliana]
 gb|AAM62722.1| myb-like protein [Arabidopsis thaliana]
 gb|AAS10078.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAD43481.1| myb-like protein [Arabidopsis thaliana]
 dbj|BAD43540.1| myb-like protein [Arabidopsis thaliana]
 gb|ABE66086.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AEE84639.1| myb domain protein 85 [Arabidopsis thaliana]
Length=266

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 12/62 (19%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL ++       PS++     D+ K  P+  
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPMTHQPLNQE-------PSNI-----DNSKTIPSNP  146

Query  182  DD  187
            DD
Sbjct  147  DD  148



>ref|XP_010416242.1| PREDICTED: transcription factor MYB122-like [Camelina sativa]
Length=255

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 4/58 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL----QKDDDEEMLPPSSLSLHSGDDQK  163
            RTDNEIKNHWNTHIKK+L+K G+DPLTH+PL     K  D    P    S+H  +D +
Sbjct  40   RTDNEIKNHWNTHIKKRLVKKGIDPLTHKPLLDGADKSSDHPETPQEKSSVHQEEDDR  97



>ref|XP_004974136.1| PREDICTED: protein ODORANT1-like isoform X1 [Setaria italica]
 ref|XP_004974137.1| PREDICTED: protein ODORANT1-like isoform X2 [Setaria italica]
Length=262

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKLIKMG+DP TH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLIKMGIDPATHQPL  129



>ref|NP_001061847.1| Os08g0428200 [Oryza sativa Japonica Group]
 emb|CAC85050.1| Myb51 protein [Oryza sativa]
 dbj|BAC75626.1| Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAD01194.1| Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAF23761.1| Os08g0428200 [Oryza sativa Japonica Group]
Length=309

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ  97
            RTDNEIKNHWNTHIKKKL KMG+DPLTH PLQ
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHRPLQ  130



>gb|EAZ07061.1| hypothetical protein OsI_29307 [Oryza sativa Indica Group]
Length=309

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ  97
            RTDNEIKNHWNTHIKKKL KMG+DPLTH PLQ
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHRPLQ  130



>ref|XP_008343128.1| PREDICTED: protein ODORANT1-like [Malus domestica]
Length=276

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+   DD
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPIANVDD  134



>ref|XP_010439306.1| PREDICTED: protein ODORANT1 [Camelina sativa]
Length=269

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL ++
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPVTHQPLTQE  132



>ref|XP_002887017.1| hypothetical protein ARALYDRAFT_894261 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63276.1| hypothetical protein ARALYDRAFT_894261 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSL  136
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   + E+  P   L
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSNVEQEDEEPVKKL  143



>ref|XP_002444623.1| hypothetical protein SORBIDRAFT_07g024970 [Sorghum bicolor]
 gb|EES14118.1| hypothetical protein SORBIDRAFT_07g024970 [Sorghum bicolor]
Length=245

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD  106
            RTDNEIKNHWNTHIKKKLIKMG+DP TH+PL   +
Sbjct  87   RTDNEIKNHWNTHIKKKLIKMGLDPATHQPLSNSN  121



>gb|ACT82838.1| transcription factor MYB047 [Glycine max]
Length=210

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 50/98 (51%), Gaps = 11/98 (11%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLH-------SGDDQ  160
            RTDNEIKN+WNTHI++KL+  G+DP TH PL  D   E  P  +L L          D  
Sbjct  99   RTDNEIKNYWNTHIRRKLLSRGIDPATHRPLNDDKVLERCPDLNLELTISPPRQPQSDQH  158

Query  161  KLKPAENDDDL----EEELPKMEEHQQCSSKEAMFAAG  262
             LKP   + +L       L   ++H  C+   A  A+G
Sbjct  159  HLKPVGRNSNLCFACSLGLQNSKDHCSCALNTANAASG  196



>ref|XP_004956766.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=278

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PLQ    +E
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHKPLQPAPPQE  136



>gb|KHN33675.1| Myb-related protein 308 [Glycine soja]
Length=210

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 50/98 (51%), Gaps = 11/98 (11%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLH-------SGDDQ  160
            RTDNEIKN+WNTHI++KL+  G+DP TH PL  D   E  P  +L L          D  
Sbjct  99   RTDNEIKNYWNTHIRRKLLSRGIDPATHRPLNDDKVLERCPDLNLELTISPPRQPQSDQH  158

Query  161  KLKPAENDDDL----EEELPKMEEHQQCSSKEAMFAAG  262
             LKP   + +L       L   ++H  C+   A  A+G
Sbjct  159  HLKPVGRNSNLCFACSLGLQNSKDHCSCALNTANAASG  196



>ref|XP_004956767.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=273

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PLQ   D
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHKPLQPVPD  134



>gb|AAL84764.1|AF474131_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=162

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPL  129



>ref|NP_197163.1| myb domain protein 43 [Arabidopsis thaliana]
 gb|AAD53095.1|AF175990_1 putative transcription factor [Arabidopsis thaliana]
 dbj|BAB10187.1| transcription factor [Arabidopsis thaliana]
 gb|AAO22590.1| unknown protein [Arabidopsis thaliana]
 gb|AAS10095.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED92315.1| myb domain protein 43 [Arabidopsis thaliana]
Length=327

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL + +  +       SL   DD+  K  + 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSEQEASQQAQGRKKSLVPHDDKNPKQDQQ  158

Query  182  DDDLEEE  202
              D +E+
Sbjct  159  TKDEQEQ  165



>ref|NP_176797.1| myb domain protein 20 [Arabidopsis thaliana]
 gb|AAG51765.1|AC066691_5 myb-related transcription factor, putative; 17635-18559 [Arabidopsis 
thaliana]
 gb|AAS10035.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABI49451.1| At1g66230 [Arabidopsis thaliana]
 gb|AEE34479.1| myb domain protein 20 [Arabidopsis thaliana]
Length=282

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 3/42 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL---QKDDDEEM  118
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   +K+D+E +
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSIVEKEDEEPL  140



>gb|EMT08335.1| Transcription factor MYB39 [Aegilops tauschii]
Length=287

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLH  145
            RTDNEIKN+WNTHI+KKL++MGVDP+TH+ L  D     L  +S++ H
Sbjct  70   RTDNEIKNYWNTHIRKKLLRMGVDPVTHKQLPPDQSRHHLNATSIAHH  117



>emb|CDY45857.1| BnaC02g22630D [Brassica napus]
Length=319

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ-KDDDEEMLPPSSLSLHSGDD  157
            RTDNEIKNHWNTHIKK+L+K  +DPLTH+ L  K  D    PP   S+H  DD
Sbjct  99   RTDNEIKNHWNTHIKKRLVKKCIDPLTHKSLNGKSSDHTETPPDKSSVHQDDD  151



>ref|XP_002867757.1| hypothetical protein ARALYDRAFT_492601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44016.1| hypothetical protein ARALYDRAFT_492601 [Arabidopsis lyrata subsp. 
lyrata]
Length=267

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL+KMG+DP+TH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPMTHQPL  129



>ref|XP_009401426.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=226

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL+++
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPLREE  132



>gb|KFK28838.1| hypothetical protein AALP_AA7G055500 [Arabis alpina]
Length=265

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 6/55 (11%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE------MLPPSSLSLHS  148
            RTDNEIKNHWNTHIKKKL+K+G+DP+TH+PL ++ +         L P  +S HS
Sbjct  99   RTDNEIKNHWNTHIKKKLLKIGIDPMTHQPLNQEPNNNDNPKNISLNPDDISKHS  153



>ref|XP_009105194.1| PREDICTED: protein ODORANT1 [Brassica rapa]
 emb|CDY07493.1| BnaA07g25720D [Brassica napus]
Length=280

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSL  136
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   + EE  P   L
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSIVEQEEDKPLKKL  143



>ref|XP_010474190.1| PREDICTED: protein ODORANT1-like, partial [Camelina sativa]
Length=286

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSL  136
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   + E+  P   L
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSIVEQEDEKPVKKL  143



>ref|XP_008803910.1| PREDICTED: protein ODORANT1-like [Phoenix dactylifera]
Length=291

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+    D++
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPIASTVDQQ  136



>gb|KHN19997.1| Myb-related protein 308 [Glycine soja]
Length=240

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 50/98 (51%), Gaps = 11/98 (11%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLH-------SGDDQ  160
            RTDNEIKN+WNTHI++KL+  G+DP TH PL  D   E  P  +L L          D  
Sbjct  129  RTDNEIKNYWNTHIRRKLLSRGIDPATHRPLNDDKVLERCPDLNLELTISPPRQPQSDQH  188

Query  161  KLKPAENDDDL----EEELPKMEEHQQCSSKEAMFAAG  262
             LKP   + +L       L   ++H  C+   A  A+G
Sbjct  189  HLKPVGRNSNLCFACSLGLQNSKDHCSCALNTANAASG  226



>gb|EPS58402.1| hypothetical protein M569_16412, partial [Genlisea aurea]
Length=236

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
           RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  55  RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPL  85



>ref|XP_009381446.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=285

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL +MG+DPLTHEPL
Sbjct  99   RTDNEIKNHWNTHIKKKLRRMGIDPLTHEPL  129



>ref|XP_004240108.1| PREDICTED: protein ODORANT1-like [Solanum lycopersicum]
Length=319

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLS  139
            RTDNEIKN WNTH+KK+L+ MGVDP THEP    + + + PP+SL+
Sbjct  99   RTDNEIKNLWNTHLKKRLLSMGVDPQTHEPSSAPNGQMITPPTSLA  144



>ref|XP_006844225.1| hypothetical protein AMTR_s00006p00267240 [Amborella trichopoda]
 gb|ERN05900.1| hypothetical protein AMTR_s00006p00267240 [Amborella trichopoda]
Length=243

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEM  118
            RTDNEIKNHWNTH+KK+L+KMG+DPLTHE +   D   M
Sbjct  84   RTDNEIKNHWNTHLKKRLLKMGIDPLTHESIASPDPPNM  122



>ref|XP_010470497.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=290

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSL  136
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   + E+  P   L
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSIVEQEDEEPVKKL  143



>ref|NP_001236232.1| uncharacterized protein LOC100306265 [Glycine max]
 gb|ACU14367.1| unknown [Glycine max]
Length=210

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 49/98 (50%), Gaps = 11/98 (11%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLH-------SGDDQ  160
            RTDNEIKN+WNTHI++KL+  G+DP TH PL  D   E  P  +L L          D  
Sbjct  99   RTDNEIKNYWNTHIRRKLLSRGIDPATHRPLNDDKVLERCPDLNLELTISPPRQPQSDQH  158

Query  161  KLKPAENDDDL----EEELPKMEEHQQCSSKEAMFAAG  262
             LKP   + +L       L   + H  C+   A  A+G
Sbjct  159  HLKPVGRNSNLCFACSLGLQNSKGHCSCALNTANAASG  196



>ref|XP_010415165.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=289

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSL  136
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   + E+  P   L
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSIVEQEDEEPVKKL  143



>ref|XP_004490820.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=319

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL    D
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPLSNTSD  134



>ref|XP_010511551.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=287

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSL  136
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   + E+  P   L
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSIVEQEDEEPVKKL  143



>ref|XP_006289620.1| hypothetical protein CARUB_v10003172mg [Capsella rubella]
 gb|EOA22518.1| hypothetical protein CARUB_v10003172mg [Capsella rubella]
Length=280

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 57/102 (56%), Gaps = 8/102 (8%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL------QKDDDEEMLPPSSLSLHSGDDQK  163
            RTDNEIKNHWNTHIKKKL+KM +DPLTH+PL      +K DD+        ++   DD+ 
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMEIDPLTHQPLNKVSSDKKFDDKSETSSKDGNVKRSDDKS  158

Query  164  LKPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADYD  289
            L+  E+  +   E   +    Q SSK+     G  ++  D D
Sbjct  159  LETDESTKNTINETSTIT--HQNSSKDEYELLGDIIDHKDED  198



>ref|XP_002452601.1| hypothetical protein SORBIDRAFT_04g028850 [Sorghum bicolor]
 gb|EES05577.1| hypothetical protein SORBIDRAFT_04g028850 [Sorghum bicolor]
Length=164

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DP+TH PL
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHRPL  129



>ref|XP_006302662.1| hypothetical protein CARUB_v10020766mg [Capsella rubella]
 gb|EOA35560.1| hypothetical protein CARUB_v10020766mg [Capsella rubella]
Length=279

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSL  136
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   + E+  P   L
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSIVEQEDEEPVKKL  143



>ref|XP_006391368.1| hypothetical protein EUTSA_v10019852mg [Eutrema salsugineum]
 gb|ESQ28654.1| hypothetical protein EUTSA_v10019852mg [Eutrema salsugineum]
Length=283

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSL  136
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   + E+  P   L
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSIVEQEDEEPVKKL  143



>ref|XP_010448861.1| PREDICTED: protein ODORANT1-like [Camelina sativa]
Length=269

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL+KMG+DP TH+PL ++
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMGIDPATHQPLNQE  132



>emb|CDX83837.1| BnaC08g18080D [Brassica napus]
Length=159

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEM  118
            RTDNEIKNHWNTHIKK+LIK GVDP+TH+ L  D  E +
Sbjct  100  RTDNEIKNHWNTHIKKRLIKKGVDPVTHKSLISDKSENL  138



>ref|XP_009370048.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=269

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+   +D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPIANVND  134



>dbj|BAJ98593.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06458.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 57/110 (52%), Gaps = 23/110 (21%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DP TH+PLQ         P++  L     Q L+ +  
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPATHKPLQ---------PAAAPLQ----QPLR-STG  144

Query  182  DDDLEEELPKMEEH--QQCSSKEAMFAAGPQVEEADYDPWMSQLLSDTFF  325
             D  E+++P        Q  ++E MF         D  P M QLL +   
Sbjct  145  GDSPEQKVPAAVAAMGSQSGAEEHMFC-------PDEVPTMMQLLDNIIL  187



>ref|XP_008227926.1| PREDICTED: protein ODORANT1-like [Prunus mume]
Length=270

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+  D
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPIAND  132



>ref|XP_007215806.1| hypothetical protein PRUPE_ppa009966mg [Prunus persica]
 gb|EMJ17005.1| hypothetical protein PRUPE_ppa009966mg [Prunus persica]
Length=270

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKD  103
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+  D
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPIAND  132



>gb|KHG13514.1| Protein ODORANT1 [Gossypium arboreum]
Length=303

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDE  112
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL     E
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPLSSTTTE  135



>ref|XP_010428376.1| PREDICTED: transcription factor MYB122-like, partial [Camelina 
sativa]
Length=238

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL----QKDDDEEMLPPSSLSLHSGDD  157
            RTDNEIKNHWNTHIKK+L+K G+DPLTH+ L     K  D    P  + S+H  +D
Sbjct  23   RTDNEIKNHWNTHIKKRLVKKGIDPLTHKSLIDGAGKSSDHPETPRENTSVHQEED  78



>ref|XP_007032972.1| Myb domain protein 20 [Theobroma cacao]
 gb|EOY03898.1| Myb domain protein 20 [Theobroma cacao]
Length=308

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPL  129



>emb|CDY49639.1| BnaCnng17910D [Brassica napus]
Length=260

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPL  129



>ref|XP_009370562.1| PREDICTED: protein ODORANT1-like [Pyrus x bretschneideri]
Length=275

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+   +D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPIANVND  134



>ref|XP_010547741.1| PREDICTED: transcription factor MYB34-like [Tarenaya hassleriana]
Length=343

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDE  112
            RTDNEIKN+WNTHIKK+LIK G+DPLTH+P+   D E
Sbjct  99   RTDNEIKNYWNTHIKKRLIKKGIDPLTHKPINSTDRE  135



>gb|EMT12444.1| Protein ODORANT1 [Aegilops tauschii]
Length=265

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DP+TH PL ++        +     S   Q+L  AE 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHRPLDQEAPPPAQQTTPPPPTSTAWQQLDGAER  158

Query  182  DDDLEEE  202
                E+E
Sbjct  159  SQQAEDE  165



>ref|XP_010471501.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB122-like 
[Camelina sativa]
Length=357

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL----QKDDDEEMLPPSSLSLHSGDD  157
            RTDNEIKNHWNTHIKK+L+K G+DPLTH+PL     K  D    P    S+H  +D
Sbjct  99   RTDNEIKNHWNTHIKKRLVKKGIDPLTHKPLLDGAAKLSDHPETPREKTSVHQEED  154



>ref|XP_002871726.1| hypothetical protein ARALYDRAFT_909643 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47985.1| hypothetical protein ARALYDRAFT_909643 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL + +  +    S  S    DD+  K  + 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSEHEALQQAQGSKKSFGPHDDKNPKQDQE  158

Query  182  DDDLEEE  202
            D   + E
Sbjct  159  DQQTKGE  165



>ref|XP_010926121.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=288

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD  106
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+P+   D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPITHKPISSTD  133



>ref|NP_001149774.1| odorant 1 protein [Zea mays]
 gb|ACG36738.1| odorant 1 protein [Zea mays]
Length=273

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 56/110 (51%), Gaps = 30/110 (27%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL-----------QKD-----------DDEE  115
            RTDNEIKNHWNTHIKKKL KMG+DP+TH PL           Q+D           DD+ 
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHGPLAPATQPLALAQQRDPPQVVREEERCDDDP  158

Query  116  MLPPSSLSLHSGDDQKLKPAENDDDLEEE-LPKMEEHQQCSSKEAMFAAG  262
                SS  L +G D+       DDD+EE      + H   ++  A  AAG
Sbjct  159  SKQASSQGLAAGADE-------DDDVEETPASAAQPHGATTTSPASAAAG  201



>ref|XP_002305215.1| hypothetical protein POPTR_0004s08480g [Populus trichocarpa]
 gb|EEE85726.1| hypothetical protein POPTR_0004s08480g [Populus trichocarpa]
Length=319

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPL  129



>ref|XP_003553077.1| PREDICTED: protein ODORANT1-like [Glycine max]
Length=331

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPP  127
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL    +E    P
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHKPLSNKTEETQAQP  140



>gb|KHN07541.1| Protein ODORANT1 [Glycine soja]
Length=333

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPP  127
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL    +E    P
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHKPLSNKTEETQAQP  140



>ref|XP_010917650.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=292

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGD  154
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+    D++       S+   D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPISSTFDQQQQQQGCASVGGND  149



>ref|XP_011007235.1| PREDICTED: protein ODORANT1-like [Populus euphratica]
Length=319

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPL  129



>gb|KHG02341.1| Protein ODORANT1 [Gossypium arboreum]
Length=296

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPL  129



>gb|KHG06720.1| Protein ODORANT1 [Gossypium arboreum]
Length=311

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDE  112
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   +++
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPLSTAEEQ  135



>ref|XP_010932583.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=294

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+ +  D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPIAETVD  134



>dbj|BAF80451.1| MYB-related transcription factor [Nicotiana tabacum]
Length=302

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ----KDDDEEMLPPSSLSLHSGDDQKLK  169
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL      D    +  P +L +     Q++ 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPLSTTITNDQITSIQQPENLPIQQEKVQEIM  158

Query  170  PAENDDDL  193
            P    +D+
Sbjct  159  PPCTVNDV  166



>ref|XP_009589696.1| PREDICTED: protein ODORANT1 [Nicotiana tomentosiformis]
Length=302

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ----KDDDEEMLPPSSLSLHSGDDQKLK  169
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL      D    +  P +L +     Q++ 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPLSTTITNDQITSIQQPENLPIQQEKVQEIM  158

Query  170  PAENDDDL  193
            P    +D+
Sbjct  159  PPCTVNDV  166



>ref|XP_009603939.1| PREDICTED: myb-related protein 308-like [Nicotiana tomentosiformis]
Length=264

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 4/78 (5%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLK-PAE  178
            RTDNEIKN+WNTHI++KL+  G+DP TH  + +   +++   +S+S  SG+D+K+   AE
Sbjct  99   RTDNEIKNYWNTHIRRKLLSRGIDPTTHRAINESSTQKV---TSISFASGNDEKINIKAE  155

Query  179  NDDDLEEELPKMEEHQQC  232
                 E+E+      ++C
Sbjct  156  FGTIKEDEISSRPVKEEC  173



>ref|XP_010433580.1| PREDICTED: protein ODORANT1 [Camelina sativa]
Length=284

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL+KM +DPLTH+PL K
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMEIDPLTHQPLNK  131



>ref|XP_003572214.1| PREDICTED: protein ODORANT1 [Brachypodium distachyon]
Length=286

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNTHIKKKL K+G+DPLTH+PL   D +  LP       S +       + 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKLGIDPLTHKPLPVPDQK--LPEQEKKTESTETGTDLQRDG  156

Query  182  DDDLEEEL  205
            DD  EEEL
Sbjct  157  DDQEEEEL  164



>emb|CDX85496.1| BnaA02g03170D [Brassica napus]
Length=306

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD  106
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL + D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPMTHKPLSEQD  133



>ref|XP_004965175.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=293

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ  97
            RTDNEIKNHWNTHI+KKL++MG+DP+TH PLQ
Sbjct  99   RTDNEIKNHWNTHIRKKLLRMGIDPVTHLPLQ  130



>gb|ABD60286.2| R2R3-MYB transcription factor MYB11 [Picea glauca]
Length=256

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEP----LQKDDDEEMLPPSSLS  139
            RTDNEIKN+WNTH+KK+L++MG+DP+TH P        +  ++L P+SLS
Sbjct  77   RTDNEIKNYWNTHLKKRLLQMGIDPVTHRPRIDLFNFSNMTQLLAPASLS  126



>ref|XP_010537410.1| PREDICTED: transcription factor MYB51 [Tarenaya hassleriana]
Length=370

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEE  115
            RTDNEIKNHWNTHIKK+LIK G+DP TH+P+    D E
Sbjct  99   RTDNEIKNHWNTHIKKRLIKKGIDPATHKPISGKSDSE  136



>ref|XP_008381375.1| PREDICTED: protein ODORANT1-like [Malus domestica]
Length=273

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+   +D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPIVNVND  134



>gb|AIT13038.1| myb-related transcription factor [Vitis amurensis]
Length=300

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPL  129



>ref|XP_008803475.1| PREDICTED: protein ODORANT1-like [Phoenix dactylifera]
Length=294

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDD  109
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+P+    D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPLTHKPIPSTVD  134



>ref|XP_010916181.1| PREDICTED: protein ODORANT1-like [Elaeis guineensis]
Length=293

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD  106
            RTDNEIKNHWNTHIKKKL KMG+DP+TH P+   D
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPITHRPISSTD  133



>tpg|DAA61360.1| TPA: LOW QUALITY PROTEIN: putative MYB DNA-binding domain superfamily 
protein, partial [Zea mays]
Length=211

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ  97
            RTDNEIKNHWNTHIKKKL KMG+DP TH+PL 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPATHKPLH  130



>gb|AAL84615.1|AF474118_1 typical P-type R2R3 Myb protein [Zea mays]
Length=212

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQ  97
            RTDNEIKNHWNTHIKKKL KMG+DP TH+PL 
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPATHKPLH  130



>gb|AFX96281.1| R2R3 DNA binding transcription factor MYB28-1 [Brassica juncea]
 gb|AFX96285.1| R2R3 DNA binding transcription factor MYB28-1 [Brassica juncea]
 gb|AFY09822.1| R2R3 DNA binding transcription factor MYB28-1 [Brassica nigra]
Length=350

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGD  154
            RTDNEIKN+WNTH+KK+LI+ G+DP+TH+PL  + +     P   +LHS D
Sbjct  99   RTDNEIKNYWNTHLKKRLIERGIDPVTHKPLASNTNPTATTPQPENLHSLD  149



>ref|XP_004289590.1| PREDICTED: protein ODORANT1-like [Fragaria vesca subsp. vesca]
Length=284

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLP  124
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL   ++ +  P
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPLSNGNEVDNQP  139



>gb|AFK47512.1| unknown [Lotus japonicus]
Length=324

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPP  127
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL    ++  + P
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHKPLPNVTEQTQIQP  140



>ref|XP_002460189.1| hypothetical protein SORBIDRAFT_02g024250 [Sorghum bicolor]
 gb|EER96710.1| hypothetical protein SORBIDRAFT_02g024250 [Sorghum bicolor]
Length=287

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL +
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPLHQ  131



>gb|AGN52100.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52210.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=230

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 8/73 (11%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHS-----GDDQKL  166
            RTDNEIKN+WNTHI++KL+  G+DP TH P+   ++ E  P +++S +S     G++++ 
Sbjct  99   RTDNEIKNYWNTHIRRKLVSRGIDPTTHRPI---NEAEAQPATTISFNSSNKLLGEEERC  155

Query  167  KPAENDDDLEEEL  205
             P   D +L+  +
Sbjct  156  SPKCPDLNLDLRI  168



>gb|AGN52052.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52162.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=219

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKN+WNTHIK+KL++ G+DP TH  +        LPP   +  S D+     AE 
Sbjct  99   RTDNEIKNYWNTHIKRKLLRRGMDPQTHRQINNRSPTPPLPPEQNNSSSADNSTTTTAEE  158

Query  182  DDDLEEEL  205
            D  L+ +L
Sbjct  159  DGGLDLDL  166



>ref|XP_004231815.2| PREDICTED: myb-related protein 315-like [Solanum lycopersicum]
Length=450

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKNHWNT IKK+L  MG+DPLTH+P+ K+ + + L P + + +   ++     EN
Sbjct  99   RTDNEIKNHWNTRIKKRLQVMGIDPLTHQPIDKEHETDELLPITETYYDKRNETENNIEN  158

Query  182  DDDL  193
             +D+
Sbjct  159  ANDI  162



>ref|XP_010660298.1| PREDICTED: protein ODORANT1 [Vitis vinifera]
Length=289

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPL  129



>emb|CBI33476.3| unnamed protein product [Vitis vinifera]
Length=274

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DPLTH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPLTHKPL  129



>ref|XP_010525098.1| PREDICTED: myb-related protein 306 isoform X2 [Tarenaya hassleriana]
Length=363

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 61/103 (59%), Gaps = 13/103 (13%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSG--------DD  157
            RTDNEIKN+WNTH+KK+L+KMG+DP+TH+P     +E +L     S ++         + 
Sbjct  99   RTDNEIKNYWNTHLKKRLVKMGIDPVTHKP----KNETLLSSGGQSKNAATLSHMAQWES  154

Query  158  QKLKPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADY  286
             +L+ AE     E +L  ++ +Q+  +K A +AA P    +++
Sbjct  155  ARLE-AEARLARESKLLHLQHYQKSLNKTAHYAAFPHKSSSNW  196



>ref|XP_010525095.1| PREDICTED: transcription factor MYB122 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525096.1| PREDICTED: transcription factor MYB122 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525097.1| PREDICTED: transcription factor MYB122 isoform X1 [Tarenaya hassleriana]
Length=369

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 61/103 (59%), Gaps = 13/103 (13%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSG--------DD  157
            RTDNEIKN+WNTH+KK+L+KMG+DP+TH+P     +E +L     S ++         + 
Sbjct  105  RTDNEIKNYWNTHLKKRLVKMGIDPVTHKP----KNETLLSSGGQSKNAATLSHMAQWES  160

Query  158  QKLKPAENDDDLEEELPKMEEHQQCSSKEAMFAAGPQVEEADY  286
             +L+ AE     E +L  ++ +Q+  +K A +AA P    +++
Sbjct  161  ARLE-AEARLARESKLLHLQHYQKSLNKTAHYAAFPHKSSSNW  202



>ref|XP_007046023.1| Myb domain protein 16, putative [Theobroma cacao]
 gb|EOY01855.1| Myb domain protein 16, putative [Theobroma cacao]
Length=385

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEP  91
            RTDNEIKNHWNTH+KK+LIKMG+DP+TH+P
Sbjct  99   RTDNEIKNHWNTHLKKRLIKMGIDPMTHKP  128



>ref|XP_008652684.1| PREDICTED: protein ODORANT1-like [Zea mays]
 tpg|DAA61358.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04682.1| MYB transcription factor, partial [Zea mays]
Length=277

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL +
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHKPLHQ  131



>ref|XP_004953828.1| PREDICTED: protein ODORANT1-like [Setaria italica]
Length=258

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL +MG+DP+TH PL
Sbjct  99   RTDNEIKNHWNTHIKKKLKRMGIDPVTHRPL  129



>ref|XP_004147038.1| PREDICTED: myb-related protein 308-like [Cucumis sativus]
 ref|XP_004172908.1| PREDICTED: LOW QUALITY PROTEIN: myb-related protein 308-like 
[Cucumis sativus]
Length=256

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEMLPPSSLSLHSGDDQKLKPAEN  181
            RTDNEIKN+WNTHI++KL+  G+DP+TH P+  +  +E +  +++S  +  D K+K  E+
Sbjct  99   RTDNEIKNYWNTHIRRKLLNRGIDPVTHRPIN-ETSQEQVASTTISF-TATDVKVKVEED  156

Query  182  DDDLEEELPKMEE  220
               + EE   +E 
Sbjct  157  KSMVVEEFQDLER  169



>gb|AAL90658.1|AF470090_1 P-type R2R3 Myb protein [Zea mays]
Length=160

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDD  106
            RTDNEIKN+WNTHI+KKL++MGVDP+TH+ L  DD
Sbjct  102  RTDNEIKNYWNTHIRKKLLRMGVDPVTHQRLPPDD  136



>gb|AFW63820.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04532.1| MYB transcription factor, partial [Zea mays]
Length=278

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DP+TH PL
Sbjct  99   RTDNEIKNHWNTHIKKKLKKMGIDPVTHGPL  129



>ref|XP_009110339.1| PREDICTED: transcription factor MYB51-like [Brassica rapa]
 gb|ACR48188.1| MYB domain protein 51-2 [Brassica rapa subsp. pekinensis]
 emb|CDX96715.1| BnaA08g22580D [Brassica napus]
Length=333

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQKDDDEEM  118
            RTDNEIKNHWNTHIKK+LIK GVDP+TH+ L  D  E +
Sbjct  100  RTDNEIKNHWNTHIKKRLIKKGVDPVTHKSLISDKSENL  138



>ref|NP_001063118.1| Os09g0401000 [Oryza sativa Japonica Group]
 emb|CAA72186.1| myb factor [Oryza sativa Japonica Group]
 dbj|BAD28515.1| putative Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAD28616.1| putative Myb51 protein [Oryza sativa Japonica Group]
 dbj|BAF25032.1| Os09g0401000 [Oryza sativa Japonica Group]
 gb|EAZ44664.1| hypothetical protein OsJ_29287 [Oryza sativa Japonica Group]
Length=279

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPL  129



>ref|XP_006396775.1| hypothetical protein EUTSA_v10028864mg [Eutrema salsugineum]
 gb|ESQ38228.1| hypothetical protein EUTSA_v10028864mg [Eutrema salsugineum]
Length=285

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPLQK  100
            RTDNEIKNHWNTHIKKKL+KM +DP+TH+PL K
Sbjct  99   RTDNEIKNHWNTHIKKKLLKMEIDPMTHQPLNK  131



>gb|EAZ09037.1| hypothetical protein OsI_31298 [Oryza sativa Indica Group]
Length=279

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    RTDNEIKNHWNTHIKKKLIKMGVDPLTHEPL  94
            RTDNEIKNHWNTHIKKKL KMG+DP+TH+PL
Sbjct  99   RTDNEIKNHWNTHIKKKLRKMGIDPVTHKPL  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1475250502080