BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6497_g1_i2 len=544 path=[1:0-329 331:330-543]

Length=544
                                                                      Score     E

ref|XP_008367255.1|  PREDICTED: probable pectate lyase 1                136   9e-35   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          136   1e-34   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                136   2e-34   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                134   1e-33   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                133   2e-33   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                133   2e-33   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                132   4e-33   
emb|CDO99404.1|  unnamed protein product                                132   8e-33   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                131   1e-32   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                130   3e-32   
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                128   1e-31   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                126   5e-31   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     126   8e-31   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     125   9e-31   
dbj|BAF43573.1|  pectate lyase                                          123   7e-30   Prunus persica
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             123   7e-30   
ref|XP_002518146.1|  Pectate lyase precursor, putative                  122   1e-29   Ricinus communis
ref|XP_008358000.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    123   6e-29   
ref|XP_010106682.1|  hypothetical protein L484_004616                   120   8e-29   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                120   9e-29   
ref|XP_006420566.1|  hypothetical protein CICLE_v10004783mg             120   1e-28   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           120   1e-28   
gb|KDO55843.1|  hypothetical protein CISIN_1g010437mg                   119   1e-28   
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             119   2e-28   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                118   4e-28   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                118   6e-28   
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                118   6e-28   
gb|ACB12931.1|  pectate lyase 1-27                                      117   8e-28   Populus tremula x Populus tremuloides
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          117   9e-28   
ref|XP_002297822.1|  pectate lyase family protein                       117   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    116   2e-27   
gb|AFZ78654.1|  pectate lyase                                           116   2e-27   
ref|XP_002304700.1|  pectate lyase family protein                       116   3e-27   Populus trichocarpa [western balsam poplar]
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                115   4e-27   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          115   4e-27   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                115   7e-27   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           114   8e-27   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         114   9e-27   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           114   1e-26   
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                114   1e-26   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          114   1e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02420.2|  OSJNBa0095E20.8                                        114   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                114   1e-26   
gb|EEC76710.1|  hypothetical protein OsI_14719                          114   2e-26   Oryza sativa Indica Group [Indian rice]
emb|CAN78491.1|  hypothetical protein VITISV_004934                     114   2e-26   Vitis vinifera
emb|CBI33346.3|  unnamed protein product                                113   2e-26   
ref|NP_001052103.1|  Os04g0137100                                       114   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                114   2e-26   Vitis vinifera
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                113   2e-26   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     113   3e-26   
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                113   3e-26   
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                113   4e-26   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     113   4e-26   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                112   5e-26   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                112   5e-26   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          112   7e-26   
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                111   1e-25   
emb|CDP03845.1|  unnamed protein product                                111   1e-25   
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          111   1e-25   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          111   1e-25   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          111   1e-25   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     111   1e-25   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                110   2e-25   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     110   2e-25   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             110   2e-25   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                110   2e-25   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             110   2e-25   
ref|XP_006350301.1|  PREDICTED: probable pectate lyase 20-like          110   3e-25   
emb|CAN75298.1|  hypothetical protein VITISV_008675                     110   3e-25   Vitis vinifera
ref|XP_002265100.1|  PREDICTED: probable pectate lyase 8                110   3e-25   Vitis vinifera
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               110   4e-25   
gb|EMT28700.1|  hypothetical protein F775_17439                         109   4e-25   
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                110   4e-25   
dbj|BAK06362.1|  predicted protein                                      110   4e-25   
gb|EPS68938.1|  hypothetical protein M569_05827                         109   4e-25   
ref|XP_008382653.1|  PREDICTED: probable pectate lyase 10               109   5e-25   
ref|XP_004247105.1|  PREDICTED: probable pectate lyase 8                109   5e-25   
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                109   5e-25   
ref|XP_003638494.1|  Pectate lyase                                      106   6e-25   
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     109   6e-25   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     108   9e-25   
gb|AAX88800.1|  ripening-related pectate lyase                          108   1e-24   Mangifera indica
ref|XP_007140561.1|  hypothetical protein PHAVU_008G123000g             108   1e-24   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                108   1e-24   
gb|ACJ83349.1|  unknown                                                 105   1e-24   Medicago truncatula
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     108   1e-24   
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              108   1e-24   
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg                108   2e-24   
ref|XP_008789532.1|  PREDICTED: probable pectate lyase 8                107   2e-24   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                107   2e-24   
ref|XP_010522431.1|  PREDICTED: probable pectate lyase 1                107   2e-24   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                108   2e-24   
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                107   2e-24   
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                107   2e-24   
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             107   2e-24   Populus trichocarpa [western balsam poplar]
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    107   3e-24   
gb|KHG06252.1|  hypothetical protein F383_10745                         107   4e-24   
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                107   4e-24   
gb|KHG30349.1|  hypothetical protein F383_15991                         107   4e-24   
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg             108   4e-24   
ref|XP_002446075.1|  hypothetical protein SORBIDRAFT_06g001410          106   5e-24   Sorghum bicolor [broomcorn]
gb|KEH41255.1|  pectate lyase family protein                            106   6e-24   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                106   6e-24   
gb|AAL06861.1|  At1g04680/T1G11_6                                       106   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563715.1|  putative pectate lyase 1                              106   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118623.1|  PREDICTED: probable pectate lyase 1 isoform X2     106   9e-24   
ref|XP_009118622.1|  PREDICTED: probable pectate lyase 1 isoform X1     106   1e-23   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                105   1e-23   
emb|CDY47327.1|  BnaCnng14640D                                          105   1e-23   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     105   1e-23   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         105   1e-23   
gb|AAF19196.1|AF206320_1  pectate lyase 2                               105   1e-23   Musa acuminata [banana]
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              105   1e-23   
ref|XP_011009338.1|  PREDICTED: probable pectate lyase 8                105   1e-23   
ref|XP_008447332.1|  PREDICTED: probable pectate lyase 8                105   1e-23   
gb|KHG26906.1|  hypothetical protein F383_09796                         105   1e-23   
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                105   1e-23   
emb|CAC80136.1|  pectate lyase II enzyme                                105   2e-23   Musa acuminata [banana]
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     105   2e-23   
ref|XP_004152014.1|  PREDICTED: probable pectate lyase 8-like           105   2e-23   
ref|XP_002521130.1|  Pectate lyase precursor, putative                  104   3e-23   Ricinus communis
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                104   3e-23   
ref|XP_004163042.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    104   4e-23   
ref|XP_003530885.1|  PREDICTED: probable pectate lyase 20-like          104   4e-23   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               104   4e-23   
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                103   5e-23   
gb|ABR26682.1|  pectate lyase                                           103   5e-23   Fragaria chiloensis
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               104   5e-23   
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 8-like           104   5e-23   
gb|AAZ31564.1|  pectate lyase isoform 2                                 103   6e-23   Fragaria x ananassa
gb|AAK66160.1|  pectate lyase B                                         103   6e-23   Fragaria x ananassa
gb|AAZ31566.1|  pectate lyase isoform 4                                 103   6e-23   Fragaria x ananassa
gb|AAZ31563.1|  pectate lyase isoform 1                                 103   6e-23   Fragaria x ananassa
ref|XP_008359470.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    103   6e-23   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              104   7e-23   
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                103   7e-23   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               103   7e-23   
ref|NP_001147553.1|  pectate lyase 8                                    103   7e-23   Zea mays [maize]
emb|CDY18738.1|  BnaC08g08780D                                          103   8e-23   
emb|CDX86615.1|  BnaC08g00880D                                          103   1e-22   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   103   1e-22   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           103   1e-22   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                103   1e-22   
ref|XP_003552152.2|  PREDICTED: probable pectate lyase 20-like          103   1e-22   
ref|XP_009102476.1|  PREDICTED: probable pectate lyase 10               103   1e-22   
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          102   2e-22   
ref|XP_002863927.1|  pectate lyase family protein                       102   2e-22   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                102   2e-22   
emb|CDY05305.1|  BnaC05g44980D                                          102   2e-22   
emb|CDX77400.1|  BnaA07g05380D                                          103   2e-22   
gb|ADP09680.1|  pectate lyase                                           102   2e-22   
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               102   2e-22   
emb|CDY46471.1|  BnaC07g03950D                                          102   2e-22   
emb|CDY01119.1|  BnaA04g07000D                                          102   2e-22   
ref|XP_010488576.1|  PREDICTED: probable pectate lyase 10               102   3e-22   
emb|CDY61137.1|  BnaC05g48970D                                          102   3e-22   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     102   3e-22   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     102   3e-22   
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             102   3e-22   
emb|CDY24654.1|  BnaA05g30530D                                          101   3e-22   
ref|XP_010513666.1|  PREDICTED: probable pectate lyase 10               102   3e-22   
ref|XP_010466894.1|  PREDICTED: probable pectate lyase 10               102   3e-22   
ref|XP_009119265.1|  PREDICTED: probable pectate lyase 1                102   3e-22   
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                102   3e-22   
ref|XP_002892236.1|  pectate lyase family protein                       101   3e-22   
ref|XP_003622996.1|  Pectate lyase 1-27                                 102   4e-22   
ref|XP_009147117.1|  PREDICTED: probable pectate lyase 8                101   4e-22   
gb|KFK39788.1|  hypothetical protein AALP_AA3G287800                    101   4e-22   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                101   5e-22   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                101   5e-22   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                101   5e-22   
gb|AAB71208.1|  pectate lyase                                           100   6e-22   Fragaria x ananassa
ref|XP_002885665.1|  pectate lyase family protein                       101   6e-22   
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                    100   6e-22   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    101   7e-22   
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    100   8e-22   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    101   8e-22   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    100   9e-22   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    100   9e-22   
ref|NP_189110.1|  probable pectate lyase 10                             100   9e-22   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01216.1|  pectate lyase                                          100   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193057.4|  putative pectate lyase 14                             100   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             100   9e-22   
ref|XP_002862216.1|  hypothetical protein ARALYDRAFT_359757           97.8    1e-21   
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     100   1e-21   
emb|CAB41931.1|  pectate lyase like protein                             100   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297684.1|  hypothetical protein CARUB_v10013715mg             100   1e-21   
ref|XP_004515610.1|  PREDICTED: probable pectate lyase 8-like           100   1e-21   
ref|XP_002884619.1|  pectate lyase family protein                       100   1e-21   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               100   1e-21   Zea mays [maize]
ref|NP_187357.1|  putative pectate lyase 8                            99.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     100   1e-21   
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8              99.8    2e-21   
gb|AAM61584.1|  putative pectate lyase                                99.8    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               100   2e-21   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               100   2e-21   
emb|CDY01151.1|  BnaA04g06680D                                          100   2e-21   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               100   2e-21   
ref|XP_010435301.1|  PREDICTED: putative pectate lyase 14 isoform X1  99.8    2e-21   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...  99.8    2e-21   
ref|XP_010440665.1|  PREDICTED: putative pectate lyase 14             99.8    2e-21   
ref|XP_010435302.1|  PREDICTED: putative pectate lyase 14 isoform X2  99.4    2e-21   
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2   99.4    2e-21   
ref|XP_010450305.1|  PREDICTED: putative pectate lyase 14             99.4    2e-21   
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8              99.4    3e-21   
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1   99.4    3e-21   
emb|CDX88845.1|  BnaA03g08040D                                          100   4e-21   
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...  99.4    4e-21   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like        98.6    4e-21   
gb|ABR17766.1|  unknown                                               98.6    4e-21   Picea sitchensis
gb|ACK38190.1|  unknown                                               98.2    4e-21   Medicago truncatula
emb|CDX89799.1|  BnaA10g02830D                                        98.6    4e-21   
ref|NP_001190715.1|  putative pectate lyase 14                        99.0    4e-21   
emb|CDY53564.1|  BnaC04g55760D                                        99.0    5e-21   
ref|XP_003618787.1|  Pectate lyase                                    98.2    5e-21   
gb|ABR17909.1|  unknown                                               98.6    6e-21   Picea sitchensis
gb|AAK66161.1|  pectate lyase                                         97.8    6e-21   Fragaria x ananassa
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...  99.0    7e-21   
gb|EPS63108.1|  hypothetical protein M569_11679                       97.4    7e-21   
gb|AGC94753.1|  putative pectate lyase                                97.8    7e-21   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2   97.8    8e-21   
ref|XP_010558823.1|  PREDICTED: probable pectate lyase 8              97.8    8e-21   
ref|XP_010695977.1|  PREDICTED: probable pectate lyase 18             97.4    9e-21   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1   97.8    1e-20   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20             97.4    1e-20   
emb|CDY19932.1|  BnaA09g03190D                                        97.4    1e-20   
emb|CDY56668.1|  BnaCnng30870D                                        97.1    2e-20   
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8              97.4    2e-20   
ref|NP_568705.1|  putative pectate lyase 20                           96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63307.1|  pectate lyase                                         96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863264.1|  pectate lyase family protein                     96.7    2e-20   
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8              97.1    2e-20   
ref|XP_010109687.1|  hypothetical protein L484_015172                 96.7    2e-20   
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20             96.3    3e-20   
dbj|BAB10313.1|  pectate lyase                                        96.3    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567409.1|  probable pectate lyase 15                           97.1    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190720.1|  probable pectate lyase 15                        96.7    3e-20   
gb|ABR17791.1|  unknown                                               95.9    4e-20   Picea sitchensis
emb|CDY66697.1|  BnaAnng22760D                                        96.3    4e-20   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9              95.9    5e-20   
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like        95.9    6e-20   
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20             95.5    6e-20   
ref|XP_004502359.1|  PREDICTED: probable pectate lyase 22-like        95.1    8e-20   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like        95.1    8e-20   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22             95.1    8e-20   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  95.1    9e-20   
ref|XP_007044917.1|  Pectate lyase family protein                     94.7    9e-20   
gb|KDO69410.1|  hypothetical protein CISIN_1g015569mg                 94.0    1e-19   
ref|XP_002870357.1|  pectate lyase family protein                     95.5    1e-19   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3   94.0    1e-19   
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                 93.6    1e-19   
ref|XP_009129753.1|  PREDICTED: probable pectate lyase 20             94.4    2e-19   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg           94.7    2e-19   
emb|CDY33938.1|  BnaA02g30490D                                        94.0    2e-19   
ref|XP_002511275.1|  Pectate lyase precursor, putative                93.2    2e-19   Ricinus communis
emb|CDP15081.1|  unnamed protein product                              93.6    2e-19   
ref|XP_010102919.1|  hypothetical protein L484_018936                 93.6    2e-19   
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg           93.6    3e-19   
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like         93.2    3e-19   
gb|KDO69408.1|  hypothetical protein CISIN_1g015569mg                 93.2    3e-19   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5              93.2    4e-19   
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                 93.2    4e-19   
gb|KFK39766.1|  hypothetical protein AALP_AA3G285000                  93.2    4e-19   
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg           93.2    4e-19   
ref|XP_003524720.1|  PREDICTED: pectate lyase-like                    92.8    4e-19   
gb|KDP26717.1|  hypothetical protein JCGZ_17875                       93.2    4e-19   
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5              92.8    4e-19   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1   92.4    7e-19   
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor   92.0    8e-19   
gb|AAN60248.1|  unknown                                               90.1    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010949.1|  PREDICTED: pectate lyase-like                    92.0    9e-19   
ref|XP_002321242.2|  pectate lyase family protein                     91.7    9e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18             92.0    9e-19   
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5              92.0    1e-18   
gb|KEH35002.1|  pectate lyase family protein                          90.9    1e-18   
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                   92.8    1e-18   
ref|XP_010682362.1|  PREDICTED: probable pectate lyase 5              91.7    1e-18   
ref|XP_010111662.1|  hypothetical protein L484_017690                 91.7    1e-18   
gb|KHN34377.1|  Putative pectate lyase 22                             91.7    1e-18   
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22             91.7    1e-18   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g           91.7    1e-18   
ref|XP_002300069.1|  pectate lyase family protein                     91.7    1e-18   
ref|XP_002866540.1|  pectate lyase                                    91.7    1e-18   
ref|XP_010488478.1|  PREDICTED: probable pectate lyase 9              92.0    1e-18   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18             91.7    2e-18   
emb|CDY05655.1|  BnaC02g38820D                                        91.7    2e-18   
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                 91.3    2e-18   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18             91.3    2e-18   
dbj|BAI94495.1|  pectate lyase                                        91.3    2e-18   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein        91.3    2e-18   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5              90.9    2e-18   
gb|AES72123.2|  pectate lyase family protein                          91.3    2e-18   
ref|XP_007037817.1|  Pectate lyase family protein isoform 3           90.1    2e-18   
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg           90.9    2e-18   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18             90.9    2e-18   
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg           90.9    2e-18   
gb|AFD54065.1|  nodulation pectate lyase mutant                       90.1    2e-18   
ref|XP_002515037.1|  Pectate lyase precursor, putative                90.9    3e-18   
emb|CDX77470.1|  BnaA07g06080D                                        91.3    3e-18   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5              90.5    3e-18   
dbj|BAF43572.1|  pectate lyase                                        90.5    3e-18   
gb|AAF19195.1|AF206319_1  pectate lyase 1                             90.5    3e-18   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                  90.5    3e-18   
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22             90.5    3e-18   
ref|XP_003638513.1|  Pectate lyase                                    90.5    4e-18   
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5              90.1    4e-18   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein        90.1    4e-18   
gb|AEX93472.1|  nodulation pectate lyase                              90.1    4e-18   
gb|AFD54064.1|  nodulation pectate lyase mutant                       90.1    4e-18   
ref|XP_007151585.1|  hypothetical protein PHAVU_004G059200g           90.1    4e-18   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5              90.1    4e-18   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18             90.1    5e-18   
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                  90.1    5e-18   
ref|XP_007031685.1|  Pectin lyase-like superfamily protein            89.7    6e-18   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1  89.7    6e-18   
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22             89.7    7e-18   
gb|EPS58564.1|  hypothetical protein M569_16249                       89.0    7e-18   
ref|XP_010528200.1|  PREDICTED: putative pectate lyase 11             89.7    7e-18   
dbj|BAB10560.1|  pectate lyase                                        89.7    7e-18   
gb|ABR18471.1|  unknown                                               90.5    7e-18   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18             89.4    8e-18   
ref|NP_568967.1|  putative pectate lyase 22                           89.7    8e-18   
gb|KHG22990.1|  hypothetical protein F383_28754                       89.4    8e-18   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2   89.7    8e-18   
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg           89.7    8e-18   
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5              89.4    9e-18   
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg           89.4    9e-18   
ref|NP_001289258.1|  probable pectate lyase 18 precursor              89.4    9e-18   
ref|NP_001280201.1|  probable pectate lyase 18 precursor              89.4    9e-18   
gb|ABO28477.1|  pectate lyase precursor                               88.2    1e-17   
ref|NP_001280839.1|  probable pectate lyase 18 precursor              89.4    1e-17   
ref|XP_007215475.1|  hypothetical protein PRUPE_ppa006569mg           89.0    1e-17   
emb|CAA63496.1|  pectate lyase                                        88.6    1e-17   
ref|XP_008230481.1|  PREDICTED: pectate lyase-like                    88.6    2e-17   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like        88.6    2e-17   
gb|KHG22755.1|  hypothetical protein F383_29653                       88.6    2e-17   
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5              88.6    2e-17   
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5              88.2    2e-17   
emb|CBI17713.3|  unnamed protein product                              87.8    2e-17   
ref|XP_006604001.1|  PREDICTED: pectate lyase-like                    88.2    2e-17   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5              87.8    3e-17   
ref|XP_007163700.1|  hypothetical protein PHAVU_001G256800g           87.8    3e-17   
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18             87.8    3e-17   
emb|CDY24847.1|  BnaA08g14630D                                        87.8    3e-17   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                87.4    3e-17   
ref|XP_009631254.1|  PREDICTED: probable pectate lyase 18             87.8    3e-17   
emb|CDP16631.1|  unnamed protein product                              87.8    3e-17   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like         87.8    3e-17   
gb|AEN70965.1|  pectate lyase                                         87.8    3e-17   
emb|CDY08948.1|  BnaC08g11780D                                        87.4    4e-17   
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg           87.8    4e-17   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18             87.4    4e-17   
ref|XP_009340844.1|  PREDICTED: pectate lyase-like                    87.4    5e-17   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like         87.0    5e-17   
ref|NP_001268051.1|  pectate lyase precursor                          87.0    5e-17   
emb|CDY41506.1|  BnaA06g22590D                                        87.4    5e-17   
gb|KHN14071.1|  Putative pectate lyase 18                             84.0    5e-17   
gb|AFK44189.1|  unknown                                               87.0    6e-17   
ref|XP_003608909.1|  Pectate lyase                                    87.0    6e-17   
gb|AAM12784.1|  putative pectate-lyase                                85.9    7e-17   
ref|XP_010100325.1|  hypothetical protein L484_027633                 86.7    7e-17   
ref|XP_010536660.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  86.7    8e-17   
gb|AEN70985.1|  pectate lyase                                         86.7    8e-17   
ref|XP_009788173.1|  PREDICTED: probable pectate lyase 18             86.7    8e-17   
ref|XP_010448519.1|  PREDICTED: probable pectate lyase 18             86.7    9e-17   
ref|XP_002885608.1|  pectate lyase family protein                     87.0    9e-17   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22             86.7    9e-17   
gb|ABK25017.1|  unknown                                               87.0    9e-17   
ref|NP_189065.2|  putative pectate lyase 9                            87.0    9e-17   
gb|KDO82122.1|  hypothetical protein CISIN_1g015702mg                 85.1    9e-17   
ref|XP_010433725.1|  PREDICTED: probable pectate lyase 18             86.7    9e-17   
emb|CAA22985.1|  putative pectate lyase                               86.3    9e-17   
ref|NP_567707.1|  putative pectate lyase 18                           86.7    9e-17   
ref|XP_008796023.1|  PREDICTED: probable pectate lyase 5              86.7    9e-17   
ref|XP_002867644.1|  pectate lyase family protein                     86.3    1e-16   
gb|AAK25850.1|AF360140_1  putative pectate lyase                      86.3    1e-16   
ref|XP_002311747.2|  pectate lyase 5 precursor family protein         86.3    1e-16   
gb|AAM65103.1|  putative pectate lyase                                86.3    1e-16   
emb|CDY65626.1|  BnaC03g74840D                                        87.0    1e-16   
gb|KDO82121.1|  hypothetical protein CISIN_1g015702mg                 85.5    1e-16   
gb|KDP46367.1|  hypothetical protein JCGZ_10207                       86.3    1e-16   
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5              86.3    1e-16   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like        86.3    1e-16   
emb|CDX92652.1|  BnaC07g39100D                                        86.3    1e-16   
dbj|BAB59066.1|  pectate lyase                                        86.3    1e-16   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18             85.9    1e-16   
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640        86.3    1e-16   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5              85.9    2e-16   
gb|KHN05801.1|  Putative pectate lyase 22                             85.9    2e-16   
ref|XP_006351443.1|  PREDICTED: probable pectate lyase 18-like        85.9    2e-16   
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg           85.9    2e-16   
gb|AEN70981.1|  pectate lyase                                         85.9    2e-16   
gb|AEN70968.1|  pectate lyase                                         85.9    2e-16   
gb|AEN70977.1|  pectate lyase                                         85.5    2e-16   
gb|ADB90479.1|  pectate lyase                                         85.5    2e-16   
gb|ADB90478.1|  pectate lyase                                         85.5    2e-16   
gb|ADB90476.1|  pectate lyase                                         85.5    2e-16   
gb|ADB90475.1|  pectate lyase                                         85.5    2e-16   
emb|CDY34310.1|  BnaA01g14130D                                        85.5    2e-16   
gb|ADB90477.1|  pectate lyase                                         85.5    2e-16   
gb|AEN70964.1|  pectate lyase                                         85.5    2e-16   
gb|AEN70963.1|  pectate lyase                                         85.5    2e-16   
gb|KHG19997.1|  hypothetical protein F383_02891                       85.5    2e-16   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1   85.9    2e-16   
ref|XP_002526952.1|  Pectate lyase precursor, putative                85.1    2e-16   
emb|CDY28857.1|  BnaC06g26450D                                        85.5    2e-16   
ref|XP_004304764.1|  PREDICTED: probable pectate lyase 15-like        85.5    2e-16   
sp|O24554.1|PLY_ZINVI  RecName: Full=Pectate lyase; AltName: Full...  85.1    3e-16   
ref|XP_009138507.1|  PREDICTED: probable pectate lyase 18             85.1    3e-16   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                       85.1    3e-16   
emb|CDY11033.1|  BnaA03g46920D                                        85.1    3e-16   
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like         85.1    3e-16   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                    85.1    3e-16   
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                 85.1    3e-16   
ref|XP_009762540.1|  PREDICTED: probable pectate lyase 18             85.1    3e-16   
gb|ABG66729.2|  pectate lyase                                         84.7    4e-16   
emb|CDY03419.1|  BnaC01g16630D                                        84.7    4e-16   
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg           85.5    4e-16   
emb|CDY01846.1|  BnaC06g28860D                                        84.7    4e-16   
gb|ABG66730.2|  pectate lyase                                         84.3    4e-16   
emb|CDY48132.1|  BnaCnng15740D                                        85.1    4e-16   
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22             85.1    4e-16   
emb|CDY16732.1|  BnaA09g06500D                                        85.1    4e-16   
ref|XP_003526981.1|  PREDICTED: probable pectate lyase 18-like        84.7    5e-16   
gb|AEN70984.1|  pectate lyase                                         84.3    5e-16   
gb|AAY85180.1|  pectate lyase                                         84.3    5e-16   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8              84.7    6e-16   
gb|KHN07962.1|  Putative pectate lyase 22                             84.3    7e-16   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22             84.0    7e-16   
ref|XP_009111570.1|  PREDICTED: putative pectate lyase 11             84.0    7e-16   
ref|XP_004502358.1|  PREDICTED: probable pectate lyase 5-like         84.0    7e-16   
ref|XP_006591479.1|  PREDICTED: probable pectate lyase 5-like         84.0    8e-16   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18             84.0    9e-16   
emb|CDY20049.1|  BnaA09g02020D                                        84.0    9e-16   
emb|CDY00156.1|  BnaC09g01450D                                        84.0    9e-16   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5              83.6    1e-15   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5              83.2    1e-15   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                  83.6    1e-15   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                  82.8    1e-15   
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                    83.2    2e-15   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                  82.8    2e-15   
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg           82.4    2e-15   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5              82.8    2e-15   
ref|XP_010502717.1|  PREDICTED: putative pectate lyase 11             82.8    2e-15   
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg           82.8    2e-15   
emb|CDP13269.1|  unnamed protein product                              82.8    2e-15   
emb|CDY56220.1|  BnaAnng14170D                                        82.8    2e-15   
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like         82.8    2e-15   
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11             82.8    2e-15   
emb|CDY03964.1|  BnaC02g36790D                                        82.4    2e-15   
gb|KHF99208.1|  hypothetical protein F383_08934                       82.8    3e-15   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22             82.4    3e-15   
gb|KFK33662.1|  hypothetical protein AALP_AA5G043100                  82.4    3e-15   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18             82.4    3e-15   
ref|XP_002314576.1|  pectate lyase 5 precursor family protein         82.0    3e-15   
ref|NP_564906.1|  putative pectate lyase 5                            82.4    3e-15   
ref|XP_010511733.1|  PREDICTED: probable pectate lyase 5              82.4    3e-15   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5              82.0    3e-15   
gb|AFK37451.1|  unknown                                               79.0    4e-15   
emb|CAN71915.1|  hypothetical protein VITISV_007917                   81.6    4e-15   
ref|XP_002875382.1|  predicted protein                                82.0    4e-15   
gb|ABR18032.1|  unknown                                               80.1    4e-15   
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5              81.6    5e-15   
ref|XP_006830637.1|  hypothetical protein AMTR_s00120p00111300        82.4    5e-15   
gb|AAM67091.1|  putative pectate lyase                                81.6    5e-15   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g           81.6    6e-15   
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg           81.6    6e-15   
emb|CDY34149.1|  BnaA02g28910D                                        80.5    7e-15   
ref|XP_003601871.1|  Pectate lyase                                    81.3    7e-15   
ref|NP_189376.1|  putative pectate lyase 11                           81.3    8e-15   
gb|AIA94884.1|  CAZy families PL1 protein                             77.0    8e-15   
ref|XP_003551943.1|  PREDICTED: probable pectate lyase 5-like         80.9    9e-15   
ref|XP_011042354.1|  PREDICTED: probable pectate lyase 5              80.9    1e-14   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg              80.9    1e-14   
ref|XP_009129418.1|  PREDICTED: putative pectate lyase 11             80.9    1e-14   
ref|XP_002887143.1|  pectate lyase family protein                     80.5    1e-14   
emb|CAN76500.1|  hypothetical protein VITISV_004734                   80.5    1e-14   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5              80.5    1e-14   
emb|CDX83690.1|  BnaC07g24300D                                        80.5    1e-14   
gb|EPS60822.1|  hypothetical protein M569_13978                       79.7    1e-14   
ref|XP_010470701.1|  PREDICTED: probable pectate lyase 5              80.5    2e-14   
ref|XP_010415362.1|  PREDICTED: probable pectate lyase 5              80.1    2e-14   
ref|XP_004304685.1|  PREDICTED: pectate lyase-like                    80.1    2e-14   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg              80.1    2e-14   
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5-like         80.1    2e-14   
ref|XP_010696303.1|  PREDICTED: probable pectate lyase 12             80.5    2e-14   
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1  79.3    4e-14   
ref|XP_010322529.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  79.0    4e-14   
ref|XP_006285259.1|  hypothetical protein CARUB_v10006630mg           78.6    4e-14   
emb|CDY32557.1|  BnaC02g17500D                                        78.6    6e-14   
emb|CDY12666.1|  BnaA02g13340D                                        78.6    6e-14   
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5              78.6    6e-14   
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like        78.6    7e-14   
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like        78.6    7e-14   
dbj|BAA95715.1|  pectate lyase-like protein                           78.2    1e-13   
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3  77.4    1e-13   
ref|XP_009151964.1|  PREDICTED: putative pectate lyase 11 isoform X1  77.8    1e-13   
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg              77.0    2e-13   
ref|XP_010243215.1|  PREDICTED: probable pectate lyase 18             77.8    2e-13   
ref|XP_002534016.1|  Pectate lyase precursor, putative                77.0    3e-13   



>ref|XP_008367255.1| PREDICTED: probable pectate lyase 1 [Malus domestica]
Length=405

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +1

Query  310  FWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWR  489
            F L +++R+AE +E  +K AV+DPEE+ASMV  SIRNSTERRKLGYFSCGTGNPIDDCWR
Sbjct  55   FQLGIFYRVAEDDEGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWR  114

Query  490  CDPNWHNNRQRLADCGIG  543
            CDPNWH NR+RLADCGIG
Sbjct  115  CDPNWHKNRKRLADCGIG  132



>ref|XP_006360328.1| PREDICTED: probable pectate lyase 15-like [Solanum tuberosum]
Length=454

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            ++   L EVEE LSK AVDDPEEV +MVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP
Sbjct  57   TMAVSLEEVEEKLSKHAVDDPEEVVAMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  116

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  117  NWQKNRKRLADCGIG  131



>ref|XP_009593549.1| PREDICTED: probable pectate lyase 8 [Nicotiana tomentosiformis]
Length=447

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD  495
            L++   L E+EE LSK AVDDPE+V SMVAESIRNSTERR+LGYFSCGTGNPIDDCWRCD
Sbjct  49   LTMAASLEEIEEKLSKHAVDDPEQVVSMVAESIRNSTERRRLGYFSCGTGNPIDDCWRCD  108

Query  496  PNWHNNRQRLADCGIG  543
            PNW  NR+RLADCGIG
Sbjct  109  PNWQKNRKRLADCGIG  124



>ref|XP_004247823.1| PREDICTED: probable pectate lyase 8 [Solanum lycopersicum]
Length=451

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            ++   L +VEE LSK AVDDPEEV +MVA+SIRNSTERRKLGYFSCGTGNPIDDCWRCDP
Sbjct  54   TMAVSLEDVEEKLSKHAVDDPEEVVAMVAQSIRNSTERRKLGYFSCGTGNPIDDCWRCDP  113

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  114  NWQKNRKRLADCGIG  128



>ref|XP_008360481.1| PREDICTED: probable pectate lyase 8 [Malus domestica]
Length=446

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD  495
            LS+  R+AE +E  +K AV+DPEE+ASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCD
Sbjct  48   LSMAARVAEDDEGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCD  107

Query  496  PNWHNNRQRLADCGIG  543
            PNWH NR+RLADCGIG
Sbjct  108  PNWHKNRKRLADCGIG  123



>ref|XP_009775177.1| PREDICTED: probable pectate lyase 8 [Nicotiana sylvestris]
Length=452

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            ++   L E+EE LSK AVDDPEEV SMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD 
Sbjct  55   TMAVSLEEIEEKLSKHAVDDPEEVVSMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDR  114

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  115  NWQKNRKRLADCGIG  129



>ref|XP_009362042.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=446

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R+AE EE  +K AV+DPEE+ASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCDP
Sbjct  49   SMEARVAEDEEGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDP  108

Query  499  NWHNNRQRLADCGIG  543
            NWH NR+RLADCGIG
Sbjct  109  NWHKNRKRLADCGIG  123



>emb|CDO99404.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            RL EVE AL++ AVDDPEE+ASMVA SI+NSTERRKLG+FSCGTGNPIDDCWRCDPNW  
Sbjct  59   RLEEVEAALAENAVDDPEEIASMVAMSIKNSTERRKLGFFSCGTGNPIDDCWRCDPNWQK  118

Query  511  NRQRLADCGIG  543
            NR+RLADCGIG
Sbjct  119  NRKRLADCGIG  129



>ref|XP_008391438.1| PREDICTED: probable pectate lyase 8 [Malus domestica]
Length=446

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R+AE +E  +K AV+DPEE+ASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCDP
Sbjct  49   SMAARVAEDDEGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDP  108

Query  499  NWHNNRQRLADCGIG  543
            NWH NR+RLADCGIG
Sbjct  109  NWHKNRKRLADCGIG  123



>ref|XP_009370039.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=446

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R+AE ++  +K AV+DPEE+ASMV  SIRNSTERRKLGYFSCGTGNP+DDCWRCDP
Sbjct  49   SMAARVAEDDQGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPVDDCWRCDP  108

Query  499  NWHNNRQRLADCGIG  543
            NWH NR+RLADCGIG
Sbjct  109  NWHKNRKRLADCGIG  123



>ref|XP_008339288.1| PREDICTED: probable pectate lyase 8 [Malus domestica]
Length=446

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R+AE ++  +K AV+DPEE+ASMV  SIRNSTERRKLGYFSCGTGNP DDCWRCDP
Sbjct  49   SMAARVAEDDQGFNKHAVEDPEEIASMVDMSIRNSTERRKLGYFSCGTGNPXDDCWRCDP  108

Query  499  NWHNNRQRLADCGIG  543
            NWH NR+RLADCGIG
Sbjct  109  NWHKNRKRLADCGIG  123



>ref|XP_008223974.1| PREDICTED: probable pectate lyase 8 [Prunus mume]
Length=445

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R+AE +E+ +K AVDDPEEV +MV  SIRNSTERRKLG+FSCGTGNPIDDCWRCDP
Sbjct  48   SMAARVAEDDESFNKHAVDDPEEVVAMVDMSIRNSTERRKLGFFSCGTGNPIDDCWRCDP  107

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  108  NWQKNRKRLADCGIG  122



>ref|XP_010023767.1| PREDICTED: probable pectate lyase 8 isoform X1 [Eucalyptus grandis]
 gb|KCW60135.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=444

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  EVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQ  519
            EV +  S+ AV+DPEE+ASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWH NR+
Sbjct  54   EVGDHSSRHAVEDPEEIASMVEMSIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHKNRK  113

Query  520  RLADCGIG  543
            RLADCGIG
Sbjct  114  RLADCGIG  121



>ref|XP_010023768.1| PREDICTED: probable pectate lyase 1 isoform X2 [Eucalyptus grandis]
 gb|KCW60136.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=427

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  EVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQ  519
            EV +  S+ AV+DPEE+ASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWH NR+
Sbjct  37   EVGDHSSRHAVEDPEEIASMVEMSIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHKNRK  96

Query  520  RLADCGIG  543
            RLADCGIG
Sbjct  97   RLADCGIG  104



>dbj|BAF43573.1| pectate lyase [Prunus persica]
Length=425

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R+AE +E+ +K AVDDPEEV +MV  SIRNSTERRKLG+FSCGTGNPIDDCWRCD 
Sbjct  28   SMAARVAEDDESFNKHAVDDPEEVVAMVDMSIRNSTERRKLGFFSCGTGNPIDDCWRCDS  87

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  88   NWQKNRKRLADCGIG  102



>ref|XP_007222160.1| hypothetical protein PRUPE_ppa005761mg [Prunus persica]
 gb|ADD62392.1| pectase lyase [Prunus persica]
 gb|EMJ23359.1| hypothetical protein PRUPE_ppa005761mg [Prunus persica]
Length=445

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R+AE +E+ +K AVDDPEEV +MV  SIRNSTERRKLG+FSCGTGNPIDDCWRCD 
Sbjct  48   SMAARVAEDDESFNKHAVDDPEEVVAMVDMSIRNSTERRKLGFFSCGTGNPIDDCWRCDS  107

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  108  NWQKNRKRLADCGIG  122



>ref|XP_002518146.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF44279.1| Pectate lyase precursor, putative [Ricinus communis]
Length=376

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  EVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQ  519
            E+EE  ++ AVDDPEEV +MV  SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNW  NR+
Sbjct  61   EIEEWKNEHAVDDPEEVVAMVEMSIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWQKNRK  120

Query  520  RLADCGIG  543
            RLADCGIG
Sbjct  121  RLADCGIG  128



>ref|XP_008358000.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan glycosyltransferase 
9 [Malus domestica]
Length=818

 Score =   123 bits (309),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  334  LAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            +AE +E  +K AV+D EE+ASMV  SIRNSTE+RKLGYFSCG GNPIDDCWRCDPNWH N
Sbjct  54   VAEDDEGFNKHAVEDLEEIASMVDMSIRNSTEKRKLGYFSCGPGNPIDDCWRCDPNWHKN  113

Query  514  RQRLADCGI  540
             +RLADCGI
Sbjct  114  XKRLADCGI  122



>ref|XP_010106682.1| hypothetical protein L484_004616 [Morus notabilis]
 gb|EXC11270.1| hypothetical protein L484_004616 [Morus notabilis]
Length=397

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            R   ++E L++ AV+DPEEVASMV   I NSTERRKLG+FSC TGNPIDDCWRCDPNWH 
Sbjct  4    RNGNIDEGLNEHAVEDPEEVASMVEMEITNSTERRKLGFFSCATGNPIDDCWRCDPNWHK  63

Query  511  NRQRLADCGIG  543
            NR+RLADCGIG
Sbjct  64   NRKRLADCGIG  74



>ref|XP_011073763.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=444

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  334  LAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            +AE  E L++ AVDDPEEVA MV  + RNSTERRKLG+FSCGTGNPIDDCWRCDPNW  N
Sbjct  52   MAEKLEGLNEHAVDDPEEVARMVEMATRNSTERRKLGFFSCGTGNPIDDCWRCDPNWQRN  111

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  112  RKRLADCGIG  121



>ref|XP_006420566.1| hypothetical protein CICLE_v10004783mg [Citrus clementina]
 gb|ESR33806.1| hypothetical protein CICLE_v10004783mg [Citrus clementina]
Length=488

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            LSK AVD+P+E+ASMV  S RNSTERRKLGYFSCGTGNPIDDCWRCD NWH NR+RLADC
Sbjct  124  LSKHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADC  183

Query  535  GIG  543
            GIG
Sbjct  184  GIG  186



>ref|XP_006487597.1| PREDICTED: probable pectate lyase 1-like [Citrus sinensis]
Length=445

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            LSK AVD+P+E+ASMV  S RNSTERRKLGYFSCGTGNPIDDCWRCD NWH NR+RLADC
Sbjct  59   LSKHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADC  118

Query  535  GIG  543
            GIG
Sbjct  119  GIG  121



>gb|KDO55843.1| hypothetical protein CISIN_1g010437mg [Citrus sinensis]
Length=363

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            LSK AVD+P+E+ASMV  S RNSTERRKLGYFSCGTGNPIDDCWRCD NWH NR+RLADC
Sbjct  124  LSKHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADC  183

Query  535  GIG  543
            GIG
Sbjct  184  GIG  186



>ref|XP_006420567.1| hypothetical protein CICLE_v10004783mg [Citrus clementina]
 gb|ESR33807.1| hypothetical protein CICLE_v10004783mg [Citrus clementina]
 gb|KDO55842.1| hypothetical protein CISIN_1g010437mg [Citrus sinensis]
Length=510

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            LSK AVD+P+E+ASMV  S RNSTERRKLGYFSCGTGNPIDDCWRCD NWH NR+RLADC
Sbjct  124  LSKHAVDNPDEIASMVEMSTRNSTERRKLGYFSCGTGNPIDDCWRCDGNWHKNRKRLADC  183

Query  535  GIG  543
            GIG
Sbjct  184  GIG  186



>ref|XP_011002172.1| PREDICTED: probable pectate lyase 8 [Populus euphratica]
Length=450

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query  331  RLAEVEEALSKQAV-DDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWH  507
            R  E  +AL+++AV ++PEEV SMV  SIRNSTERR+LGYFSCGTGNPIDDCWRCDPNWH
Sbjct  56   RSQEEADALNEKAVAENPEEVVSMVEMSIRNSTERRRLGYFSCGTGNPIDDCWRCDPNWH  115

Query  508  NNRQRLADCGIG  543
             NR+RLADCGIG
Sbjct  116  KNRKRLADCGIG  127



>ref|XP_011091390.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=452

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            EE L++ AVDDPEEVA MV  + RNSTERR LG+FSCGTGNPIDDCWRCD NWH NR+RL
Sbjct  64   EEGLNEHAVDDPEEVARMVEMATRNSTERRNLGFFSCGTGNPIDDCWRCDANWHKNRKRL  123

Query  526  ADCGIG  543
            ADCGIG
Sbjct  124  ADCGIG  129



>ref|XP_010069078.1| PREDICTED: probable pectate lyase 8 [Eucalyptus grandis]
 gb|KCW57295.1| hypothetical protein EUGRSUZ_H00093 [Eucalyptus grandis]
Length=450

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            L+ QAVDDPE+VASMV   IRNSTERR LG+FSCGTGNPIDDCWRCDPNWH NR+RLADC
Sbjct  65   LNDQAVDDPEKVASMVDMIIRNSTERRNLGFFSCGTGNPIDDCWRCDPNWHLNRKRLADC  124

Query  535  GIG  543
            GIG
Sbjct  125  GIG  127



>gb|ACB12931.1| pectate lyase 1-27 [Populus tremula x Populus tremuloides]
Length=452

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  331  RLAEVEEALSKQAVD-DPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWH  507
            R  E  +AL+++AV  DPEEV SMV  +IRNSTERR+LGYFSCGTGNPIDDCWRCDPNWH
Sbjct  58   RSQEEADALNEKAVAADPEEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDDCWRCDPNWH  117

Query  508  NNRQRLADCGIG  543
             NR+RLADCGIG
Sbjct  118  KNRKRLADCGIG  129



>ref|XP_004289729.1| PREDICTED: probable pectate lyase 15-like [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
             L+K AV++P+E+A+MV  SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNW  NR+RLAD
Sbjct  65   GLNKHAVENPDEIAAMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWQKNRKRLAD  124

Query  532  CGIG  543
            CGIG
Sbjct  125  CGIG  128



>ref|XP_002297822.1| pectate lyase family protein [Populus trichocarpa]
 gb|ABK96205.1| unknown [Populus trichocarpa]
 gb|EEE82627.1| pectate lyase family protein [Populus trichocarpa]
Length=450

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +1

Query  331  RLAEVEEALSKQAV-DDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWH  507
            R  E  +AL+++AV D+PEEV SMV  SIRNSTERR+LGYFSCGTGNPIDDCWRCDPNW 
Sbjct  56   RSQEEADALNEKAVADNPEEVVSMVEMSIRNSTERRRLGYFSCGTGNPIDDCWRCDPNWQ  115

Query  508  NNRQRLADCGIG  543
             NR+RLADCGIG
Sbjct  116  KNRKRLADCGIG  127



>ref|XP_006653139.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 8-like 
[Oryza brachyantha]
Length=483

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPEEV S V  SIRNST RRKLGY SCGTGNPIDDCWRCDP+WHNNRQRLADCGIG
Sbjct  83   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHNNRQRLADCGIG  141



>gb|AFZ78654.1| pectate lyase [Populus tomentosa]
Length=452

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  331  RLAEVEEALSKQAVD-DPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWH  507
            R  E  +A +++AV  DPEEV SMV  +IRNSTERR+LGYFSCGTGNPIDDCWRCDPNWH
Sbjct  58   RSQEEADAFNEKAVAADPEEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDDCWRCDPNWH  117

Query  508  NNRQRLADCGIG  543
             NR+RLADCGIG
Sbjct  118  KNRKRLADCGIG  129



>ref|XP_002304700.1| pectate lyase family protein [Populus trichocarpa]
 gb|ABK95980.1| unknown [Populus trichocarpa]
 gb|EEE79679.1| pectate lyase family protein [Populus trichocarpa]
Length=452

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  331  RLAEVEEALSKQAVD-DPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWH  507
            R  E  +A +++AV  DPEEV SMV  +IRNSTERR+LGYFSCGTGNPIDDCWRCDPNWH
Sbjct  58   RSQEEADAFNEKAVAADPEEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDDCWRCDPNWH  117

Query  508  NNRQRLADCGIG  543
             NR+RLADCGIG
Sbjct  118  KNRKRLADCGIG  129



>ref|XP_008438392.1| PREDICTED: probable pectate lyase 8 [Cucumis melo]
Length=447

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            ++  RL E ++  ++ AVD+PEE+A+MV  SIRN+T RR+LG+FSCGTGNPIDDCWRCDP
Sbjct  50   TMAVRLDETKDLGNEHAVDNPEEIAAMVDMSIRNATARRELGFFSCGTGNPIDDCWRCDP  109

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  110  NWQQNRKRLADCGIG  124



>ref|XP_004134015.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 ref|XP_004157662.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN56767.1| hypothetical protein Csa_3G133180 [Cucumis sativus]
Length=447

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            ++  RL E ++  ++ AVD+PEE+A+MV  SIRN+T RR+LG+FSCGTGNPIDDCWRCDP
Sbjct  50   TMAVRLDEAKDLGNEHAVDNPEEIAAMVDMSIRNATARRELGFFSCGTGNPIDDCWRCDP  109

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  110  NWQQNRKRLADCGIG  124



>ref|XP_011020694.1| PREDICTED: probable pectate lyase 8 [Populus euphratica]
Length=452

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +1

Query  331  RLAEVEEALSKQAVD-DPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWH  507
            R  E  +A +++AV  DP+EV SMV  +IRNSTERR+LGYFSCGTGNPIDDCWRCDPNWH
Sbjct  58   RSQEEADAFNEKAVAADPDEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDDCWRCDPNWH  117

Query  508  NNRQRLADCGIG  543
             NR+RLADCGIG
Sbjct  118  KNRKRLADCGIG  129



>ref|XP_003535958.1| PREDICTED: probable pectate lyase 1-like [Glycine max]
 gb|KHN24365.1| Putative pectate lyase 15 [Glycine soja]
Length=450

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R  E ++   + AV +PEEV SMV  SI+NSTERRKLGYFSCGTGNPIDDCWRCDP
Sbjct  53   SMVERAKEADKLNEQAAVANPEEVVSMVEMSIQNSTERRKLGYFSCGTGNPIDDCWRCDP  112

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  113  NWQRNRKRLADCGIG  127



>gb|KDP33375.1| hypothetical protein JCGZ_12924 [Jatropha curcas]
Length=449

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVDDPEEV +MV  SIRNSTERR+LGYFSCGTGNPIDDCWRCDPNW  NR+RLA+CG
Sbjct  65   NEHAVDDPEEVVAMVEMSIRNSTERRQLGYFSCGTGNPIDDCWRCDPNWQKNRKRLAECG  124

Query  538  IG  543
            IG
Sbjct  125  IG  126



>ref|XP_003555714.2| PREDICTED: probable pectate lyase 1-like [Glycine max]
Length=489

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R  E E+   + AV +PEEV SMV  SI+NSTERRKLG+FSCGTGNPIDDCWRCDP
Sbjct  92   SMAERAKEAEKLNEQAAVANPEEVVSMVEMSIQNSTERRKLGFFSCGTGNPIDDCWRCDP  151

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  152  NWQRNRKRLADCGIG  166



>gb|EYU43815.1| hypothetical protein MIMGU_mgv1a006554mg [Erythranthe guttata]
Length=439

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  QAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            + +DDPEEV  MV  + RNSTERRKLG+FSCGTGNPIDDCWRCDPNWH NR+RLADCGIG
Sbjct  55   EGIDDPEEVVRMVEMATRNSTERRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  114



>gb|EEE60442.1| hypothetical protein OsJ_13660 [Oryza sativa Japonica Group]
Length=443

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPEEV S V  SIRNST RRKLGY SCGTGNPIDDCWRCDP+WH NRQRLADCGIG
Sbjct  62   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIG  120



>emb|CAE02420.2| OSJNBa0095E20.8 [Oryza sativa Japonica Group]
 emb|CAH65848.1| OSIGBa0147B06.7 [Oryza sativa Indica Group]
Length=472

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPEEV S V  SIRNST RRKLGY SCGTGNPIDDCWRCDP+WH NRQRLADCGIG
Sbjct  91   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIG  149



>gb|EYU32621.1| hypothetical protein MIMGU_mgv1a006198mg [Erythranthe guttata]
Length=453

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRK-LGYFSCGTGNPIDDCWRCDPNWHNNRQR  522
            E+ L++ AVDDPEEV  MV  + RNST+RR+ LGYFSCGTGNPIDDCWRCDPNWH NR+R
Sbjct  64   EDVLNEHAVDDPEEVVRMVEMATRNSTDRRRRLGYFSCGTGNPIDDCWRCDPNWHKNRKR  123

Query  523  LADCGIG  543
            LADCGIG
Sbjct  124  LADCGIG  130



>gb|EEC76710.1| hypothetical protein OsI_14719 [Oryza sativa Indica Group]
Length=473

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPEEV S V  SIRNST RRKLGY SCGTGNPIDDCWRCDP+WH NRQRLADCGIG
Sbjct  92   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIG  150



>emb|CAN78491.1| hypothetical protein VITISV_004934 [Vitis vinifera]
Length=418

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
            A ++ AVDDP+ VASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCD NW  NR+RLAD
Sbjct  44   ARNEHAVDDPDAVASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDHNWQKNRKRLAD  103

Query  532  CGIG  543
            CGIG
Sbjct  104  CGIG  107



>emb|CBI33346.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
            A ++ AVDDP+ VASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCD NW  NR+RLAD
Sbjct  44   ARNEHAVDDPDAVASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDHNWQKNRKRLAD  103

Query  532  CGIG  543
            CGIG
Sbjct  104  CGIG  107



>ref|NP_001052103.1| Os04g0137100 [Oryza sativa Japonica Group]
 dbj|BAF14017.1| Os04g0137100 [Oryza sativa Japonica Group]
Length=492

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPEEV S V  SIRNST RRKLGY SCGTGNPIDDCWRCDP+WH NRQRLADCGIG
Sbjct  92   AVDDPEEVVSQVHMSIRNSTARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIG  150



>ref|XP_002285639.2| PREDICTED: probable pectate lyase 8 [Vitis vinifera]
Length=464

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
            A ++ AVDDP+ VASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCD NW  NR+RLAD
Sbjct  78   ARNEHAVDDPDAVASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDHNWQKNRKRLAD  137

Query  532  CGIG  543
            CGIG
Sbjct  138  CGIG  141



>ref|XP_010243989.1| PREDICTED: probable pectate lyase 8 [Nelumbo nucifera]
Length=444

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            RL E E   ++ AVD+PEEVASMV  SIRNSTERR LGY SCGTGNPIDDCWRCDP WH 
Sbjct  52   RLEETE-PWNEHAVDNPEEVASMVDMSIRNSTERRNLGYLSCGTGNPIDDCWRCDPQWHL  110

Query  511  NRQRLADCGIG  543
            +R+RLADCGIG
Sbjct  111  HRKRLADCGIG  121



>ref|XP_010935686.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=425

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE VASMV  SIRNST RR LGY SCGTGNPIDDCWRCDP+WH+NR+RLADCGIG
Sbjct  44   AVDDPEMVASMVQMSIRNSTARRALGYLSCGTGNPIDDCWRCDPDWHHNRKRLADCGIG  102



>ref|XP_008372438.1| PREDICTED: probable pectate lyase 8 [Malus domestica]
Length=451

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            EEAL++ AVD+P+E+ASMV  SIRNSTERR LG+FSC TGNPIDDCWRCDP+W  +R+RL
Sbjct  65   EEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCATGNPIDDCWRCDPHWQLHRKRL  124

Query  526  ADCGIG  543
            A+CGIG
Sbjct  125  ANCGIG  130



>ref|XP_009371193.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=451

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            EEAL++ AVD+P+E+ASMV  SIRNSTERR LG+FSC TGNPIDDCWRCDP+W  +R+RL
Sbjct  65   EEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCATGNPIDDCWRCDPHWQLHRKRL  124

Query  526  ADCGIG  543
            A+CGIG
Sbjct  125  ANCGIG  130



>ref|XP_010935685.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=453

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE VASMV  SIRNST RR LGY SCGTGNPIDDCWRCDP+WH+NR+RLADCGIG
Sbjct  72   AVDDPEMVASMVQMSIRNSTARRALGYLSCGTGNPIDDCWRCDPDWHHNRKRLADCGIG  130



>ref|XP_010940647.1| PREDICTED: probable pectate lyase 8 [Elaeis guineensis]
Length=448

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  343  VEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQR  522
            V EA+ K AVDDPE VASMV  SIRNST RR LGY SCGTGNPIDDCWRCDP+WH NR+R
Sbjct  60   VLEAV-KAAVDDPEVVASMVQMSIRNSTARRALGYLSCGTGNPIDDCWRCDPDWHLNRKR  118

Query  523  LADCGIG  543
            LADCGIG
Sbjct  119  LADCGIG  125



>ref|XP_010672089.1| PREDICTED: probable pectate lyase 1 [Beta vulgaris subsp. vulgaris]
Length=436

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD  495
            +++  +L EVE   ++ AV DPEEV ++V  SIRNST+RR LGYFSCGTGNP+DDCWRCD
Sbjct  39   ITMAEKLNEVE-IYNEHAVADPEEVVALVHMSIRNSTQRRNLGYFSCGTGNPVDDCWRCD  97

Query  496  PNWHNNRQRLADCGIG  543
             NWH NR+RLADCGIG
Sbjct  98   RNWHKNRKRLADCGIG  113



>ref|XP_004497757.1| PREDICTED: probable pectate lyase 15-like [Cicer arietinum]
Length=452

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R  EVE+   + AV DPE VASMV   I+N+T+RR LG+FSCGTGNPIDDCWRCDP
Sbjct  55   SMAARAKEVEKLNERAAVADPEVVASMVEMHIQNNTQRRNLGFFSCGTGNPIDDCWRCDP  114

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  115  NWQRNRKRLADCGIG  129



>ref|XP_009624534.1| PREDICTED: probable pectate lyase 8 [Nicotiana tomentosiformis]
Length=438

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            K AVDDPE VASMV  SIRNSTERRKLG+FSCGTGNPIDDCWRCD NW  NR+RLADC I
Sbjct  55   KHAVDDPEMVASMVDMSIRNSTERRKLGFFSCGTGNPIDDCWRCDRNWQRNRKRLADCAI  114

Query  541  G  543
            G
Sbjct  115  G  115



>emb|CDP03845.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            ++  R  E  E   + AVDDPE VASMV  SIRN+TERRKLG+FSCGTGNPIDDCWRCDP
Sbjct  44   TIPLRPNEEAEFKHEHAVDDPEMVASMVDMSIRNNTERRKLGFFSCGTGNPIDDCWRCDP  103

Query  499  NWHNNRQRLADCGIG  543
            NW   R+RLADC IG
Sbjct  104  NWQRQRKRLADCAIG  118



>ref|XP_006352706.1| PREDICTED: probable pectate lyase 10-like [Solanum tuberosum]
Length=434

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            RL+  +E   + AVDDPE +ASMV  SIRNSTERRKLGYFSC TGNPIDDCWRCD NW  
Sbjct  48   RLSGNDELRHEHAVDDPEAIASMVDMSIRNSTERRKLGYFSCTTGNPIDDCWRCDRNWQR  107

Query  511  NRQRLADCGIG  543
            NR+RLADC IG
Sbjct  108  NRRRLADCSIG  118



>ref|XP_004171543.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
Length=444

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  EVEEALS-KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNR  516
            +VE+ L+ + AVD+P+E+A+ V  SIRNSTERRKLG+FSCGTGNPIDDCWRCD NWH NR
Sbjct  53   DVEQELNNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGTGNPIDDCWRCDSNWHRNR  112

Query  517  QRLADCGIG  543
            +RLA+CGIG
Sbjct  113  KRLAECGIG  121



>ref|XP_004138973.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN61525.1| hypothetical protein Csa_2G155600 [Cucumis sativus]
Length=449

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  EVEEALS-KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNR  516
            +VE+ L+ + AVD+P+E+A+ V  SIRNSTERRKLG+FSCGTGNPIDDCWRCD NWH NR
Sbjct  58   DVEQELNNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGTGNPIDDCWRCDSNWHRNR  117

Query  517  QRLADCGIG  543
            +RLA+CGIG
Sbjct  118  KRLAECGIG  126



>ref|XP_008460726.1| PREDICTED: probable pectate lyase 8 isoform X1 [Cucumis melo]
Length=449

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  EVEEALS-KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNR  516
            +VE+ L+ + AVD+P+E+A+ V  SIRNSTERRKLG+FSCGTGNPIDDCWRCD NWH NR
Sbjct  58   DVEQELNNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGTGNPIDDCWRCDSNWHRNR  117

Query  517  QRLADCGIG  543
            +RLA+CGIG
Sbjct  118  KRLAECGIG  126



>ref|XP_009609746.1| PREDICTED: probable pectate lyase 8 [Nicotiana tomentosiformis]
Length=437

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            +L  RL+E +E   + A DDPE +ASMVA SIRNSTERRKLGYFSC TGNPIDDCWRCD 
Sbjct  40   TLANRLSENDELRHEHAEDDPEAIASMVAMSIRNSTERRKLGYFSCTTGNPIDDCWRCDR  99

Query  499  NWHNNRQRLADCGIG  543
            +W  NR+RLADC IG
Sbjct  100  HWVRNRKRLADCSIG  114



>ref|XP_008460727.1| PREDICTED: probable pectate lyase 1 isoform X2 [Cucumis melo]
Length=431

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  EVEEALS-KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNR  516
            +VE+ L+ + AVD+P+E+A+ V  SIRNSTERRKLG+FSCGTGNPIDDCWRCD NWH NR
Sbjct  40   DVEQELNNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGTGNPIDDCWRCDSNWHRNR  99

Query  517  QRLADCGIG  543
            +RLA+CGIG
Sbjct  100  KRLAECGIG  108



>ref|XP_007201029.1| hypothetical protein PRUPE_ppa006229mg [Prunus persica]
 gb|EMJ02228.1| hypothetical protein PRUPE_ppa006229mg [Prunus persica]
Length=421

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            +EAL++ AVD+P+E+ASMV  SIRNSTERR LG+FSC TGNP+DDCWRCDP+W  +R+RL
Sbjct  35   DEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCATGNPVDDCWRCDPHWQLHRKRL  94

Query  526  ADCGIG  543
            A+CGIG
Sbjct  95   ANCGIG  100



>ref|XP_008235520.1| PREDICTED: probable pectate lyase 8 [Prunus mume]
Length=448

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            +EAL++ AVD+P+E+ASMV  SIRNSTERR LG+FSC TGNP+DDCWRCDP+W  +R+RL
Sbjct  61   DEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCATGNPVDDCWRCDPHWQLHRKRL  120

Query  526  ADCGIG  543
            A+CGIG
Sbjct  121  ANCGIG  126



>ref|XP_007145412.1| hypothetical protein PHAVU_007G236800g [Phaseolus vulgaris]
 gb|ESW17406.1| hypothetical protein PHAVU_007G236800g [Phaseolus vulgaris]
Length=451

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R  E E+   + AV +PEEV SMV  SI NST+RR LG+FSCGTGNPIDDCWRCDP
Sbjct  54   SMVERAKEAEKLNEEAAVANPEEVVSMVEMSIHNSTQRRNLGFFSCGTGNPIDDCWRCDP  113

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  114  NWQRNRKRLADCGIG  128



>ref|XP_006350301.1| PREDICTED: probable pectate lyase 20-like [Solanum tuberosum]
Length=439

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD  495
            L++   L+E      + AVDDPE+V SMV  SIRNSTERRKLG+FSCGTGNPIDDCWRCD
Sbjct  42   LTMANSLSEENVPNHEHAVDDPEKVVSMVDMSIRNSTERRKLGFFSCGTGNPIDDCWRCD  101

Query  496  PNWHNNRQRLADCGIG  543
             NW  NR+RLADC IG
Sbjct  102  RNWQRNRKRLADCAIG  117



>emb|CAN75298.1| hypothetical protein VITISV_008675 [Vitis vinifera]
Length=445

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AV++PEEVASMV  SIRNSTERR LGYFSCGTGNPIDDCWRCDP+W  +R+RLADCG
Sbjct  61   NEHAVENPEEVASMVDMSIRNSTERRNLGYFSCGTGNPIDDCWRCDPHWQLHRKRLADCG  120

Query  538  IG  543
            IG
Sbjct  121  IG  122



>ref|XP_002265100.1| PREDICTED: probable pectate lyase 8 [Vitis vinifera]
 emb|CBI37263.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AV++PEEVASMV  SIRNSTERR LGYFSCGTGNPIDDCWRCDP+W  +R+RLADCG
Sbjct  61   NEHAVENPEEVASMVDMSIRNSTERRNLGYFSCGTGNPIDDCWRCDPHWQLHRKRLADCG  120

Query  538  IG  543
            IG
Sbjct  121  IG  122



>ref|XP_011024740.1| PREDICTED: probable pectate lyase 20 [Populus euphratica]
Length=442

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 63/89 (71%), Gaps = 15/89 (17%)
 Frame = +1

Query  322  LWFRLAEVEEALS---------------KQAVDDPEEVASMVAESIRNSTERRKLGYFSC  456
            L  RL E +E LS               +  ++DPEEVA+MV ESIRNSTERRKLG+FSC
Sbjct  31   LKLRLKETQELLSSKNSSMADWYDDTWNEHTMEDPEEVAAMVDESIRNSTERRKLGFFSC  90

Query  457  GTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            GTGNPIDDCWRCDP+W  +R+ LA+CGIG
Sbjct  91   GTGNPIDDCWRCDPHWQRHRKSLANCGIG  119



>gb|EMT28700.1| hypothetical protein F775_17439 [Aegilops tauschii]
Length=399

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE V S V  SIRNST RR LGY SCGTGNPIDDCWRCD +WHNNRQRLADCGIG
Sbjct  18   AVDDPEAVVSQVHMSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIG  76



>ref|XP_009804999.1| PREDICTED: probable pectate lyase 8 [Nicotiana sylvestris]
Length=439

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            K AVDDP+ VASMV  SIRNSTERRKLG+FSCGTGNPIDDCWRCD NW  NR+RLADC I
Sbjct  56   KHAVDDPDMVASMVDMSIRNSTERRKLGFFSCGTGNPIDDCWRCDRNWQRNRKRLADCAI  115

Query  541  G  543
            G
Sbjct  116  G  116



>dbj|BAK06362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE V S V  SIRNST RR LGY SCGTGNPIDDCWRCD +WHNNRQRLADCGIG
Sbjct  85   AVDDPETVVSQVHMSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIG  143



>gb|EPS68938.1| hypothetical protein M569_05827, partial [Genlisea aurea]
Length=394

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  334  LAEVEEALSKQAVDDPEEVASMVAESIRNSTERR-KLGYFSCGTGNPIDDCWRCDPNWHN  510
            L  ++E      ++DPEEVA MV  + RNSTERR KLG+FSCGTGNPIDDCWRCDPNWH 
Sbjct  1    LEGIDEGAFNYTMEDPEEVARMVEMATRNSTERRRKLGFFSCGTGNPIDDCWRCDPNWHK  60

Query  511  NRQRLADCGIG  543
            NR+RLADCGIG
Sbjct  61   NRRRLADCGIG  71



>ref|XP_008382653.1| PREDICTED: probable pectate lyase 10 [Malus domestica]
Length=381

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            +EAL + AVD+P+E+ASMV  +IRNSTERR LG+FSC TGNPIDDCWRCDP W  +R+RL
Sbjct  65   DEALDEHAVDNPDEIASMVDMTIRNSTERRNLGFFSCATGNPIDDCWRCDPQWQLHRKRL  124

Query  526  ADCGIG  543
            A+CGIG
Sbjct  125  ANCGIG  130



>ref|XP_004247105.1| PREDICTED: probable pectate lyase 8 [Solanum lycopersicum]
Length=439

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD  495
            L++   L+E      + AVDDPE+V SMV  SI+NSTERRKLG+FSCGTGNPIDDCWRCD
Sbjct  42   LTMTNSLSEENVPNHEHAVDDPEKVVSMVDMSIKNSTERRKLGFFSCGTGNPIDDCWRCD  101

Query  496  PNWHNNRQRLADCGIG  543
             NW  NR+RLADC IG
Sbjct  102  RNWQRNRKRLADCAIG  117



>ref|XP_009349844.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=451

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            +EAL + AVD+P+E+ASMV  +IRNSTERR LG+FSC TGNPIDDCWRCDP W  +R+RL
Sbjct  65   DEALDEHAVDNPDEIASMVDMTIRNSTERRNLGFFSCATGNPIDDCWRCDPQWQLHRKRL  124

Query  526  ADCGIG  543
            A+CGIG
Sbjct  125  ANCGIG  130



>ref|XP_003638494.1| Pectate lyase, partial [Medicago truncatula]
Length=194

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R  + E+   + AV +P+EVASMV   I+NSTERR LG+FSCGTGNPIDDCWRCD 
Sbjct  53   SMAAREKQAEKLNERAAVANPKEVASMVEMHIQNSTERRNLGFFSCGTGNPIDDCWRCDR  112

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  113  NWQQNRKRLADCGIG  127



>gb|KCW57296.1| hypothetical protein EUGRSUZ_H00093 [Eucalyptus grandis]
Length=447

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 3/63 (5%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            L+ QAVDDPE+VASMV     NSTERR LG+FSCGTGNPIDDCWRCDPNWH NR+RLADC
Sbjct  65   LNDQAVDDPEKVASMVD---MNSTERRNLGFFSCGTGNPIDDCWRCDPNWHLNRKRLADC  121

Query  535  GIG  543
            GIG
Sbjct  122  GIG  124



>ref|XP_010239620.1| PREDICTED: probable pectate lyase 8 isoform X2 [Brachypodium 
distachyon]
Length=424

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            +VDDPE VAS V  SI+NST RR LGY SCGTGNPIDDCWRCD +WHNNRQRLADCGIG
Sbjct  43   SVDDPETVASQVHMSIKNSTARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIG  101



>gb|AAX88800.1| ripening-related pectate lyase [Mangifera indica]
Length=437

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            +++ S+ AVD+PEEVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCDP WH +R+ L
Sbjct  49   DDSWSQHAVDNPEEVAAMVDISIRNSTERRRLGYFSCETGNPIDDCWRCDPKWHLHRKHL  108

Query  526  ADCGIG  543
            ADC IG
Sbjct  109  ADCAIG  114



>ref|XP_007140561.1| hypothetical protein PHAVU_008G123000g [Phaseolus vulgaris]
 gb|ESW12555.1| hypothetical protein PHAVU_008G123000g [Phaseolus vulgaris]
Length=451

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  VEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQR  522
            +E+AL++ AVD+PEE+ASMV ESIRNST RR L +FSCGTGNPIDDCWRCD  W+  R+R
Sbjct  62   LEDALNEHAVDNPEEIASMVDESIRNSTARRNLNFFSCGTGNPIDDCWRCDKRWYLRRKR  121

Query  523  LADCGIG  543
            LA+CGIG
Sbjct  122  LANCGIG  128



>ref|XP_010684949.1| PREDICTED: probable pectate lyase 8 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R  E E    + AV+ PEE+ SMV  SI NST RR LGYFSCGTGNPIDDCWRCD 
Sbjct  49   SMADRAREAEVKSEQAAVEQPEEIVSMVQRSIDNSTARRNLGYFSCGTGNPIDDCWRCDS  108

Query  499  NWHNNRQRLADCGIG  543
            +WHNNR+RLADC IG
Sbjct  109  DWHNNRKRLADCAIG  123



>gb|ACJ83349.1| unknown [Medicago truncatula]
Length=206

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R  + E+   + AV +P+EVASMV   I+NSTERR LG+FSCGTGNPIDDCWRCD 
Sbjct  53   SMAAREKQAEKLNERAAVANPKEVASMVEMHIQNSTERRDLGFFSCGTGNPIDDCWRCDR  112

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  113  NWQQNRKRLADCGIG  127



>ref|XP_010239619.1| PREDICTED: probable pectate lyase 8 isoform X1 [Brachypodium 
distachyon]
Length=450

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            +VDDPE VAS V  SI+NST RR LGY SCGTGNPIDDCWRCD +WHNNRQRLADCGIG
Sbjct  69   SVDDPETVASQVHMSIKNSTARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIG  127



>ref|XP_007049844.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOX94001.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=444

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            E  +++ AVD+PEE+ASMV  SIRNSTERRKLGYFSCGTGNPIDDCWRCD  W+  R+RL
Sbjct  56   ETWINEHAVDNPEEIASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDRRWYLRRKRL  115

Query  526  ADCGIG  543
            A+CGIG
Sbjct  116  ANCGIG  121



>gb|EYU17974.1| hypothetical protein MIMGU_mgv1a006571mg [Erythranthe guttata]
Length=438

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  EVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQ  519
             +EE  +  AVDDPE +A+MV  +IRNSTERRKLG+FSCGTGNPIDDCWRCD NW  NR+
Sbjct  49   RLEEFDNPHAVDDPEAIATMVNMAIRNSTERRKLGFFSCGTGNPIDDCWRCDRNWIRNRR  108

Query  520  RLADCGIG  543
            RLADC IG
Sbjct  109  RLADCSIG  116



>ref|XP_008789532.1| PREDICTED: probable pectate lyase 8 [Phoenix dactylifera]
Length=322

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDP+ VASMV  SIRNS+ RR LGY SCGTGNPIDDCWRCDP WH++R+RLADCGIG
Sbjct  3    AVDDPDMVASMVQMSIRNSSARRALGYLSCGTGNPIDDCWRCDPAWHHHRKRLADCGIG  61



>ref|XP_010038352.1| PREDICTED: probable pectate lyase 8 [Eucalyptus grandis]
 gb|KCW50165.1| hypothetical protein EUGRSUZ_K03600 [Eucalyptus grandis]
Length=444

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            + AVDDPEEVASMV  SIRNST RR LG+FSCGTGNPIDDCWRCDP W+  R+RLADC I
Sbjct  61   EHAVDDPEEVASMVDMSIRNSTARRNLGFFSCGTGNPIDDCWRCDPKWYLRRKRLADCAI  120

Query  541  G  543
            G
Sbjct  121  G  121



>ref|XP_010522431.1| PREDICTED: probable pectate lyase 1 [Tarenaya hassleriana]
Length=420

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 4/73 (5%)
 Frame = +1

Query  337  AEVEEALSKQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNW  504
            AE E   ++ AV DP+    EVAS+V  S+RN TERRKLGYFSCGTGNPIDDCWRCD NW
Sbjct  33   AEEEPEWNEHAVADPDKVADEVASLVDMSMRNHTERRKLGYFSCGTGNPIDDCWRCDANW  92

Query  505  HNNRQRLADCGIG  543
            H NR+RLADCGIG
Sbjct  93   HKNRKRLADCGIG  105



>ref|XP_009391056.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=453

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            +++ AVDDPEEVAS V  SI NST RR LGY SCGTGNPIDDCWRCDP+WH NR+ LADC
Sbjct  68   MAEAAVDDPEEVASAVHMSISNSTARRSLGYLSCGTGNPIDDCWRCDPDWHLNRKTLADC  127

Query  535  GIG  543
            GIG
Sbjct  128  GIG  130



>ref|XP_004242391.1| PREDICTED: probable pectate lyase 8 [Solanum lycopersicum]
Length=434

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            RL+  +E   + A DDPE +ASMV  SIRNSTERRKLGYFSC TGNPIDDCWRCD NW  
Sbjct  48   RLSGNDELRHEHAEDDPEAIASMVDMSIRNSTERRKLGYFSCRTGNPIDDCWRCDRNWQR  107

Query  511  NRQRLADCGIG  543
            NR+RLADC IG
Sbjct  108  NRRRLADCSIG  118



>ref|XP_009799817.1| PREDICTED: probable pectate lyase 8 [Nicotiana sylvestris]
Length=437

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            RL+E +E   + A  DPE +ASMVA SIRNSTERRKLGYFSC TGNPIDDCWRCD +W  
Sbjct  44   RLSENDELRHEHAEVDPEAIASMVAMSIRNSTERRKLGYFSCTTGNPIDDCWRCDRHWVR  103

Query  511  NRQRLADCGIG  543
            NR+RLADC IG
Sbjct  104  NRKRLADCSIG  114



>ref|XP_002301766.2| hypothetical protein POPTR_0002s23990g [Populus trichocarpa]
 gb|EEE81039.2| hypothetical protein POPTR_0002s23990g [Populus trichocarpa]
Length=442

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            ++A ++  ++DPEEVA+MV ESIRNSTERRKLG+FSC TGNPIDDCWRCDP+W  +R+RL
Sbjct  54   DDAWNEHTMEDPEEVAAMVDESIRNSTERRKLGFFSCVTGNPIDDCWRCDPHWQLHRKRL  113

Query  526  ADCGIG  543
            A+CGIG
Sbjct  114  ANCGIG  119



>gb|KFK42808.1| hypothetical protein AALP_AA1G041400 [Arabis alpina]
Length=432

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 67/97 (69%), Gaps = 5/97 (5%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      + N+    +S   R  +V E  +K AV +P+EVA    ++V  S+RN TER
Sbjct  12   MCLLFFVGAMENITDDKISSLSRSEDVTE-WNKHAVTNPDEVADEVVALVEMSVRNHTER  70

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  71   RKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  107



>gb|KHG06252.1| hypothetical protein F383_10745 [Gossypium arboreum]
Length=429

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 4/73 (5%)
 Frame = +1

Query  337  AEVEEALSKQAVDDPEEVA----SMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNW  504
            +E  +AL++ AV DPE VA    +++  +IRN+TERRKLG+FSCGTGNPIDDCWRCDPNW
Sbjct  34   SEEVKALNEHAVADPEAVAAEVETIIDMNIRNATERRKLGFFSCGTGNPIDDCWRCDPNW  93

Query  505  HNNRQRLADCGIG  543
              NR+RLADCGIG
Sbjct  94   QKNRKRLADCGIG  106



>ref|XP_009408120.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  337  AEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNR  516
            A      ++ AVDDPEEVAS V   I NST RR LGY SCGTGNPIDDCWRCDP+WH NR
Sbjct  56   ARAVAGTAEAAVDDPEEVASAVQMIISNSTARRSLGYLSCGTGNPIDDCWRCDPDWHLNR  115

Query  517  QRLADCGIG  543
            +RLADCGIG
Sbjct  116  KRLADCGIG  124



>gb|KHG30349.1| hypothetical protein F383_15991 [Gossypium arboreum]
Length=487

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 4/73 (5%)
 Frame = +1

Query  337  AEVEEALSKQAVDDPEEVA----SMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNW  504
            +E  +AL++ AV DPE VA    +++  +IRN+TERRKLG+FSCGTGNPIDDCWRCDPNW
Sbjct  92   SEEVKALNEHAVADPEAVAAEVETIIDMNIRNATERRKLGFFSCGTGNPIDDCWRCDPNW  151

Query  505  HNNRQRLADCGIG  543
              NR+RLADCGIG
Sbjct  152  QKNRKRLADCGIG  164



>ref|XP_006443655.1| hypothetical protein CICLE_v10019202mg [Citrus clementina]
 gb|ESR56895.1| hypothetical protein CICLE_v10019202mg [Citrus clementina]
Length=661

 Score =   108 bits (271),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            EE   + AVD+P+E+A+ V  +IRNSTERRKLGYFSCGTGNPIDDCWRCD  W+  R+RL
Sbjct  273  EEWTHEHAVDNPDEIAATVDMAIRNSTERRKLGYFSCGTGNPIDDCWRCDSRWYLRRKRL  332

Query  526  ADCGIG  543
            ADC IG
Sbjct  333  ADCAIG  338



>ref|XP_002446075.1| hypothetical protein SORBIDRAFT_06g001410 [Sorghum bicolor]
 gb|EES10403.1| hypothetical protein SORBIDRAFT_06g001410 [Sorghum bicolor]
Length=381

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE VA+ V  SIRNST RR LGY SCGTGNPIDDCWRCD +WHNNRQRLADCGIG
Sbjct  71   AVEDPEAVANDVHVSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIG  129



>gb|KEH41255.1| pectate lyase family protein [Medicago truncatula]
Length=450

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+  R  + E+   + AV +P+EVASMV   I+NSTERR LG+FSCGTGNPIDDCWRCD 
Sbjct  53   SMAAREKQAEKLNERAAVANPKEVASMVEMHIQNSTERRNLGFFSCGTGNPIDDCWRCDR  112

Query  499  NWHNNRQRLADCGIG  543
            NW  NR+RLADCGIG
Sbjct  113  NWQQNRKRLADCGIG  127



>ref|XP_010264036.1| PREDICTED: probable pectate lyase 8 [Nelumbo nucifera]
Length=440

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEEVA+MV  SIRNST RR LG+ SCGTGNPIDDCWRCDP WH  R+RLADCG
Sbjct  56   AEHAVDNPEEVAAMVDMSIRNSTARRNLGFLSCGTGNPIDDCWRCDPMWHLRRKRLADCG  115

Query  538  IG  543
            IG
Sbjct  116  IG  117



>gb|AAL06861.1| At1g04680/T1G11_6 [Arabidopsis thaliana]
 gb|AAL47400.1| At1g04680/T1G11_6 [Arabidopsis thaliana]
Length=354

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      + N     +S   R  E E   ++ AV +P+EVA    ++   S+RN TER
Sbjct  12   MCLLFFVGAMENTTHDNISSLPRSDETE--WNQHAVTNPDEVADEVLALTEMSVRNHTER  69

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCDPNWH NR+RLADCGIG
Sbjct  70   RKLGYFTCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  106



>ref|NP_563715.1| putative pectate lyase 1 [Arabidopsis thaliana]
 sp|Q940Q1.2|PLY1_ARATH RecName: Full=Probable pectate lyase 1; AltName: Full=Pectate 
lyase A1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB80622.1| Strong similarity to Musa pectate lyase (gb|X92943). ESTs gb|AA042458, 
gb|ATTS4502, gb|N38552 come from this gene [Arabidopsis 
thaliana]
 gb|AAL57671.1| At1g04680/T1G11_6 [Arabidopsis thaliana]
 gb|AAM65261.1| putative pectate lyase A11 [Arabidopsis thaliana]
 gb|AEE27732.1| putative pectate lyase 1 [Arabidopsis thaliana]
Length=431

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      + N     +S   R  E E   ++ AV +P+EVA    ++   S+RN TER
Sbjct  12   MCLLFFVGAMENTTHDNISSLPRSDETE--WNQHAVTNPDEVADEVLALTEMSVRNHTER  69

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCDPNWH NR+RLADCGIG
Sbjct  70   RKLGYFTCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  106



>ref|XP_009118623.1| PREDICTED: probable pectate lyase 1 isoform X2 [Brassica rapa]
Length=431

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 66/97 (68%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      ++N     +S   R  E+E   +K AV +P+EVA    ++   S+RN TER
Sbjct  12   ICLLFFVGAMDNSTHDKISSLSRSVEIE--WNKHAVTNPDEVADEVIALAEMSVRNHTER  69

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  70   RKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  106



>ref|XP_009118622.1| PREDICTED: probable pectate lyase 1 isoform X1 [Brassica rapa]
Length=434

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 66/97 (68%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      ++N     +S   R  E+E   +K AV +P+EVA    ++   S+RN TER
Sbjct  12   ICLLFFVGAMDNSTHDKISSLSRSVEIE--WNKHAVTNPDEVADEVIALAEMSVRNHTER  69

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  70   RKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  106



>gb|EYU46355.1| hypothetical protein MIMGU_mgv1a007094mg [Erythranthe guttata]
Length=419

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            RL E  E   + A DDPE +A+MV  +IRNSTERRKLG+ SCGTGNPIDDCWRCD NW  
Sbjct  25   RLDESGELKHEHAEDDPEAIAAMVESNIRNSTERRKLGFLSCGTGNPIDDCWRCDRNWIR  84

Query  511  NRQRLADCGIG  543
            NR+RLADC IG
Sbjct  85   NRKRLADCAIG  95



>emb|CDY47327.1| BnaCnng14640D [Brassica napus]
Length=433

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLG  444
            L + V   G+ + K        R +  +    + AV DPEE+A+MV   IRNSTERR+LG
Sbjct  18   LTLFVHVNGVQDTKELKPDQSSRTSMTDYEWHEHAVKDPEEIAAMVDMKIRNSTERRRLG  77

Query  445  YFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            YFSC TGNPIDDCWRCD  WH  R+RLA C IG
Sbjct  78   YFSCSTGNPIDDCWRCDKKWHRQRKRLASCAIG  110



>ref|XP_009385867.1| PREDICTED: probable pectate lyase 8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=454

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVDDPEEVAS V  +I NST RR LGY SCG+GNPIDDCWRCDP+WH NR++LADCG
Sbjct  70   AEAAVDDPEEVASTVLTTIINSTARRSLGYLSCGSGNPIDDCWRCDPDWHVNRKKLADCG  129

Query  538  IG  543
            IG
Sbjct  130  IG  131



>gb|KDP26417.1| hypothetical protein JCGZ_17575 [Jatropha curcas]
Length=442

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            +A ++ AV++P+EVASMV ES+RNST RR LG+FSC TGNPIDDCWRCD NW  NR+RLA
Sbjct  55   DAWNEHAVENPDEVASMVDESVRNSTARRNLGFFSCVTGNPIDDCWRCDRNWQKNRKRLA  114

Query  529  DCGIG  543
            DCGIG
Sbjct  115  DCGIG  119



>gb|AAF19196.1|AF206320_1 pectate lyase 2 [Musa acuminata AAA Group]
Length=454

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVDDPEEVAS V  +I NST RR LGY SCG+GNPIDDCWRCDP+WH NR++LADCG
Sbjct  70   AEAAVDDPEEVASTVLTTIINSTARRSLGYLSCGSGNPIDDCWRCDPDWHVNRKKLADCG  129

Query  538  IG  543
            IG
Sbjct  130  IG  131



>ref|XP_007034463.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY05389.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=447

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 4/73 (5%)
 Frame = +1

Query  337  AEVEEALSKQAVDDP----EEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNW  504
            +E  E L++ AV DP     EV +M+  +IRN TERRKLG+FSCGTGNPIDDCWRCDPNW
Sbjct  52   SEEAEPLNEHAVPDPGAVAAEVETMIDMNIRNVTERRKLGFFSCGTGNPIDDCWRCDPNW  111

Query  505  HNNRQRLADCGIG  543
              NR+RLADCGIG
Sbjct  112  QKNRKRLADCGIG  124



>ref|XP_011009338.1| PREDICTED: probable pectate lyase 8 [Populus euphratica]
Length=442

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 61/89 (69%), Gaps = 15/89 (17%)
 Frame = +1

Query  322  LWFRLAEVEEALS---------------KQAVDDPEEVASMVAESIRNSTERRKLGYFSC  456
            L  RL E +E LS               +  V+D EEVA+MV ESIRNSTERRKLG+FSC
Sbjct  31   LKLRLKETQELLSSKNSSMAERSDDAWNEHTVEDSEEVAAMVDESIRNSTERRKLGFFSC  90

Query  457  GTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
             TGNPIDDCWRCDP+W  +R+RLA CGIG
Sbjct  91   VTGNPIDDCWRCDPHWQLHRKRLAKCGIG  119



>ref|XP_008447332.1| PREDICTED: probable pectate lyase 8 [Cucumis melo]
Length=432

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+ASMV  SIRNSTERR LG+FSCGTGNPIDDCWRCDP W   R+ LA+CG
Sbjct  48   NEHAVDNPEEIASMVDSSIRNSTERRNLGFFSCGTGNPIDDCWRCDPRWQLRRKHLANCG  107

Query  538  IG  543
            IG
Sbjct  108  IG  109



>gb|KHG26906.1| hypothetical protein F383_09796 [Gossypium arboreum]
Length=446

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  EVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQ  519
            E E+ +++ +VD+PEE+ASMV  SIRNST+RRKLGYFSCGTGNP+DDCWRCD +W+  R+
Sbjct  56   EDEQWINEHSVDNPEEIASMVHMSIRNSTKRRKLGYFSCGTGNPVDDCWRCDRHWYLRRK  115

Query  520  RLADCGIG  543
             LA+CGIG
Sbjct  116  NLANCGIG  123



>ref|XP_010556943.1| PREDICTED: probable pectate lyase 1 [Tarenaya hassleriana]
Length=428

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = +1

Query  334  LAEVEEALSKQAVDDPEEVA----SMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPN  501
            L+  E   ++ AV DP++VA    S+V  S+RN TERRKLGYFSCGTGNPIDDCWRCD N
Sbjct  30   LSREEPEWNEHAVADPDKVADHVASLVEMSMRNHTERRKLGYFSCGTGNPIDDCWRCDSN  89

Query  502  WHNNRQRLADCGIG  543
            WH NR+RLADCGIG
Sbjct  90   WHKNRKRLADCGIG  103



>emb|CAC80136.1| pectate lyase II enzyme [Musa acuminata AAA Group]
Length=454

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVDDPEEVAS V  +I NST RR LGY SCG+GNPIDDCWRCDP+WH NR++LADCG
Sbjct  70   AEAAVDDPEEVASTVLTTIINSTARRSLGYLSCGSGNPIDDCWRCDPDWHVNRKKLADCG  129

Query  538  IG  543
            IG
Sbjct  130  IG  131



>ref|XP_009385866.1| PREDICTED: probable pectate lyase 8 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVDDPEEVAS V  +I NST RR LGY SCG+GNPIDDCWRCDP+WH NR++LADCG
Sbjct  102  AEAAVDDPEEVASTVLTTIINSTARRSLGYLSCGSGNPIDDCWRCDPDWHVNRKKLADCG  161

Query  538  IG  543
            IG
Sbjct  162  IG  163



>ref|XP_004152014.1| PREDICTED: probable pectate lyase 8-like [Cucumis sativus]
 gb|KGN58334.1| hypothetical protein Csa_3G624020 [Cucumis sativus]
Length=433

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 5/75 (7%)
 Frame = +1

Query  319  SLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            S+ +R  E E      AVD+PEE+ASMV  SIRNSTERR LG+FSCGTGNPIDDCWRCDP
Sbjct  41   SMPYRYIENE-----HAVDNPEEIASMVDLSIRNSTERRNLGFFSCGTGNPIDDCWRCDP  95

Query  499  NWHNNRQRLADCGIG  543
             W   R+ LA+CGIG
Sbjct  96   RWQLRRKHLANCGIG  110



>ref|XP_002521130.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF41281.1| Pectate lyase precursor, putative [Ricinus communis]
Length=441

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
            A ++ AV+DPE++ASMV ESIRNST RR LG+FSC TGNPIDDCWRCDP+W  +R+RLA+
Sbjct  55   AWNEHAVEDPEDIASMVDESIRNSTARRNLGFFSCVTGNPIDDCWRCDPHWQLHRKRLAN  114

Query  532  CGIG  543
            CGIG
Sbjct  115  CGIG  118



>ref|XP_010484103.1| PREDICTED: probable pectate lyase 1 [Camelina sativa]
Length=432

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      + N     +S + R  E E   ++ AV +P+EVA    ++   S+RN TER
Sbjct  13   MCLLFFVGAMENTTHNKISSFPRSDETE--WNQHAVKNPDEVADEVLALTEMSVRNHTER  70

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  71   RKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  107



>ref|XP_004163042.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 8-like 
[Cucumis sativus]
Length=392

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+ASMV  SIRNSTERR LG+FSCGTGNPIDDCWRCDP W   R+ LA+CG
Sbjct  8    NEHAVDNPEEIASMVDLSIRNSTERRNLGFFSCGTGNPIDDCWRCDPRWQLRRKHLANCG  67

Query  538  IG  543
            IG
Sbjct  68   IG  69



>ref|XP_003530885.1| PREDICTED: probable pectate lyase 20-like [Glycine max]
Length=451

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
            AL++ AVD+PEE+ASMV ESIRN T RR L +FSCGTGNPIDDCWRCD  W+  R+RLA+
Sbjct  65   ALNEHAVDNPEEIASMVDESIRNYTARRNLNFFSCGTGNPIDDCWRCDKRWYARRKRLAN  124

Query  532  CGIG  543
            CGIG
Sbjct  125  CGIG  128



>ref|XP_010532870.1| PREDICTED: putative pectate lyase 14 [Tarenaya hassleriana]
Length=440

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 5/98 (5%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSK-----QAVDDPEEVASMVAESIRNSTE  429
            L +CV+ + +     F  S   R + + + LS+      AV +PEE+ASMV  SIRNSTE
Sbjct  20   LFLCVNASSVRETAEFMKSQSSRNSSMADTLSEDAWHEHAVKNPEEIASMVDMSIRNSTE  79

Query  430  RRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RRKLG+FSC TGN IDDCWRCD +WH  R+RLA+C IG
Sbjct  80   RRKLGFFSCTTGNTIDDCWRCDRSWHLRRKRLANCAIG  117



>ref|XP_010475133.1| PREDICTED: probable pectate lyase 1 [Camelina sativa]
Length=432

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      + N     +S   R  E E   ++ AV +P+EVA    ++   S+RN TER
Sbjct  13   MCLLFFVGAMENTTHHKISSLPRSDETE--WNQHAVTNPDEVADEVLALTEMSLRNHTER  70

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  71   RKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  107



>gb|ABR26682.1| pectate lyase [Fragaria chiloensis]
Length=419

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+AS+V  SIRNS+ RR+LGYFSC TGNPIDDCWRCDP W  +R+RLA+CG
Sbjct  65   NEHAVDNPEEIASLVDTSIRNSSTRRELGYFSCATGNPIDDCWRCDPQWQRHRKRLANCG  124

Query  538  IG  543
            IG
Sbjct  125  IG  126



>ref|XP_009107745.1| PREDICTED: probable pectate lyase 15 [Brassica rapa]
Length=451

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 4/65 (6%)
 Frame = +1

Query  361  KQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            + AV DP+    EVAS+V  S  N T RRKLG+FSCGTGNPIDDCWRCDPNWH NR+RLA
Sbjct  64   QHAVSDPDRVADEVASLVQMSEHNKTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLA  123

Query  529  DCGIG  543
            DCGIG
Sbjct  124  DCGIG  128



>ref|XP_004290232.1| PREDICTED: probable pectate lyase 8-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 59/86 (69%), Gaps = 15/86 (17%)
 Frame = +1

Query  331  RLAEVEEALS---------------KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTG  465
            R  EVEE  S               + AVD+PEE+AS+V  SIRNS+ RR+LGYFSC TG
Sbjct  40   RFVEVEEPKSSFNSSMADRSNDDWNEHAVDNPEEIASLVDTSIRNSSARRELGYFSCATG  99

Query  466  NPIDDCWRCDPNWHNNRQRLADCGIG  543
            NPIDDCWRCDP W  +R+RLA+CGIG
Sbjct  100  NPIDDCWRCDPQWQRHRKRLANCGIG  125



>gb|AAZ31564.1| pectate lyase isoform 2 [Fragaria x ananassa]
Length=405

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+AS+V  SIRNS+ RR+LGYFSC TGNPIDDCWRCDP W  +R+RLA+CG
Sbjct  65   NEHAVDNPEEIASLVDTSIRNSSARRELGYFSCATGNPIDDCWRCDPQWQRHRKRLANCG  124

Query  538  IG  543
            IG
Sbjct  125  IG  126



>gb|AAK66160.1| pectate lyase B [Fragaria x ananassa]
 gb|AAZ31565.1| pectate lyase isoform 3 [Fragaria x ananassa]
Length=405

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+AS+V  SIRNS+ RR+LGYFSC TGNPIDDCWRCDP W  +R+RLA+CG
Sbjct  65   NEHAVDNPEEIASLVDTSIRNSSARRELGYFSCATGNPIDDCWRCDPQWQRHRKRLANCG  124

Query  538  IG  543
            IG
Sbjct  125  IG  126



>gb|AAZ31566.1| pectate lyase isoform 4 [Fragaria x ananassa]
Length=405

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+AS+V  SIRNS+ RR+LGYFSC TGNPIDDCWRCDP W  +R+RLA+CG
Sbjct  65   NEHAVDNPEEIASLVDTSIRNSSARRELGYFSCATGNPIDDCWRCDPQWQRHRKRLANCG  124

Query  538  IG  543
            IG
Sbjct  125  IG  126



>gb|AAZ31563.1| pectate lyase isoform 1 [Fragaria x ananassa]
Length=405

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+AS+V  SIRNS+ RR+LGYFSC TGNPIDDCWRCDP W  +R+RLA+CG
Sbjct  65   NEHAVDNPEEIASLVDTSIRNSSARRELGYFSCATGNPIDDCWRCDPQWQRHRKRLANCG  124

Query  538  IG  543
            IG
Sbjct  125  IG  126



>ref|XP_008359470.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 66-like [Malus domestica]
Length=393

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = +1

Query  214  WFGWGSTKVHLVCFDP*LCVCVSCAGINNVKRFWLS----LWFRLAEVEEALSKQAVDDP  381
            W G   T + + CF   +   +SC      +    S    +  R+AE +E  +  A ++P
Sbjct  10   WVGAFMTVLPVCCFAAAMVSEISCNSNGGTEELQSSSNSSMAARVAEDDEGFNWYAAENP  69

Query  382  EEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
            E++ASMV   IRNSTERRKLGY SC TGNPIDD WRCDPNWH NR+RLAD
Sbjct  70   EKIASMVDMRIRNSTERRKLGYVSCRTGNPIDDYWRCDPNWHKNRKRLAD  119



>ref|XP_008667903.1| PREDICTED: pectate lyase 8 isoform X1 [Zea mays]
 tpg|DAA38670.1| TPA: pectate lyase 8 [Zea mays]
Length=479

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE VA+ V  SIRNST RR LGY SCGTGNPIDDCWRCD +WH+NRQRLADCGIG
Sbjct  98   AVEDPEAVANDVHVSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHSNRQRLADCGIG  156



>ref|XP_009111089.1| PREDICTED: probable pectate lyase 1 [Brassica rapa]
 emb|CDY15517.1| BnaA08g28010D [Brassica napus]
Length=431

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      + N     +S   R  E+E   ++ AV +P+EVA    ++V  S RN TER
Sbjct  12   MCLFFFVGAMENKTHDKISSLSRSDEIE--WNRHAVTNPDEVADEVLALVEMSARNHTER  69

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  70   RKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  106



>ref|XP_010527219.1| PREDICTED: probable pectate lyase 10 [Tarenaya hassleriana]
Length=395

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            E++  + AV +PEE+ASMV  SIRNSTERRKLG+FSC TGNPIDDCWRCD  WH  R+RL
Sbjct  7    EDSWHEHAVKNPEEIASMVDMSIRNSTERRKLGFFSCATGNPIDDCWRCDQRWHLRRKRL  66

Query  526  ADCGIG  543
            A+C IG
Sbjct  67   ANCAIG  72



>ref|NP_001147553.1| pectate lyase 8 [Zea mays]
 gb|ACG27904.1| pectate lyase 8 precursor [Zea mays]
Length=467

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE VA+ V  SIRNST RR LGY SCGTGNPIDDCWRCD +WH+NRQRLADCGIG
Sbjct  99   AVEDPEAVANDVHVSIRNSTARRNLGYLSCGTGNPIDDCWRCDSDWHSNRQRLADCGIG  157



>emb|CDY18738.1| BnaC08g08780D [Brassica napus]
Length=476

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 4/65 (6%)
 Frame = +1

Query  361  KQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            + AV DP+    EVAS+V  S  N T RRKLG+FSCGTGNPIDDCWRCDPNWH NR+RLA
Sbjct  89   QHAVSDPDRVADEVASLVQMSEHNKTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLA  148

Query  529  DCGIG  543
            DCGIG
Sbjct  149  DCGIG  153



>emb|CDX86615.1| BnaC08g00880D [Brassica napus]
Length=431

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 4/66 (6%)
 Frame = +1

Query  358  SKQAVDDPEEVA----SMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            +K AV +P+EVA    ++   S+RN TERRKLGYF+CGTGNPIDDCWRCD NWH NR+RL
Sbjct  41   NKHAVTNPDEVADEVLALAEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKNRKRL  100

Query  526  ADCGIG  543
            ADCGIG
Sbjct  101  ADCGIG  106



>gb|KDO65869.1| hypothetical protein CISIN_1g013239mg [Citrus sinensis]
Length=447

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            EE   + AVD+P+E+A+ V  +IRNSTERRKLGYFSCGTGNPIDDCWRCD  W+  R+RL
Sbjct  59   EEWTHEHAVDNPDEIAATVDMAIRNSTERRKLGYFSCGTGNPIDDCWRCDSRWYLRRKRL  118

Query  526  ADCGIG  543
            ADC IG
Sbjct  119  ADCAIG  124



>ref|XP_006480190.1| PREDICTED: probable pectate lyase 8-like [Citrus sinensis]
Length=447

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            EE   + AVD+P+E+A+ V  +IRNSTERRKLGYFSCGTGNPIDDCWRCD  W+  R+RL
Sbjct  59   EEWTHEHAVDNPDEIAATVDMAIRNSTERRKLGYFSCGTGNPIDDCWRCDSRWYLRRKRL  118

Query  526  ADCGIG  543
            ADC IG
Sbjct  119  ADCAIG  124



>ref|XP_010457526.1| PREDICTED: probable pectate lyase 1 [Camelina sativa]
Length=432

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      + N     +S   R  E E   ++ AV +P+EVA    ++   S+RN TER
Sbjct  13   MCLLFFVGAMENTTHNKISSLPRSDETE--WNQHAVKNPDEVADEVLALTEMSVRNHTER  70

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  71   RKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  107



>ref|XP_003552152.2| PREDICTED: probable pectate lyase 20-like [Glycine max]
Length=451

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
             AL++ AVD+PEE+ASMV ESIRN T RR L +FSCG+GNPIDDCWRCD  W+  R+RLA
Sbjct  64   SALNEHAVDNPEEIASMVDESIRNYTARRNLNFFSCGSGNPIDDCWRCDKRWYARRKRLA  123

Query  529  DCGIG  543
            +CGIG
Sbjct  124  NCGIG  128



>ref|XP_009102476.1| PREDICTED: probable pectate lyase 10 [Brassica rapa]
Length=439

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            + A ++ AV++PEEVA++V  +IRNSTERRKLG+FSC TGNPIDDCWRCD NWH  R+RL
Sbjct  51   DSAWNEHAVENPEEVAALVDMTIRNSTERRKLGFFSCATGNPIDDCWRCDRNWHLRRKRL  110

Query  526  ADCGIG  543
            A+C IG
Sbjct  111  ANCAIG  116



>ref|XP_006854398.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
 gb|ERN15865.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
Length=457

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  EVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQ  519
            E E ++    V+DPE VASMV  SI N+T+RR+LG+FSCGTGNPIDDCWRCDP W   R+
Sbjct  67   ERERSVGPLQVEDPEMVASMVEMSIHNATQRRRLGFFSCGTGNPIDDCWRCDPLWARRRK  126

Query  520  RLADCGIG  543
            RLADCGIG
Sbjct  127  RLADCGIG  134



>ref|XP_002863927.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40186.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=411

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 3/76 (4%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD  495
            LS++F   +   + S+QAV++PEEVA+MV  SIRNSTERRKLGYFSC TGNPIDDCWRCD
Sbjct  16   LSMFFTGVD---STSEQAVENPEEVAAMVDMSIRNSTERRKLGYFSCSTGNPIDDCWRCD  72

Query  496  PNWHNNRQRLADCGIG  543
              W + R+ LA+C IG
Sbjct  73   RRWQSRRKALANCAIG  88



>ref|XP_011080166.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=405

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            + AVDDPE VA+MV  +IRNSTERRKLG+ SCGTGNPIDDCWRCD NW  +R+RLADC I
Sbjct  21   EHAVDDPEAVAAMVDMTIRNSTERRKLGFLSCGTGNPIDDCWRCDRNWIRHRRRLADCAI  80

Query  541  G  543
            G
Sbjct  81   G  81



>emb|CDY05305.1| BnaC05g44980D [Brassica napus]
Length=416

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 61/100 (61%), Gaps = 12/100 (12%)
 Frame = +1

Query  244  LVCFDP*LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNS  423
            L+ F   L V     G+N+ +              E   + AV+ PEEVA+MV  SIRNS
Sbjct  6    LILFASALLVTTLFVGVNSSRS------------NETWHEHAVEKPEEVAAMVDMSIRNS  53

Query  424  TERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            TERR+LGYFSC TGNPIDDCWRCD  W   R+RLADC IG
Sbjct  54   TERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCSIG  93



>emb|CDX77400.1| BnaA07g05380D [Brassica napus]
Length=492

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            + A ++ AV++PEEVA++V  +IRNSTERRKLG+FSC TGNPIDDCWRCD NWH  R+RL
Sbjct  51   DSAWNEHAVENPEEVAALVDMTIRNSTERRKLGFFSCATGNPIDDCWRCDRNWHLRRKRL  110

Query  526  ADCGIG  543
            A+C IG
Sbjct  111  ANCAIG  116



>gb|ADP09680.1| pectate lyase [Rosa x borboniana]
Length=448

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+AS+V  +IRNST RR LG+FSC TGNPIDDCWRCDP W  +R+RLA+CG
Sbjct  65   NEHAVDNPEEIASLVDTTIRNSTARRNLGFFSCATGNPIDDCWRCDPQWQRHRKRLANCG  124

Query  538  IG  543
            IG
Sbjct  125  IG  126



>ref|XP_009139642.1| PREDICTED: putative pectate lyase 14 [Brassica rapa]
Length=434

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            + AV DPEE+A+MV   IRNSTERR+LGYFSC TGNPIDDCWRCD  WH  R+RLA C I
Sbjct  51   EHAVKDPEEIAAMVDMKIRNSTERRRLGYFSCSTGNPIDDCWRCDKKWHRQRKRLASCAI  110

Query  541  G  543
            G
Sbjct  111  G  111



>emb|CDY46471.1| BnaC07g03950D [Brassica napus]
Length=439

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
            A ++ AV++PEEVA++V  +IRNSTERRKLG+FSC TGNPIDDCWRCD NWH  R+RLA+
Sbjct  53   AWNEHAVENPEEVAALVDMTIRNSTERRKLGFFSCATGNPIDDCWRCDRNWHLRRKRLAN  112

Query  532  CGIG  543
            C IG
Sbjct  113  CAIG  116



>emb|CDY01119.1| BnaA04g07000D [Brassica napus]
Length=435

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            + AV DPEE+A+MV   IRNSTERR+LGYFSC TGNPIDDCWRCD  WH  R+RLA C I
Sbjct  51   EHAVKDPEEIAAMVDMKIRNSTERRRLGYFSCSTGNPIDDCWRCDKKWHRQRKRLASCAI  110

Query  541  G  543
            G
Sbjct  111  G  111



>ref|XP_010488576.1| PREDICTED: probable pectate lyase 10 [Camelina sativa]
Length=442

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            +L+  + A ++ AV +PEEVA+MV  +I+NSTERR+LG+FSC TGNPIDDCWRCD NWH 
Sbjct  49   KLSNDDGAWNEHAVKNPEEVAAMVDMTIKNSTERRRLGFFSCATGNPIDDCWRCDRNWHL  108

Query  511  NRQRLADCGIG  543
             R+RLA+C IG
Sbjct  109  RRKRLANCAIG  119



>emb|CDY61137.1| BnaC05g48970D [Brassica napus]
Length=431

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            +C+      I N  +  +S   R  E E   +  AV +P+EVA    ++   S+RN TER
Sbjct  12   MCLLFFVGAIENSTQDKISSLSRSNENE--WNAHAVTNPDEVADEVIALAEMSVRNHTER  69

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  70   RKLGYFACGTGNPIDDCWRCDANWHKNRKRLADCGIG  106



>ref|XP_008800564.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=455

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVDDPE VAS V  +IRNST RR LGY SCGTGNPIDDCWRCD +WH +R RLADCG
Sbjct  71   AEGAVDDPEMVASTVQMTIRNSTARRALGYLSCGTGNPIDDCWRCDSDWHLHRTRLADCG  130

Query  538  IG  543
            IG
Sbjct  131  IG  132



>ref|XP_008800563.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=456

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVDDPE VAS V  +IRNST RR LGY SCGTGNPIDDCWRCD +WH +R RLADCG
Sbjct  72   AEGAVDDPEMVASTVQMTIRNSTARRALGYLSCGTGNPIDDCWRCDSDWHLHRTRLADCG  131

Query  538  IG  543
            IG
Sbjct  132  IG  133



>ref|XP_006307575.1| hypothetical protein CARUB_v10009197mg [Capsella rubella]
 gb|EOA40473.1| hypothetical protein CARUB_v10009197mg [Capsella rubella]
Length=431

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVA----SMVAESIRNSTER  432
            LC+      ++N     +S   R  + E   ++ AV +P+EVA    +M   S RN TER
Sbjct  12   LCLLFVVGAMDNTTHDKISSLPRSDDSE--WNQHAVTNPDEVADEVLAMTEMSARNHTER  69

Query  433  RKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            RKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  70   RKLGYFTCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  106



>emb|CDY24654.1| BnaA05g30530D [Brassica napus]
Length=416

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 61/100 (61%), Gaps = 12/100 (12%)
 Frame = +1

Query  244  LVCFDP*LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNS  423
            L+ F   L V     G+N+ +              E   + AV+ PEEVA+MV  SIRNS
Sbjct  6    LILFASALLVTTLFIGVNSSRS------------NETWHEHAVEKPEEVAAMVDMSIRNS  53

Query  424  TERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            TERR+LGYFSC TGNPIDDCWRCD  W   R+RLADC IG
Sbjct  54   TERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCSIG  93



>ref|XP_010513666.1| PREDICTED: probable pectate lyase 10 [Camelina sativa]
Length=442

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            +L+  + A ++ AV +PEEVA+MV  +I+NSTERR+LG+FSC TGNPIDDCWRCD NWH 
Sbjct  49   KLSNDDGAWNEHAVKNPEEVAAMVDMTIKNSTERRRLGFFSCATGNPIDDCWRCDRNWHL  108

Query  511  NRQRLADCGIG  543
             R+RLA+C IG
Sbjct  109  RRKRLANCAIG  119



>ref|XP_010466894.1| PREDICTED: probable pectate lyase 10 [Camelina sativa]
Length=441

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            RL+  + A ++ AV +PE+VA+MV  +I+NSTERR+LG+FSC TGNPIDDCWRCD NWH 
Sbjct  48   RLSNDDGAWNEHAVKNPEDVAAMVDMTIKNSTERRRLGFFSCATGNPIDDCWRCDRNWHL  107

Query  511  NRQRLADCGIG  543
             R+RLA+C IG
Sbjct  108  RRKRLANCAIG  118



>ref|XP_009119265.1| PREDICTED: probable pectate lyase 1 [Brassica rapa]
Length=431

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 4/70 (6%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVA----SMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            E   +  AV +P+EVA    ++   S+RN TERRKLGYF+CGTGNPIDDCWRCD NWH N
Sbjct  37   ENEWNTHAVTNPDEVADEVIALAEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDANWHKN  96

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  97   RKRLADCGIG  106



>ref|XP_009411363.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=454

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE VAS V   I NST RR LGY SCGTGNPIDDCWRCDP WH +R+RLADCGIG
Sbjct  73   AVDDPELVASEVDMMISNSTSRRALGYLSCGTGNPIDDCWRCDPEWHRHRKRLADCGIG  131



>ref|XP_002892236.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68495.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=432

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 4/70 (6%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVA----SMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            E   ++ AV +P+EVA    ++   S+RN TERRKLGYF+CGTGNPIDDCWRCD NWH N
Sbjct  38   ENEWNQHAVTNPDEVAGEVLALTEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDRNWHKN  97

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  98   RKRLADCGIG  107



>ref|XP_003622996.1| Pectate lyase 1-27 [Medicago truncatula]
 gb|AES79214.1| pectate lyase-like protein [Medicago truncatula]
Length=444

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
             +A+++ AVD+PEE+ASMV  +IRN TERR L +FSCGTGNP+DDCWRCD  W+  R+RL
Sbjct  56   HDAINEHAVDNPEEIASMVDTTIRNHTERRSLSFFSCGTGNPMDDCWRCDKLWYRRRKRL  115

Query  526  ADCGIG  543
            ADC IG
Sbjct  116  ADCAIG  121



>ref|XP_009147117.1| PREDICTED: probable pectate lyase 8 [Brassica rapa]
Length=416

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 61/100 (61%), Gaps = 12/100 (12%)
 Frame = +1

Query  244  LVCFDP*LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNS  423
            L+ F   L V     G+N+ +              E   + AV+ PEEVA+MV  SIRNS
Sbjct  6    LIFFASALLVTTLFIGVNSSRS------------NETWHEHAVEKPEEVAAMVDMSIRNS  53

Query  424  TERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            TERR+LGYFSC TGNPIDDCWRCD  W   R+RLADC IG
Sbjct  54   TERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCSIG  93



>gb|KFK39788.1| hypothetical protein AALP_AA3G287800 [Arabis alpina]
Length=437

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLAD  531
            A ++ AV +PEEVA++V  SIRNSTERR+LG+FSC TGNPIDDCWRCD NWH  R+RLA+
Sbjct  51   AWNEHAVKNPEEVAALVDMSIRNSTERRQLGFFSCATGNPIDDCWRCDRNWHLRRKRLAN  110

Query  532  CGIG  543
            C IG
Sbjct  111  CAIG  114



>ref|XP_010447044.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=417

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++PEEVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+RLA
Sbjct  30   ETWHEHAVENPEEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKRLA  89

Query  529  DCGIG  543
            DC IG
Sbjct  90   DCSIG  94



>ref|XP_010486231.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=419

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++PEEVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+RLA
Sbjct  32   ETWHEHAVENPEEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKRLA  91

Query  529  DCGIG  543
            DC IG
Sbjct  92   DCSIG  96



>ref|XP_010464311.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=417

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++PEEVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+RLA
Sbjct  30   ETWHEHAVENPEEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKRLA  89

Query  529  DCGIG  543
            DC IG
Sbjct  90   DCSIG  94



>gb|AAB71208.1| pectate lyase [Fragaria x ananassa]
 gb|AAZ31567.1| pectate lyase isoform 5 [Fragaria x ananassa]
Length=405

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  358  SKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            ++ AVD+PEE+AS+V  SIRNS+ RR+LGYFSC TGNPIDDCWRCDP W  +R+R A+CG
Sbjct  65   NEHAVDNPEEIASLVDTSIRNSSTRRELGYFSCATGNPIDDCWRCDPQWQRHRKRPANCG  124

Query  538  IG  543
            IG
Sbjct  125  IG  126



>ref|XP_002885665.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61924.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            + A ++ AV +PEEVA+MV  +I+NSTERR+LG+FSC TGNPIDDCWRCD NWH  R+RL
Sbjct  52   DGAWNEHAVKNPEEVAAMVDMTIKNSTERRRLGFFSCATGNPIDDCWRCDQNWHLRRKRL  111

Query  526  ADCGIG  543
            A+C IG
Sbjct  112  ANCAIG  117



>gb|KFK31278.1| hypothetical protein AALP_AA6G091900 [Arabis alpina]
Length=417

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++PEEVA+MV  SIRNSTERRKLGYFSC TGNPIDDCWRCD  W   R+ LA
Sbjct  30   ETRHEHAVENPEEVAAMVDMSIRNSTERRKLGYFSCSTGNPIDDCWRCDRKWQLRRKHLA  89

Query  529  DCGIG  543
            +CGIG
Sbjct  90   NCGIG  94



>ref|XP_010440536.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=462

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  346  EEALSKQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            EE        DPE    EVA +V  S +N T RRKLG+FSCGTGNPIDDCWRCDPNWH N
Sbjct  70   EEEQQHAVAADPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKN  129

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  130  RKRLADCGIG  139



>gb|KFK38096.1| hypothetical protein AALP_AA3G068900 [Arabis alpina]
Length=416

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 61/100 (61%), Gaps = 12/100 (12%)
 Frame = +1

Query  244  LVCFDP*LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNS  423
            L+ F   L +     G+N+ +              E   + AV +PEE+A+MV  SIRNS
Sbjct  6    LILFASALLITTLFIGVNSSRS------------NETWHEHAVKNPEEIAAMVDMSIRNS  53

Query  424  TERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            T+RRKLGYFSC TGNPIDDCWRCD  W   R+RLADC IG
Sbjct  54   TDRRKLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCSIG  93



>ref|XP_010440534.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=466

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  346  EEALSKQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            EE        DPE    EVA +V  S +N T RRKLG+FSCGTGNPIDDCWRCDPNWH N
Sbjct  74   EEEQQHAVAADPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKN  133

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  134  RKRLADCGIG  143



>ref|XP_010450168.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=461

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  346  EEALSKQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            EE        DPE    EVA +V  S +N T RRKLG+FSCGTGNPIDDCWRCDPNWH N
Sbjct  69   EEQQQHAVAVDPEKGADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKN  128

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  129  RKRLADCGIG  138



>ref|XP_010450167.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=465

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  346  EEALSKQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            EE        DPE    EVA +V  S +N T RRKLG+FSCGTGNPIDDCWRCDPNWH N
Sbjct  73   EEQQQHAVAVDPEKGADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKN  132

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  133  RKRLADCGIG  142



>ref|NP_189110.1| probable pectate lyase 10 [Arabidopsis thaliana]
 sp|Q9LJ42.2|PLY10_ARATH RecName: Full=Probable pectate lyase 10; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76935.1| probable pectate lyase 10 [Arabidopsis thaliana]
Length=440

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            +L   + A ++ AV +PEEVA+MV   I+NSTERR+LG+FSC TGNPIDDCWRCD NWH 
Sbjct  47   KLPNDDGAWNEHAVKNPEEVAAMVDMKIKNSTERRRLGFFSCATGNPIDDCWRCDRNWHL  106

Query  511  NRQRLADCGIG  543
             R+RLA+C IG
Sbjct  107  RRKRLANCAIG  117



>dbj|BAB01216.1| pectate lyase [Arabidopsis thaliana]
Length=449

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            +L   + A ++ AV +PEEVA+MV   I+NSTERR+LG+FSC TGNPIDDCWRCD NWH 
Sbjct  47   KLPNDDGAWNEHAVKNPEEVAAMVDMKIKNSTERRRLGFFSCATGNPIDDCWRCDRNWHL  106

Query  511  NRQRLADCGIG  543
             R+RLA+C IG
Sbjct  107  RRKRLANCAIG  117



>ref|NP_193057.4| putative pectate lyase 14 [Arabidopsis thaliana]
 gb|AEE83245.1| putative pectate lyase 14 [Arabidopsis thaliana]
Length=401

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 56/78 (72%), Gaps = 6/78 (8%)
 Frame = +1

Query  328  FRLAEVEEALS-----KQAVDDPEEVASMVAESIRNSTERRKLGYFS-CGTGNPIDDCWR  489
             R  E+ + LS     + AV DPEE+A+MV  SIRNST RRKLG+FS C TGNPIDDCWR
Sbjct  1    MRAQEIHQRLSDGEWHEHAVKDPEEIAAMVDMSIRNSTYRRKLGFFSSCSTGNPIDDCWR  60

Query  490  CDPNWHNNRQRLADCGIG  543
            CD  WH  R+RLADC IG
Sbjct  61   CDKKWHRRRKRLADCAIG  78



>ref|XP_006297767.1| hypothetical protein CARUB_v10013802mg [Capsella rubella]
 gb|EOA30665.1| hypothetical protein CARUB_v10013802mg [Capsella rubella]
Length=418

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV+ PEEVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+RLA
Sbjct  31   ETWHEHAVEKPEEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLA  90

Query  529  DCGIG  543
            DC IG
Sbjct  91   DCSIG  95



>ref|XP_002862216.1| hypothetical protein ARALYDRAFT_359757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38474.1| hypothetical protein ARALYDRAFT_359757 [Arabidopsis lyrata subsp. 
lyrata]
Length=200

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = +1

Query  310  FWLSLWFRLAEV---EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDD  480
              LS++F   +     E   + AV++PEEVA+MV  SIRNSTERR+LGYFSC TGNPIDD
Sbjct  14   LLLSMFFTGVDSTRSNETWHEHAVENPEEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDD  73

Query  481  CWRCDPNWHNNRQRLADCGIG  543
            CWRCD  W + R+ LA+C IG
Sbjct  74   CWRCDRRWQSRRKALANCAIG  94



>ref|XP_010933172.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
             VDDPE VAS V  SI+N T RR LGY SCGTGN IDDCWRCDP WH NR+RLADCGIG
Sbjct  45   TVDDPELVASEVLMSIKNHTMRRSLGYLSCGTGNSIDDCWRCDPKWHRNRKRLADCGIG  103



>emb|CAB41931.1| pectate lyase like protein [Arabidopsis thaliana]
 emb|CAB78363.1| pectate lyase like protein [Arabidopsis thaliana]
Length=418

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +1

Query  265  LCVCVSCAGINNVKRFWLSLWFRLAEVEEA-LSKQAVDDPEEVASMVAESIRNSTERRKL  441
            + V  +   I+     +L+L+  +  + +    + AV DPEE+A+MV  SIRNST RRKL
Sbjct  1    MVVARTLFSISATLIIFLALFLHVNALSDGEWHEHAVKDPEEIAAMVDMSIRNSTYRRKL  60

Query  442  GYFS-CGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            G+FS C TGNPIDDCWRCD  WH  R+RLADC IG
Sbjct  61   GFFSSCSTGNPIDDCWRCDKKWHRRRKRLADCAIG  95



>ref|XP_006297684.1| hypothetical protein CARUB_v10013715mg [Capsella rubella]
 gb|EOA30582.1| hypothetical protein CARUB_v10013715mg [Capsella rubella]
Length=442

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHN  510
            +L   + A ++ AV +P+EVA+MV  +I+NSTERR+LG+FSC TGNPIDDCWRCD NWH 
Sbjct  49   KLPNDDGAWNEHAVKNPDEVAAMVDMTIKNSTERRRLGFFSCATGNPIDDCWRCDRNWHL  108

Query  511  NRQRLADCGIG  543
             R+RLA+C IG
Sbjct  109  RRKRLANCAIG  119



>ref|XP_004515610.1| PREDICTED: probable pectate lyase 8-like [Cicer arietinum]
Length=443

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  VEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQR  522
            + ++ ++ AVD+PEE+ASMV  +IRN TERR L +FSCGTGNPIDDCWRCD  W+  R+R
Sbjct  54   LSDSFNEHAVDNPEEIASMVDTTIRNYTERRNLNFFSCGTGNPIDDCWRCDKRWYLRRKR  113

Query  523  LADCGIG  543
            L+DC IG
Sbjct  114  LSDCAIG  120



>ref|XP_002884619.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60878.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=416

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 12/100 (12%)
 Frame = +1

Query  244  LVCFDP*LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNS  423
            L+ F   L +     G+N+ +              E   + AV++P+EVA+MV  SIRNS
Sbjct  6    LILFASALLLTTLFIGVNSSRS------------NETWHEHAVENPDEVAAMVDMSIRNS  53

Query  424  TERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            TERR+LGYFSC TGNPIDDCWRCD  W   R+RLADC IG
Sbjct  54   TERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCSIG  93



>ref|NP_001141589.1| uncharacterized protein LOC100273705 [Zea mays]
 gb|ACF86672.1| unknown [Zea mays]
 gb|AFW57904.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
Length=466

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE VA+ V  SI N T RR LGY SCGTGNPIDDCWRCD +WHNNR+RLADCGIG
Sbjct  85   AVEDPEAVANDVHASINNITARRNLGYLSCGTGNPIDDCWRCDSDWHNNRKRLADCGIG  143



>ref|NP_187357.1| putative pectate lyase 8 [Arabidopsis thaliana]
 sp|Q9M8Z8.1|PLY8_ARATH RecName: Full=Probable pectate lyase 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF27005.1|AC016827_16 putative pectate lyase [Arabidopsis thaliana]
 dbj|BAH20216.1| AT3G07010 [Arabidopsis thaliana]
 gb|AEE74488.1| putative pectate lyase 8 [Arabidopsis thaliana]
Length=416

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++P+EVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+RLA
Sbjct  29   ETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLA  88

Query  529  DCGIG  543
            DC IG
Sbjct  89   DCSIG  93



>ref|XP_010933171.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=452

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
             VDDPE VAS V  SI+N T RR LGY SCGTGN IDDCWRCDP WH NR+RLADCGIG
Sbjct  71   TVDDPELVASEVLMSIKNHTMRRSLGYLSCGTGNSIDDCWRCDPKWHRNRKRLADCGIG  129



>ref|XP_010547043.1| PREDICTED: probable pectate lyase 8 [Tarenaya hassleriana]
Length=416

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV+ PEEVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+RLA
Sbjct  29   ETWHEHAVEHPEEVAAMVDMSIRNSTERRRLGYFSCTTGNPIDDCWRCDRKWQLRRKRLA  88

Query  529  DCGIG  543
            DC IG
Sbjct  89   DCAIG  93



>gb|AAM61584.1| putative pectate lyase [Arabidopsis thaliana]
Length=416

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++P+EVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+RLA
Sbjct  29   ETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLA  88

Query  529  DCGIG  543
            DC IG
Sbjct  89   DCSIG  93



>ref|XP_010435229.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=461

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  346  EEALSKQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            EE        DPE    EVA +V  S +N T RRKLG+FSCGTGNPIDDCWRCDPNWH N
Sbjct  69   EEDQQHAVAVDPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKN  128

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  129  RKRLADCGIG  138



>ref|XP_010532807.1| PREDICTED: probable pectate lyase 15 [Tarenaya hassleriana]
Length=452

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 6/75 (8%)
 Frame = +1

Query  331  RLAEVEEALSKQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDP  498
            RL  +E  L++ AV DP+    EVA++V  S +N+T RRKLGYFSCGTGNPIDDCWRCD 
Sbjct  57   RLEGIE--LNEHAVADPDKVADEVAALVEISEQNNTARRKLGYFSCGTGNPIDDCWRCDT  114

Query  499  NWHNNRQRLADCGIG  543
             WH NR+RLADCGIG
Sbjct  115  KWHKNRKRLADCGIG  129



>emb|CDY01151.1| BnaA04g06680D [Brassica napus]
Length=452

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 4/65 (6%)
 Frame = +1

Query  361  KQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            + AVDDP+    EV+++V  S  N T RRKLG+FSCGTGNPIDDCWRCD NWH NR+RLA
Sbjct  65   QHAVDDPDKVADEVSTLVQMSEHNITARRKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLA  124

Query  529  DCGIG  543
            DCGIG
Sbjct  125  DCGIG  129



>ref|XP_009139602.1| PREDICTED: probable pectate lyase 15 [Brassica rapa]
Length=451

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 4/65 (6%)
 Frame = +1

Query  361  KQAVDDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            + AVDDP+    EV+++V  S  N T RRKLG+FSCGTGNPIDDCWRCD NWH NR+RLA
Sbjct  64   QHAVDDPDKVADEVSTLVQMSEHNITARRKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLA  123

Query  529  DCGIG  543
            DCGIG
Sbjct  124  DCGIG  128



>ref|XP_010435301.1| PREDICTED: putative pectate lyase 14 isoform X1 [Camelina sativa]
Length=437

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            + AV DP+E+A+MV  SIRNST RRKLG+FSC TGNPIDDCWRCD  WH  R+RLA C I
Sbjct  54   EHAVKDPDEIAAMVDMSIRNSTYRRKLGFFSCSTGNPIDDCWRCDKKWHRQRKRLAGCAI  113

Query  541  G  543
            G
Sbjct  114  G  114



>ref|XP_004975048.1| PREDICTED: probable pectate lyase 15-like isoform X3 [Setaria 
italica]
Length=440

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE V   V  SIRNST RR L Y SCGTGNPIDDCWRCD +WH NRQRLADCGIG
Sbjct  59   AVEDPEAVVDDVHVSIRNSTARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIG  117



>ref|XP_010440665.1| PREDICTED: putative pectate lyase 14 [Camelina sativa]
Length=437

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            + AV DP+E+A+MV  SIRNST RRKLG+FSC TGNPIDDCWRCD  WH  R+RLA C I
Sbjct  54   EHAVKDPDEIAAMVDMSIRNSTYRRKLGFFSCSTGNPIDDCWRCDKKWHRQRKRLAGCAI  113

Query  541  G  543
            G
Sbjct  114  G  114



>ref|XP_010435302.1| PREDICTED: putative pectate lyase 14 isoform X2 [Camelina sativa]
Length=416

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            + AV DP+E+A+MV  SIRNST RRKLG+FSC TGNPIDDCWRCD  WH  R+RLA C I
Sbjct  33   EHAVKDPDEIAAMVDMSIRNSTYRRKLGFFSCSTGNPIDDCWRCDKKWHRQRKRLAGCAI  92

Query  541  G  543
            G
Sbjct  93   G  93



>ref|XP_008804450.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=426

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE VAS V  +I N T RR LGY SCGTGN IDDCWRCDP WH NR+RLADCGIG
Sbjct  45   AVDDPELVASEVHMTINNHTARRALGYLSCGTGNSIDDCWRCDPEWHRNRKRLADCGIG  103



>ref|XP_010450305.1| PREDICTED: putative pectate lyase 14 [Camelina sativa]
Length=437

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  QAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
             AV DP+E+A+MV  SIRNST RRKLG+FSC TGNPIDDCWRCD  WH  R+RLA C IG
Sbjct  55   HAVKDPDEIAAMVDMSIRNSTYRRKLGFFSCSTGNPIDDCWRCDKKWHRQRKRLAGCAIG  114



>ref|XP_009382167.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=427

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE VAS V   I+NST RR LGY SC TGNPIDDCWRCD  WH NR+RLADCGIG
Sbjct  46   AVDDPELVASEVHMMIKNSTARRALGYLSCSTGNPIDDCWRCDAEWHRNRKRLADCGIG  104



>ref|XP_008804449.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=451

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE VAS V  +I N T RR LGY SCGTGN IDDCWRCDP WH NR+RLADCGIG
Sbjct  70   AVDDPELVASEVHMTINNHTARRALGYLSCGTGNSIDDCWRCDPEWHRNRKRLADCGIG  128



>emb|CDX88845.1| BnaA03g08040D [Brassica napus]
Length=752

 Score =   100 bits (250),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  400  VAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            V  S+RN TERRKLGYF+CGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  6    VLMSVRNHTERRKLGYFACGTGNPIDDCWRCDANWHKNRKRLADCGIG  53



>ref|XP_004975047.1| PREDICTED: probable pectate lyase 15-like isoform X2 [Setaria 
italica]
Length=473

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE V   V  SIRNST RR L Y SCGTGNPIDDCWRCD +WH NRQRLADCGIG
Sbjct  92   AVEDPEAVVDDVHVSIRNSTARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIG  150



>ref|XP_004299169.1| PREDICTED: probable pectate lyase 18-like [Fragaria vesca subsp. 
vesca]
Length=412

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  352  ALSKQAVDDPEEVASMVAESIRN-STERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            A+S   V DPE V   V  SI N ST RRKLGY SCGTGNPIDDCWRCDPNW  NRQRLA
Sbjct  25   AVSSSPVQDPELVVQQVQRSIYNASTTRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQRLA  84

Query  529  DCGIG  543
            DC IG
Sbjct  85   DCAIG  89



>gb|ABR17766.1| unknown [Picea sitchensis]
Length=426

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  373  DDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            +DPE V  MV  SI NST RR+LGY SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  48   EDPESVVQMVQRSIDNSTRRRELGYLSCGTGNPIDDCWRCDPNWERNRKRLADCAIG  104



>gb|ACK38190.1| unknown [Medicago truncatula]
Length=328

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  310  FWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWR  489
            ++L L+  L  +   +S  +V DPE V   V  SI  S  RR LGY SCGTGNPIDDCWR
Sbjct  6    YFLILFALL--IPNFVSSSSVQDPELVVQDVQRSINVSRSRRNLGYLSCGTGNPIDDCWR  63

Query  490  CDPNWHNNRQRLADCGIG  543
            CDPNW NNRQRLADC IG
Sbjct  64   CDPNWENNRQRLADCAIG  81



>emb|CDX89799.1| BnaA10g02830D [Brassica napus]
Length=431

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVA----SMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNN  513
            E   +  AV +P+EVA    ++   S+RN TERRKLGYF+CGTGNPIDDCWRCD NW  N
Sbjct  37   ENEWNTHAVTNPDEVADEVIALAEMSVRNHTERRKLGYFTCGTGNPIDDCWRCDANWQKN  96

Query  514  RQRLADCGIG  543
            R+RLADCGIG
Sbjct  97   RKRLADCGIG  106



>ref|NP_001190715.1| putative pectate lyase 14 [Arabidopsis thaliana]
 sp|Q9SVQ6.2|PLY14_ARATH RecName: Full=Putative pectate lyase 14; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE83246.1| putative pectate lyase 14 [Arabidopsis thaliana]
Length=438

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +1

Query  361  KQAVDDPEEVASMVAESIRNSTERRKLGYFS-CGTGNPIDDCWRCDPNWHNNRQRLADCG  537
            + AV DPEE+A+MV  SIRNST RRKLG+FS C TGNPIDDCWRCD  WH  R+RLADC 
Sbjct  54   EHAVKDPEEIAAMVDMSIRNSTYRRKLGFFSSCSTGNPIDDCWRCDKKWHRRRKRLADCA  113

Query  538  IG  543
            IG
Sbjct  114  IG  115



>emb|CDY53564.1| BnaC04g55760D [Brassica napus]
Length=455

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 59/80 (74%), Gaps = 11/80 (14%)
 Frame = +1

Query  331  RLAEVEEALSKQ-AVDDPEEVASMVAESIR--------NSTERRKLGYFSCGTGNPIDDC  483
            RL  VE  L+KQ AVDDP++VA  V+  ++        N T RRKLG+FSCGTGNPIDDC
Sbjct  55   RLEGVE--LNKQHAVDDPDKVADEVSTLVKVLIFRSEHNITARRKLGFFSCGTGNPIDDC  112

Query  484  WRCDPNWHNNRQRLADCGIG  543
            WRCD NWH NR+RLADCGIG
Sbjct  113  WRCDRNWHKNRKRLADCGIG  132



>ref|XP_003618787.1| Pectate lyase [Medicago truncatula]
 gb|AES75005.1| pectate lyase family protein [Medicago truncatula]
 gb|AFK34950.1| unknown [Medicago truncatula]
Length=404

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  310  FWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWR  489
            ++L L+  L  +   +S  +V DPE V   V  SI  S  RR LGY SCGTGNPIDDCWR
Sbjct  6    YFLILFALL--IPNFVSSSSVQDPELVVQDVQRSINVSRSRRNLGYLSCGTGNPIDDCWR  63

Query  490  CDPNWHNNRQRLADCGIG  543
            CDPNW NNRQRLADC IG
Sbjct  64   CDPNWENNRQRLADCAIG  81



>gb|ABR17909.1| unknown [Picea sitchensis]
Length=429

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  337  AEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNR  516
            AE     +  A  DP+ +  MV  SI NST RR+LGY SCGTGNPIDDCWRCDPNW N+R
Sbjct  38   AEPANGNTTAAEKDPDSIVQMVQRSIDNSTRRRELGYLSCGTGNPIDDCWRCDPNWENHR  97

Query  517  QRLADCGIG  543
            +RLADC IG
Sbjct  98   KRLADCAIG  106



>gb|AAK66161.1| pectate lyase [Fragaria x ananassa]
Length=368

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNW  NR+RLADCGIG
Sbjct  1    SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIG  45



>ref|XP_004975046.1| PREDICTED: probable pectate lyase 15-like isoform X1 [Setaria 
italica]
Length=509

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE V   V  SIRNST RR L Y SCGTGNPIDDCWRCD +WH NRQRLADCGIG
Sbjct  128  AVEDPEAVVDDVHVSIRNSTARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIG  186



>gb|EPS63108.1| hypothetical protein M569_11679, partial [Genlisea aurea]
Length=382

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = +1

Query  370  VDDPEEVASMVAESIRNST-ERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            V+DPEEV+ MV  ++RN+T  RR+LGYFSCGTGNPIDDCWRC+P+W NNR++LADC IG
Sbjct  1    VEDPEEVSRMVTMAVRNATWRRRRLGYFSCGTGNPIDDCWRCNPDWQNNRKQLADCSIG  59



>gb|AGC94753.1| putative pectate lyase [Euphorbia lathyris]
Length=404

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +1

Query  304  KRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDC  483
            +  +L+  F L +    +S   V +PE VA  V +SI  +T RRKLG+ SCG+GNPIDDC
Sbjct  4    QHIFLTFSFLLLQALSFISSSPVQNPELVAEQVHKSI--NTTRRKLGFLSCGSGNPIDDC  61

Query  484  WRCDPNWHNNRQRLADCGIG  543
            WRCDPNW  NRQRLADC IG
Sbjct  62   WRCDPNWEKNRQRLADCAIG  81



>ref|XP_010918897.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE VAS V  +I N T RR LGY SCGTGN IDDCWRCDP WH NR+RLADCGIG
Sbjct  45   AVNDPELVASEVHMAINNHTARRSLGYLSCGTGNSIDDCWRCDPQWHRNRKRLADCGIG  103



>ref|XP_010558823.1| PREDICTED: probable pectate lyase 8 [Tarenaya hassleriana]
Length=418

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV+ P EVA+ V  SIRNSTERRKLGYFSC TGNPIDDCWRCD  WH  R+RLA
Sbjct  31   ETWHEDAVEHPHEVAATVDMSIRNSTERRKLGYFSCSTGNPIDDCWRCDRKWHLRRKRLA  90

Query  529  DCGIG  543
            +C IG
Sbjct  91   ECSIG  95



>ref|XP_010695977.1| PREDICTED: probable pectate lyase 18 [Beta vulgaris subsp. vulgaris]
Length=406

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAV-DDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRC  492
            L   F L      LS   V  DPE V   V  SI  S  RR LGY SCGTGNPIDDCWRC
Sbjct  7    LFFLFSLFAPSFVLSSPTVASDPELVVHEVHRSINESIARRSLGYLSCGTGNPIDDCWRC  66

Query  493  DPNWHNNRQRLADCGIG  543
            DPNWH NRQRLADC IG
Sbjct  67   DPNWHENRQRLADCAIG  83



>ref|XP_010918895.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=451

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV+DPE VAS V  +I N T RR LGY SCGTGN IDDCWRCDP WH NR+RLADCGIG
Sbjct  70   AVNDPELVASEVHMAINNHTARRSLGYLSCGTGNSIDDCWRCDPQWHRNRKRLADCGIG  128



>ref|XP_009111860.1| PREDICTED: probable pectate lyase 20 [Brassica rapa]
Length=418

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++P+EVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+ LA
Sbjct  31   ETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWKLRRKHLA  90

Query  529  DCGIG  543
            DC IG
Sbjct  91   DCSIG  95



>emb|CDY19932.1| BnaA09g03190D [Brassica napus]
Length=418

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++P+EVA+MV  SIRNSTERR+LGYFSC TGNPIDDCWRCD  W   R+ LA
Sbjct  31   ETWHEHAVENPDEVAAMVDMSIRNSTERRRLGYFSCSTGNPIDDCWRCDRKWKLRRKHLA  90

Query  529  DCGIG  543
            DC IG
Sbjct  91   DCSIG  95



>emb|CDY56668.1| BnaCnng30870D [Brassica napus]
Length=418

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AVD+P+EVA+MV  S RNSTERR+LGYFSC TGNPIDDCWRCD  W   R+ LA
Sbjct  31   ETWHEHAVDNPDEVAAMVDMSTRNSTERRRLGYFSCSTGNPIDDCWRCDRKWKLRRKHLA  90

Query  529  DCGIG  543
            DC IG
Sbjct  91   DCSIG  95



>ref|XP_009384552.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=457

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AVDDPE VA+ V  +I NST RR LGY SCGTGNPIDDCWRCD  WH +R+RLADCGIG
Sbjct  76   AVDDPELVANEVHMAISNSTARRALGYLSCGTGNPIDDCWRCDSEWHLHRKRLADCGIG  134



>ref|NP_568705.1| putative pectate lyase 20 [Arabidopsis thaliana]
 sp|Q93WF1.1|PLY20_ARATH RecName: Full=Probable pectate lyase 20; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK91420.1| AT5g48900/K19E20_1 [Arabidopsis thaliana]
 gb|AAK92730.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AED95740.1| putative pectate lyase 20 [Arabidopsis thaliana]
Length=417

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 12/100 (12%)
 Frame = +1

Query  244  LVCFDP*LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNS  423
            LV F   L + +   G+++ +              E   + AV++PEEVA+MV  SIRNS
Sbjct  7    LVVFASALLLSMFFTGVDSTRS------------NETWHEHAVENPEEVAAMVDMSIRNS  54

Query  424  TERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            T RR+LGYFSC TGNPIDDCWRCD  W + R+ LA+C IG
Sbjct  55   TARRRLGYFSCSTGNPIDDCWRCDRRWQSRRKHLANCAIG  94



>gb|AAM63307.1| pectate lyase [Arabidopsis thaliana]
Length=417

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 12/100 (12%)
 Frame = +1

Query  244  LVCFDP*LCVCVSCAGINNVKRFWLSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNS  423
            LV F   L + +   G+++ +              E   + AV++PEEVA+MV  SIRNS
Sbjct  7    LVVFASALLLSMFFTGVDSTRS------------NETWHEHAVENPEEVAAMVDMSIRNS  54

Query  424  TERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            T RR+LGYFSC TGNPIDDCWRCD  W + R+ LA+C IG
Sbjct  55   TARRRLGYFSCSTGNPIDDCWRCDRRWQSRRKHLANCAIG  94



>ref|XP_002863264.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39523.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +1

Query  316  LSLWFRLAEVEEA-LSKQAVDDPEEVASMVAESIRNSTERRKLGYFS-CGTGNPIDDCWR  489
            L+L+F +  + +    + AV DPEE+A++V  SIRNST RRKLG+FS C TGNPIDDCWR
Sbjct  18   LALFFHVNSLSDGEWHEHAVKDPEEIAALVDMSIRNSTYRRKLGFFSSCETGNPIDDCWR  77

Query  490  CDPNWHNNRQRLADCGIG  543
            CD  WH  R+RLA C IG
Sbjct  78   CDKKWHRRRKRLAGCAIG  95



>ref|XP_008812405.1| PREDICTED: probable pectate lyase 8 [Phoenix dactylifera]
Length=451

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            A D+PE VAS V  SI N T RR LG+ SCGTGNPIDDCWRCDP WH NR+RLA CGIG
Sbjct  70   AADNPELVASEVQMSINNHTMRRSLGFLSCGTGNPIDDCWRCDPKWHRNRKRLAGCGIG  128



>ref|XP_010109687.1| hypothetical protein L484_015172 [Morus notabilis]
 gb|EXC24157.1| hypothetical protein L484_015172 [Morus notabilis]
Length=444

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRL  525
            ++  ++ AV +P+E+A+MV  +IRN TERR LGYF+CGTGNPIDDCWRCD  WH  R+ L
Sbjct  56   DDIQNEHAVGNPDEIAAMVDMNIRNHTERRNLGYFTCGTGNPIDDCWRCDRRWHLRRKHL  115

Query  526  ADCGIG  543
            A+CGIG
Sbjct  116  ANCGIG  121



>ref|XP_010439830.1| PREDICTED: probable pectate lyase 20 [Camelina sativa]
Length=417

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  316  LSLWFRLAEV---EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCW  486
            LS++F   +     E   + AV++P+EVA+MV  SIRNST RR+LGYFSC TGNPIDDCW
Sbjct  16   LSMFFSGVDSTRSNETWHEHAVENPDEVAAMVDMSIRNSTARRRLGYFSCSTGNPIDDCW  75

Query  487  RCDPNWHNNRQRLADCGIG  543
            RCD  W   R+RLA+C IG
Sbjct  76   RCDRKWQFRRKRLANCAIG  94



>dbj|BAB10313.1| pectate lyase [Arabidopsis thaliana]
Length=393

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            E   + AV++PEEVA+MV  SIRNST RR+LGYFSC TGNPIDDCWRCD  W + R+ LA
Sbjct  7    ETWHEHAVENPEEVAAMVDMSIRNSTARRRLGYFSCSTGNPIDDCWRCDRRWQSRRKHLA  66

Query  529  DCGIG  543
            +C IG
Sbjct  67   NCAIG  71



>ref|NP_567409.1| probable pectate lyase 15 [Arabidopsis thaliana]
 sp|Q944R1.1|PLY15_ARATH RecName: Full=Probable pectate lyase 15; AltName: Full=Pectate 
lyase A11; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL11586.1|AF424592_1 AT4g13710/F18A5_100 [Arabidopsis thaliana]
 gb|AAM98277.1| At4g13710/F18A5_100 [Arabidopsis thaliana]
 gb|AEE83315.1| probable pectate lyase 15 [Arabidopsis thaliana]
Length=470

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = +1

Query  373  DDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            DDP+    EVA +V  S +N T RRKLG+FSCGTGNPIDDCWRCD NWH NR+RLADCGI
Sbjct  87   DDPDMVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGI  146

Query  541  G  543
            G
Sbjct  147  G  147



>ref|NP_001190720.1| probable pectate lyase 15 [Arabidopsis thaliana]
 gb|AEE83316.1| probable pectate lyase 15 [Arabidopsis thaliana]
Length=451

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = +1

Query  373  DDPE----EVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGI  540
            DDP+    EVA +V  S +N T RRKLG+FSCGTGNPIDDCWRCD NWH NR+RLADCGI
Sbjct  68   DDPDMVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGI  127

Query  541  G  543
            G
Sbjct  128  G  128



>gb|ABR17791.1| unknown [Picea sitchensis]
Length=420

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +1

Query  349  EALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLA  528
            ++ +  AV+DPE V  MV  SI +S  RR+LGYFSCGTGNPIDDCWRCDP+W  NR+RLA
Sbjct  26   QSSNSSAVEDPEMVVEMVERSINSS--RRQLGYFSCGTGNPIDDCWRCDPDWERNRKRLA  83

Query  529  DCGIG  543
            DCGIG
Sbjct  84   DCGIG  88



>emb|CDY66697.1| BnaAnng22760D [Brassica napus]
Length=447

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            L++ AV DP++VA ++  + +N TERRKLG+FSCG GN IDDCWRCDPNWH NR+RLADC
Sbjct  62   LNEHAVADPDQVA-LLQTNEQNITERRKLGFFSCGNGNVIDDCWRCDPNWHMNRKRLADC  120

Query  535  GIG  543
            G+G
Sbjct  121  GMG  123



>ref|XP_009102560.1| PREDICTED: probable pectate lyase 9 [Brassica rapa]
Length=447

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +1

Query  355  LSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADC  534
            L++ AV DP++VA ++  + +N TERRKLG+FSCG GN IDDCWRCDPNWH NR+RLADC
Sbjct  62   LNEHAVADPDQVA-LLQTNEQNITERRKLGFFSCGNGNLIDDCWRCDPNWHMNRKRLADC  120

Query  535  GIG  543
            G+G
Sbjct  121  GMG  123



>ref|XP_006476937.1| PREDICTED: probable pectate lyase 18-like [Citrus sinensis]
Length=449

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD  495
            LS++         +S  AV DPE V   V +SI  S  RR LGY SCGTGNPIDDCWRCD
Sbjct  53   LSIFLLFLMTPALISASAVPDPELVVHEVHKSINAS--RRNLGYLSCGTGNPIDDCWRCD  110

Query  496  PNWHNNRQRLADCGIG  543
            PNW  NRQRLADC IG
Sbjct  111  PNWEKNRQRLADCAIG  126



>ref|XP_010442341.1| PREDICTED: probable pectate lyase 20 [Camelina sativa]
 ref|XP_010482158.1| PREDICTED: probable pectate lyase 20 isoform X1 [Camelina sativa]
 ref|XP_010482159.1| PREDICTED: probable pectate lyase 20 isoform X2 [Camelina sativa]
Length=417

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  316  LSLWFRLAEV---EEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCW  486
            LS++F   +     E   + AV++P+EVA+MV  SI+NST RR+LGYFSC TGNPIDDCW
Sbjct  16   LSMFFSGVDSTRSNETWHEHAVENPDEVAAMVDMSIKNSTARRRLGYFSCSTGNPIDDCW  75

Query  487  RCDPNWHNNRQRLADCGIG  543
            RCD  W   R+RLA+C IG
Sbjct  76   RCDRKWQFRRKRLANCAIG  94



>ref|XP_004502359.1| PREDICTED: probable pectate lyase 22-like [Cicer arietinum]
Length=405

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  310  FWLSLWFRLAEVEEALSKQA-VDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCW  486
            F +SL  +   +  AL   + V+DPE V   V +SI  + +RRKLGY+SCGT NPIDDCW
Sbjct  3    FAMSLMLQFLFLAPALIYSSPVEDPESVVQQVQKSIIENEQRRKLGYYSCGTSNPIDDCW  62

Query  487  RCDPNWHNNRQRLADCGIG  543
            RCDPNW  NR+RLA+C IG
Sbjct  63   RCDPNWEMNRKRLAECAIG  81



>ref|XP_004152502.1| PREDICTED: probable pectate lyase 22-like [Cucumis sativus]
 gb|KGN64357.1| hypothetical protein Csa_1G049960 [Cucumis sativus]
Length=413

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV +PE V   V  SI N+T+RR LGY SCGTGNPIDDCWRCD NW  NRQRLADCGIG
Sbjct  32   AVSNPELVVQEVHRSIINATKRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLADCGIG  90



>ref|XP_008439105.1| PREDICTED: probable pectate lyase 22 [Cucumis melo]
Length=411

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  VDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            V DPE V   V  SI N+T+RR LGY SCGTGNPIDDCWRCD NW  NRQRLADCGIG
Sbjct  31   VSDPELVVQEVHRSIINATKRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLADCGIG  88



>ref|XP_004157771.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 22-like 
[Cucumis sativus]
Length=413

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  AVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            AV +PE V   V  SI N+T+RR LGY SCGTGNPIDDCWRCD NW  NRQRLADCGIG
Sbjct  32   AVSNPELVVQEVHRSIINATKRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLADCGIG  90



>ref|XP_007044917.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY00749.1| Pectate lyase family protein [Theobroma cacao]
Length=406

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  370  VDDPEEVASMVAESIRNST-ERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            V DPE+V   V ES+RN+T  RR LGY SCGTGNPIDDCWRCDP W  NRQRLADC IG
Sbjct  25   VQDPEQVVQQVNESVRNATIARRNLGYLSCGTGNPIDDCWRCDPRWEKNRQRLADCAIG  83



>gb|KDO69410.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=285

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  316  LSLWFRLAEVEEALSKQAVDDPEEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCD  495
            LS++         +   AV DPE V   V +SI  S  RR LGY SCGTGNPIDDCWRCD
Sbjct  8    LSIFLLFLMTPALILASAVPDPELVVHEVHKSINAS--RRNLGYLSCGTGNPIDDCWRCD  65

Query  496  PNWHNNRQRLADCGIG  543
            PNW  NRQRLADC IG
Sbjct  66   PNWEKNRQRLADCAIG  81



>ref|XP_002870357.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46616.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  382  EEVASMVAESIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            +EVA +V  S +N T RRKLG+FSCGTGNPIDDCWRCD NWH NR+RLADCGIG
Sbjct  108  DEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDRNWHKNRKRLADCGIG  161



>ref|XP_008460728.1| PREDICTED: probable pectate lyase 1 isoform X3 [Cucumis melo]
Length=369

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SIRNSTERRKLGYFSCGTGNPIDDCWRCDPNWHNNRQRLADCGIG  543
            SIRNSTERRKLG+FSCGTGNPIDDCWRCD NWH NR+RLA+CGIG
Sbjct  2    SIRNSTERRKLGFFSCGTGNPIDDCWRCDSNWHRNRKRLAECGIG  46



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 533345884428