BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6483_g1_i1 len=142 path=[259:0-141]

Length=142
                                                                      Score     E

gb|KDO36005.1|  hypothetical protein CISIN_1g041298mg                 68.6    6e-13   
ref|XP_006470748.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  69.7    2e-12   
ref|XP_009612037.1|  PREDICTED: methanol O-anthraniloyltransferas...  67.0    2e-12   
ref|XP_009612038.1|  PREDICTED: methanol O-anthraniloyltransferas...  66.6    2e-12   
ref|XP_006446264.1|  hypothetical protein CICLE_v10015163mg           69.3    3e-12   
ref|XP_006361592.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  68.2    7e-12   
gb|KDO44966.1|  hypothetical protein CISIN_1g0133462mg                65.1    9e-12   
ref|XP_004239236.1|  PREDICTED: methanol O-anthraniloyltransferas...  67.4    1e-11   
ref|XP_006470749.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  66.2    3e-11   
ref|XP_006470741.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  66.2    4e-11   
ref|XP_007208844.1|  hypothetical protein PRUPE_ppa025565mg           66.6    4e-11   
ref|XP_009778012.1|  PREDICTED: methanol O-anthraniloyltransferas...  65.9    5e-11   
ref|XP_007209120.1|  hypothetical protein PRUPE_ppa005455mg           65.9    5e-11   
ref|XP_008238035.1|  PREDICTED: methanol O-anthraniloyltransferas...  65.1    9e-11   
gb|AGK82816.1|  alcohol acyltransferase 2                             65.1    1e-10   
gb|KDP39574.1|  hypothetical protein JCGZ_02594                       63.5    1e-10   
ref|XP_008356442.1|  PREDICTED: methanol O-anthraniloyltransferas...  64.7    1e-10   
ref|XP_006470571.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  64.7    1e-10   
ref|XP_009759678.1|  PREDICTED: methanol O-anthraniloyltransferas...  64.7    1e-10   
gb|AIW04708.1|  alcohol acyltransferase 1                             64.7    1e-10   
ref|XP_009365763.1|  PREDICTED: methanol O-anthraniloyltransferas...  64.3    2e-10   
ref|XP_006470747.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  64.3    2e-10   
ref|XP_006446260.1|  hypothetical protein CICLE_v10015249mg           64.3    2e-10   
ref|XP_006470570.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  64.3    2e-10   
ref|XP_004244681.1|  PREDICTED: methanol O-anthraniloyltransferase    64.3    2e-10   
ref|XP_008238086.1|  PREDICTED: methanol O-anthraniloyltransferas...  64.3    2e-10   
ref|XP_006446267.1|  hypothetical protein CICLE_v10015194mg           63.9    2e-10   
gb|KDO39324.1|  hypothetical protein CISIN_1g045235mg                 60.8    3e-10   
ref|XP_009368754.1|  PREDICTED: methanol O-anthraniloyltransferas...  63.5    4e-10   
gb|AAN85436.1|  acyltransferase 2                                     63.5    4e-10   Capsicum chinense [bonnet pepper]
gb|KEH17125.1|  benzyl alcohol O-benzoyltransferase                   60.5    5e-10   
gb|KDP39576.1|  hypothetical protein JCGZ_02596                       62.8    6e-10   
ref|XP_006350348.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  62.8    6e-10   
ref|XP_002517500.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...  62.4    8e-10   Ricinus communis
ref|XP_010110383.1|  Benzyl alcohol O-benzoyltransferase              62.0    1e-09   
ref|XP_007029789.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  62.0    1e-09   
ref|XP_008797996.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  59.7    1e-09   
gb|AGW30201.1|  alcohol acyl transferase                              61.6    2e-09   
gb|KDP39569.1|  hypothetical protein JCGZ_02589                       60.8    2e-09   
ref|XP_008384757.1|  PREDICTED: methanol O-anthraniloyltransferas...  61.2    2e-09   
ref|XP_010110389.1|  Benzyl alcohol O-benzoyltransferase              61.6    2e-09   
ref|XP_004290447.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  61.2    2e-09   
ref|XP_004305015.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  60.8    2e-09   
ref|XP_008343918.1|  PREDICTED: methanol O-anthraniloyltransferas...  60.8    3e-09   
ref|XP_009368287.1|  PREDICTED: methanol O-anthraniloyltransferas...  60.8    3e-09   
ref|NP_001234496.1|  alcohol acyl transferase                         60.5    3e-09   
ref|NP_001275839.1|  alcohol acyl transferase                         60.5    4e-09   
ref|XP_006368249.1|  hypothetical protein POPTR_0001s00970g           60.5    4e-09   
ref|XP_006351055.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  60.5    4e-09   
ref|XP_003626388.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  60.5    5e-09   
gb|AGW30204.1|  truncated alcohol acyl transferase                    59.7    5e-09   
gb|KDO54865.1|  hypothetical protein CISIN_1g048162mg                 57.8    5e-09   
ref|XP_007029781.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  60.5    5e-09   
ref|XP_006446263.1|  hypothetical protein CICLE_v10015199mg           60.1    5e-09   
gb|AGW30205.1|  alcohol acyl transferase                              60.1    5e-09   
ref|XP_007029780.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  60.1    6e-09   
gb|AHC32224.2|  alcohol acyl transferase 1                            60.1    6e-09   
gb|AIZ00468.1|  alcohol acyl transferase                              58.2    6e-09   
ref|XP_009365780.1|  PREDICTED: methanol O-anthraniloyltransferas...  60.1    6e-09   
ref|XP_007029787.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  60.1    6e-09   
ref|XP_004294711.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  59.7    6e-09   
ref|XP_003616154.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  59.7    7e-09   
ref|XP_007029786.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  60.1    7e-09   
gb|AJD18611.1|  alcohol acyltransferase                               59.7    7e-09   
gb|AEM43830.1|  alcohol acyl transferase                              59.3    7e-09   
gb|AGW30203.1|  alcohol acyl transferase                              59.7    8e-09   
gb|AFK34239.1|  unknown                                               59.7    8e-09   
gb|KDO48023.1|  hypothetical protein CISIN_1g031330mg                 57.0    9e-09   
gb|AES82601.2|  benzyl alcohol O-benzoyltransferase                   59.7    9e-09   
ref|XP_003626383.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  59.7    9e-09   
ref|XP_008362881.1|  PREDICTED: methanol O-anthraniloyltransferas...  59.3    9e-09   
dbj|BAE72881.1|  benzoyl CoA benzoic acid benzoyltransferase          59.3    1e-08   Glandularia x hybrida [garden verbena]
gb|KEH33832.1|  benzyl alcohol O-benzoyltransferase                   57.0    1e-08   
gb|KEH40977.1|  benzyl alcohol O-benzoyltransferase                   58.9    1e-08   
ref|XP_007029790.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  58.9    1e-08   
gb|AAS79797.1|  alcohol acyl transferase                              58.9    1e-08   Malus domestica [apple tree]
gb|AAR99826.1|  alcohol acyl transferase                              58.9    1e-08   Malus domestica [apple tree]
ref|XP_009365778.1|  PREDICTED: methanol O-anthraniloyltransferas...  58.9    1e-08   
gb|AES82602.2|  benzyl alcohol O-benzoyltransferase                   56.6    1e-08   
ref|XP_010676997.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  56.6    1e-08   
emb|CBI29212.3|  unnamed protein product                              58.5    1e-08   
gb|KDO36030.1|  hypothetical protein CISIN_1g044203mg                 56.6    1e-08   
gb|AGW30202.1|  alcohol acyl transferase                              58.5    2e-08   
emb|CBI29213.3|  unnamed protein product                              56.2    2e-08   
ref|XP_003626384.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  56.6    2e-08   
ref|XP_002270240.1|  PREDICTED: methanol O-anthraniloyltransferase    58.5    2e-08   Vitis vinifera
gb|KHN41759.1|  Benzyl alcohol O-benzoyltransferase                   58.5    2e-08   
ref|XP_009589917.1|  PREDICTED: methanol O-anthraniloyltransferas...  58.2    2e-08   
ref|XP_003516503.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  58.2    2e-08   
ref|XP_004494963.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  58.2    3e-08   
ref|XP_011085899.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  58.2    3e-08   
gb|KEH40969.1|  benzyl alcohol O-benzoyltransferase                   58.2    3e-08   
gb|EYU41389.1|  hypothetical protein MIMGU_mgv1a006154mg              57.8    3e-08   
gb|EYU41386.1|  hypothetical protein MIMGU_mgv1a006089mg              57.8    3e-08   
ref|XP_009386561.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  57.8    3e-08   
ref|XP_008232530.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   57.8    4e-08   
ref|XP_009374085.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  57.8    4e-08   
ref|XP_002524020.1|  transferase, putative                            56.2    4e-08   Ricinus communis
gb|ACF07921.1|  alcohol acyl transferase                              57.8    4e-08   Prunus armeniaca
ref|XP_008364483.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  57.4    4e-08   
ref|XP_006484694.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  57.4    4e-08   
ref|XP_006437408.1|  hypothetical protein CICLE_v10031489mg           57.4    4e-08   
ref|XP_008391402.1|  PREDICTED: methanol O-anthraniloyltransferas...  57.4    4e-08   
gb|EYU31840.1|  hypothetical protein MIMGU_mgv1a019044mg              57.4    5e-08   
gb|AAS48090.1|  alcohol acyl transferase                              57.4    5e-08   Pyrus communis
gb|EYU41395.1|  hypothetical protein MIMGU_mgv1a006288mg              57.4    5e-08   
ref|XP_010549748.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  57.4    5e-08   
gb|EYU41388.1|  hypothetical protein MIMGU_mgv1a021683mg              57.0    5e-08   
ref|XP_006470742.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  57.4    6e-08   
ref|XP_006446261.1|  hypothetical protein CICLE_v10015234mg           57.4    6e-08   
ref|XP_011085897.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  57.4    6e-08   
ref|XP_008368021.1|  PREDICTED: methanol O-anthraniloyltransferas...  57.4    6e-08   
ref|XP_009388282.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   57.0    6e-08   
gb|EYU34530.1|  hypothetical protein MIMGU_mgv1a006233mg              57.0    7e-08   
ref|XP_010933015.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   54.7    7e-08   
gb|KHF99421.1|  Benzyl alcohol O-benzoyltransferase                   57.0    7e-08   
gb|KDP39567.1|  hypothetical protein JCGZ_02587                       57.0    7e-08   
gb|ADD62404.1|  fatty omega-hydroxyacid/fatty alcohol 0-hydroxyci...  56.6    8e-08   
ref|XP_002300497.2|  hypothetical protein POPTR_0001s45180g           56.6    8e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010918388.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  54.7    8e-08   
ref|XP_011041078.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  56.6    8e-08   
gb|ABX57719.1|  acyltransferase                                       56.6    8e-08   Vanda hybrid cultivar
ref|XP_010667734.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  55.5    9e-08   
gb|KEH40970.1|  benzyl alcohol O-benzoyltransferase                   56.6    9e-08   
ref|XP_003518844.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   56.6    9e-08   
ref|XP_004301775.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  56.6    9e-08   
ref|XP_006370717.1|  hypothetical protein POPTR_0001s45150g           56.2    9e-08   
ref|XP_006446721.1|  hypothetical protein CICLE_v10017956mg           56.2    9e-08   
ref|XP_006368247.1|  hypothetical protein POPTR_0001s00950g           56.6    1e-07   
gb|KEH40971.1|  benzyl alcohol O-benzoyltransferase                   56.6    1e-07   
gb|AFK36385.1|  unknown                                               56.6    1e-07   
gb|ACJ85557.1|  unknown                                               56.6    1e-07   Medicago truncatula
ref|XP_002298956.2|  hypothetical protein POPTR_0001s45160g           56.6    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011041077.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  56.6    1e-07   
gb|KHN31436.1|  Benzyl alcohol O-benzoyltransferase                   56.2    1e-07   
ref|XP_003520833.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  56.2    1e-07   
ref|XP_007029784.1|  Quinolizidine alkaloid O-tigloyltransferase      53.9    1e-07   
ref|XP_011016392.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  53.9    1e-07   
emb|CDP22130.1|  unnamed protein product                              53.9    1e-07   
ref|XP_009374321.1|  PREDICTED: methanol O-anthraniloyltransferas...  56.2    1e-07   
gb|ACV74416.1|  putative alcohol acyl transferase                     56.2    1e-07   Camellia sinensis [black tea]
gb|AES82607.2|  benzyl alcohol O-benzoyltransferase                   56.2    1e-07   
ref|XP_007209131.1|  hypothetical protein PRUPE_ppa005625mg           56.2    1e-07   
ref|XP_003626389.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  56.2    1e-07   
ref|XP_002319767.1|  transferase family protein                       55.8    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_002524021.1|  transferase, putative                            55.1    2e-07   Ricinus communis
ref|XP_007147131.1|  hypothetical protein PHAVU_006G098300g           55.5    2e-07   
gb|AJD25145.1|  benzoyl-CoA:benzyl alcohol O-benzoyltransferase       55.8    2e-07   
ref|XP_002325454.2|  transferase family protein                       55.8    2e-07   Populus trichocarpa [western balsam poplar]
emb|CBI37444.3|  unnamed protein product                              54.3    2e-07   
sp|Q3ZPN4.1|ACMAT_VITLA  RecName: Full=Methanol O-anthraniloyltra...  55.8    2e-07   Vitis labrusca [Concord grape]
gb|KDP39572.1|  hypothetical protein JCGZ_02592                       55.5    2e-07   
ref|XP_006588255.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  55.1    2e-07   
ref|XP_011012995.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  55.8    2e-07   
ref|XP_009336752.1|  PREDICTED: methanol O-anthraniloyltransferas...  55.8    2e-07   
ref|XP_009336751.1|  PREDICTED: methanol O-anthraniloyltransferas...  55.8    2e-07   
ref|XP_010644575.1|  PREDICTED: methanol O-anthraniloyltransferas...  55.8    2e-07   
gb|AAT68601.1|  benzoyl coenzyme A: benzyl alcohol benzoyl transf...  55.8    2e-07   Petunia x hybrida [garden petunia]
ref|XP_004243496.2|  PREDICTED: benzyl alcohol O-benzoyltransferase   55.8    2e-07   
ref|XP_007147136.1|  hypothetical protein PHAVU_006G098800g           55.5    2e-07   
ref|XP_002271603.1|  PREDICTED: methanol O-anthraniloyltransferase    55.5    2e-07   Vitis vinifera
emb|CBI25251.3|  unnamed protein product                              55.5    2e-07   
ref|XP_006600094.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  53.1    2e-07   
ref|XP_007031933.1|  HXXXD-type acyl-transferase family protein       55.5    2e-07   
ref|XP_011046333.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  55.5    2e-07   
ref|XP_011007948.1|  PREDICTED: methanol O-anthraniloyltransferas...  55.5    2e-07   
gb|KHN31434.1|  Benzyl alcohol O-benzoyltransferase                   55.5    2e-07   
ref|XP_008344828.1|  PREDICTED: methanol O-anthraniloyltransferas...  53.1    2e-07   
ref|XP_002265049.1|  PREDICTED: methanol O-anthraniloyltransferase    55.5    3e-07   Vitis vinifera
ref|XP_007147134.1|  hypothetical protein PHAVU_006G098600g           55.5    3e-07   
ref|XP_011009230.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  55.1    3e-07   
emb|CBI37443.3|  unnamed protein product                              55.5    3e-07   
emb|CDP09539.1|  unnamed protein product                              55.5    3e-07   
emb|CAN72252.1|  hypothetical protein VITISV_017467                   55.1    3e-07   Vitis vinifera
ref|XP_007147132.1|  hypothetical protein PHAVU_006G098400g           55.5    3e-07   
ref|XP_007029777.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  55.1    3e-07   
ref|XP_002319766.1|  hypothetical protein POPTR_0013s07230g           55.1    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004243495.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  55.1    3e-07   
dbj|BAJ92444.1|  predicted protein                                    55.1    3e-07   
emb|CAN74729.1|  hypothetical protein VITISV_042062                   55.1    3e-07   Vitis vinifera
ref|XP_009372579.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  55.1    3e-07   
ref|XP_002265841.1|  PREDICTED: methanol O-anthraniloyltransferase    55.1    3e-07   Vitis vinifera
ref|XP_002266420.1|  PREDICTED: methanol O-anthraniloyltransferase    55.1    3e-07   Vitis vinifera
ref|XP_011018694.1|  PREDICTED: methanol O-anthraniloyltransferas...  55.1    3e-07   
emb|CBI37442.3|  unnamed protein product                              55.1    3e-07   
ref|XP_010038484.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  55.1    3e-07   
gb|ABK96738.1|  unknown                                               55.1    3e-07   Populus trichocarpa x Populus deltoides
ref|XP_010665210.1|  PREDICTED: methanol O-anthraniloyltransferas...  54.7    3e-07   
ref|XP_011009229.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  55.1    3e-07   
ref|XP_007161685.1|  hypothetical protein PHAVU_001G089700g           55.1    3e-07   
gb|EYU41397.1|  hypothetical protein MIMGU_mgv1a024853mg              55.1    3e-07   
gb|KCW84614.1|  hypothetical protein EUGRSUZ_B01445                   54.7    3e-07   
ref|XP_002319765.2|  hypothetical protein POPTR_0013s07220g           55.1    4e-07   Populus trichocarpa [western balsam poplar]
gb|EYU41396.1|  hypothetical protein MIMGU_mgv1a005907mg              55.1    4e-07   
ref|XP_010045974.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  54.7    4e-07   
ref|XP_009803458.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  52.4    4e-07   
ref|XP_008779983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  52.4    4e-07   
ref|XP_002304071.1|  hypothetical protein POPTR_0003s01420g           54.7    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010040517.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  54.7    4e-07   
ref|XP_010040516.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  54.7    4e-07   
ref|XP_003521737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  54.7    4e-07   
gb|KDP41799.1|  hypothetical protein JCGZ_26817                       54.7    4e-07   
ref|XP_011040637.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  54.7    4e-07   
ref|XP_006377894.1|  hypothetical protein POPTR_0011s15660g           54.7    4e-07   
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  54.7    4e-07   
ref|XP_003634222.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  54.3    5e-07   
ref|XP_011046335.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  54.7    5e-07   
ref|XP_004156760.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...  54.7    5e-07   
gb|KCW60630.1|  hypothetical protein EUGRSUZ_H03354                   54.3    5e-07   
ref|XP_004151857.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  54.3    5e-07   
gb|KHN04051.1|  Benzyl alcohol O-benzoyltransferase                   54.3    6e-07   
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  54.3    6e-07   
ref|XP_010024179.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  54.3    6e-07   
ref|XP_002266114.1|  PREDICTED: methanol O-anthraniloyltransferas...  54.3    6e-07   Vitis vinifera
emb|CAN77583.1|  hypothetical protein VITISV_040970                   54.3    6e-07   Vitis vinifera
dbj|BAF49304.1|  putative acyltransferase                             54.3    6e-07   Clitoria ternatea
ref|XP_010665177.1|  PREDICTED: methanol O-anthraniloyltransferas...  53.9    6e-07   
ref|XP_008355599.1|  PREDICTED: methanol O-anthraniloyltransferas...  54.3    6e-07   
ref|XP_007029788.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  54.3    7e-07   
sp|Q5H873.1|HLTT_LUPAL  RecName: Full=13-hydroxylupanine O-tigloy...  54.3    7e-07   Lupinus albus
gb|ABN48480.1|  quinolizidine alkaloid O-tigloyltransferase           53.9    7e-07   Lupinus albus
ref|XP_003521736.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  53.9    7e-07   
ref|XP_010521555.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  53.9    7e-07   
ref|XP_010557037.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  53.9    8e-07   
ref|XP_011098396.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  53.9    8e-07   
ref|XP_007147133.1|  hypothetical protein PHAVU_006G098500g           53.9    8e-07   
ref|XP_010042878.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.2    9e-07   
ref|XP_002298962.2|  hypothetical protein POPTR_0001s45210g           53.9    9e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008373467.1|  PREDICTED: methanol O-anthraniloyltransferas...  53.9    9e-07   
ref|XP_006878641.1|  hypothetical protein AMTR_s00011p00264530        51.2    1e-06   
emb|CAN68818.1|  hypothetical protein VITISV_012041                   53.5    1e-06   Vitis vinifera
emb|CBI15706.3|  unnamed protein product                              53.9    1e-06   
ref|XP_003549135.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  53.5    1e-06   
ref|XP_002270962.1|  PREDICTED: methanol O-anthraniloyltransferas...  53.5    1e-06   Vitis vinifera
emb|CAN69948.1|  hypothetical protein VITISV_009219                   53.5    1e-06   Vitis vinifera
ref|XP_006878640.1|  hypothetical protein AMTR_s00011p00264480        51.2    1e-06   
ref|XP_008678444.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  53.5    1e-06   
sp|Q8GT21.1|BEBT_CLABR  RecName: Full=Benzyl alcohol O-benzoyltra...  53.5    1e-06   Clarkia breweri [fairy fans]
emb|CAA64636.1|  hsr201                                               53.1    1e-06   Nicotiana tabacum [American tobacco]
sp|Q8GT20.1|BEBT_TOBAC  RecName: Full=Benzyl alcohol O-benzoyltra...  53.1    1e-06   Nicotiana tabacum [American tobacco]
gb|ACT82248.1|  alcohol acyltransferase                               53.1    1e-06   Vasconcellea cundinamarcensis
ref|XP_007029779.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  52.4    1e-06   
ref|XP_009619718.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   53.1    1e-06   
ref|XP_008373476.1|  PREDICTED: methanol O-anthraniloyltransferas...  53.1    2e-06   
ref|XP_008359502.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  53.1    2e-06   
ref|XP_004498041.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  52.0    2e-06   
ref|XP_007029776.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  53.1    2e-06   
ref|XP_010275172.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   53.1    2e-06   
ref|XP_008379094.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  53.1    2e-06   
gb|KDP39568.1|  hypothetical protein JCGZ_02588                       53.1    2e-06   
ref|XP_004171600.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.4    2e-06   
ref|XP_009804829.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   52.8    2e-06   
gb|AGJ03151.1|  hydroxycinnamoyltransferase                           52.8    2e-06   
ref|XP_002298644.2|  hypothetical protein POPTR_0001s33390g           52.8    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  52.8    2e-06   
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  52.8    2e-06   
ref|XP_006470104.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  52.8    2e-06   
ref|XP_004982683.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  52.8    2e-06   
ref|XP_006447016.1|  hypothetical protein CICLE_v10015302mg           52.8    2e-06   
emb|CDP21409.1|  unnamed protein product                              52.8    2e-06   
gb|KDO63871.1|  hypothetical protein CISIN_1g014029mg                 52.8    2e-06   
ref|XP_003553956.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  52.8    2e-06   
gb|KEH40976.1|  benzyl alcohol O-benzoyltransferase                   52.4    2e-06   
ref|XP_010668237.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  50.4    2e-06   
ref|XP_006370913.1|  hypothetical protein POPTR_0019s01680g           52.4    2e-06   
gb|KDP32472.1|  hypothetical protein JCGZ_13397                       52.4    3e-06   
ref|XP_009378002.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  52.4    3e-06   
ref|XP_010926850.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  52.4    3e-06   
ref|XP_003574156.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   52.4    3e-06   
ref|XP_006370914.1|  hypothetical protein POPTR_0019s01690g           52.4    3e-06   
ref|XP_002264599.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   52.4    3e-06   Vitis vinifera
ref|XP_003626386.1|  Alcohol acetyltransferase                        52.4    3e-06   
ref|XP_009344220.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  52.4    3e-06   
ref|XP_004498016.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  52.0    3e-06   
ref|XP_004151707.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.2    3e-06   
ref|XP_007147137.1|  hypothetical protein PHAVU_006G098900g           52.0    3e-06   
ref|XP_010558858.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  52.0    4e-06   
ref|XP_003626382.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  52.0    4e-06   
ref|XP_002512898.1|  Anthranilate N-benzoyltransferase protein, p...  51.6    4e-06   Ricinus communis
ref|XP_010557044.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  52.0    4e-06   
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  51.6    4e-06   
ref|XP_010558859.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  51.6    5e-06   
ref|XP_008462818.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.6    5e-06   
ref|XP_009803457.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.6    5e-06   
ref|XP_003536235.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.6    5e-06   
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  51.6    5e-06   
gb|EPS68008.1|  hypothetical protein M569_06766                       51.6    5e-06   
ref|XP_008373466.1|  PREDICTED: methanol O-anthraniloyltransferas...  51.6    5e-06   
ref|XP_009803456.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.6    6e-06   
emb|CDP18599.1|  unnamed protein product                              51.6    6e-06   
ref|XP_004986643.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.6    6e-06   
ref|XP_006878638.1|  hypothetical protein AMTR_s00011p00264170        51.6    6e-06   
ref|XP_006856294.1|  hypothetical protein AMTR_s00047p00102350        51.2    6e-06   
ref|NP_186998.1|  acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase       51.2    6e-06   
gb|AAM61186.1|  putative hypersensitivity-related gene                51.2    6e-06   
ref|XP_009346788.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  51.2    6e-06   
ref|XP_004304535.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  51.2    7e-06   
ref|NP_001266678.1|  10-deacetylbaccatin III 10-O-acetyltransferase   51.2    7e-06   
ref|XP_010489657.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  51.2    7e-06   
ref|XP_010110923.1|  Omega-hydroxypalmitate O-feruloyl transferase    51.2    7e-06   
ref|XP_004986631.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.2    7e-06   
gb|KDO54861.1|  hypothetical protein CISIN_1g047129mg                 48.9    7e-06   
ref|XP_004304536.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  51.2    7e-06   
ref|XP_008239515.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  51.2    7e-06   
ref|NP_001064997.1|  Os10g0503300                                     51.2    8e-06   
ref|XP_008462816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.2    8e-06   
ref|XP_010672751.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  51.2    8e-06   
gb|AAG13627.1|AC078840_18  putative hypersensitivity-related (hsr...  51.2    8e-06   
ref|XP_004516455.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.8    8e-06   
ref|XP_002466979.1|  hypothetical protein SORBIDRAFT_01g017800        50.8    9e-06   
ref|XP_004297519.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.8    9e-06   
ref|XP_010249109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.8    9e-06   
ref|XP_007209159.1|  hypothetical protein PRUPE_ppa006018mg           50.8    9e-06   
gb|KHN28276.1|  Omega-hydroxypalmitate O-feruloyl transferase         50.4    1e-05   
ref|XP_004151058.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  50.8    1e-05   
ref|XP_003627912.1|  Taxadien-5-alpha-ol O-acetyltransferase          48.1    1e-05   
ref|XP_007038057.1|  HXXXD-type acyl-transferase family protein, ...  50.8    1e-05   
ref|XP_009381344.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.4    1e-05   
ref|XP_003536109.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  50.4    1e-05   
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.4    1e-05   
ref|XP_009381343.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.4    1e-05   
ref|XP_007038058.1|  HXXXD-type acyl-transferase family protein i...  50.1    1e-05   
ref|XP_011045747.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.1    2e-05   
ref|NP_001275190.1|  feruloyl transferase                             50.1    2e-05   
ref|XP_008231077.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.1    2e-05   
ref|XP_003549071.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.1    2e-05   
ref|XP_008341279.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.1    2e-05   
gb|KEH21938.1|  omega-hydroxypalmitate O-feruloyl transferase         50.1    2e-05   
ref|XP_004235315.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.1    2e-05   
ref|XP_009770247.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.1    2e-05   
gb|EMT25788.1|  10-deacetylbaccatin III 10-O-acetyltransferase        47.8    2e-05   
gb|ACY79409.1|  omega-hydroxyacid hydroxycinnamoyltransferase         50.1    2e-05   
ref|XP_010689157.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  50.1    2e-05   
dbj|BAK02525.1|  predicted protein                                    50.1    2e-05   
ref|XP_009600109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  50.1    2e-05   
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase    49.7    2e-05   
ref|XP_002444440.1|  hypothetical protein SORBIDRAFT_07g021930        49.7    2e-05   
gb|EYU23064.1|  hypothetical protein MIMGU_mgv1a006699mg              49.7    2e-05   
ref|XP_002321725.2|  hypothetical protein POPTR_0015s11290g           49.7    2e-05   
ref|XP_010689158.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  49.7    2e-05   
gb|KCW72711.1|  hypothetical protein EUGRSUZ_E01163                   49.7    2e-05   
ref|XP_002463957.1|  hypothetical protein SORBIDRAFT_01g009555        48.9    2e-05   
ref|XP_011023948.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  49.7    2e-05   
ref|XP_006446265.1|  hypothetical protein CICLE_v10017548mg           47.4    2e-05   
ref|XP_002443835.1|  hypothetical protein SORBIDRAFT_07g003030        49.3    3e-05   
gb|AIC83790.1|  alcohol acyltransferase                               49.7    3e-05   
ref|XP_010058392.1|  PREDICTED: methanol O-anthraniloyltransferas...  49.7    3e-05   
tpg|DAA49395.1|  TPA: 10-deacetylbaccatin III 10-O-acetyltransferase  49.3    3e-05   
ref|NP_001141054.1|  uncharacterized protein LOC100273135             49.3    3e-05   
ref|NP_001152518.1|  10-deacetylbaccatin III 10-O-acetyltransferase   49.3    3e-05   
ref|XP_010058391.1|  PREDICTED: methanol O-anthraniloyltransferas...  49.3    3e-05   
gb|KHN43217.1|  Benzyl alcohol O-benzoyltransferase                   49.3    3e-05   
emb|CDO98678.1|  unnamed protein product                              49.3    3e-05   
gb|KEH24545.1|  benzyl alcohol O-benzoyltransferase                   46.6    3e-05   
gb|ADB25239.1|  putative alcohol acyl transferase                     47.8    3e-05   
gb|KCW72712.1|  hypothetical protein EUGRSUZ_E01165                   48.9    3e-05   
ref|XP_010550256.1|  PREDICTED: LOW QUALITY PROTEIN: (Z)-3-hexen-...  49.3    3e-05   
emb|CAT00082.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  49.3    3e-05   
ref|XP_010250620.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  49.3    3e-05   
ref|XP_006844599.1|  hypothetical protein AMTR_s00016p00213830        48.9    4e-05   
ref|XP_010058393.1|  PREDICTED: methanol O-anthraniloyltransferas...  49.3    4e-05   
ref|XP_003554685.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  48.9    5e-05   
ref|XP_007215405.1|  hypothetical protein PRUPE_ppa005943mg           48.9    5e-05   
ref|XP_004506306.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  48.9    5e-05   
ref|XP_002511135.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...  48.5    6e-05   
ref|XP_011085895.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...  48.5    6e-05   
ref|XP_010689156.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  48.5    6e-05   
gb|KDP22581.1|  hypothetical protein JCGZ_26412                       48.1    7e-05   
ref|XP_010557036.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  48.1    7e-05   
ref|XP_008778437.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  48.1    7e-05   
gb|AAW51125.1|  putative alcohol acyl-transferases                    48.1    8e-05   
ref|XP_008374212.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  48.1    8e-05   
ref|XP_002884383.1|  chat-3-HEXEN-1-OL ACETYLTRANSFERASE              48.1    8e-05   
gb|ADL62856.1|  acyltransferase                                       48.1    8e-05   
ref|XP_009383405.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  47.8    1e-04   
ref|XP_009405177.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  48.1    1e-04   
gb|KCW72708.1|  hypothetical protein EUGRSUZ_E01160                   45.4    1e-04   
ref|XP_003528100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  47.8    1e-04   
ref|XP_006581855.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  47.8    1e-04   
gb|KFK38055.1|  hypothetical protein AALP_AA3G064400                  47.8    1e-04   
ref|XP_006436888.1|  hypothetical protein CICLE_v10031592mg           47.8    1e-04   
gb|KHN32561.1|  Omega-hydroxypalmitate O-feruloyl transferase         47.8    1e-04   
gb|KDO64448.1|  hypothetical protein CISIN_1g013997mg                 47.8    1e-04   
ref|XP_002298960.2|  hypothetical protein POPTR_0001s45190g           47.8    1e-04   
gb|EMS53476.1|  Omega-hydroxypalmitate O-feruloyl transferase         46.6    1e-04   
ref|XP_006408298.1|  hypothetical protein EUTSA_v10022248mg           47.8    1e-04   
ref|XP_010026248.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  47.8    1e-04   
ref|XP_009375174.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  47.4    1e-04   
ref|XP_007145940.1|  hypothetical protein PHAVU_007G280800g           47.4    1e-04   
ref|XP_009130369.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  47.4    1e-04   
ref|XP_010112404.1|  Omega-hydroxypalmitate O-feruloyl transferase    47.4    2e-04   
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  47.4    2e-04   
emb|CDY43120.1|  BnaA05g32660D                                        47.4    2e-04   
gb|ABR16407.1|  unknown                                               47.4    2e-04   
gb|ABR16595.1|  unknown                                               47.4    2e-04   
ref|XP_002524024.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...  47.4    2e-04   
emb|CDY50709.1|  BnaC05g47740D                                        47.4    2e-04   
gb|EMT31153.1|  2-alpha-hydroxytaxane 2-O-benzoyltransferase          47.4    2e-04   
gb|KHN43221.1|  Benzyl alcohol O-benzoyltransferase                   44.3    2e-04   
gb|AFK34995.1|  unknown                                               45.4    2e-04   
gb|KCW72714.1|  hypothetical protein EUGRSUZ_E01167                   46.6    3e-04   
ref|XP_010058394.1|  PREDICTED: methanol O-anthraniloyltransferas...  46.6    3e-04   
ref|XP_003591040.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  46.6    3e-04   
ref|XP_003626378.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  46.2    3e-04   
gb|AFK49108.1|  unknown                                               46.2    3e-04   
ref|XP_008660766.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  46.2    3e-04   
gb|KFK38057.1|  hypothetical protein AALP_AA3G064500                  46.6    4e-04   
ref|XP_004156786.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  46.2    4e-04   
gb|KFK38056.1|  hypothetical protein AALP_AA3G064500                  46.6    4e-04   
ref|XP_010667725.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  46.2    4e-04   
ref|XP_010436740.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  45.8    4e-04   
gb|EMS58180.1|  Omega-hydroxypalmitate O-feruloyl transferase         43.9    4e-04   
gb|KHN17483.1|  Omega-hydroxypalmitate O-feruloyl transferase         45.8    4e-04   
ref|XP_010554116.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  45.8    4e-04   
gb|EMT25787.1|  10-deacetylbaccatin III 10-O-acetyltransferase        45.8    5e-04   
ref|XP_008462820.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  45.8    5e-04   
ref|XP_004151858.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  45.8    5e-04   
gb|ACU16063.1|  unknown                                               44.7    5e-04   
ref|XP_007211147.1|  hypothetical protein PRUPE_ppa026958mg           43.5    6e-04   
ref|XP_010058385.1|  PREDICTED: methanol O-anthraniloyltransferas...  45.4    6e-04   
ref|XP_002438731.1|  hypothetical protein SORBIDRAFT_10g025140        45.4    6e-04   
ref|XP_010941428.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  45.4    7e-04   
ref|XP_010450554.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase    45.4    7e-04   
ref|XP_007147135.1|  hypothetical protein PHAVU_006G098700g           45.4    7e-04   
gb|KHN31437.1|  Benzyl alcohol O-benzoyltransferase                   43.1    7e-04   
ref|XP_003580168.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  45.4    7e-04   
ref|XP_003525421.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  45.4    7e-04   
ref|XP_010058390.1|  PREDICTED: methanol O-anthraniloyltransferas...  45.4    8e-04   
gb|KCW72709.1|  hypothetical protein EUGRSUZ_E01161                   45.4    8e-04   
ref|XP_011082158.1|  PREDICTED: methanol O-anthraniloyltransferas...  45.4    8e-04   
gb|KFK25971.1|  hypothetical protein AALP_AA8G186800                  45.4    8e-04   
ref|XP_006653585.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  44.7    8e-04   
gb|KHG11495.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...  45.1    9e-04   
gb|KHN23966.1|  Omega-hydroxypalmitate O-feruloyl transferase         45.1    0.001   
gb|KCW72707.1|  hypothetical protein EUGRSUZ_E01159                   45.1    0.001   



>gb|KDO36005.1| hypothetical protein CISIN_1g041298mg [Citrus sinensis]
Length=157

 Score = 68.6 bits (166),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LFL+AEAN  L +LG  I  P PYL +L YNVPG
Sbjct  94   NRKLMVDCNGEGILFLEAEANFKLEQLGGAIQPPCPYLEQLTYNVPG  140



>ref|XP_006470748.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=463

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LFL+AEAN  L +LG  I  P PYL +L YNVPG
Sbjct  94   NRKLMVDCNGEGILFLEAEANFKLEQLGGAIQPPCPYLEQLTYNVPG  140



>ref|XP_009612037.1| PREDICTED: methanol O-anthraniloyltransferase-like isoform X1 
[Nicotiana tomentosiformis]
Length=164

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDCNGEG LF++A+A V L KLGD I  P PYL +L YNVPG
Sbjct  90   DRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYNVPG  136



>ref|XP_009612038.1| PREDICTED: methanol O-anthraniloyltransferase-like isoform X2 
[Nicotiana tomentosiformis]
Length=150

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDCNGEG LF++A+A V L KLGD I  P PYL +L YNVPG
Sbjct  90   DRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYNVPG  136



>ref|XP_006446264.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
 gb|ESR59504.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
Length=464

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LFL+AEAN  L +LG  I  P PYL +L YNVPG
Sbjct  94   NRKLMVDCNGEGILFLEAEANFKLEQLGGAIQPPCPYLEQLTYNVPG  140



>ref|XP_006361592.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=447

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+V+CNGEG LF++A+ANV L KLGD I  P PYL  L +NVPG
Sbjct  88   NKKLMVNCNGEGVLFIEADANVELEKLGDSIKPPCPYLDLLLHNVPG  134



>gb|KDO44966.1| hypothetical protein CISIN_1g0133462mg, partial [Citrus sinensis]
Length=152

 Score = 65.1 bits (157),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKL--GDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF +AEAN+ L +L  GD +  P PYL +L YNVPG
Sbjct  91   NRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPCPYLHELLYNVPG  139



>ref|XP_004239236.1| PREDICTED: methanol O-anthraniloyltransferase-like [Solanum lycopersicum]
Length=448

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+V+CNGEG LF++A+ANV L KLGD I  P PY+  L +NVPG
Sbjct  88   NKKLMVNCNGEGVLFIEADANVELEKLGDSIKPPCPYMDLLLHNVPG  134



>ref|XP_006470749.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKL--GDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF +AEAN+ L +L  GD +  P PYL +L YNVPG
Sbjct  91   NRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPCPYLHELLYNVPG  139



>ref|XP_006470741.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKL--GDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF +AEAN+ L +L  GD +  P PYL +L YNVPG
Sbjct  91   NRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPCPYLHELLYNVPG  139



>ref|XP_007208844.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
 gb|EMJ10043.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
Length=558

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++A A+V L +LGD I  PSP+L +  YNVPG
Sbjct  90   NRKLMVECNGEGVLFIEANADVTLAQLGDTIAPPSPFLEEFLYNVPG  136



>ref|XP_009778012.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
sylvestris]
Length=461

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDCNGEG LF++A+A V L KLGD I  P PYL +L Y+VPG
Sbjct  90   DRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYSVPG  136



>ref|XP_007209120.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
 gb|EMJ10319.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
Length=460

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++A A+V L +LGD I  PSP+L +  YNVPG
Sbjct  89   NRKLMVECNGEGVLFIEANADVTLAQLGDTIAPPSPFLEEFLYNVPG  135



>ref|XP_008238035.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=460

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++A A+V L +LGD I  PSP+L +  YNVPG
Sbjct  89   NRKLMVECNGEGVLFMEANADVRLAQLGDTIAPPSPFLEEFLYNVPG  135



>gb|AGK82816.1| alcohol acyltransferase 2 [Solanum pimpinellifolium]
Length=447

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+V+CNGEG LF++ +ANV L KLG+ I  P PYL  L +NVPG
Sbjct  87   NKKLMVNCNGEGVLFIEGDANVELEKLGESIKPPCPYLDLLLHNVPG  133



>gb|KDP39574.1| hypothetical protein JCGZ_02594 [Jatropha curcas]
Length=281

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KLI+DCNGEG LF++A+ANV+L + GD +  P P+L +L ++VPG
Sbjct  33   NRKLIMDCNGEGVLFIEADANVSLDQSGDALQPPFPFLDELLFDVPG  79



>ref|XP_008356442.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+VDCNGEG LF++AEA+V L +LGD +  P P L    Y+VPG
Sbjct  90   NKKLMVDCNGEGVLFIEAEADVTLEQLGDTLQPPCPLLEDFLYDVPG  136



>ref|XP_006470571.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN EG LF++A+AN  L +LGD I  P PYL++L Y+VPG
Sbjct  91   NRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLLYDVPG  137



>ref|XP_009759678.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
sylvestris]
Length=444

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+V+CNGEG LF++A+AN+ L KLGD I  P PYL  L +NVPG
Sbjct  83   NKKLLVNCNGEGILFVEADANIELDKLGDSIKPPCPYLDILIHNVPG  129



>gb|AIW04708.1| alcohol acyltransferase 1 [Solanum pennellii]
Length=442

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+V+CNGEG LF++ +AN+ L KLG+ I  P PYL  L +NVPG
Sbjct  87   NKKLMVNCNGEGVLFIEGDANIELEKLGESIKPPCPYLDLLLHNVPG  133



>ref|XP_009365763.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=451

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+VDCNGEG LF++A+A+  L +LGD I  P P L +L +NVPG
Sbjct  88   NKKLMVDCNGEGVLFIEADADFTLEELGDTIRPPCPLLDELLFNVPG  134



>ref|XP_006470747.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=468

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN EG LF++A+AN  L +LGD I  P PYL++L Y+VPG
Sbjct  91   NRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLIYDVPG  137



>ref|XP_006446260.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
 gb|ESR59500.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
Length=445

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKL--GDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF +AE N+ L +L  GD +  P PYL +L YNVPG
Sbjct  91   NRKLMVDCNGEGVLFTEAEGNITLEQLEVGDAVRPPCPYLHELLYNVPG  139



>ref|XP_006470570.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN EG LF++A+AN  L +LGD I  P PYL++L Y+VPG
Sbjct  91   NRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLIYDVPG  137



>ref|XP_004244681.1| PREDICTED: methanol O-anthraniloyltransferase [Solanum lycopersicum]
 gb|AGK82804.1| alcohol acyltransferase 2 [Solanum lycopersicum]
Length=447

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+V+CNGEG LF++  ANV L KLG+ I  P PYL  L +NVPG
Sbjct  87   NKKLMVNCNGEGVLFIEGNANVELEKLGESIKPPCPYLDLLLHNVPG  133



>ref|XP_008238086.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=532

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++  A+V L +LGD I  PSP+L +  YNVPG
Sbjct  92   NRKLMVECNGEGVLFIEGNADVTLAQLGDTIAPPSPFLEEFLYNVPG  138



>ref|XP_006446267.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
 gb|ESR59507.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
Length=456

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N++L+V+CN EG LF++A+AN  L +LGD I  P PYL++L Y+VPG
Sbjct  91   NRRLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLLYDVPG  137



>gb|KDO39324.1| hypothetical protein CISIN_1g045235mg [Citrus sinensis]
Length=117

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            N+KL+VD NGEG LFL+ EAN  L +LGD I  P PYL +L YNVP
Sbjct  50   NRKLMVDRNGEGILFLEVEANFKLEQLGDAIKPPCPYLEQLIYNVP  95



>ref|XP_009368754.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+VDCNGEG LF++A+A+V L +LGD +  P P L    Y+VPG
Sbjct  90   NKKLMVDCNGEGVLFIEADADVTLEQLGDTLQPPCPVLEDFLYDVPG  136



>gb|AAN85436.1| acyltransferase 2 [Capsicum chinense]
Length=453

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN EG LF++A+ANV L KLGD I  P PYL  L +NVPG
Sbjct  93   NRKLMVNCNSEGVLFVEADANVELEKLGDSIKPPCPYLDLLLHNVPG  139



>gb|KEH17125.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=155

 Score = 60.5 bits (145),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG LF++A+A+V L++ GD +H P P L +L Y+VPG
Sbjct  88   RKLMVDCTGEGVLFIEADADVTLKQFGDALHPPFPCLGELIYDVPG  133



>gb|KDP39576.1| hypothetical protein JCGZ_02596 [Jatropha curcas]
Length=454

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KLI+DCNGEG LF++A+ANV+L + GD +  P P+L +L ++VPG
Sbjct  88   NRKLIMDCNGEGVLFIEADANVSLDQSGDALQPPFPFLDELLFDVPG  134



>ref|XP_006350348.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=453

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN EG +F++A+ANV L KLGD I  P PYL +L YN PG
Sbjct  90   NRKLMVNCNSEGIMFIEADANVELEKLGDSILPPCPYLEELLYNEPG  136



>ref|XP_002517500.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF45042.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=458

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KLIVDCNGEG LF++A+A++ + +LGD +  P P + +L Y+VPG
Sbjct  90   NRKLIVDCNGEGILFIEADADITIEQLGDSMQPPCPCIEELLYDVPG  136



>ref|XP_010110383.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26215.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=465

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF+ A+A+V   +LGD I  P P+L K  YNVPG
Sbjct  94   NRKLMVDCTGEGVLFVAAKADVGYDRLGDAIRPPCPFLDKFLYNVPG  140



>ref|XP_007029789.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10291.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=452

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+V L + GD +H P P L +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADVTLEQFGDELHPPFPCLDELLYDVPG  136



>ref|XP_008797996.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Phoenix 
dactylifera]
Length=182

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+V L + GD +  PSPYL +L Y+V G
Sbjct  88   RKLVVECTGEGVLFIEADADVRLEQFGDALQPPSPYLEELLYDVEG  133



>gb|AGW30201.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  YN PG
Sbjct  88   NRKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLYNFPG  134



>gb|KDP39569.1| hypothetical protein JCGZ_02589 [Jatropha curcas]
Length=347

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KLI++CNGEG LF++A+ANV+L + GD +  P P+L +L ++VPG
Sbjct  88   NRKLIMECNGEGVLFIEADANVSLDQSGDALQPPFPFLDELLFDVPG  134



>ref|XP_008384757.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NKKLVVDCNGEGILFVEASADVTLEQLGDXILPPCPLLEEFLFNFPG  134



>ref|XP_010110389.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26221.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=493

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KL+VDC GEG LF+ A+A+V   +LGD I  PSP+L +  YNVPG
Sbjct  94   NGKLMVDCTGEGVLFVAAKADVGFDQLGDAIRPPSPFLDQFLYNVPG  140



>ref|XP_004290447.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=463

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG LF++A+A+V LR+ GD +  P P L +L YNVPG
Sbjct  91   RKLMVDCTGEGILFIEADADVTLRQFGDALQPPFPCLEELLYNVPG  136



>ref|XP_004305015.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=445

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KL VDCNGEG LF++A+A+V+L +LGD +  P P+L    ++VPG
Sbjct  91   NGKLFVDCNGEGILFIEADADVSLEQLGDSLQPPCPFLEDFLFDVPG  137



>ref|XP_008343918.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
 gb|AAU14879.2| alcohol acyl transferase [Malus domestica]
 gb|AGW30200.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  YN PG
Sbjct  88   NRKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLYNFPG  134



>ref|XP_009368287.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=463

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NKKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134



>ref|NP_001234496.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AAS48091.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AFD29888.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AGK82805.1| alcohol acyltransferase 3 [Solanum lycopersicum]
 gb|AIW04709.1| alcohol acyltransferase 1 [Solanum lycopersicum]
Length=442

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+V+CNGEG LF++ +AN+ L KLG+ I  P PYL  L +NV G
Sbjct  87   NKKLMVNCNGEGVLFIEGDANIELEKLGESIKPPCPYLDLLLHNVHG  133



>ref|NP_001275839.1| alcohol acyl transferase [Citrus sinensis]
 gb|ABW81204.1| alcohol acyl transferase [Citrus sinensis]
Length=456

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN EG LF++A+AN  L +L D +  P PYL++L Y+VPG
Sbjct  91   NRKLMVECNAEGVLFIEADANFTLEQLRDDVQPPCPYLNQLIYDVPG  137



>ref|XP_006368249.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
 gb|ERP64818.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
Length=459

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KL+VDC GEG LFL+A+A+  L  L D I  P PYL +L YNVPG
Sbjct  94   KLLVDCTGEGVLFLEADADTTLELLEDTIQPPCPYLDQLLYNVPG  138



>ref|XP_006351055.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=447

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN EG +F++A+A V L KLGD I  P PYL  L +NVPG
Sbjct  87   NRKLMVNCNSEGIMFIEADAYVVLDKLGDSIKPPCPYLDLLLHNVPG  133



>ref|XP_003626388.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES82606.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=459

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++AEA+V L + GD +H P P   +L Y+VPG
Sbjct  89   RKLMVDCTGEGVMFIEAEADVTLDQFGDALHPPFPCFQQLLYDVPG  134



>gb|AGW30204.1| truncated alcohol acyl transferase [Malus domestica]
Length=323

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134



>gb|KDO54865.1| hypothetical protein CISIN_1g048162mg [Citrus sinensis]
Length=152

 Score = 57.8 bits (138),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLG-DFIHSPSPYLSKLQYNVPG  1
            N KL+VDCNGEG LF +A+A+ +L +LG D I  P PYL +L Y+VPG
Sbjct  92   NGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPG  139



>ref|XP_007029781.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10283.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=562

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+V L + GD +H P P   +L Y VPG
Sbjct  200  NRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPG  246



>ref|XP_006446263.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
 gb|ESR59503.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
Length=456

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN EG LF++A+AN  L +L D +  P PYL++L Y+VPG
Sbjct  91   NRKLMVECNAEGVLFIEADANFTLEQLRDDLQPPCPYLNQLIYDVPG  137



>gb|AGW30205.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NKKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134



>ref|XP_007029780.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10282.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=475

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+V L + GD +H P P   +L Y VPG
Sbjct  112  NRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPG  158



>gb|AHC32224.2| alcohol acyl transferase 1 [Eriobotrya japonica]
Length=459

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCN EG LF++A ANV L +LGD I  P P L +  +NVPG
Sbjct  88   NRKLVVDCNSEGILFVEAFANVTLEQLGDKILPPCPLLEEFLFNVPG  134



>gb|AIZ00468.1| alcohol acyl transferase, partial [Prunus armeniaca]
Length=227

 Score = 58.2 bits (139),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  4    NRKLMVECNGEGVLFIEANADVTLEQLGDRILPPCPVLEEFLFNPPG  50



>ref|XP_009365780.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+VDCNGEG LF +A+A+  L +LGD +  P P L    Y+VPG
Sbjct  90   NKKLMVDCNGEGVLFREADADFTLEQLGDTLQPPCPLLEDFLYDVPG  136



>ref|XP_007029787.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
 gb|EOY10289.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
Length=485

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+V L + GD +H P P   +L Y VPG
Sbjct  104  NRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPG  150



>ref|XP_004294711.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A+A+V L +LGD I  P P+L     +VPG
Sbjct  94   NRKLMVDCNGEGVLFVEAKADVTLEQLGDAIRPPCPFLEGFLCDVPG  140



>ref|XP_003616154.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES99112.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=460

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++AEA+V L + GD +H P P   +L Y+VPG
Sbjct  89   RKLMVDCTGEGVVFIEAEADVTLDQFGDALHPPFPCFQQLLYDVPG  134



>ref|XP_007029786.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
 gb|EOY10288.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
Length=525

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+V L + GD +H P P   +L Y VPG
Sbjct  112  NRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPG  158



>gb|AJD18611.1| alcohol acyltransferase [Pyrus ussuriensis]
Length=459

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++A ANV L +LGD I  P P L +  +N PG
Sbjct  88   NRKLVVNCNGEGILFVEASANVTLEQLGDKILPPCPLLEEFLFNFPG  134



>gb|AEM43830.1| alcohol acyl transferase [Fragaria x ananassa]
Length=391

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+VDC GEG LF++A A V L +LGD I  P P+L    +NVPG
Sbjct  43   NKKLMVDCTGEGILFVEANAEVTLDELGDAILPPCPFLDGFLFNVPG  89



>gb|AGW30203.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NRKLVVDCNGEGILFIEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134



>gb|AFK34239.1| unknown [Medicago truncatula]
Length=445

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++AEA+V L + GD +H P P   +L Y+VPG
Sbjct  89   RKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLYDVPG  134



>gb|KDO48023.1| hypothetical protein CISIN_1g031330mg [Citrus sinensis]
Length=161

 Score = 57.0 bits (136),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  87   NRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFDVPG  133



>gb|AES82601.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=502

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++AEA+V L + GD +H P P   +L Y+VPG
Sbjct  89   RKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLYDVPG  134



>ref|XP_003626383.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=510

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++AEA+V L + GD +H P P   +L Y+VPG
Sbjct  89   RKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLYDVPG  134



>ref|XP_008362881.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=468

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134



>dbj|BAE72881.1| benzoyl CoA benzoic acid benzoyltransferase [Verbena x hybrida]
Length=461

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KKL+VDC+GEG LF++AEA+V L + GD +  P P L +L Y+VPG
Sbjct  91   KKLMVDCSGEGVLFIEAEADVTLNQFGDALQPPFPCLEELLYDVPG  136



>gb|KEH33832.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=181

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+VDC GEG +F++AEANV L   GD +H P P + +L Y+VP
Sbjct  92   QKLMVDCTGEGVMFIEAEANVTLDDFGDGLHPPFPCVDELLYDVP  136



>gb|KEH40977.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=425

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG LF++A+A+V L++ GD +H P P L +L Y VPG
Sbjct  88   RKLMVDCTGEGVLFIEADADVTLKEFGDALHPPFPCLDELLYYVPG  133



>ref|XP_007029790.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10292.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=457

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            N+KL+VDCNGEGALF++A+A+V L + GD +  P P L +L Y+ P
Sbjct  90   NRKLMVDCNGEGALFVEADADVTLEQFGDALQPPFPCLHELLYDTP  135



>gb|AAS79797.1| alcohol acyl transferase [Malus domestica]
Length=459

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134



>gb|AAR99826.1| alcohol acyl transferase [Malus domestica]
Length=470

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134



>ref|XP_009365778.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLDEFLFNFPG  134



>gb|AES82602.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=153

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KL+VDC GEG +F++AE +V L + GD +H P P   +L Y+VPG
Sbjct  90   KLMVDCTGEGVMFIEAETDVTLDEFGDALHPPFPCFQELIYDVPG  134



>ref|XP_010676997.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=152

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KLIVDCN +GALF++A+ANV L ++   I  P P L +L Y+VPG
Sbjct  89   NQKLIVDCNNDGALFIEADANVTLEEIQAQILPPCPLLGELLYDVPG  135



>emb|CBI29212.3| unnamed protein product [Vitis vinifera]
Length=399

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I  P P   +L Y+VPG
Sbjct  33   NRKLLVDCTGEGVLFVEADADTTLEYLGDAIQPPCPCFEELLYDVPG  79



>gb|KDO36030.1| hypothetical protein CISIN_1g044203mg [Citrus sinensis]
Length=156

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLG-DFIHSPSPYLSKLQYNVPG  1
            + KL+VDCNGEG LF +A+A+ +L +LG D I  P PYL +L Y+VPG
Sbjct  92   DGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPG  139



>gb|AGW30202.1| alcohol acyl transferase, partial [Malus domestica]
Length=418

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  51   NRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  97



>emb|CBI29213.3| unnamed protein product [Vitis vinifera]
Length=152

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  65   NRKLLVDCTGEGVLFIEADADTTLEHLGDAIQPHCPCFEELLYDVPG  111



>ref|XP_003626384.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=196

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KL+VDC GEG +F++AE +V L + GD +H P P   +L Y+VPG
Sbjct  90   KLMVDCTGEGVMFIEAETDVTLDEFGDALHPPFPCFQELIYDVPG  134



>ref|XP_002270240.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=445

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I  P P   +L Y+VPG
Sbjct  89   NRKLLVDCTGEGVLFVEADADTTLEYLGDAIQPPCPCFEELLYDVPG  135



>gb|KHN41759.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=469

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL VDC+GEG LF++AEA+V+L++LG+ I  P P++ +L  +VPG
Sbjct  88   NRKLTVDCSGEGILFVEAEAHVSLKELGNSILPPCPHMKELLLDVPG  134



>ref|XP_009589917.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
tomentosiformis]
Length=444

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL+V+CNGEG LF++A+AN+ L KLG+ I  P  YL  + +NVPG
Sbjct  83   NKKLLVNCNGEGILFVEADANIELDKLGNSIKPPCTYLDLVIHNVPG  129



>ref|XP_003516503.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Glycine 
max]
Length=452

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL VDC+GEG LF++AEA+V+L++LG+ I  P P++ +L  +VPG
Sbjct  88   NRKLTVDCSGEGILFVEAEAHVSLKELGNSILPPCPHMKELLLDVPG  134



>ref|XP_004494963.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=456

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            N+KL+VDCNGEG +F++AEA+V L + GD +  P P   +L Y+ P
Sbjct  88   NRKLMVDCNGEGVMFIEAEADVTLDQFGDTLQPPFPCFQQLLYDAP  133



>ref|XP_011085899.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=464

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEGALF++A+A+V L++ GD +  P P L +L Y+VPG
Sbjct  90   RKLVVECTGEGALFIEADADVGLQQFGDTLQPPFPCLEELLYDVPG  135



>gb|KEH40969.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=458

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG LF++A+A+V+L++ G+ +H P P + +L Y+VPG
Sbjct  88   RKLMVDCTGEGVLFIEADADVSLKEFGEDLHPPFPCIDELLYDVPG  133



>gb|EYU41389.1| hypothetical protein MIMGU_mgv1a006154mg [Erythranthe guttata]
Length=455

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+V+C GEG +F++A+A+VAL++ GD +  P P L +L Y+VPG
Sbjct  85   DRKLVVECTGEGVMFIEADADVALQQFGDDLQPPFPCLEELLYDVPG  131



>gb|EYU41386.1| hypothetical protein MIMGU_mgv1a006089mg [Erythranthe guttata]
Length=458

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+V+C GEG +F++A+A+VAL++ GD +  P P L +L Y+VPG
Sbjct  85   DRKLVVECTGEGVMFIEADADVALQQFGDDLQPPFPCLDELLYDVPG  131



>ref|XP_009386561.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=460

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+++L + G+ +H P P+L +L ++VPG
Sbjct  98   RKLVVECTGEGVLFVEADADISLEQFGEALHPPLPFLGELLHDVPG  143



>ref|XP_008232530.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Prunus mume]
Length=461

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC  EG LF++A+A+V L++ GD +  P P L +L YNVPG
Sbjct  91   RKLMVDCTAEGILFIEADADVTLQQFGDALQPPFPCLEELLYNVPG  136



>ref|XP_009374085.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=458

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL V+C  EG +F++A+A++ L   GD +H P P L +L YNVPG
Sbjct  90   NRKLAVECTAEGIMFIEADADITLEHFGDNLHPPFPCLEELLYNVPG  136



>ref|XP_002524020.1| transferase, putative [Ricinus communis]
 gb|EEF38388.1| transferase, putative [Ricinus communis]
Length=244

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C  EG LF++A+ANV L + GD +  P P L +L ++VPG
Sbjct  90   NRKLVVECTSEGVLFIEADANVTLEQCGDALQPPFPLLDELLFDVPG  136



>gb|ACF07921.1| alcohol acyl transferase [Prunus armeniaca]
Length=453

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  87   NRKLMVECNGEGVLFIEANADVTLEQLGDRILPPCPVLEEFLFNPPG  133



>ref|XP_008364483.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=437

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            N+KL+VDCNGEG LF++A ANV L +LGD I  P P L +  +N P
Sbjct  66   NRKLMVDCNGEGILFVEAFANVTLEQLGDKILPPCPLLEEFLFNFP  111



>ref|XP_006484694.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Citrus sinensis]
Length=458

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  87   NRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFDVPG  133



>ref|XP_006437408.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
 gb|ESR50648.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
Length=458

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  87   NRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFDVPG  133



>ref|XP_008391402.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LGD I  P P L +   N PG
Sbjct  88   NRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLVNFPG  134



>gb|EYU31840.1| hypothetical protein MIMGU_mgv1a019044mg [Erythranthe guttata]
Length=436

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KLIVDC GEGA+F++AEAN A+R+LGD +      L KL Y++PG
Sbjct  91   KLIVDCTGEGAVFVEAEANCAIRQLGDTLKLDHSTLCKLVYDIPG  135



>gb|AAS48090.1| alcohol acyl transferase [Pyrus communis]
Length=442

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NRKLMVNCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134



>gb|EYU41395.1| hypothetical protein MIMGU_mgv1a006288mg [Erythranthe guttata]
Length=449

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG +F++A+A+VAL + GD I  P P L +L Y+VPG
Sbjct  90   RKLVVECTGEGVMFIEADADVALEQFGDEIRPPVPCLDELLYDVPG  135



>ref|XP_010549748.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Tarenaya 
hassleriana]
Length=456

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KLIVDCNGEGA+F++A+ +VAL   G ++H P P L +L ++  G
Sbjct  98   NGKLIVDCNGEGAMFVEADTDVALDDFGQYLHPPFPCLEELLFDTEG  144



>gb|EYU41388.1| hypothetical protein MIMGU_mgv1a021683mg [Erythranthe guttata]
Length=418

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG +F++A+A+VAL + GD I  P P L +L Y+VPG
Sbjct  90   RKLVVECTGEGVMFIEADADVALEQFGDEIRPPVPCLDELLYDVPG  135



>ref|XP_006470742.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=447

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLG-DFIHSPSPYLSKLQYNVPG  1
            KL+VDCNGEG LF +A+A+ +L +LG D I  P PYL +L Y+VPG
Sbjct  94   KLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPG  139



>ref|XP_006446261.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
 gb|ESR59501.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
Length=447

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLG-DFIHSPSPYLSKLQYNVPG  1
            KL+VDCNGEG LF +A+A+ +L +LG D I  P PYL +L Y+VPG
Sbjct  94   KLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPG  139



>ref|XP_011085897.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=465

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEGALF++A+A+V L++ GD +  P P L +L Y+VPG
Sbjct  90   RKLVVECTGEGALFIEADADVRLQQFGDTLQPPFPCLEELLYDVPG  135



>ref|XP_008368021.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=455

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KL VDCNGEG LF++A A+V L +LGD I  P P L +  +N PG
Sbjct  88   NXKLXVDCNGEGILFVEASADVTLEQLGDXILPPCPLLEEFLFNFPG  134



>ref|XP_009388282.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Musa acuminata 
subsp. malaccensis]
Length=457

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+V L + GD +  P P L +L YNVPG
Sbjct  88   RKLVVECTGEGILFIEADADVRLEQFGDELQPPFPCLEELVYNVPG  133



>gb|EYU34530.1| hypothetical protein MIMGU_mgv1a006233mg [Erythranthe guttata]
Length=451

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+V+C GEG +F++A+A+V+L++ GD +  P P L +L Y+VPG
Sbjct  85   DRKLVVECTGEGVMFIEADADVSLQQFGDDLQPPFPCLEELLYDVPG  131



>ref|XP_010933015.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Elaeis guineensis]
Length=160

 Score = 54.7 bits (130),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+V L + GD +  P P L +L YNV G
Sbjct  88   RKLVVECTGEGVLFIEADADVRLEQFGDALQPPFPCLEELLYNVEG  133



>gb|KHF99421.1| Benzyl alcohol O-benzoyltransferase [Gossypium arboreum]
Length=454

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++A+A+V L + GD +  P P L +L Y+VPG
Sbjct  91   RKLMVDCTGEGLMFIEADADVTLEQFGDVLQPPFPCLEELLYDVPG  136



>gb|KDP39567.1| hypothetical protein JCGZ_02587 [Jatropha curcas]
Length=444

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+VAL + GD I  P P   +L ++VPG
Sbjct  88   NRKLVVECTGEGILFVEADADVALDQFGDAIRPPFPCFGELLFDVPG  134



>gb|ADD62404.1| fatty omega-hydroxyacid/fatty alcohol 0-hydroxycinnamoyl transferase 
1 [Quercus suber]
Length=419

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KLIVDCNGEGA+F++AEAN +++++GD        L KL Y++PG
Sbjct  76   KLIVDCNGEGAIFVEAEANCSMKEIGDITKPDPETLRKLVYDIPG  120



>ref|XP_002300497.2| hypothetical protein POPTR_0001s45180g [Populus trichocarpa]
 gb|EEE85302.2| hypothetical protein POPTR_0001s45180g [Populus trichocarpa]
Length=465

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            + KLIVDC GEG LF++A+A+  + + GD I SP P   +L YNVPG
Sbjct  89   DNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQELLYNVPG  135



>ref|XP_010918388.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Elaeis guineensis]
Length=192

 Score = 54.7 bits (130),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+AN+ L + GD +  P P L +L Y++PG
Sbjct  89   RKLVVECTGEGVLFIEAKANIRLEQFGDQLPPPVPCLEELLYDIPG  134



>ref|XP_011041078.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Populus euphratica]
Length=463

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            + KLIVDC GEG LF++A+A+  + + GD I SP P   +L YNVPG
Sbjct  87   DNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQELLYNVPG  133



>gb|ABX57719.1| acyltransferase [Vanda hybrid cultivar]
Length=447

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KKL VDC GEG LF++AEA+V L+  GD +H P P L +L ++V G
Sbjct  89   KKLFVDCTGEGVLFIEAEADVKLKDFGDALHPPFPCLEELLFDVDG  134



>ref|XP_010667734.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Beta vulgaris subsp. vulgaris]
Length=262

 Score = 55.5 bits (132),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+CNGEG +F++A+A+V L + GD I  P P    L Y+VPG
Sbjct  100  RKLVVECNGEGIIFIEADADVTLEEFGDIIQPPFPLKQLLFYDVPG  145



>gb|KEH40970.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=436

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG LF++A+A+V+L++ GD +  P P L +L ++VPG
Sbjct  65   RKLMVDCTGEGVLFIEADADVSLKEFGDALQPPFPCLDELLFDVPG  110



>ref|XP_003518844.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Glycine max]
Length=459

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG LF++A+A+V L++ GD +  P P   +L Y+VPG
Sbjct  88   RKLMVDCTGEGVLFIEADADVTLKQFGDALQPPFPCWEELLYDVPG  133



>ref|XP_004301775.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KL+VDCNGEG +F++A+A+V L +LGD +  P  +L    ++VPG
Sbjct  90   NGKLLVDCNGEGIVFIEADADVTLEQLGDSLQPPCSFLEDFLFDVPG  136



>ref|XP_006370717.1| hypothetical protein POPTR_0001s45150g, partial [Populus trichocarpa]
 gb|ERP67286.1| hypothetical protein POPTR_0001s45150g, partial [Populus trichocarpa]
Length=334

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            + KLIVDC GEG LF++A+A+  + + GD I SP P   +L YNVPG
Sbjct  89   DNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQELLYNVPG  135



>ref|XP_006446721.1| hypothetical protein CICLE_v10017956mg [Citrus clementina]
 gb|ESR59961.1| hypothetical protein CICLE_v10017956mg [Citrus clementina]
Length=395

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CN +G LF+  +AN  L +LGD I  P PYL++L Y+VPG
Sbjct  72   NRKLMVECNAKGVLFID-DANFTLEQLGDDIQPPCPYLNQLLYDVPG  117



>ref|XP_006368247.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
 gb|ERP64816.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
Length=462

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -2

Query  141  NKKLIVDCNGE-GALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDC GE G LF++A+A++ L  LGD I  P PYL    Y++PG
Sbjct  95   SRKLMVDCTGELGVLFIEADADITLEHLGDAIQPPCPYLEHFLYDIPG  142



>gb|KEH40971.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=461

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDCN EG LF++A+A+V L + G+ +H P P + +L Y+VPG
Sbjct  87   SRKLMVDCNDEGILFIEADADVTLEQFGEDLHPPFPCIDELLYDVPG  133



>gb|AFK36385.1| unknown [Medicago truncatula]
Length=459

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG LF++A+A+V+L++ GD +  P P L +L ++VPG
Sbjct  88   RKLMVDCTGEGVLFIEADADVSLKEFGDALQPPFPCLDELLFDVPG  133



>gb|ACJ85557.1| unknown [Medicago truncatula]
Length=459

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG LF++A+A+V+L++ GD +  P P L +L ++VPG
Sbjct  88   RKLMVDCTGEGVLFIEADADVSLKEFGDALQPPFPCLDELLFDVPG  133



>ref|XP_002298956.2| hypothetical protein POPTR_0001s45160g [Populus trichocarpa]
 gb|EEE83761.2| hypothetical protein POPTR_0001s45160g [Populus trichocarpa]
Length=465

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            + KLIVDC GEG LF++A+A+  + + GD I SP P   +L YNVPG
Sbjct  89   DNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQELLYNVPG  135



>ref|XP_011041077.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Populus euphratica]
Length=467

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            + KLIVDC GEG LF++A+A+  + + GD I SP P   +L YNVPG
Sbjct  87   DNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQELLYNVPG  133



>gb|KHN31436.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=440

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            + KL+VDC GEG LF++A+A+V L +LGD +  P P   +L YNVP
Sbjct  82   DHKLMVDCTGEGVLFIEADADVTLDQLGDALQPPFPCFEQLLYNVP  127



>ref|XP_003520833.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=452

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            + KL+VDC GEG LF++A+A+V L +LGD +  P P   +L YNVP
Sbjct  94   DHKLMVDCTGEGVLFIEADADVTLDQLGDALQPPFPCFEQLLYNVP  139



>ref|XP_007029784.1| Quinolizidine alkaloid O-tigloyltransferase [Theobroma cacao]
 gb|EOY10286.1| Quinolizidine alkaloid O-tigloyltransferase [Theobroma cacao]
Length=147

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            N+KL+VDC GEG LF+K +A+V L + G+ +  P P L +L YNVP
Sbjct  33   NRKLMVDCIGEGVLFIKVDADVKLEQFGEELLPPFPCLDQLLYNVP  78



>ref|XP_011016392.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Populus euphratica]
Length=148

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            + KLIV+C GEG LF++A+A+  + + GD I SP P   +L YNVPG
Sbjct  89   DNKLIVECTGEGVLFIEADADATVEQFGDPIPSPFPCFEELLYNVPG  135



>emb|CDP22130.1| unnamed protein product [Coffea canephora]
Length=161

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+VDC GEG +F++A+A V L + GD +  P P L +L Y+VP
Sbjct  87   RKLVVDCTGEGVMFIEADAEVTLEQYGDELQPPFPCLEELLYDVP  131



>ref|XP_009374321.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+ANV L +LGD I  PSP+L +   + P 
Sbjct  92   NRKLMVECTGEGVLFIEADANVTLEQLGDAIVPPSPFLEEFLCDAPA  138



>gb|ACV74416.1| putative alcohol acyl transferase [Camellia sinensis]
Length=464

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL VDC  EG LF++A+ANV +  LGD +    PYL +L Y+VPG
Sbjct  90   NRKLSVDCTAEGVLFIEADANVEIDWLGDAVRPGCPYLEELLYDVPG  136



>gb|AES82607.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=459

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDC GEG +F++AEA+V L + GD +H P P   +L Y+V G
Sbjct  88   SRKLMVDCTGEGVMFIEAEADVTLDQFGDALHPPFPCFHQLLYDVRG  134



>ref|XP_007209131.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
 gb|EMJ10330.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
Length=450

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+CNGEG LF++A A+V L +LGD I  P P L +   N PG
Sbjct  89   NRKLMVECNGEGVLFIEANADVTLEQLGDRILPPCPVLEEFLSNPPG  135



>ref|XP_003626389.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=560

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDC GEG +F++AEA+V L + GD +H P P   +L Y+V G
Sbjct  88   SRKLMVDCTGEGVMFIEAEADVTLDQFGDALHPPFPCFHQLLYDVRG  134



>ref|XP_002319767.1| transferase family protein [Populus trichocarpa]
 gb|EEE95690.1| transferase family protein [Populus trichocarpa]
 gb|AJD25144.1| benzoyl-CoA:salicyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=459

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  90   NRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELIFDVPG  136



>ref|XP_002524021.1| transferase, putative [Ricinus communis]
 gb|EEF38389.1| transferase, putative [Ricinus communis]
Length=265

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+V+C GEG LF++A+A+V+L++ GD +  P P L  L ++VPG
Sbjct  91   DRKLMVECTGEGVLFIEADADVSLQQFGDALQPPFPCLEDLLFDVPG  137



>ref|XP_007147131.1| hypothetical protein PHAVU_006G098300g [Phaseolus vulgaris]
 gb|ESW19125.1| hypothetical protein PHAVU_006G098300g [Phaseolus vulgaris]
Length=314

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEGA+F++ +A+V L + GD +  P P   +L Y+VPG
Sbjct  34   RKLMVDCTGEGAMFMEGDADVTLAEFGDSLQPPFPCFDELLYDVPG  79



>gb|AJD25145.1| benzoyl-CoA:benzyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=460

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  90   NRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVPG  136



>ref|XP_002325454.2| transferase family protein [Populus trichocarpa]
 gb|EEE99835.2| transferase family protein [Populus trichocarpa]
Length=460

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  90   NRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVPG  136



>emb|CBI37444.3| unnamed protein product [Vitis vinifera]
Length=222

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFEELLYDVPG  136



>sp|Q3ZPN4.1|ACMAT_VITLA RecName: Full=Methanol O-anthraniloyltransferase; AltName: Full=Anthraniloyl-CoA:methanol 
acyltransferase; AltName: Full=Benzyl 
alcohol O-benzoyltransferase [Vitis labrusca]
 gb|AAW22989.1| anthraniloyal-CoA: methanol anthraniloyal transferase [Vitis 
labrusca]
Length=449

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>gb|KDP39572.1| hypothetical protein JCGZ_02592 [Jatropha curcas]
Length=329

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  126  VDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +DCNGEG LF++A+ANV+L + GD +  P P+L +L ++VPG
Sbjct  1    MDCNGEGVLFIEADANVSLDQSGDALQPPCPFLDELLFDVPG  42



>ref|XP_006588255.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
Length=304

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KL VDC+ EG LF++A+A+VA+ + GD    P P+  ++ YNVPG
Sbjct  166  NGKLTVDCDEEGVLFIEADADVAIEQFGDNFMPPFPFFDEILYNVPG  212



>ref|XP_011012995.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=459

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  90   NRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVPG  136



>ref|XP_009336752.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+ L+VDCNGEG LF++A A+V L ++GD I  P P L +  +N PG
Sbjct  88   NRMLMVDCNGEGILFVEASADVTLEQVGDKILPPCPLLEEFLFNFPG  134



>ref|XP_009336751.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+ L+VDCNGEG LF++A A+V L ++GD I  P P L +  +N PG
Sbjct  88   NRMLMVDCNGEGILFVEASADVTLEQVGDKILPPCPLLEEFLFNFPG  134



>ref|XP_010644575.1| PREDICTED: methanol O-anthraniloyltransferase-like [Vitis vinifera]
Length=445

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  89   NRKLLVDCTGEGVLFIEADADTTLEHLGDAIQPHCPCFEELLYDVPG  135



>gb|AAT68601.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Petunia 
x hybrida]
 gb|AAU06226.1| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase [Petunia 
x hybrida]
Length=460

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDC GEG +F++A A+V L + GD +  P P L +L Y+VPG
Sbjct  91   DRKLMVDCTGEGVMFVEANADVTLEEFGDELQPPFPCLEELLYDVPG  137



>ref|XP_004243496.2| PREDICTED: benzyl alcohol O-benzoyltransferase [Solanum lycopersicum]
Length=485

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++A+A+V L + GD +  P P L +L Y+VPG
Sbjct  115  RKLMVDCTGEGVMFVEADADVTLEQFGDELQPPFPCLEELLYDVPG  160



>ref|XP_007147136.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
 gb|ESW19130.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
Length=460

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+V+C GEGA+F++A+A+V L + GD +  P P   +L Y+VPG
Sbjct  95   HRKLMVECTGEGAMFIEADADVTLHEFGDSLQPPFPCFHELLYHVPG  141



>ref|XP_002271603.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=449

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>emb|CBI25251.3| unnamed protein product [Vitis vinifera]
Length=443

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>ref|XP_006600094.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN24394.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=158

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KL+VDCNGEG +F++A+A+V + + G+    P P   +L YNVPG
Sbjct  92   KLMVDCNGEGVMFIEADADVTIEQFGNNFMPPFPCFDELLYNVPG  136



>ref|XP_007031933.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY02859.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=506

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSP-YLSKLQYNVPG  1
            KLIVDCNGEGA+F++AEAN  + ++GD I  P P  L KL Y++PG
Sbjct  101  KLIVDCNGEGAVFVEAEANCKMEEIGD-ITKPDPETLGKLVYDIPG  145



>ref|XP_011046333.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+V L + GD ++ P P L +L Y+VPG
Sbjct  91   RKLLVECTGEGILFIEADADVTLEQFGDELYPPIPCLEELLYDVPG  136



>ref|XP_011007948.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=468

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KL+VDC GEG LF++A+A+V + +LGD IH P  Y+ +  ++VPG
Sbjct  107  KLLVDCTGEGILFVEADADVTIDQLGDSIHPPFSYIEEFLHDVPG  151



>gb|KHN31434.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=471

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++A+A+  L +LGD +  P P   +L Y+VPG
Sbjct  91   RKLVVDCTGEGVMFIEADADATLDQLGDTLQPPFPCFEQLLYDVPG  136



>ref|XP_008344828.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=188

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L +LGD +  P P+L +   + PG
Sbjct  92   NRKLMVECTGEGVLFIEADADVTLEQLGDALVPPCPFLEEFLCDAPG  138



>ref|XP_002265049.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>ref|XP_007147134.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
 gb|ESW19128.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
Length=462

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KLIVDC GEG +F++ +A+V L + GD +  P P   +L Y+VPG
Sbjct  96   HRKLIVDCTGEGVMFIEGDADVTLAEFGDSLQPPFPCFDELLYDVPG  142



>ref|XP_011009230.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=399

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  33   NRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPG  79



>emb|CBI37443.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>emb|CDP09539.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+V+C GEG LF++A+A+V L + GD I  P P L +L Y+VP
Sbjct  100  RKLMVECTGEGVLFIEADADVTLEQFGDAIQPPFPCLEELLYDVP  144



>emb|CAN72252.1| hypothetical protein VITISV_017467 [Vitis vinifera]
Length=451

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>ref|XP_007147132.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
 gb|ESW19126.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
Length=485

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+VDC GEGA+F++A+A+V L + GD +  P P   +L Y+VP
Sbjct  135  RKLMVDCTGEGAMFIEADADVTLAEFGDSLQPPFPCFHELMYDVP  179



>ref|XP_007029777.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
 gb|EOY10279.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
Length=471

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KL+VDC G+G LF++A+A+V L + G+ +  P P L +L Y+VPG
Sbjct  106  NGKLMVDCTGDGVLFIEADADVKLEQFGEALQPPFPCLDQLLYDVPG  152



>ref|XP_002319766.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
 gb|EEE95689.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
Length=456

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  90   NRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPG  136



>ref|XP_004243495.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC+GEG +F++A+A+V L + GD +  P P L +L Y+VPG
Sbjct  102  RKLMVDCSGEGVMFVEADADVTLEQFGDELKPPFPCLEELLYDVPG  147



>dbj|BAJ92444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL VDC GEG LF++A+ANV L   GD +  P P L +L ++VPG
Sbjct  110  RKLAVDCTGEGVLFIEADANVRLEHFGDALQPPFPGLEELVFDVPG  155



>emb|CAN74729.1| hypothetical protein VITISV_042062 [Vitis vinifera]
Length=451

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>ref|XP_009372579.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=461

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL V+C  EG +F++A+A+V L + GD +  P P L +L YNVPG
Sbjct  90   DRKLTVECTAEGVMFIEADADVTLEQFGDALQPPFPCLEELLYNVPG  136



>ref|XP_002265841.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
 emb|CBI37446.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>ref|XP_002266420.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136



>ref|XP_011018694.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=461

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  141  NKKLIVDCNGE-GALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDC GE G LF++A A++ L  LGD I  P PYL    Y++PG
Sbjct  94   SRKLMVDCTGELGVLFIEAVADITLEHLGDAIQPPCPYLEHFLYDIPG  141



>emb|CBI37442.3| unnamed protein product [Vitis vinifera]
Length=475

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  114  NRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  160



>ref|XP_010038484.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010038489.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84617.1| hypothetical protein EUGRSUZ_B01448 [Eucalyptus grandis]
Length=458

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDCN EG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  88   SRKLVVDCNEEGVLFVEADADVTLDQFGDALQPPFPCLEELIFDVPG  134



>gb|ABK96738.1| unknown [Populus trichocarpa x Populus deltoides]
Length=440

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  90   NRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPG  136



>ref|XP_010665210.1| PREDICTED: methanol O-anthraniloyltransferase isoform X2 [Vitis 
vinifera]
Length=382

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFEELLYDVPG  136



>ref|XP_011009229.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=456

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  90   NRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPG  136



>ref|XP_007161685.1| hypothetical protein PHAVU_001G089700g [Phaseolus vulgaris]
 gb|ESW33679.1| hypothetical protein PHAVU_001G089700g [Phaseolus vulgaris]
Length=430

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSP-YLSKLQYNVPG  1
            KLIVDC GEGALF++AEAN ++ ++GD I  P P  L KL Y++PG
Sbjct  88   KLIVDCTGEGALFVEAEANCSMEEIGD-ITKPDPGTLGKLVYDIPG  132



>gb|EYU41397.1| hypothetical protein MIMGU_mgv1a024853mg, partial [Erythranthe 
guttata]
Length=433

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL V+C GEG +F++A+A+VAL + GD +  P P L +L Y+VPG
Sbjct  84   RKLAVECTGEGVMFIEADADVALEQFGDELKPPVPCLEELLYDVPG  129



>gb|KCW84614.1| hypothetical protein EUGRSUZ_B01445, partial [Eucalyptus grandis]
Length=392

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDCN E   F++A A+V L + GD +HSP P L +L +++PG
Sbjct  88   RKLVVDCNEEAVAFVEASADVTLDQFGDALHSPFPCLEELLFDIPG  133



>ref|XP_002319765.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
 gb|EEE95688.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
Length=440

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L + GD +  P P L +L ++VPG
Sbjct  90   NRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVPG  136



>gb|EYU41396.1| hypothetical protein MIMGU_mgv1a005907mg [Erythranthe guttata]
Length=465

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL V+CNGEG +F++A+A+VAL + GD +  P P   +L Y+ PG
Sbjct  114  RKLAVECNGEGVMFIEADADVALEQFGDELQPPVPCFEELLYDAPG  159



>ref|XP_010045974.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
Length=406

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDCN E   F++A A+V L + GD +HSP P L +L +++PG
Sbjct  88   RKLVVDCNEEAVAFVEASADVTLDQFGDALHSPFPCLEELLFDIPG  133



>ref|XP_009803458.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Nicotiana 
sylvestris]
Length=158

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+VDC GEG +F+ A+A+V L + GD +H P P L +L + VP
Sbjct  92   RKLMVDCTGEGNMFVDADADVTLEEFGDELHPPFPCLDELLFYVP  136



>ref|XP_008779983.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Phoenix dactylifera]
Length=146

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+V L + GD +  P P L +L Y+V G
Sbjct  88   RKLVVECTGEGVLFIEADADVRLEQFGDALQPPFPCLEELLYDVEG  133



>ref|XP_002304071.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
 gb|EEE79050.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
Length=454

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KL+VDC GEG LF++A+A V + +LGD IH P  Y+ +  ++VPG
Sbjct  93   KLLVDCTGEGILFVEADAGVTIDQLGDSIHPPFSYIEEFLHDVPG  137



>ref|XP_010040517.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Eucalyptus grandis]
Length=461

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDCN EG  F++A A+V L + GD +H P P L +L +++PG
Sbjct  91   RKLVVDCNEEGVAFVEASADVTLDQFGDALHPPFPCLEELLFDIPG  136



>ref|XP_010040516.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW45153.1| hypothetical protein EUGRSUZ_L01233 [Eucalyptus grandis]
Length=458

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDCN EG  F++A A+V L + GD +H P P L +L +++PG
Sbjct  88   RKLVVDCNEEGVAFVEASADVTLDQFGDALHPPFPCLEELLFDIPG  133



>ref|XP_003521737.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=475

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++A+A+  L +LGD +  P P   +L Y+VPG
Sbjct  91   RKLVVDCTGEGLMFIEADADATLDQLGDTLQPPFPCFEQLLYDVPG  136



>gb|KDP41799.1| hypothetical protein JCGZ_26817 [Jatropha curcas]
Length=434

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSP-YLSKLQYNVPG  1
            KLIV+CNGEGA+F++AEAN A+ ++GD I  P P  L KL Y++PG
Sbjct  91   KLIVNCNGEGAVFVEAEANCAMEEIGD-ITKPDPDTLGKLVYDIPG  135



>ref|XP_011040637.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=465

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            + KLIV+C GEG LF++A+A+  + + GD I SP P   +L YNVPG
Sbjct  89   DNKLIVECTGEGVLFIEADADATVEQFGDPIPSPFPCFEELLYNVPG  135



>ref|XP_006377894.1| hypothetical protein POPTR_0011s15660g [Populus trichocarpa]
 gb|ERP55691.1| hypothetical protein POPTR_0011s15660g [Populus trichocarpa]
Length=465

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            + KLIV+C GEG LF++A+A+  + + GD I SP P   +L YNVPG
Sbjct  89   DNKLIVECTGEGVLFIEADADATVEQFGDPIPSPFPCFEELLYNVPG  135



>ref|XP_011073100.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Sesamum indicum]
Length=490

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPY-LSKLQYNVPG  1
            KLIVDC GEGA+F++AEA   L+KLGD I  P P  L KL Y++PG
Sbjct  148  KLIVDCTGEGAVFVEAEAECELQKLGD-ITKPDPVTLGKLVYDIPG  192



>ref|XP_003634222.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
Length=433

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPY-LSKLQYNVPG  1
            KLIVDC GEGA+F++AEAN A+ ++GD I  P P  L KL Y++PG
Sbjct  91   KLIVDCTGEGAVFVEAEANCAVEEIGD-ITKPDPVTLGKLVYDIPG  135



>ref|XP_011046335.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+V L + GD ++ P P L +L ++VPG
Sbjct  91   RKLLVECTGEGILFIEADADVTLEQFGDALYPPIPCLEELLFDVPG  136



>ref|XP_004156760.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Cucumis sativus]
Length=461

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            KKL V+C  EG LF++A+ANVAL++ GD +  P  +L  + YNVP
Sbjct  92   KKLFVECTAEGILFIEADANVALQQFGDAVQPPFAFLDDVLYNVP  136



>gb|KCW60630.1| hypothetical protein EUGRSUZ_H03354 [Eucalyptus grandis]
Length=433

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSP-YLSKLQYNVPG  1
            KLIVDC GEGA+F++AEAN  L ++GD I  P P  L KL Y+VPG
Sbjct  91   KLIVDCTGEGAIFVEAEANCTLEEIGD-ITKPHPETLGKLVYDVPG  135



>ref|XP_004151857.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63330.1| hypothetical protein Csa_2G429030 [Cucumis sativus]
Length=461

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            KKL V+C  EG LF++A+ANVAL++ GD +  P  +L  + YNVP
Sbjct  92   KKLFVECTAEGILFIEADANVALQQFGDAVQPPFAFLDDVLYNVP  136



>gb|KHN04051.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=403

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGD--FIHSPSPYLSKLQYNVPG  1
            +KL+VDCNGEG LF++A+A+V L + G    +H P P L +L ++VPG
Sbjct  32   RKLMVDCNGEGVLFIEADADVTLHQFGPSYLLHPPFPCLEELLHDVPG  79



>ref|XP_011073101.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
 ref|XP_011073102.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
Length=432

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPY-LSKLQYNVPG  1
            KLIVDC GEGA+F++AEA   L+KLGD I  P P  L KL Y++PG
Sbjct  90   KLIVDCTGEGAVFVEAEAECELQKLGD-ITKPDPVTLGKLVYDIPG  134



>ref|XP_010024179.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 gb|KCW60629.1| hypothetical protein EUGRSUZ_H03354 [Eucalyptus grandis]
Length=443

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSP-YLSKLQYNVPG  1
            KLIVDC GEGA+F++AEAN  L ++GD I  P P  L KL Y+VPG
Sbjct  101  KLIVDCTGEGAIFVEAEANCTLEEIGD-ITKPHPETLGKLVYDVPG  145



>ref|XP_002266114.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
Length=451

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFEELLYDVPG  136



>emb|CAN77583.1| hypothetical protein VITISV_040970 [Vitis vinifera]
Length=451

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   +L Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFEELLYDVPG  136



>dbj|BAF49304.1| putative acyltransferase [Clitoria ternatea]
Length=461

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+VDC GEG LF++A A+V L++ GD +  P P L  L YN+P
Sbjct  93   RKLMVDCTGEGVLFIEAHADVTLQQFGDSLQPPFPGLDHLLYNLP  137



>ref|XP_010665177.1| PREDICTED: methanol O-anthraniloyltransferase isoform X2 [Vitis 
vinifera]
Length=382

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   ++ Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPG  136



>ref|XP_008355599.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=454

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+V+C GEG LF++A+A+V L +LGD +  P P+L +   + PG
Sbjct  92   NRKLMVECTGEGVLFIEADADVTLEQLGDALVPPCPFLEEFLCDAPG  138



>ref|XP_007029788.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10290.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=454

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++A+A+V L + GD +  P P L  L ++VPG
Sbjct  89   RKLMVDCTGEGVMFIEADADVTLEQFGDALQPPFPCLEDLLHDVPG  134



>sp|Q5H873.1|HLTT_LUPAL RecName: Full=13-hydroxylupanine O-tigloyltransferase; AltName: 
Full=(-)-13alpha-hydroxymultiflorine/(+)-13alpha-hydroxylupanine 
O-tigloyltransferase; Short=HMT/HLTase; AltName: Full=Quinolizidine 
alkaloid O-tigloyltransferase [Lupinus albus]
 dbj|BAD89275.1| (-)-13alpha-hydroxymultiflorine/(+)-13alpha- hydroxylupanine 
O-tigloyltransferase [Lupinus albus]
Length=453

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KL+VDC GEG +F++A+A+V L + G  +H P P   +L Y+VPG
Sbjct  90   NGKLMVDCTGEGVIFIEADADVTLDQFGIDLHPPFPCFDQLLYDVPG  136



>gb|ABN48480.1| quinolizidine alkaloid O-tigloyltransferase [Lupinus albus]
Length=453

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N KL+VDC GEG +F++A+A+V L + G  +H P P   +L Y+VPG
Sbjct  90   NGKLMVDCTGEGVIFIEADADVTLDQFGIDLHPPFPCFDQLLYDVPG  136



>ref|XP_003521736.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=464

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGD--FIHSPSPYLSKLQYNVPG  1
            +KL+VDCNGEG LF++A+A+V L + G    +H P P L +L ++VPG
Sbjct  93   RKLMVDCNGEGVLFIEADADVTLHQFGPSYLLHPPFPCLEELLHDVPG  140



>ref|XP_010521555.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010521556.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010521557.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like isoform X3 
[Tarenaya hassleriana]
Length=461

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL VDCNGEG LF++A+A VAL   G+ +H P P L +L  +V G
Sbjct  98   NRKLTVDCNGEGVLFVEADAAVALVDFGEDLHPPFPCLEELLLDVEG  144



>ref|XP_010557037.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Tarenaya 
hassleriana]
Length=465

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDCNGEG +F++A+A+VAL + GD +  P P L +L + V G
Sbjct  105  DQKLVVDCNGEGVMFIEADADVALHEFGDDLLPPFPCLDELLFEVEG  151



>ref|XP_011098396.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=460

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A A+V L++ GD +  P P L +L Y+VPG
Sbjct  90   RKLVVECTGEGVLFIEAVADVTLQQFGDALLPPFPCLEELLYDVPG  135



>ref|XP_007147133.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
 gb|ESW19127.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
Length=463

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDC GEG +F++ +A+V L + GD +  P P   +L Y+VPG
Sbjct  97   RKLMVDCTGEGVMFMEGDADVTLAEFGDSLQPPFPCFDELLYDVPG  142



>ref|XP_010042878.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Eucalyptus grandis]
Length=146

 Score = 51.2 bits (121),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+VDCN EG +F++A+A++ L +  D +H P P   +L ++VPG
Sbjct  88   RKLVVDCNEEGVMFVEADADITLDQFEDALHPPFPCQEELLFDVPG  133



>ref|XP_002298962.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
 gb|EEE83767.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
Length=469

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KL+VDC GEG LF++A+A+  L + GD I  P P   +L YNVPG
Sbjct  91   KLVVDCTGEGVLFIEADADGTLEQFGDPIQPPFPCAEELLYNVPG  135



>ref|XP_008373467.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDCNGEG LF++A A+V L +LG+ I    P L +  YN PG
Sbjct  88   NRKLMVDCNGEGILFIEAFADVTLEQLGEKILPHCPPLEEFLYNFPG  134



>ref|XP_006878641.1| hypothetical protein AMTR_s00011p00264530 [Amborella trichopoda]
 gb|ERM94786.1| hypothetical protein AMTR_s00011p00264530 [Amborella trichopoda]
Length=160

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            NKKL V+C+GEG LF++ +A+V+L + GD +  P P   KL  +VPG
Sbjct  88   NKKLSVECSGEGVLFVEGDADVSLEEFGDALKPPFPCWEKLLMHVPG  134



>emb|CAN68818.1| hypothetical protein VITISV_012041 [Vitis vinifera]
Length=451

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   ++ Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPG  136



>emb|CBI15706.3| unnamed protein product [Vitis vinifera]
Length=1006

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPY-LSKLQYNVPG  1
            KLIVDC GEGA+F++AEAN A+ ++GD I  P P  L KL Y++PG
Sbjct  764  KLIVDCTGEGAVFVEAEANCAVEEIGD-ITKPDPVTLGKLVYDIPG  808



>ref|XP_003549135.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN31562.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=455

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KL+VDCNGEG +F++A+A+V + + G+    P P   +L YNVPG
Sbjct  92   KLMVDCNGEGVMFIEADADVTIEQFGNNFMPPFPCFDELLYNVPG  136



>ref|XP_002270962.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
 emb|CBI37440.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   ++ Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPG  136



>emb|CAN69948.1| hypothetical protein VITISV_009219 [Vitis vinifera]
Length=451

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC GEG LF++A+A+  L  LGD I    P   ++ Y+VPG
Sbjct  90   NRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPG  136



>ref|XP_006878640.1| hypothetical protein AMTR_s00011p00264480 [Amborella trichopoda]
 gb|ERM94785.1| hypothetical protein AMTR_s00011p00264480 [Amborella trichopoda]
Length=155

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL V+C+GEG LF++ +A+V+L + GD +H P P   +L  +VPG
Sbjct  74   RKLSVECSGEGVLFVEGDADVSLEEFGDALHPPFPCWERLLIHVPG  119



>ref|XP_008678444.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Zea mays]
 gb|AFW61772.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=459

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL VDC GEG LF++AEA+V L   GD +  P P L +L ++VPG
Sbjct  88   RKLAVDCTGEGVLFIEAEADVRLDHFGDELQPPFPCLEELIFDVPG  133



>sp|Q8GT21.1|BEBT_CLABR RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Clarkia 
breweri]
 gb|AAN09796.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Clarkia 
breweri]
Length=456

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG +F++A+A+V L + GD +  P P   +L ++VPG
Sbjct  91   RKLVVECTGEGVMFIEADADVTLEQFGDALQPPFPCFDQLLFDVPG  136



>emb|CAA64636.1| hsr201 [Nicotiana tabacum]
Length=460

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+VDC GEG +F++A+A+V L + GD +  P P L +L Y+VP
Sbjct  92   RKLMVDCTGEGIMFVEADADVTLEQFGDELQPPFPCLEELLYDVP  136



>sp|Q8GT20.1|BEBT_TOBAC RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
 gb|AAN09798.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
Length=460

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+VDC GEG +F++A+A+V L + GD +  P P L +L Y+VP
Sbjct  92   RKLMVDCTGEGIMFVEADADVTLEQFGDELQPPFPCLEELLYDVP  136



>gb|ACT82248.1| alcohol acyltransferase [Vasconcellea cundinamarcensis]
Length=463

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+V L + GD +  P P L +L Y+VPG
Sbjct  91   RKLMVECTGEGILFIEADADVTLHEFGDDLPPPFPCLVELLYDVPG  136



>ref|XP_007029779.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10281.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=270

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL+VDC G+G LF+ A A+V L + G+ +  P P L++L Y+ PG
Sbjct  32   NRKLMVDCTGQGVLFVVANADVKLEQFGEALLPPFPCLTQLLYDAPG  78



>ref|XP_009619718.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana tomentosiformis]
Length=460

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVP  4
            +KL+VDC GEG +F++A+A+V L + GD +  P P L +L Y+VP
Sbjct  92   RKLMVDCTGEGIIFVEADADVTLEQFGDELQPPFPCLEELLYDVP  136



>ref|XP_008373476.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDCNGEG LF++A ANV L +LGD    P P L +  +N  G
Sbjct  88   DRKLMVDCNGEGILFVEASANVTLEQLGDKXLPPCPLLEEFLFNFLG  134



>ref|XP_008359502.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=461

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL V+C  EG +F++A+A+V L + GD +  P P L +L YNV G
Sbjct  90   NRKLTVECTAEGVMFIEADADVTLEQFGDALQPPFPCLEELLYNVRG  136



>ref|XP_004498041.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=251

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL+VDCNGEG LF++A+A+V++ + G  +  P P   +L ++VPG
Sbjct  87   DRKLMVDCNGEGVLFIEADADVSVEEFGGQLQPPFPCWDQLLFDVPG  133



>ref|XP_007029776.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10278.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=540

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            N+KL VDC GEG LF + +A+V L + G+ +  P P + +L Y+VPG
Sbjct  186  NRKLTVDCTGEGVLFSEGDADVTLEQFGEELQPPFPCMEELLYDVPG  232



>ref|XP_010275172.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nelumbo nucifera]
Length=459

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  141  NKKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            ++KL V+C GEG +F++A+A+V L + GD +  P P L +L ++VPG
Sbjct  89   HRKLTVECTGEGVMFIEADADVRLEQFGDALQPPFPCLEELLFDVPG  135



>ref|XP_008379094.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Malus domestica]
Length=445

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  135  KLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            KLIVDC GEGA+F++AEA+ A+ ++GD        L KL Y+VPG
Sbjct  102  KLIVDCTGEGAVFVEAEADCAIEEIGDITKPDPETLGKLVYDVPG  146



>gb|KDP39568.1| hypothetical protein JCGZ_02588 [Jatropha curcas]
Length=459

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  KKLIVDCNGEGALFLKAEANVALRKLGDFIHSPSPYLSKLQYNVPG  1
            +KL+V+C GEG LF++A+A+V+L   GD +  P P L  L ++VPG
Sbjct  91   RKLMVECTGEGVLFIEADADVSLEDFGDALQPPFPCLEDLLFDVPG  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507653521284