BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6474_g1_i1 len=1788 path=[1:0-972 974:973-975 977:976-1787]

Length=1788
                                                                      Score     E

ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          653   0.0      
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          645   0.0      
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          625   0.0      
emb|CDP06076.1|  unnamed protein product                                591   0.0      
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          575   0.0      
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               548   0.0      Vitis vinifera
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    541   0.0      
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               540   0.0      Vitis vinifera
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      539   0.0      
emb|CBI39886.3|  unnamed protein product                                540   0.0      
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          538   0.0      
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          538   0.0      
emb|CBI22134.3|  unnamed protein product                                537   0.0      
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               537   0.0      Vitis vinifera
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          536   0.0      Vitis vinifera
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             536   0.0      
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    536   0.0      
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          535   0.0      Vitis vinifera
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     535   0.0      
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              534   0.0      
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               533   0.0      Vitis vinifera
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          531   5e-180   
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          531   5e-180   Vitis vinifera
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    531   6e-180   
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               531   7e-180   Vitis vinifera
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    531   1e-179   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              530   2e-179   
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          530   2e-179   
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               530   3e-179   
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             529   3e-179   
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          529   3e-179   
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               529   6e-179   
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          528   7e-179   
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               528   8e-179   
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               528   1e-178   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              527   2e-178   
emb|CDP19599.1|  unnamed protein product                                527   3e-178   
emb|CDP15988.1|  unnamed protein product                                527   3e-178   
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like               527   3e-178   
gb|KEH38478.1|  cytochrome P450 family 72 protein                       526   4e-178   
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          526   5e-178   
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like               526   5e-178   
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          526   6e-178   
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          525   1e-177   
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          525   2e-177   
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          525   2e-177   
gb|KEH38475.1|  cytochrome P450 family 72 protein                       525   2e-177   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    524   3e-177   
ref|XP_006348402.1|  PREDICTED: secologanin synthase-like               522   4e-177   
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               524   4e-177   
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          524   5e-177   
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          523   8e-177   
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          523   1e-176   
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               523   2e-176   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              522   2e-176   
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      522   2e-176   
ref|XP_010092742.1|  Secologanin synthase                               522   2e-176   
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    522   3e-176   
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      521   8e-176   
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              520   2e-175   
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              519   3e-175   
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    519   4e-175   
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          519   4e-175   Vitis vinifera
emb|CDP19601.1|  unnamed protein product                                519   4e-175   
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          518   6e-175   
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          518   7e-175   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              518   8e-175   
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    518   8e-175   
emb|CAN67740.1|  hypothetical protein VITISV_015554                     518   1e-174   Vitis vinifera
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          517   2e-174   
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    517   2e-174   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              516   2e-174   
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    516   4e-174   
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    516   7e-174   
ref|XP_010092744.1|  Secologanin synthase                               517   8e-174   
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          515   9e-174   
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     515   9e-174   
emb|CBI39884.3|  unnamed protein product                                513   1e-173   
gb|ABC69417.1|  CYP72A54                                                514   2e-173   Nicotiana tabacum [American tobacco]
ref|XP_004294189.1|  PREDICTED: secologanin synthase-like               513   5e-173   
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              513   6e-173   
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          512   1e-172   
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               512   2e-172   
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          512   2e-172   
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          511   3e-172   
emb|CDP15976.1|  unnamed protein product                                511   8e-172   
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          510   9e-172   
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  510   1e-171   Medicago truncatula
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          510   1e-171   
emb|CDP15975.1|  unnamed protein product                                510   1e-171   
emb|CDP15981.1|  unnamed protein product                                509   1e-171   
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          509   2e-171   
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          509   2e-171   
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          509   3e-171   
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    509   3e-171   
dbj|BAF98466.1|  cytochrome P450                                        509   3e-171   Coptis japonica var. dissecta
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          508   5e-171   
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              508   9e-171   
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               507   2e-170   
gb|ABC69393.1|  CYP72A55v2                                              507   2e-170   Nicotiana tabacum [American tobacco]
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      507   2e-170   
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    507   2e-170   
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          506   3e-170   
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      506   3e-170   
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          507   3e-170   
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    506   4e-170   
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               506   4e-170   
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    506   6e-170   
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          505   7e-170   
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               505   8e-170   
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               505   9e-170   
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          505   1e-169   
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    505   1e-169   
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          504   1e-169   
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    504   2e-169   
ref|XP_004295684.1|  PREDICTED: secologanin synthase-like               504   2e-169   
emb|CDP19600.1|  unnamed protein product                                504   2e-169   
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          504   3e-169   
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    504   3e-169   
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               504   3e-169   
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    504   3e-169   
gb|ABC69392.1|  CYP72A55v1                                              504   3e-169   Nicotiana tabacum [American tobacco]
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               504   4e-169   
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             503   5e-169   
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    503   5e-169   
gb|KHN14193.1|  Secologanin synthase                                    503   6e-169   
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          503   6e-169   
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          503   6e-169   
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              503   7e-169   
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          503   7e-169   
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          503   7e-169   
gb|ABC69419.1|  CYP72A56                                                503   8e-169   Nicotiana tabacum [American tobacco]
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          503   1e-168   
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      503   1e-168   
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             503   1e-168   
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    502   1e-168   
gb|ABC69422.1|  CYP72A58                                                502   1e-168   Nicotiana tabacum [American tobacco]
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              502   2e-168   
ref|XP_011082965.1|  PREDICTED: cytochrome P450 CYP72A219-like          502   2e-168   
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    502   2e-168   
gb|KHN44056.1|  Secologanin synthase                                    502   2e-168   
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          502   2e-168   
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    502   2e-168   
gb|KHN44057.1|  Secologanin synthase                                    501   2e-168   
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          501   2e-168   
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          501   2e-168   
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          502   3e-168   
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    502   3e-168   
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               501   3e-168   
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          501   3e-168   
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    501   4e-168   
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    502   4e-168   
gb|ABC69389.1|  CYP72A52v1                                              501   4e-168   Nicotiana tabacum [American tobacco]
gb|ABC69390.1|  CYP72A53v1                                              501   5e-168   Nicotiana tabacum [American tobacco]
gb|KHG14489.1|  Secologanin synthase                                    501   5e-168   
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               501   5e-168   
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               501   5e-168   
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          501   5e-168   
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              501   7e-168   
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          501   7e-168   
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    500   1e-167   
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               500   1e-167   
ref|XP_004307203.1|  PREDICTED: secologanin synthase-like               501   1e-167   
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              499   1e-167   
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    499   2e-167   
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    499   2e-167   
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          499   3e-167   
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    499   3e-167   
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          498   3e-167   
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               499   4e-167   
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              498   4e-167   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              499   4e-167   
gb|KHN36820.1|  Secologanin synthase                                    498   4e-167   
emb|CDX97593.1|  BnaA05g24860D                                          498   5e-167   
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    497   7e-167   
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              498   8e-167   
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          498   1e-166   
emb|CDY20075.1|  BnaA01g29270D                                          497   1e-166   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    497   1e-166   
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               498   1e-166   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               497   1e-166   
emb|CDP15978.1|  unnamed protein product                                497   1e-166   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          498   1e-166   
emb|CDP15979.1|  unnamed protein product                                497   2e-166   
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        496   3e-166   
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               496   3e-166   
gb|AAZ07706.1|  cytochrome P450 monooxygenase                           496   3e-166   Sesamum indicum [beniseed]
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    496   4e-166   
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               496   4e-166   
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          496   5e-166   
emb|CDP15982.1|  unnamed protein product                                496   5e-166   
emb|CDP11335.1|  unnamed protein product                                496   7e-166   
gb|EYU26272.1|  hypothetical protein MIMGU_mgv1a018891mg                495   8e-166   
emb|CDP15983.1|  unnamed protein product                                495   8e-166   
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg             495   9e-166   
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    495   9e-166   
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               494   1e-165   
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              494   1e-165   
gb|AJD25169.1|  cytochrome P450 CYP72A328                               494   1e-165   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    495   1e-165   
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          494   1e-165   
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              494   1e-165   
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          495   2e-165   
emb|CDY32348.1|  BnaC01g36670D                                          494   2e-165   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          494   3e-165   
gb|KHG18227.1|  Secologanin synthase                                    494   3e-165   
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          494   3e-165   
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    494   3e-165   
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                493   3e-165   
ref|XP_004300362.1|  PREDICTED: secologanin synthase-like               493   4e-165   
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        493   4e-165   
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase           493   4e-165   
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    496   5e-165   
emb|CDX98486.1|  BnaC05g38890D                                          493   5e-165   
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    493   5e-165   
emb|CDP19609.1|  unnamed protein product                                493   6e-165   
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              493   6e-165   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               493   7e-165   
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          492   9e-165   
emb|CDX98485.1|  BnaC05g38900D                                          492   9e-165   
gb|KFK38819.1|  hypothetical protein AALP_AA3G164600                    492   1e-164   
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          492   1e-164   
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             492   1e-164   
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                492   1e-164   
ref|XP_009116734.1|  PREDICTED: cytochrome P450 72A13-like isofor...    491   2e-164   
gb|KHN47459.1|  Secologanin synthase                                    492   2e-164   
emb|CDP15973.1|  unnamed protein product                                492   2e-164   
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             491   2e-164   
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          491   2e-164   
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    491   3e-164   
emb|CDY32349.1|  BnaC01g36680D                                          491   3e-164   
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               491   3e-164   
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               491   4e-164   
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          489   4e-164   
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             491   4e-164   
ref|XP_004294188.1|  PREDICTED: secologanin synthase-like               491   5e-164   
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          490   5e-164   
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          490   7e-164   
emb|CAN72865.1|  hypothetical protein VITISV_029731                     489   9e-164   Vitis vinifera
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    490   9e-164   
gb|AIA82924.1|  SLS1                                                    490   1e-163   
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               489   1e-163   
gb|KEH38469.1|  cytochrome P450 family 709 protein                      489   2e-163   
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    489   2e-163   
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              490   2e-163   
emb|CDY51036.1|  BnaA06g02990D                                          488   3e-163   
ref|XP_002882888.1|  CYP72A15                                           488   3e-163   
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               489   3e-163   
emb|CBI22131.3|  unnamed protein product                                487   3e-163   
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          488   3e-163   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          489   3e-163   
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    488   4e-163   
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              489   4e-163   
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      488   4e-163   
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          488   5e-163   
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                488   5e-163   
emb|CDY28093.1|  BnaC06g02740D                                          488   6e-163   
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              488   6e-163   
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    488   7e-163   
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             487   8e-163   
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              487   1e-162   
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             487   1e-162   
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    487   1e-162   
ref|XP_010065484.1|  PREDICTED: cytochrome P450 CYP72A219-like          487   2e-162   
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          486   2e-162   
emb|CDY51038.1|  BnaA06g03010D                                          486   2e-162   
emb|CDY20078.1|  BnaA01g29240D                                          486   2e-162   
ref|NP_001043632.1|  Os01g0627500                                       486   2e-162   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      486   3e-162   
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    486   3e-162   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               487   3e-162   
ref|XP_009116727.1|  PREDICTED: cytochrome P450 72A13-like isofor...    486   3e-162   
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          486   4e-162   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              485   4e-162   
gb|AJD25168.1|  cytochrome P450 CYP72A327                               485   5e-162   
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             485   6e-162   
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      485   6e-162   
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              485   6e-162   
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             485   6e-162   
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    485   7e-162   
ref|XP_010552411.1|  PREDICTED: cytochrome P450 72A13-like              485   8e-162   
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g             485   8e-162   
gb|AJD25170.1|  cytochrome P450 CYP72A329                               484   9e-162   
gb|EYU26273.1|  hypothetical protein MIMGU_mgv1a004412mg                485   1e-161   
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              484   1e-161   
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   484   1e-161   
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                484   1e-161   
emb|CDX97592.1|  BnaA05g24870D                                          483   3e-161   
gb|KHN44046.1|  Secologanin synthase                                    483   3e-161   
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    483   3e-161   
gb|KHN47456.1|  Secologanin synthase                                    484   4e-161   
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      484   4e-161   
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      483   5e-161   
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          483   7e-161   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             482   8e-161   
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              482   8e-161   
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              482   8e-161   
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   482   9e-161   
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          482   1e-160   
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              482   1e-160   
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     482   2e-160   
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             481   3e-160   
emb|CDP15985.1|  unnamed protein product                                480   4e-160   
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              480   4e-160   
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        481   4e-160   
gb|EYU26264.1|  hypothetical protein MIMGU_mgv1a004586mg                480   5e-160   
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             480   5e-160   
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              480   6e-160   
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          480   6e-160   
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    480   6e-160   
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                479   1e-159   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    479   1e-159   
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    479   1e-159   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             479   2e-159   
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  479   2e-159   
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          479   2e-159   
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               478   2e-159   
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             478   3e-159   
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    478   3e-159   
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            479   3e-159   
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...    478   4e-159   
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          476   4e-159   
emb|CDY32351.1|  BnaC01g36700D                                          477   5e-159   
ref|XP_010065483.1|  PREDICTED: cytochrome P450 CYP72A219-like          478   5e-159   
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              477   6e-159   
emb|CDP15980.1|  unnamed protein product                                477   9e-159   
gb|EYU26263.1|  hypothetical protein MIMGU_mgv1a019274mg                477   1e-158   
ref|XP_010678917.1|  PREDICTED: cytochrome P450 72A15-like              476   2e-158   
ref|XP_010065487.1|  PREDICTED: cytochrome P450 CYP72A219-like          476   2e-158   
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              476   2e-158   
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          477   2e-158   
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             476   3e-158   
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          476   3e-158   
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    475   4e-158   
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          473   5e-158   
ref|NP_188080.1|  cytochrome P450, family 72, subfamily A, polype...    475   6e-158   
emb|CDX82468.1|  BnaA03g33530D                                          475   6e-158   
gb|AAL38603.1|AF446870_1  AT3g14620/MIE1_12                             475   6e-158   
emb|CDX97591.1|  BnaA05g24880D                                          474   6e-158   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          475   7e-158   
ref|XP_009146340.1|  PREDICTED: cytochrome P450 72A13                   476   8e-158   
gb|AEI59771.1|  cytochrome P450                                         474   8e-158   
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like          474   1e-157   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              474   2e-157   
emb|CDX97588.1|  BnaA05g24910D                                          473   2e-157   
gb|EPS69403.1|  hypothetical protein M569_05363                         473   3e-157   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             473   3e-157   
emb|CDX97589.1|  BnaA05g24900D                                          473   3e-157   
gb|AGX93044.1|  secologanin synthase-like protein                       473   4e-157   
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          473   4e-157   
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          473   5e-157   
ref|XP_004969232.1|  PREDICTED: secologanin synthase-like               473   5e-157   
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          472   5e-157   
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like               473   6e-157   
ref|XP_007212563.1|  hypothetical protein PRUPE_ppa015526mg             471   6e-157   
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like              473   6e-157   
emb|CDX97590.1|  BnaA05g24890D                                          472   7e-157   
gb|AHK60841.1|  CYP72A225                                               473   9e-157   
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          472   9e-157   
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             472   1e-156   
emb|CDP06075.1|  unnamed protein product                                476   1e-156   
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like          472   1e-156   
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    471   2e-156   
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               471   2e-156   
emb|CBI39923.3|  unnamed protein product                                468   3e-156   
dbj|BAN19916.1|  cytochrome P450                                        471   4e-156   
ref|XP_004146006.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    469   5e-156   
ref|XP_009116716.1|  PREDICTED: cytochrome P450 72A15-like isofor...    469   6e-156   
ref|XP_009146336.1|  PREDICTED: cytochrome P450 72A15                   469   7e-156   
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      469   7e-156   
ref|XP_009146337.1|  PREDICTED: cytochrome P450 72A13                   469   9e-156   
emb|CBI39937.3|  unnamed protein product                                467   1e-155   
gb|AJD25171.1|  cytochrome P450 CYP72A330                               469   1e-155   
dbj|BAN19928.1|  cytochrome P450                                        469   1e-155   
emb|CBI39916.3|  unnamed protein product                                468   1e-155   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          469   2e-155   
ref|XP_003569397.1|  PREDICTED: cytochrome P450 72A15-like              469   2e-155   
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              468   2e-155   
ref|XP_010465356.1|  PREDICTED: cytochrome P450 72A13-like              468   2e-155   
ref|XP_006646125.1|  PREDICTED: secologanin synthase-like               468   2e-155   
emb|CBI39929.3|  unnamed protein product                                466   2e-155   
gb|AJD25172.1|  cytochrome P450 CYP72A331                               468   2e-155   
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               468   3e-155   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    468   3e-155   
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              468   4e-155   
emb|CBI39938.3|  unnamed protein product                                465   4e-155   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              468   6e-155   
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    468   6e-155   
ref|XP_006407059.1|  hypothetical protein EUTSA_v10021962mg             467   7e-155   
emb|CDX98484.1|  BnaC05g38910D                                          466   9e-155   
ref|XP_002882887.1|  CYP72A7                                            466   1e-154   
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    466   1e-154   
gb|KEH38476.1|  cytochrome P450 family 72 protein                       465   1e-154   
ref|XP_006299368.1|  hypothetical protein CARUB_v10015526mg             466   2e-154   
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like          466   2e-154   
emb|CDY20076.1|  BnaA01g29260D                                          465   2e-154   
gb|ADO16184.1|  cytochrome P450 mono-oxygenase                          466   3e-154   
gb|KFK38818.1|  hypothetical protein AALP_AA3G164500                    465   3e-154   
ref|XP_002458200.1|  hypothetical protein SORBIDRAFT_03g028610          466   4e-154   
gb|KDP34034.1|  hypothetical protein JCGZ_07605                         465   4e-154   
emb|CDX82471.1|  BnaA03g33500D                                          465   5e-154   
ref|XP_010501999.1|  PREDICTED: cytochrome P450 72A13-like              465   5e-154   
ref|XP_008784422.1|  PREDICTED: cytochrome P450 CYP72A219-like          464   7e-154   
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          464   7e-154   
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          464   8e-154   
gb|EMT23021.1|  Secologanin synthase                                    464   9e-154   
emb|CDX75784.1|  BnaC03g38670D                                          464   1e-153   
ref|NP_001168846.1|  uncharacterized protein LOC100382651               464   1e-153   
ref|XP_008784485.1|  PREDICTED: cytochrome P450 CYP72A219-like          464   1e-153   
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                   462   1e-153   
gb|AGX93046.1|  secologanin synthase-like protein                       464   2e-153   
gb|EYU26274.1|  hypothetical protein MIMGU_mgv1a004552mg                463   2e-153   
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    464   2e-153   
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       463   3e-153   
ref|XP_002455997.1|  hypothetical protein SORBIDRAFT_03g028680          463   4e-153   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    462   6e-153   
ref|XP_003569207.1|  PREDICTED: cytochrome P450 72A15-like              462   6e-153   
ref|XP_006407061.1|  hypothetical protein EUTSA_v10020533mg             461   9e-153   
gb|AJD25167.1|  cytochrome P450 CYP72A326                               461   1e-152   
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          462   1e-152   
ref|XP_002458201.1|  hypothetical protein SORBIDRAFT_03g028620          461   2e-152   
gb|AAK38093.1|  putative cytochrome P450                                460   3e-152   
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                460   4e-152   
gb|AAK38094.1|  putative cytochrome P450                                460   4e-152   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    460   4e-152   
ref|XP_006830577.1|  hypothetical protein AMTR_s00117p00134960          459   5e-152   
gb|AGX93049.1|  secologanin synthase-like protein                       460   6e-152   
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  459   8e-152   
dbj|BAP90521.1|  secologanin synthase                                   459   8e-152   
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              459   1e-151   
ref|XP_009135391.1|  PREDICTED: cytochrome P450 72A15-like              458   1e-151   
gb|AAK38090.1|  putative cytochrome P450                                459   1e-151   
gb|AGX93045.1|  secologanin synthase-like protein                       459   1e-151   
gb|EYU38223.1|  hypothetical protein MIMGU_mgv1a005129mg                458   1e-151   
ref|XP_007043676.1|  Cytochrome P450, putative                          457   3e-151   
gb|KEH37983.1|  cytochrome P450 family 72 protein                       457   4e-151   
gb|AEI59770.1|  cytochrome P450                                         457   5e-151   
gb|KEH38470.1|  cytochrome P450 family monooxygenase                    457   5e-151   
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          457   5e-151   
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              457   9e-151   
gb|AGX93047.1|  secologanin synthase-like protein                       457   1e-150   
ref|XP_006407056.1|  hypothetical protein EUTSA_v10022214mg             456   1e-150   
gb|AEI59772.1|  cytochrome P450                                         456   1e-150   
ref|XP_004301212.1|  PREDICTED: secologanin synthase-like               456   1e-150   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    456   1e-150   
dbj|BAN19927.1|  cytochrome P450                                        456   2e-150   
ref|XP_004969230.1|  PREDICTED: secologanin synthase-like               456   2e-150   
ref|XP_010678723.1|  PREDICTED: cytochrome P450 CYP72A219-like          455   2e-150   
emb|CBI39917.3|  unnamed protein product                                453   2e-150   
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    456   2e-150   
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          456   2e-150   
dbj|BAB02396.1|  cytochrome P450                                        455   2e-150   
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               456   3e-150   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          455   3e-150   
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like          455   4e-150   
gb|KCW62995.1|  hypothetical protein EUGRSUZ_G00595                     453   2e-149   
ref|XP_009404407.1|  PREDICTED: cytochrome P450 CYP72A219-like          453   2e-149   
gb|AAA17732.1|  cytochrome P450                                         453   2e-149   
ref|XP_010068175.1|  PREDICTED: cytochrome P450 CYP72A219-like          452   4e-149   
ref|XP_004511068.1|  PREDICTED: secologanin synthase-like isoform X1    452   4e-149   
ref|XP_010535011.1|  PREDICTED: cytochrome P450 72A15-like              450   5e-149   
gb|ADU19849.1|  putative secologanin synthase                           452   7e-149   
ref|XP_009149145.1|  PREDICTED: cytochrome P450 72C1                    451   8e-149   
ref|XP_003569398.1|  PREDICTED: cytochrome P450 72A15-like              452   1e-148   
ref|XP_003566917.1|  PREDICTED: cytochrome P450 72A15-like              451   1e-148   
emb|CDX81797.1|  BnaC08g38040D                                          451   1e-148   
ref|XP_010273926.1|  PREDICTED: cytochrome P450 72A15-like              451   2e-148   
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like               451   2e-148   
ref|XP_006299313.1|  hypothetical protein CARUB_v10015468mg             450   2e-148   
ref|XP_006646124.1|  PREDICTED: secologanin synthase-like               451   2e-148   
dbj|BAN19913.1|  cytochrome P450                                        451   2e-148   
emb|CDY67933.1|  BnaAnng25600D                                          451   2e-148   
ref|XP_004969229.1|  PREDICTED: secologanin synthase-like               450   3e-148   
emb|CBI22133.3|  unnamed protein product                                453   5e-148   
ref|NP_001044129.1|  Os01g0728300                                       449   6e-148   
emb|CDY64008.1|  BnaCnng42960D                                          449   7e-148   
ref|XP_002516130.1|  cytochrome P450, putative                          449   8e-148   
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    449   1e-147   
ref|XP_006377676.1|  hypothetical protein POPTR_0011s10150g             448   1e-147   
gb|EAY75694.1|  hypothetical protein OsI_03601                          449   1e-147   
gb|KCW62993.1|  hypothetical protein EUGRSUZ_G00593                     449   1e-147   
ref|XP_006307236.1|  hypothetical protein CARUB_v10008841mg             449   1e-147   
gb|AAA17746.1|  cytochrome P450                                         448   1e-147   
gb|AGX93064.1|  secologanin synthase                                    449   1e-147   
gb|KFK43897.1|  hypothetical protein AALP_AA1G188200                    448   2e-147   
sp|Q9SHG5.2|C72C1_ARATH  RecName: Full=Cytochrome P450 72C1; AltN...    448   2e-147   
gb|EPS69617.1|  hypothetical protein M569_05150                         448   2e-147   
ref|XP_006644655.1|  PREDICTED: secologanin synthase-like               447   3e-147   
ref|XP_007223241.1|  hypothetical protein PRUPE_ppa004414mg             447   3e-147   
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g             447   6e-147   
gb|EAY75042.1|  hypothetical protein OsI_02938                          447   6e-147   
ref|XP_003527236.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    447   6e-147   
ref|XP_009117728.1|  PREDICTED: cytochrome P450 72C1-like               447   6e-147   
dbj|BAJ95191.1|  predicted protein                                      446   7e-147   
ref|XP_004969228.1|  PREDICTED: secologanin synthase-like isoform X2    447   9e-147   
ref|XP_006598146.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      444   1e-146   
ref|XP_004511069.1|  PREDICTED: secologanin synthase-like isoform X2    446   1e-146   
gb|KHN18291.1|  Secologanin synthase                                    446   1e-146   
dbj|BAJ89369.1|  predicted protein                                      446   1e-146   
ref|XP_002455991.1|  hypothetical protein SORBIDRAFT_03g028590          446   2e-146   



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/512 (61%), Positives = 394/512 (77%), Gaps = 10/512 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V+ILF  I + A+VIW  R+V WVWL+PRKLEK  R+QG+NG+ YR  YGDTKEMA +T 
Sbjct  4     VAILFSAIVI-ALVIWVWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAEMTK  62

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +AK KPI L+DDILPR+ PFYH    KYG +CF W GP PR+ + +PEL++E+  NNT+F
Sbjct  63    EAKFKPIKLTDDILPRIFPFYHHTFNKYGNHCFAWIGPEPRIFVMKPELIKEIVTNNTIF  122

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             K+PKP PLV+ LVSG++ YED +WA+HRKI++ AFY +K+KCM P++ +SCE+MI  KWE
Sbjct  123   KKPKPAPLVQLLVSGISSYEDDKWAKHRKILNTAFYAEKLKCMLPAMHTSCEDMI-NKWE  181

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
             +L SE   C+ DV PY E FTSDVISRTAFG SY EG ++F LQ E AELTRQ   SVY 
Sbjct  182   ILLSENKSCELDVHPYFEDFTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQSVYI  241

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L ++ +RRM  IDNE+R +++ ++ KRER M  +  D ++    LL   LK    
Sbjct  242   PGWRYLPTRTNRRMKAIDNELRDILRKIVSKRERAMVGEASDQEDLLGILLKSNLKEIQE  301

Query  815   -----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNK  651
                  G +TDEVIEEC+ FYFAGQES+S+ LVW M+LLS+HQTWQ RAR+EVQQVF +NK
Sbjct  302   RGSKFGMTTDEVIEECKVFYFAGQESSSNLLVWTMVLLSVHQTWQARAREEVQQVFQNNK  361

Query  650   PDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRD  471
             PDF+GL+RLKI+TMILNEVLRLYPP+PY +R +Y+ETKLG M +PP +IL++ ++ V  +
Sbjct  362   PDFEGLSRLKIVTMILNEVLRLYPPAPYFVRKVYKETKLGNMSIPPEVILVIPTIFVHHN  421

Query  470   PDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQR  291
             P++WG D  EFKPERFAEG+A ATKNRL FLPF WGPR CIGNNFAM+E KIA+A ILQR
Sbjct  422   PELWGEDVKEFKPERFAEGIATATKNRLCFLPFSWGPRICIGNNFAMLETKIALAMILQR  481

Query  290   FSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             F+F LSPSYAH+P +VVTL+PQ GA L+L K+
Sbjct  482   FAFELSPSYAHAPTYVVTLRPQCGAHLILQKL  513



>ref|XP_009797437.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=515

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/513 (59%), Positives = 386/513 (75%), Gaps = 10/513 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V+ILF  I + A+VIW  ++V WVWL+PRKLEK  R+QG+NG+ YR  YGDTKEMA LT 
Sbjct  4     VAILFSAIVINALVIWGWKMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAELTK  63

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A  KPI L+DDILPR+ PFYH  + KYG +C+ W GP PR+ + EPEL++E+  NNT+F
Sbjct  64    EAMLKPIKLTDDILPRIFPFYHHTLNKYGNHCYAWIGPEPRIFVMEPELIKEIVTNNTIF  123

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             K+PKP PLV+ LVSG++ YED++WA+HRKII+ AFY +K+KCM P++ +SCE+MI  KWE
Sbjct  124   KKPKPAPLVQLLVSGISSYEDEKWAKHRKIINTAFYAEKLKCMLPAMHTSCEDMI-NKWE  182

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
             +L SE    + DV PY E  TSDVISRTAFG SY EG ++F LQ E AELTRQ   SVY 
Sbjct  183   ILLSENKSYELDVHPYFEDLTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQSVYI  242

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgd---------ddeenldll  834
             P W  L ++ +RRM  IDNE+R +++ ++ KRER MK                    ++ 
Sbjct  243   PGWRYLPTRTNRRMKAIDNELRDILRKIVSKRERAMKVGEASDEEDLLGILLKSNLKEIQ  302

Query  833   gvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                 K G +TDEVIEEC+ FYFAGQES+S+ L+W M+LLS+HQ WQ RAR+EVQQVF +N
Sbjct  303   EGGRKFGMTTDEVIEECKIFYFAGQESSSNLLIWTMVLLSMHQNWQARAREEVQQVFQNN  362

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             KPDF+GL+RLKI+TMILNEVLRLYPP+PY +R  Y+ETKLG M +PP +IL++ ++ V  
Sbjct  363   KPDFEGLSRLKIVTMILNEVLRLYPPAPYFVRKAYKETKLGNMSIPPEVILVIPTIFVHH  422

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             +P++WG D  EFKPERFAEG+A ATKNRL FLPF WGPR CIGNNFA+ME KIA+A ILQ
Sbjct  423   NPELWGDDVKEFKPERFAEGIATATKNRLCFLPFSWGPRICIGNNFAIMETKIALAMILQ  482

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             RF+F LSPSY H+P +VVTL+PQ GA L+L K+
Sbjct  483   RFAFQLSPSYTHAPTYVVTLRPQCGAHLILQKL  515



>ref|XP_004244382.2| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=511

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/510 (58%), Positives = 380/510 (75%), Gaps = 9/510 (2%)
 Frame = -2

Query  1700  ILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKA  1521
             +L  F ++   +IW  R+V WVW++PRK+EK  R+QGLNG+ YR  YGDTKEMA LT +A
Sbjct  3     VLICFSALLVTMIWMWRMVNWVWIRPRKIEKCFRKQGLNGHPYRTLYGDTKEMAKLTKQA  62

Query  1520  KSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR  1341
             K KP+ L+DDIL RVLPFYH  + KYG NCF+W GP PR+ I EPEL++++ MNN +FK+
Sbjct  63    KLKPMKLTDDILTRVLPFYHYTLNKYGNNCFIWIGPEPRIFIMEPELIRDIVMNNNIFKK  122

Query  1340  PKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
             PKP PLV+ LVSG++ YEDQ+WA+HRKI++ AFY +K+K M P++  SCE+M M KWE+L
Sbjct  123   PKPTPLVQLLVSGISSYEDQKWAKHRKILNTAFYTEKLKYMVPAMHKSCEDM-MNKWEIL  181

Query  1160  TSEKN-WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
                KN  C+ DV PY E  TSDVISRTAFG SY EG K+F LQ E AELTRQ   SVY P
Sbjct  182   ICNKNKSCELDVHPYFEDLTSDVISRTAFGSSYQEGMKIFHLQKELAELTRQAFQSVYIP  241

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgd-------ddeenldllgvl  825
              W  L ++R+RRM  IDNE++  ++ ++ KRER M                   ++    
Sbjct  242   GWRFLPTRRNRRMKGIDNELKDTLRKIVNKRERSMNLGETQEDLLGILLKSNVNEIQQNG  301

Query  824   LKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
              K G +TDEVIEEC+ FYFAGQE++S+ LVW M+LLS+HQ WQ RAR+EVQQVF +NKPD
Sbjct  302   TKFGMTTDEVIEECKLFYFAGQETSSNLLVWTMVLLSVHQNWQTRAREEVQQVFHNNKPD  361

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
             F+GL RLKI+TMILNEVLRLYPP+PY +R   +ETKLG M +P  +IL++ ++ +  + +
Sbjct  362   FEGLKRLKIVTMILNEVLRLYPPAPYFLRKANQETKLGNMNIPSEVILMIPTIFIHHNEE  421

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG D  EFKP+RF++G+AKATK+RL FLPF WGPR CIG+NFAMME KIA+A ILQRF+
Sbjct  422   LWGDDVKEFKPDRFSQGIAKATKDRLCFLPFSWGPRICIGHNFAMMETKIALAMILQRFA  481

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             F LSPSY H+P +VVTL+PQ GA L+L+K+
Sbjct  482   FELSPSYTHAPTYVVTLQPQCGAHLILNKL  511



>emb|CDP06076.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/512 (55%), Positives = 368/512 (72%), Gaps = 9/512 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +S+L +F+ +  ++ WA R V WVWL P+++E+ LR+QG NGN YR+ YGDTKE+ ++  
Sbjct  5     LSVLVIFVLIMLLIFWAARTVNWVWLNPKRIERCLRKQGFNGNPYRLLYGDTKEIGSMIK  64

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
              A SKPI LSDDILPRVLPF    +  YG+  F W GP  +V+I +PEL++E+   N +F
Sbjct  65    AANSKPIKLSDDILPRVLPFQLHLIKTYGEKSFFWVGPVAKVLIMDPELIREILARNAIF  124

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             K+P P+PL KFLV+GLA YED++WA+HR+I++PAFY +K+K M P +   C EMI +KWE
Sbjct  125   KKPIPNPLAKFLVAGLAGYEDEKWAKHRRIVTPAFYVEKLKNMLPKMYFCCNEMI-RKWE  183

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              L +EK+  + D QP+ +  TSDVISRT FG  + +G K+F LQ EQAELT QV+ SVY 
Sbjct  184   TLLAEKSCLELDAQPHFDDLTSDVISRTTFGNCHAQGRKIFKLQKEQAELTGQVLKSVYI  243

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEK--------vgdddeenldllg  831
             P W  L +KR++RM +I+NE++ L   +I +RER MK                   ++  
Sbjct  244   PGWSFLPTKRNKRMKKINNELQALFLDIIMERERVMKLGKDDDDNLLSMLLKSSAREIQE  303

Query  830   vlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNK  651
                K G ST EV+EEC+ FYFAGQESTS+ L W  +LLS+H  WQ  AR+E+ +VFG+NK
Sbjct  304   QGKKHGLSTGEVMEECKTFYFAGQESTSNLLAWTTVLLSMHPHWQVHAREEILRVFGNNK  363

Query  650   PDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRD  471
             PD+DGLNRLKI+TMIL EVLRLYPPS    RT+YEETKLGEM  PP + L+L  +L+  D
Sbjct  364   PDYDGLNRLKIVTMILYEVLRLYPPSIIFSRTIYEETKLGEMSFPPGVFLMLPIILLHHD  423

Query  470   PDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQR  291
             P +WG D  EFKPERF++G+AKATKN+L+F PF WGPRTCIGNNFA+MEAK+A+  ILQ 
Sbjct  424   PQLWGEDCKEFKPERFSQGIAKATKNQLSFFPFSWGPRTCIGNNFALMEAKLALTMILQH  483

Query  290   FSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             F F LSPSY H+PCFVVT KPQ GA ++L KI
Sbjct  484   FEFELSPSYIHAPCFVVTHKPQHGANIILRKI  515



>ref|XP_011082820.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/517 (54%), Positives = 370/517 (72%), Gaps = 15/517 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +S LF F+   A+ IWA R+V WVW++P+ +EK LR QG  GN YR+ YGDT +MA +  
Sbjct  2     ISSLFTFLFF-AIAIWAWRIVNWVWIRPKNIEKRLRAQGFGGNPYRILYGDTNDMAKMIK  60

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A SKPI LSDD+LPRV+P +H  V KYGK CFVW GP  RV+I EPEL++EV  NN +F
Sbjct  61    EANSKPIKLSDDVLPRVIPLHHHIVRKYGKACFVWIGPVARVVIMEPELIKEVLNNNHIF  120

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             K+P P+PL +FLV G+  YED +W++HRKII+PAFY +K++ M P++  SC EMI +KWE
Sbjct  121   KKPTPNPLARFLVCGINGYEDDKWSKHRKIINPAFYVEKLRHMVPAMHRSCVEMI-EKWE  179

Query  1166  LLT----SEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              L      ++   + DV PY E  T  VISRTAFG SY EG ++F LQ EQAELTRQV+ 
Sbjct  180   KLVEIEGGKRKGIEIDVGPYFEDLTGQVISRTAFGSSYEEGRRIFELQKEQAELTRQVLQ  239

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdd---------deen  846
             SVY P W  + +KR+RR+ EI++++  L++G+I +R+  M+     +             
Sbjct  240   SVYVPGWRYVPTKRNRRLKEINDDLCSLLRGIIKQRQTAMQTGNSTEDDDLLGILLKSNE  299

Query  845   ldllgvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
              ++     KSG S +EVIEEC+ FYF+GQESTS+ L W M LLSIHQ WQ RAR+E+ QV
Sbjct  300   KEMKENGKKSGMSIEEVIEECKTFYFSGQESTSNLLSWTMFLLSIHQDWQKRAREELFQV  359

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG + PDFDGLNRLKI+TMIL EVLRLYPP+    R +++ETKLGE+ LP  + L L  +
Sbjct  360   FGDSAPDFDGLNRLKIVTMILYEVLRLYPPAIIFNRIIHKETKLGEVTLPAGVHLQLPII  419

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
             L+  D ++WG DA EFKPERF++G+AKATKN+L+F PF WGPR CIGNNFA+ME K+A+A
Sbjct  420   LLHHDQNLWGEDAKEFKPERFSQGIAKATKNQLSFFPFSWGPRICIGNNFALMETKMALA  479

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              IL+ FSF LSPSY H+P +V+TL+PQ G  L++ +I
Sbjct  480   MILRAFSFDLSPSYTHAPSYVLTLQPQCGVHLMMTQI  516



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 364/516 (71%), Gaps = 14/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V+I F FI++   +I+A R++  VWLKP+K+E++LRQQGL GNSYR+ +GD +EM+ +
Sbjct  4     SSVAISFAFITL---LIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRM  60

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A S+PI+LSDDI+ RVLPF++ ++ KYGKNCF+W GP P V I EPEL+++V + + 
Sbjct  61    IDEANSRPISLSDDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHN  120

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++P  HPL K L +G+   E +QW + RKII+PAF+ +K+K M P+   SC EM+  K
Sbjct  121   AFQKPPVHPLGKLLATGVIALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSEMV-NK  179

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE   S+   C+ D+ P LE    DVISRTAFG SY EG ++F LQ EQA L  QV  S+
Sbjct  180   WEKKLSKDGSCELDIWPDLENLAGDVISRTAFGSSYEEGRRIFQLQKEQAHLAVQVSQSI  239

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W  + +K ++RM +I NE+  L+KG+I +RE+ MK     +D+    L+    K  
Sbjct  240   YIPGWRFVPTKTNKRMRQISNEVNALLKGIIERREKAMKVGETANDDLLGLLMESNYKEM  299

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  +VIEEC+ FYFAGQE+TS  L+W M+LLS H  WQ RAR+EV QVF
Sbjct  300   QEHGERKNVGMSNKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVF  359

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD DGLN LKI+TMI +EVLRLYPP+   IR++Y +T++G M LP  + + L  LL
Sbjct  360   GNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRSVYADTEVGGMYLPDGVQVSLPILL  419

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  D ++WG DA +F PERF+EGV+KATK + AF PFG+GPR CIG NFAMMEAK+A+A 
Sbjct  420   LHHDHEIWGDDAKDFNPERFSEGVSKATKGQFAFFPFGYGPRVCIGQNFAMMEAKMALAM  479

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  V+T++PQ+GA L+LH +
Sbjct  480   ILQRFSFELSPSYAHAPISVITIQPQYGAHLILHGL  515



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/508 (53%), Positives = 352/508 (69%), Gaps = 11/508 (2%)
 Frame = -2

Query  1688  FISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKP  1509
             F ++  V++   R+  WVWL+PRKLEK+LR QG NGNSYR+F+GD KEM  +  +AKSKP
Sbjct  11    FCAIVVVILLGWRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVKEMIVMLKEAKSKP  70

Query  1508  INLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH  1329
             INL DDI+PR++P     +T YGKN F+W GP P V I  P+ +++V      F++P+ +
Sbjct  71    INLYDDIIPRIIPLNQKIITNYGKNSFLWLGPKPMVHIMNPDHIKDVLSKFYQFQKPRHN  130

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             PL K L +G+A  E  +WA+HRK+I+PAF+ +K+K M P++  S  E I+ KWE + S K
Sbjct  131   PLTKLLATGVADAEGDRWAKHRKLINPAFHLEKLKNMLPAIYLSSSE-IVTKWEEMVSTK  189

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV PYLE  TSDVISRTAFG SY EG K+F LQ EQAEL  Q   ++Y P    L
Sbjct  190   GQFELDVLPYLETLTSDVISRTAFGSSYEEGRKIFQLQREQAELIIQASQTIYLPGMRFL  249

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR++RM EI  E++  +K +I KR + M+       ++ L +L               
Sbjct  250   PTKRNKRMKEIAKEVKIALKSIINKRLKAMEAGERSSHDDLLGILLESNSKEIKQHGNTN  309

Query  815   -GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFD  639
              G + DEVIEEC+ F+FAGQE+TS+ LVW MILLS HQ WQ RA++EV + FG+NKPDFD
Sbjct  310   FGLTVDEVIEECKLFFFAGQETTSNLLVWTMILLSQHQDWQKRAKEEVLRTFGNNKPDFD  369

Query  638   GLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVW  459
             GLN LK++ MIL EVLRLYPP     RT+YEE KLGE+ LP  +IL+L  +L+  D ++W
Sbjct  370   GLNHLKVVNMILLEVLRLYPPILSLDRTIYEEIKLGEISLPAGVILLLPIILLHYDQEIW  429

Query  458   GADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFH  279
             G DA EF PERF+EGV KATK R+ + PF WGPR CIG NFAM+EAK+A+A ILQRFSF 
Sbjct  430   GDDAKEFNPERFSEGVLKATKGRVTYFPFSWGPRICIGQNFAMLEAKMAMAMILQRFSFV  489

Query  278   LSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LSPSYAH+P  ++TL+PQ+GA L+LH +
Sbjct  490   LSPSYAHAPHAIITLQPQYGAHLILHSL  517



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 362/516 (70%), Gaps = 14/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V+I F F++V    +W  R++ WVWL+P++LE+ LR+QGL GNSYR+  GD+KEM+ +
Sbjct  4     SSVAISFGFLTVLISCVW--RLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRM  61

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A S+PI+LSDDI+ RVLPF+   + KYGKN F W GP+PRV I EPELM++V + + 
Sbjct  62    MKEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSN  121

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
             +F++   HPLVK LVSGL   E +QWA+ RKII+PAF+P+K+K M  +   SC +M+  K
Sbjct  122   IFQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMV-NK  180

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             W+ L+ E + C+ DV PYLE  T DVISRTAFG SY EG ++F LQ EQ  L  +V  SV
Sbjct  181   WKKLSVEGS-CELDVWPYLENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSV  239

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv-----  828
             Y P W    +K ++RM +I  E+  L+ G+I KRE+ M+     + +    L+       
Sbjct  240   YIPGWRFFPTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSDLLGILMESNFREI  299

Query  827   -----lLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                    K G S  +VI+EC+ FY AGQE+TS  L+W M+LLS H  WQ RAR+EV QVF
Sbjct  300   QEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVF  359

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+NKP+ DGLN LKI+TMI +EVLRLYPP     R + ++T++G+M  P  + + L ++L
Sbjct  360   GNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTIL  419

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             V  D ++WG DA EF PERFAEGV+KATKN+++FLPFGWGPR CIG NFAMMEAKIA+A 
Sbjct  420   VHHDHEIWGDDAKEFNPERFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAM  479

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  ++T++PQ+GA L+L  +
Sbjct  480   ILQRFSFELSPSYAHAPYSLITIQPQYGAHLILRGL  515



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/511 (52%), Positives = 361/511 (71%), Gaps = 10/511 (2%)
 Frame = -2

Query  1697  LFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK  1518
             L LF+     VI+A R++ W W  PRKLEK LRQQGL GNSY++ YGD KE++     A+
Sbjct  8     LVLFLLAITFVIYAWRLLDWAWFMPRKLEKCLRQQGLKGNSYKLIYGDIKELSKSIEDAE  67

Query  1517  SKPINLSDDIL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR  1341
             SKP+N+SDD L PR+LP++   + KYGKNCF+W GP P VI+ +PE++++VF  + L+++
Sbjct  68    SKPLNVSDDDLTPRILPYFVQTIKKYGKNCFIWIGPKPLVIVGDPEVIRDVFNKHALYQK  127

Query  1340  PKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
             PK  PL K L  G+  YE+ +WA+HRKI++PAF+ +KIK M  +V  SC EM+ +  E +
Sbjct  128   PKSTPLTKLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKDMLQAVLLSCSEMVNQWEEAV  187

Query  1160  TSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPE  981
             + +++  + D+ PYL+  TSDVISRTAFG +Y EG K+F LQ EQAE   +V  ++Y P 
Sbjct  188   SMKESSTELDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKEQAEHVIEVSRTLYIPG  247

Query  980   WWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-----  816
             W  L +KR+RRM EI+ E++  ++G+I KR +GMK    + D+    LL    K      
Sbjct  248   WRFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESNFKEIEQHG  307

Query  815   ----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKP  648
                 G +  EVIEEC+ FYFAGQE+TS +LVW MILLS H  WQ RAR+EV QVFG   P
Sbjct  308   NKNFGMTIKEVIEECKLFYFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQVFGDGMP  367

Query  647   DFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDP  468
              FDGLNRLK++TMIL+E LRLYPP     R +  +TKLGE+ LP  ++L L ++LV  D 
Sbjct  368   GFDGLNRLKVVTMILHESLRLYPPVSALGRRITTKTKLGELNLPAGVMLSLPTILVHHDK  427

Query  467   DVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRF  288
             ++WG DA EFKPERF+EG++KATK ++ F PFG GPR CIG NFAM+EAK+ +A ILQRF
Sbjct  428   EIWGEDATEFKPERFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMTMAMILQRF  487

Query  287   SFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +F LSPSY H+P  V+T++P++GAPLVLH++
Sbjct  488   AFELSPSYTHAPQSVITMQPKYGAPLVLHRL  518



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 362/516 (70%), Gaps = 14/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V+I F F++V    +W  R++ WVWL+P++LE+ LR+QGL GNSYR+  GD+KEM+ +
Sbjct  4     SSVAISFGFLTVLISCVW--RLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRM  61

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A S+PI+LSDDI+ RVLPF+   + KYGKN F W GP+PRV I EPELM++V + + 
Sbjct  62    MKEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSN  121

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
             +F++   HPLVK LVSGL   E +QWA+ RKII+PAF+P+K+K M  +   SC +M+  K
Sbjct  122   IFQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMV-NK  180

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             W+ L+ E + C+ DV PYLE  T DVISRTAFG SY EG ++F LQ EQ  L  +V  SV
Sbjct  181   WKKLSVEGS-CELDVWPYLENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSV  239

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv-----  828
             Y P W    +K ++RM +I  E+  L+ G+I KRE+ M+     + +    L+       
Sbjct  240   YIPGWRFFPTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSDLLGILMESNFREI  299

Query  827   -----lLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                    K G S  +VI+EC+ FY AGQE+TS  L+W M+LLS H  WQ RAR+EV QVF
Sbjct  300   QEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVF  359

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+NKP+ DGLN LKI+TMI +EVLRLYPP     R + ++T++G+M  P  + + L ++L
Sbjct  360   GNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTIL  419

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             V  D ++WG DA EF PERFAEGV+KATKN+++FLPFGWGPR CIG NFAMMEAKIA+A 
Sbjct  420   VHHDHEIWGDDAKEFNPERFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAM  479

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  ++T++PQ+GA L+L  +
Sbjct  480   ILQRFSFELSPSYAHAPYSLITIQPQYGAHLILRGL  515



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/513 (52%), Positives = 361/513 (70%), Gaps = 11/513 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
              S+    +    ++ WA RV+ WVWL+P+KLE+ LRQQGL GNSYR+  GDTKE + +  
Sbjct  7     ASVALRVVWASVIITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMVK  66

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             + KSKP++L  D+ PRVLPF H ++  YGKN F+W GP PRV IS P+ M+++F     F
Sbjct  67    ETKSKPMDLCHDLAPRVLPFVHQSMNTYGKNFFIWIGPTPRVNISNPDDMKDIFAKYEDF  126

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P  +PLV  L +GL+ YE ++WA+HRKII+PAF+ +K+K M P+   SC EMI +KWE
Sbjct  127   QKPATNPLVNLLATGLSSYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSEMI-EKWE  185

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              L S++  C+ DV PYL+  T+DVISRTAFG SY EG K+F L  +Q +LT + I SVY 
Sbjct  186   SLASKEGSCELDVWPYLQNLTADVISRTAFGSSYEEGRKIFQLLKDQGQLTMKTIQSVYI  245

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P WW L ++ ++RM EID EI+G + G+I KRE  ++      D+    L+   LK    
Sbjct  246   PGWWFLPTRMNKRMKEIDKEIKGSLMGIINKREEAIRVGEATKDDLLGILMASNLKEIRE  305

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S ++VIEEC+ FYFAGQE+TS  LVW ++LLS +Q WQ RAR EV QVFG 
Sbjct  306   NGNTKNFGMSIEDVIEECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARARDEVLQVFGS  365

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             NKPDFDGL+ +K++TMIL EVLRLYP      R +++ T+LG++ LP  + + L++LLV 
Sbjct  366   NKPDFDGLSHVKVVTMILLEVLRLYPAVVVLSRAIHKNTQLGKLSLPAGVEVSLNTLLVH  425

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EFKPERF+EGV+KATKN+ A+ PFG GPR CIG NFAM+EAK+A+A IL
Sbjct  426   HDKELWGEDANEFKPERFSEGVSKATKNKFAYFPFGGGPRICIGQNFAMVEAKLALALIL  485

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             Q F+F LSPSYAH+P   +TL+PQFGA ++LHK
Sbjct  486   QHFAFELSPSYAHAPSAEITLQPQFGAHIILHK  518



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/521 (52%), Positives = 360/521 (69%), Gaps = 13/521 (2%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVV-IWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDT  1551
             M+ +Q  V+     I +  VV IW  RV+ WVW +P+KLEK LR+QGL GNSYR+ YGD 
Sbjct  1     METVQITVTASCAAIIITLVVCIW--RVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDM  58

Query  1550  KEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             KE++ +  +A SKP+NLSDDI PR++PF+   + KYGK  FVW GP P V + +PEL++E
Sbjct  59    KELSGMIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFVMDPELIKE  118

Query  1370  VFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCE  1191
             VF  N L+++P  +PL K L  GL   E+ +WA+HRKI++PAF+ +K+K M P+   SC 
Sbjct  119   VFSKNYLYQKPHSNPLTKLLAQGLVSQEEDKWAKHRKIVTPAFHLEKLKHMLPAFCLSCT  178

Query  1190  EMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTR  1011
             EM + KWE + + +   + D+ P L+  TSDVISRTAFG SY  G ++F LQ EQA+   
Sbjct  179   EM-LSKWEDIVAVEGSHEIDIWPGLQQLTSDVISRTAFGSSYEAGRRIFELQKEQAQFLM  237

Query  1010  QVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllg  831
             + I SVY P W  L +KR+RRM EI+ +++ L++G+I KR + MK    ++++    LL 
Sbjct  238   EAIRSVYIPGWRFLPTKRNRRMKEIEKDVQALVRGIIDKRVKSMKAGEVNNEDLLGILLE  297

Query  830   vlLKS---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQE  678
                K          G S +EVI+EC+ FYFAGQE+TS  LVW +ILLS HQ WQ  AR+E
Sbjct  298   SNFKEIEQHGNKDFGMSIEEVIQECKLFYFAGQETTSVLLVWTLILLSRHQDWQALAREE  357

Query  677   VQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiili  498
             V QVFG+ KPDFDGLNRLKI+TMIL E LRLYPP     R   E+T LG++ LP  +++ 
Sbjct  358   VLQVFGNQKPDFDGLNRLKIVTMILYESLRLYPPVVTLTRRPKEDTVLGDVSLPAGVLIS  417

Query  497   lsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAK  318
             L  +L+  D ++WG DA +FKPERF +GV+ ATK ++ F PF WGPR CIG NFAM+EAK
Sbjct  418   LPVILLHHDEEIWGKDAKKFKPERFRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAK  477

Query  317   IAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
               +A ILQRFSF LSPSYAH+P  ++TL+PQ+GAPL+LHKI
Sbjct  478   TTLAMILQRFSFELSPSYAHAPQSIITLQPQYGAPLILHKI  518



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/520 (51%), Positives = 362/520 (70%), Gaps = 15/520 (3%)
 Frame = -2

Query  1721  RIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEM  1542
             R+   V+I F FI++   +I+A R++ WVWL+P+KLE+ LRQQG+ GNSYR+ +GD +EM
Sbjct  14    RLLISVAISFAFITL---LIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREM  70

Query  1541  ATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFM  1362
               + ++A S+PI+LSD+I+ RVLPF++ ++ KYGKN F+W GP P V I +PEL+++VF+
Sbjct  71    LRMISEANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFL  130

Query  1361  NNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMI  1182
                 F +P PHPL K L +GL   E +QW +HRKII+PAF+ +K+K M P+   SC +M+
Sbjct  131   RYNAFHKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMV  190

Query  1181  MKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVI  1002
               KWE   S+   C+ D+ P LE  T D ISRTAFG SY EG ++F LQ EQA L  +V 
Sbjct  191   -NKWEKKLSKDGSCELDIWPDLENLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVF  249

Query  1001  HSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlL  822
              SVY P W  + +K ++R+ +I NE+  L+KG+I KRE+ M      +D+    L+    
Sbjct  250   RSVYIPGWRFVPTKTNKRIRQIRNELHALLKGIIEKREKAMLVGETANDDLLSLLMESNF  309

Query  821   KS----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQ  672
             +           G S D+VIEEC+ FYFAGQE+TSD L+W MILLS H  WQ RAR+E+ 
Sbjct  310   REMQEHDERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEIL  369

Query  671   QVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilils  492
             QVFG+ KPD +GLN LKI+TMI +EVLRLYPP    IRT++ ++++G    P    + L 
Sbjct  370   QVFGNKKPDGNGLNHLKIVTMIFHEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALP  429

Query  491   slLVQRDPDVWGADAGEFKPERFAEGVAKATK-NRLAFLPFGWGPRTCIGNNFAMMEAKI  315
              LL+  D ++WG DA EF PERF+EGV+KATK  + AF PFG+GPR CIG NFAMMEAK+
Sbjct  430   ILLIHHDHEIWGEDAKEFNPERFSEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKM  489

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             A+A ILQRFSF LSPSYAH+P  V+T++PQ+GA L+LH +
Sbjct  490   ALAMILQRFSFELSPSYAHAPFNVITVQPQYGAHLILHGL  529



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/515 (51%), Positives = 360/515 (70%), Gaps = 15/515 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V+I F FI++   +I+A R++ WVWL+P+KLE+ LRQQG+ GNSYR+ +GD +EM  + +
Sbjct  6     VAISFAFITL---LIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMIS  62

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A S+PI+LSD+I+ RVLPF++ ++ KYGKN F+W GP P V I +PEL+++VF+    F
Sbjct  63    EANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAF  122

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
              +P PHPL K L +GL   E +QW +HRKII+PAF+ +K+K M P+   SC +M+  KWE
Sbjct  123   HKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMV-NKWE  181

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
                S+   C+ D+ P LE  T D ISRTAFG SY EG ++F LQ EQA L  +V  SVY 
Sbjct  182   KKLSKDGSCELDIWPDLENLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYI  241

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  + +K ++R+ +I NE+  L+KG+I KRE+ M      +D+    L+    +    
Sbjct  242   PGWRFVPTKTNKRIRQIRNELHALLKGIIEKREKAMLVGETANDDLLSLLMESNFREMQE  301

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S D+VIEEC+ FYFAGQE+TSD L+W MILLS H  WQ RAR+E+ QVFG+
Sbjct  302   HDERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVFGN  361

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
              KPD +GLN LKI+TMI +EVLRLYPP    IRT++ ++++G    P    + L  LL+ 
Sbjct  362   KKPDGNGLNHLKIVTMIFHEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILLIH  421

Query  476   RDPDVWGADAGEFKPERFAEGVAKATK-NRLAFLPFGWGPRTCIGNNFAMMEAKIAIATI  300
              D ++WG DA EF PERF+EGV+KATK  + AF PFG+GPR CIG NFAMMEAK+A+A I
Sbjct  422   HDHEIWGEDAKEFNPERFSEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALAMI  481

Query  299   LQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LQRFSF LSPSYAH+P  V+T++PQ+GA L+LH +
Sbjct  482   LQRFSFELSPSYAHAPFNVITVQPQYGAHLILHGL  516



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/516 (51%), Positives = 358/516 (69%), Gaps = 14/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V+I F FI++   +I+A R++ WVWL+P+KLE+ LRQQGL GNSYR+ +GD +EM  +
Sbjct  4     SSVAISFAFITL---LIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRM  60

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
              ++A S+ I+LSDDI+ RVLPF+  ++ KYGKN F+W GP P V I +PEL+++VF+   
Sbjct  61    ISEANSRSISLSDDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYN  120

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++P PHPL K L +GL   E +QW + RKII+PAF+ +K+K M P+   SC +M+  K
Sbjct  121   AFRKPPPHPLGKLLATGLVTLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSDMV-NK  179

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE   S+   C+ D+ P LE    D ISRTAFG SY EG ++F LQ EQA L  +V  SV
Sbjct  180   WEKKLSKDGSCELDIWPDLENLAGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSV  239

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W  + +K ++RM +I NE+  L+KG+I +RE+ MK     +D+    L+    +  
Sbjct  240   YIPGWRFVPTKTNKRMRQISNEVHALLKGIIERREKAMKVGETANDDLLSLLMESNFREM  299

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  +VIEEC+ FYFAGQE+TSD L+W M+LLS H  WQ RAR+EV QVF
Sbjct  300   QEHDERKNVGMSIKDVIEECKLFYFAGQETTSDLLLWTMVLLSKHSNWQARAREEVLQVF  359

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD DGLN LKI+T+I +EVLRLYPP    IRT+  ++++G    P   ++ L  LL
Sbjct  360   GNKKPDGDGLNHLKIVTIIFHEVLRLYPPVSMLIRTVVADSQVGGWYFPDGALITLPILL  419

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  D ++WG DA EF PERF+EGV+KATK + AF PFG+GPR CIG NFAMMEAK+A+A 
Sbjct  420   IHHDHEIWGEDAKEFNPERFSEGVSKATKGQFAFYPFGYGPRVCIGQNFAMMEAKMALAM  479

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  ++T++PQ+GA L+LH +
Sbjct  480   ILQRFSFELSPSYAHAPSNIITIQPQYGAYLILHGL  515



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/501 (54%), Positives = 360/501 (72%), Gaps = 11/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             ++ WA RV+ WVWL+P+KLE+ LRQQGL GNSYR+  GDTKE + +  +AKSKP++L  D
Sbjct  19    IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMLKEAKSKPMDLFHD  78

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             + PRVLPF H ++  YGKN F+W GP PRV IS PE M+++F     F++P  +PLVK L
Sbjct  79    LAPRVLPFVHQSMNTYGKNSFIWIGPTPRVNISNPEDMKDIFAKYEDFQKPVKNPLVKLL  138

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
              +GLA YE ++WA+HRKII+PAF+ +K+K M P+   SC E+I ++WE L S++  C+ D
Sbjct  139   ATGLANYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSELI-EEWESLASKEGSCELD  197

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V PYL+  T+DVISRTAFG SY EG K+F L  +QA+LT + I SVY P W  L ++ ++
Sbjct  198   VWPYLQNLTADVISRTAFGSSYEEGRKIFQLLKDQAQLTIKAIQSVYIPGWRFLPTRMNK  257

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTD  801
             RM EID EI+G + G+I KRE  ++ +    D+    L+   LK           G S +
Sbjct  258   RMKEIDKEIKGSLMGIINKREEAIRVREATRDDLLGILMDSNLKEIRENGNTKNVGMSIE  317

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             +VIEEC+ FYFAGQE+TS  LVW ++LLS +Q WQ RAR EV QVFG NKPDFDGL+ LK
Sbjct  318   DVIEECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARARDEVLQVFGSNKPDFDGLSHLK  377

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMIL EVLRLYP      R +++ T+LG++ LP  + + L++LLV  D ++WG DA E
Sbjct  378   VVTMILLEVLRLYPAVVVLSRAIHKNTQLGKLSLPAGVEVSLNTLLVHHDKELWGEDANE  437

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             FKPERF+ GV+KATKN+ A+ PFG GPR CIG NFAM+EAK+A+A ILQ F+F LSPSYA
Sbjct  438   FKPERFSSGVSKATKNKFAYFPFGGGPRICIGQNFAMVEAKLALALILQHFAFELSPSYA  497

Query  260   HSPCFVVTLKPQFGAPLVLHK  198
             H+P   +TL+PQFGA ++LHK
Sbjct  498   HAPSADITLQPQFGAHIILHK  518



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/514 (52%), Positives = 362/514 (70%), Gaps = 14/514 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V++ F FI++   +I+A RV+ W+WL+P++LE+ L+QQGL GNSYR+ YGD KEM+ +  
Sbjct  9     VALSFAFITI---LIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIK  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A S+PI++SDDI+ RV PF++ ++ KYGK+ F+W GP PRV I EPEL+++V   +T+F
Sbjct  66    EATSRPISISDDIVQRVAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P+ H LVK LVSGL   + ++WA+HRKII+PAF  +K+K M P+   SC +MI  KWE
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMI-SKWE  184

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
                S +  C+ DV PYL+  T D ISRTAFG +Y EG  +F LQ EQA+L  Q   S + 
Sbjct  185   GKLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFI  244

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +K ++RM +I  E+  L+ G+I KR + MK     +D+    LL    K    
Sbjct  245   PGWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQE  304

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S  +VIEEC+ FYFAGQE+TS  L+W M+LLS H  WQ RAR+EV  VFG+
Sbjct  305   HENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGN  364

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             NKP+ DGLN LKI+ MIL+EVLRLYPP P   RT+YE+ ++G+M LP  + + L ++LV 
Sbjct  365   NKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVH  424

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EF PERF++GV KATK+ ++F PFGWG R CIG NFA++EAK+ +A IL
Sbjct  425   HDHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAMIL  484

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             QRFSF LSPSY+H+PC +VTLKPQ+GA L+LH I
Sbjct  485   QRFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/503 (51%), Positives = 357/503 (71%), Gaps = 11/503 (2%)
 Frame = -2

Query  1673  AVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSD  1494
             A++  A R    VWL+PR+LE+ LR+QGL GNSYR  +GD K+++ +  +A S+PINLSD
Sbjct  15    ALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSIMLKEANSRPINLSD  74

Query  1493  DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             DI+PRV+PF +  + +YGKN F W GP PRV I +PEL++EVF+    F++ KP+PL  F
Sbjct  75    DIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEAGRFQKQKPNPLANF  134

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             L++GL  YE ++WA+HRK+++PAF+ +K+K M+P+   SC +MI K  E+++ E + C+ 
Sbjct  135   LLTGLVSYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSCRQMISKMEEMVSPEGS-CEL  193

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV P+L+  T+D +SRTAFG SY EG ++F L  EQ  LT +V  SVY P WW L +KR+
Sbjct  194   DVWPFLKNLTADALSRTAFGSSYEEGRRLFQLLQEQTYLTMEVFQSVYIPGWWYLPTKRN  253

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK----------SGFST  804
             +RM +ID E+  L+  +I KR++ MK+    +++    L+    K          +G S 
Sbjct  254   KRMKKIDKEMNTLLNDIITKRDKAMKDGKTANEDLLGILMESNSKEIQEGGNSKNAGISM  313

Query  803   DEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRL  624
              EVIEEC+ FY AGQE+TS+ L+W M+LLS H  WQ  AR+EV QVFG NKP+F GL+RL
Sbjct  314   QEVIEECKLFYLAGQETTSNLLLWTMVLLSKHPNWQTLAREEVFQVFGKNKPEFAGLSRL  373

Query  623   KILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAG  444
             K++TMI  EVLRLYPP     R +YE+  LGE+ LP  + ++L ++LV  DP++WG D  
Sbjct  374   KVVTMIFYEVLRLYPPGATLNRAVYEDINLGELYLPSGVEIVLPTILVHHDPEIWGDDVK  433

Query  443   EFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSY  264
             EFKPERF+EGV KATK ++++ PFGWGPR CIG NFAM EAK+A+A ILQ F+F LSPSY
Sbjct  434   EFKPERFSEGVMKATKGQVSYFPFGWGPRICIGQNFAMAEAKMALAMILQCFTFELSPSY  493

Query  263   AHSPCFVVTLKPQFGAPLVLHKI  195
              H+P  V+TL+PQ+GA L+LHKI
Sbjct  494   THAPTSVLTLQPQYGAHLILHKI  516



>gb|KCW67646.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=510

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/509 (51%), Positives = 358/509 (70%), Gaps = 3/509 (1%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +++ +  + L   +  +  WA RVV WVWL+P++LE+ LRQQGL+G  Y   +GD KE +
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
              L  +A SKPI++SDDI PR+LPF H +   YGK+ F+W GP PRV I+ PE ++E+F  
Sbjct  61    RLLTEANSKPISVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSK  120

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                + RP  +PLVK L  GLA +E ++WARHRKII+PAF+ +K+K M P+  SSC EM+ 
Sbjct  121   INDYPRPGSNPLVKLLADGLASHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMV-  179

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              +WE L S    C+ D    L+  T +VISRTAFG S+ EG ++F LQ EQA+LT   + 
Sbjct  180   GRWEKLVSVDRSCEIDAWVDLQNLTREVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQ  239

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  + +K +RRM  ID E+R L+  +I +RE+ ++E     D+    LL   +K
Sbjct  240   SVYIPGWRFVPTKMNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMK  299

Query  818   S--GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
                G S  +V+EEC+ FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV Q+FG  KPD
Sbjct  300   ENVGMSLHDVMEECRLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPD  359

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              DGL+ LKI+TMILNEVLRLYPP     R + +ETKLG++ +PP + L++ +LL+  D +
Sbjct  360   PDGLSHLKIVTMILNEVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKE  419

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG DA EFKPERFAEGV+KATKN+++F PFGWGPR CIG NFA++EAK+A+A ILQ+F+
Sbjct  420   LWGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFT  479

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             F LSPSYAH+P  V+TL+P++G  ++L K
Sbjct  480   FELSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_010060783.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/509 (52%), Positives = 356/509 (70%), Gaps = 3/509 (1%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +++ +  + L   +  +  WA RVV WVWL+P++LE+ LRQQGL+G  Y   +GD KE +
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
              L  +A SKPI++SDDI PR+LPF H +   YGK+ F+W GP PRV I+ PE ++E+F  
Sbjct  61    RLLTEANSKPISVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSK  120

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                + RP  +PLVK L  GLA +E ++WARHRKII+PAF+ +K+K M P+  SSC EM+ 
Sbjct  121   INDYPRPGSNPLVKLLADGLASHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMV-  179

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              +WE L S    C+ D    L+  T +VISRTAFG S+ EG ++F LQ EQA+LT   + 
Sbjct  180   GRWEKLVSVDRSCEIDAWVDLQNLTREVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQ  239

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  + +K +RRM  ID E+R L+  +I +RE+ ++E     D+    LL   +K
Sbjct  240   SVYIPGWRFVPTKMNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMK  299

Query  818   S--GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
                G S  +VIEEC+ FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV Q+FG  KPD
Sbjct  300   ENVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPD  359

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              DGL+ LKI+TMILNEVLRLYPP     R +  ETKLG++ +PP + L + +LL+  D +
Sbjct  360   PDGLSHLKIVTMILNEVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDQE  419

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG DA EFKPERFAEGV+KATKN+++F PFGWGPR CIG NFA++EAK+A+A ILQ+F+
Sbjct  420   LWGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFT  479

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             F LSPSYAH+P  V+TL+P++G  ++L K
Sbjct  480   FELSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/516 (51%), Positives = 354/516 (69%), Gaps = 14/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V+I F+FI++   +I+A R++ WVWL+P+KLE+ LRQQGL GNSY   YGD KEM+ +
Sbjct  4     SSVAISFVFITL---LIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRM  60

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A S+PI+ SDDI+ RVLPF+  ++ KYGKN F W GP P V I EPEL+++VF+ + 
Sbjct  61    INEANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHN  120

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++  PHPL K L +G+   E +QW + RKII+PAF+ +K+K M  +   SC +M+  K
Sbjct  121   AFQKVPPHPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMV-NK  179

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE   S    C+ DV PYLE    DVISRTAFG SY EG ++F LQ EQA L  QV  S+
Sbjct  180   WEKKLSLDGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSI  239

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W    +K +RRM +I NE+  L+KG+I KRE+ MK     + +    L+    +  
Sbjct  240   YVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDM  299

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  +VIEEC+ FY AGQE+TS  L+W M+LLS H  WQ RAR+EV +VF
Sbjct  300   QENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTRAREEVLRVF  359

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD DGLN LKI+TMI +EVLRLYPP    +RT++ ++++G + LP  + + L  LL
Sbjct  360   GNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILL  419

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  D ++WG DA EF P RF+EGV+KA K +++F PFG+GPR C+G NFAMMEAK+A+A 
Sbjct  420   LHHDHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAM  479

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  ++T++PQ+GA L+LH +
Sbjct  480   ILQRFSFELSPSYAHAPISLITMQPQYGAHLILHGL  515



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   531 bits (1369),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 261/512 (51%), Positives = 358/512 (70%), Gaps = 13/512 (3%)
 Frame = -2

Query  1700  ILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKA  1521
             +L LF     + +W  +++ W W +PRKL++ LRQQGL GNSY++ +GD KE++    +A
Sbjct  8     VLSLFAVTSVIYVW--KLLNWAWFRPRKLDQCLRQQGLKGNSYKLIFGDLKELSKSIEEA  65

Query  1520  KSKPINLSDD-ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             KSKP+N+SDD I PR+LP++  A+ KYGKN F+W GP P V + +P+++++V   ++L++
Sbjct  66    KSKPLNVSDDDIPPRILPYFIEAIKKYGKNSFIWLGPNPLVFVRDPDVLKDVLTKHSLYQ  125

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +PK  PL + L  G+  YE+ +WA+HRKI++PAF+ +KIK M P++  SC EM+  +W+ 
Sbjct  126   KPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAIQLSCSEMV-SQWKE  184

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
               S K  C+ D+ PYL+  +SD ISRTAFG +Y EG K+F LQ EQAE    +  ++Y P
Sbjct  185   AASVKGSCELDIWPYLQRLSSDAISRTAFGSNYEEGRKIFELQKEQAEHVIAISSTLYIP  244

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  + +KR+RRM EI+ E++  ++G+I KR + MK    + D+    LL    K     
Sbjct  245   GWRFMPTKRNRRMKEIEKEVQATVRGIIDKRVKTMKAGEANADDLLGILLDSNFKEIEQH  304

Query  815   -----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNK  651
                  G ST EVIEEC+ FYFAGQE+TS  LVW M+LLS H  WQ RAR+EV QVFG   
Sbjct  305   GSKNFGMSTQEVIEECKLFYFAGQETTSVLLVWTMVLLSRHPEWQARAREEVLQVFGDGM  364

Query  650   PDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRD  471
              +FDGLNRLKI+TMIL+E LRLYPP     R +  +TKLGE+ LP  ++L L  LLV  D
Sbjct  365   LEFDGLNRLKIVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPMLLVHHD  424

Query  470   PDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQR  291
              ++WG DA EFKPERF+EGV+KATK ++ F PFG GPR CIG NFAM+EAK+A+A ILQR
Sbjct  425   EEIWGEDAKEFKPERFSEGVSKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQR  484

Query  290   FSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             FSF LSPSY H+P  V+T++PQ+GAPL+LHK+
Sbjct  485   FSFELSPSYTHAPQSVITMQPQYGAPLILHKL  516



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   531 bits (1368),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 260/516 (50%), Positives = 359/516 (70%), Gaps = 14/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V+I F+FI++   +I+A R++ WVWL+P+KLE+ LRQQGL GNSYR+ +GD +EM+ +
Sbjct  4     SSVAISFVFITL---LIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRM  60

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A S+PI+ SDDI+ RVLPF+  ++ KYGKN F+W GP P V I +PEL+++V + + 
Sbjct  61    INEANSRPISFSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHN  120

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++P  HPL K L SG+A  E +QW + RKII+PAF+ +K+K M  +   SC +M+  K
Sbjct  121   AFQKPPRHPLGKLLASGVASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMV-NK  179

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE   S    C+ D+ PYL+  T DVISRTAFG SY EG ++F LQ EQA LT QV  SV
Sbjct  180   WEKQLSLDGSCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSV  239

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W    +K +RRM +I +E+  L+KG+I KRE+ M+     +D+    L+    +  
Sbjct  240   YVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREM  299

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  +VIEEC+ FY AGQE+TS  L+W M+LLS H  WQ RAR+EV +VF
Sbjct  300   QENDERKNVGMSIKDVIEECKLFYLAGQETTSALLLWTMVLLSKHSNWQARAREEVLRVF  359

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD DGLN LKI+TMI +EVLRLYPP+P   R ++ ++++G + LP  + + L  LL
Sbjct  360   GNKKPDGDGLNHLKIVTMIFHEVLRLYPPAPMLTRAVFADSQVGGLYLPDGVQIALPILL  419

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  D  +WG DA EF P RF+EGV+KA K++++F PFG+GPR C+G NFAMMEAK+A+A 
Sbjct  420   IHHDDKIWGDDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAM  479

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  ++T++PQ GA L+LH +
Sbjct  480   ILQRFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  515



>ref|XP_010060778.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67643.1| hypothetical protein EUGRSUZ_F01390 [Eucalyptus grandis]
Length=510

 Score =   531 bits (1368),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 260/493 (53%), Positives = 348/493 (71%), Gaps = 3/493 (1%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             +  WA RVV WVWL+P++LE+ LRQQGL+G  Y   +GD KE + L  +A SKPI +SDD
Sbjct  17    LTTWAWRVVNWVWLRPQRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAVSDD  76

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PR+LPF H +   YGK+ F+W GP PRV I+ PE ++E+F     + RP  +PLVK L
Sbjct  77    IKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLL  136

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL  +E ++WARHRKII+PAF+ +K+K M P+  SSC EM+  +WE L S +  C+ D
Sbjct  137   ADGLTSHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMV-GRWEKLVSVERSCEID  195

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
                 L+  T +VISRTAFG S+ EG ++F LQ EQA+LT   + SVY P W  + +K +R
Sbjct  196   AWVDLQNLTGEVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNR  255

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--GFSTDEVIEECQH  777
             RM  ID E+R L+  ++ +RE+ ++E     D+    LL   +K   G S  +VIEEC+ 
Sbjct  256   RMKSIDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKENVGMSLHDVIEECKL  315

Query  776   FYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNE  597
             FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV Q+FG  KPD DGL+ LKI+TMILNE
Sbjct  316   FYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILNE  375

Query  596   VLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAE  417
             VLRLYPP     R +  ETKLG++ +PP + L + +LL+  D ++WG DA EFKPERFAE
Sbjct  376   VLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDKELWGEDAEEFKPERFAE  435

Query  416   GVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVT  237
             GV+KATKN+++F PFGWGPR CIG NFA++EAK+A+A ILQ+F+F LSPSYAH+P  V+T
Sbjct  436   GVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFDLSPSYAHAPSNVIT  495

Query  236   LKPQFGAPLVLHK  198
             L+P++G  ++L K
Sbjct  496   LQPRYGVQVILRK  508



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   531 bits (1368),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 259/516 (50%), Positives = 353/516 (68%), Gaps = 14/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V+I F FI    ++I+A R++ WVWL+P+KLE+ LRQQGL GNSYR+ +GD +EM+ +
Sbjct  4     SSVAISFAFI---VLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSEM  60

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A S+PI+ SDDI+ RVLPF+  ++ KYGKN F W GP P V I EPEL+++V + + 
Sbjct  61    INEANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHN  120

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
             +F++P PHPL K L +G+   E +QW + RKII+PAF+ +K+K M  +   SC +M+  K
Sbjct  121   VFQKPPPHPLSKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMV-NK  179

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE   S    C+ DV PYLE    DVISRTAFG SY EG ++F LQ EQA L  QV  S+
Sbjct  180   WEKKLSLDGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSI  239

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W    +K +RRM +I NE+  L+KG+I KRE+ MK     + +    L+    +  
Sbjct  240   YVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDM  299

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  +VIEEC+ FY AGQE+TS  L+W M+LLS H  WQ  AR+EV +VF
Sbjct  300   QENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTHAREEVLRVF  359

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD DGLN LKI+TMI +EVLRLYPP    +RT++ ++++G + LP  + + L  LL
Sbjct  360   GNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILL  419

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  D ++WG DA EF P RF+EGV+KA K++++F PFG+GPR C+G NFAMMEAK+A+A 
Sbjct  420   LHHDHEIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAM  479

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  ++T  PQ+GA L+LH +
Sbjct  480   ILQRFSFELSPSYAHAPISLLTTHPQYGAHLILHGL  515



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   531 bits (1367),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 263/514 (51%), Positives = 360/514 (70%), Gaps = 14/514 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V++ F FI++   +I+A R++ W+WL+P++LE+ L+QQGL GNSYR+ +GD KEM  +  
Sbjct  9     VALSFAFITI---LIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIK  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A S+PI++SDDI+ R+ PF + ++ KYGK+ F+W GP PRV I EPEL+++V   +T+F
Sbjct  66    EASSRPISISDDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P+ H LVK LVSGL   + ++WA+HRKII+PAF  +K+K M P+   SC +MI  KWE
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMI-SKWE  184

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
                S +  C+ DV PYL+  T D ISRTAFG +Y EG  +F LQ EQA+L  Q   S + 
Sbjct  185   GKLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFI  244

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +K ++RM +I  E+  L+ G+I KR + MK     +D+    LL    K    
Sbjct  245   PGWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQE  304

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S  +VIEEC+ FYFAGQE+TS  L+W M+LLS H  WQ RAR+EV  VFG+
Sbjct  305   HENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGN  364

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             NKP+ DGLN LKI+ MIL+EVLRLYPP P   RT+YE+ ++G+M LP  + + L ++LV 
Sbjct  365   NKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVH  424

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EF PERF++GV KATK+ ++F PFGWG R CIG NFA++EAK+ +A IL
Sbjct  425   HDHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAMIL  484

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             QRFSF LSPSY+H+PC +VTLKPQ+GA L+LH I
Sbjct  485   QRFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_010060780.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 ref|XP_010060781.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67645.1| hypothetical protein EUGRSUZ_F01392 [Eucalyptus grandis]
Length=510

 Score =   530 bits (1365),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 258/509 (51%), Positives = 357/509 (70%), Gaps = 3/509 (1%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +++ +  + L   +  +  WA RVV WVWL+P++LE+ LRQQGL+G  Y   +GD KE +
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
              L  +A SKPI +SDDI PR+ PF H +   YGK+ F+W GP PRV I+ PE ++E+F N
Sbjct  61    RLLTEANSKPIAISDDIKPRLFPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSN  120

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                + +P  +PLVK LV GLA +E ++W RHRKII+PAF+ +K+K M P+  SSC EM+ 
Sbjct  121   INDYPKPASNPLVKLLVDGLANHEGEKWVRHRKIINPAFHMEKLKLMLPAFYSSCAEMV-  179

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              +WE L S +  C+ D    L+  T +V+SRTAFG S+ EG ++  LQ EQA+LT     
Sbjct  180   GRWEKLVSVERSCEIDAWVDLQNLTREVLSRTAFGSSFEEGKRICELQGEQAQLTIIAFQ  239

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  + +K +RRM  ID E+R L+  ++ +RE+ ++E     D+    LL   +K
Sbjct  240   SVYIPGWRFVPTKMNRRMKNIDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMK  299

Query  818   S--GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
                G S  +VIEEC+ FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV ++FG  KPD
Sbjct  300   ENVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLRIFGSGKPD  359

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              DGL+ LKI+TMILNEVLRLYPP+   +R + +ETKLG++ +PP + L + +LL+  D +
Sbjct  360   PDGLSHLKIVTMILNEVLRLYPPATDLVREVLKETKLGKLTIPPGVQLSMPTLLIHHDKE  419

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG DA EFKPERFAEGV+KATKN+++F PFGWGPR CIG NFA++EAK+A+A ILQ+F+
Sbjct  420   LWGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFT  479

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             F LSPSYAH+P  V+TL+P++G  ++L K
Sbjct  480   FELSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   530 bits (1364),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 260/498 (52%), Positives = 345/498 (69%), Gaps = 11/498 (2%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             WA RVV W+WL+P+KLE++LRQQGL GN YR   GD KE++  T +A SKP++LS DI P
Sbjct  19    WAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIAP  78

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSG  1302
             RV+PF+H  V  YGKN FVW G  PRVII+ PE ++ +     +F +P+P+PLVK L +G
Sbjct  79    RVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLATG  138

Query  1301  LACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQP  1122
             +A YE ++WA+HR+II+P F+ +K+K M P+   SC EMI++ WE L  +++ C+ DV P
Sbjct  139   IAFYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVE-WESLVLKESSCELDVWP  197

Query  1121  YLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMH  942
             Y +  T+DVISRTAFG SY EG K+F L  EQ +L  +V+ SVY+P W  L +K +++M 
Sbjct  198   YFQNLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYTPGWRFLPTKTNKKMK  257

Query  941   EIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVI  792
              ID EIR L+ G+I KRE  +K      D+    L+   +K           G S  +VI
Sbjct  258   GIDREIRALLMGIINKREGAIKAGKATKDDLLGVLMESNVKEIREHGNNKKVGMSMHDVI  317

Query  791   EECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILT  612
             EEC+ FYFAGQE+TS  LVW M+LL  +Q WQD AR+EV +VFG NKPDFDGL  LK++T
Sbjct  318   EECKLFYFAGQETTSGLLVWTMVLLGQYQDWQDHAREEVIEVFGSNKPDFDGLIHLKVVT  377

Query  611   MILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKP  432
             MIL+EVLRLYP      R   ++T+L    LP  + + L +LLV  D  +WG DA EFKP
Sbjct  378   MILHEVLRLYPALSLMTRITSKKTQLANYSLPAGVEVALPTLLVHHDKQLWGDDAQEFKP  437

Query  431   ERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSP  252
             ERF+EGV KATKN+  + PFG GPR CIG NFAM+EAK+A++ ILQ F+F LSPSYAH+P
Sbjct  438   ERFSEGVLKATKNKFTYFPFGGGPRICIGQNFAMVEAKVALSLILQHFTFELSPSYAHAP  497

Query  251   CFVVTLKPQFGAPLVLHK  198
                +T++PQFGA ++LHK
Sbjct  498   SSHLTIRPQFGAHIILHK  515



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   530 bits (1364),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 264/509 (52%), Positives = 347/509 (68%), Gaps = 11/509 (2%)
 Frame = -2

Query  1691  LFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSK  1512
             L I +  V+ WA RV+ WVWL+P+KLEK+LRQQGL GNSYR+ +GD KE +    +AK++
Sbjct  10    LTIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKAR  69

Query  1511  PINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKP  1332
             P++L DDI  RV PF H  V  YGKN F+W GP PRV I  P+ ++ +F     F++   
Sbjct  70    PLSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNS  129

Query  1331  HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSE  1152
              PL + L+ GLA  E ++WA+HRK+I+PAF+ +K+K M P+   SC E+I  KWE   S 
Sbjct  130   IPLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEII-TKWEKQMSV  188

Query  1151  KNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWL  972
             +   + DV PYL   TSDVISRTAFG SY EG ++F LQ E AELT QV  SV+ P W  
Sbjct  189   EGSSELDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGWRF  248

Query  971   LSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--------  816
             L +KR+RRM EID EIR  + G+I  RE+ M+     +++    L+    +         
Sbjct  249   LPTKRNRRMKEIDKEIRASLMGIIKNREKAMRAGEAANNDLLGILMETSFREIEEHGNNK  308

Query  815   --GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDF  642
               GFS ++VIEEC+ FYFAGQE+TS  L W M+LLS HQ WQ+RARQEV QVFG+NKPD+
Sbjct  309   NVGFSMNDVIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDY  368

Query  641   DGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDV  462
             DGLN LKI+ MIL EVLRLYPP     R +++ETKLG + LP  + + L  +LV +DP++
Sbjct  369   DGLNHLKIVQMILYEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQIGLPMILVHQDPEL  428

Query  461   WGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSF  282
             WG DA EFKPERFAEG++KA KN++++ PF  GPR C+G NFA++EAK+A A ILQ +SF
Sbjct  429   WGDDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMATAMILQNYSF  488

Query  281   HLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              LSPSY H+P  V TL P+ G  L+L K+
Sbjct  489   ELSPSYVHAPTAVPTLHPELGTQLILRKL  517



>ref|XP_007212438.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
 gb|EMJ13637.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
Length=506

 Score =   529 bits (1362),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 266/501 (53%), Positives = 357/501 (71%), Gaps = 11/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             ++ WA RV+ WVWL+P+KLE+ LRQQGL GNSYR+  GDTKE + +  +AKSKP+NLS D
Sbjct  6     IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNLSHD  65

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PRVLPF H +VT YGKN F+W GP PRV IS P  +++VF N   F++P  +PLVKFL
Sbjct  66    ITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQKPVINPLVKFL  125

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
              +GL  YE ++WA+HRKII+PAF+ +K+K M P+   SC EMI +KWE L S++  C+ D
Sbjct  126   ATGLPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHQSCSEMI-EKWERLVSKEGSCELD  184

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V PYLE+  +DVISR +FG SY EG K+F L  EQA+LT + + S Y P W  L ++ ++
Sbjct  185   VWPYLESLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQSFYIPGWRFLPTRSNK  244

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTD  801
             RM  ID EI+G ++ +I  RE  ++      D+    L+   LK           G S +
Sbjct  245   RMKAIDKEIKGSLRDIISTREEAIRMGEAAKDDLLGILMESNLKEIRENGNTKNVGMSIE  304

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             +VIEEC+ FYFAGQE+TS  L+W ++LLS +Q WQ RAR EV QVFG NKPDFDGL+ LK
Sbjct  305   DVIEECKLFYFAGQETTSVLLLWTLVLLSQNQNWQARARDEVLQVFGSNKPDFDGLSHLK  364

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMIL EVLRLYP      RT +++T+LG++ LP  + + L  LL+  D ++WG DA E
Sbjct  365   VVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILLLHHDKELWGEDAIE  424

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERF+EGV+KA+KN+ A+ PFG GPR CIG NFAM+EAK+A + +LQRF+F LSPSYA
Sbjct  425   FNPERFSEGVSKASKNQFAYFPFGGGPRICIGQNFAMLEAKLAFSLLLQRFTFELSPSYA  484

Query  260   HSPCFVVTLKPQFGAPLVLHK  198
             H+P  +++L+PQ+GA ++LHK
Sbjct  485   HAPSLIISLQPQYGAHIILHK  505



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   529 bits (1363),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 264/498 (53%), Positives = 349/498 (70%), Gaps = 11/498 (2%)
 Frame = -2

Query  1658  ACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPR  1479
             A RV+ WVWL+P+KLEK LRQQGL GNSYR++ GD KE++ +  +A SKP+NLS D  PR
Sbjct  23    AWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNLSHDTAPR  82

Query  1478  VLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGL  1299
             V+P+ H +V+ YGKN F+W GP PRV I+ PE ++ +F  +  F +P   PLVK L++GL
Sbjct  83    VVPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKPALSPLVKLLLTGL  142

Query  1298  ACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPY  1119
             A Y  ++WA+HRKII PAF+ +K+K M P++  SC EMI ++WE L S+++  + DV PY
Sbjct  143   ANYGGEKWAKHRKIIKPAFHSEKLKRMLPAIYQSCSEMI-EEWESLVSKESSYELDVWPY  201

Query  1118  LEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHE  939
             L+  T+DVISRT+FG SY EG ++F L   Q ELT ++ HSVY P W  L +K ++R+ E
Sbjct  202   LQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTVKMKHSVYIPGWRFLPTKTNKRLKE  261

Query  938   IDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVIE  789
             +D EIR L  G+I KRE  +K      D+    LL    K           G S  +V+ 
Sbjct  262   VDKEIRELFMGIINKREEAIKAGEAAKDDLLGLLLESNNKEIKEHGNKKKVGMSIQDVLG  321

Query  788   ECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTM  609
             EC+ FYFAGQE+TS  LVW M+LLS +Q WQDRAR+EV QVFG NKPDFDGLN LK++TM
Sbjct  322   ECKLFYFAGQETTSILLVWTMVLLSENQNWQDRAREEVLQVFGGNKPDFDGLNHLKVVTM  381

Query  608   ILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPE  429
             IL E LRLYP S    R ++++T+  E  LP  + + L ++L+  D ++WG DA +FKPE
Sbjct  382   ILLEALRLYPSSFTLSRMIHKKTQFAEFSLPAGVGISLPTILIHHDKELWGDDATQFKPE  441

Query  428   RFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             RFAEGV+KATKN+L + PFG G R CIG NFAMMEAK+A+A ILQ F+F LSPSYAH+P 
Sbjct  442   RFAEGVSKATKNKLTYFPFGGGARICIGQNFAMMEAKLAVALILQHFTFKLSPSYAHAPS  501

Query  248   FVVTLKPQFGAPLVLHKI  195
              +  L+PQFGA +VLHK+
Sbjct  502   GITLLQPQFGAHIVLHKL  519



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   529 bits (1362),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 265/509 (52%), Positives = 346/509 (68%), Gaps = 11/509 (2%)
 Frame = -2

Query  1691  LFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSK  1512
             L I +  V+ WA RV+ WVWL+P KLEK+LRQQGL GNSYR+ +GD KE +    +AK++
Sbjct  10    LTIVIVTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKAR  69

Query  1511  PINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKP  1332
             P++L DDI  RV PF H  V  YGKN F+W GP PRV I  P+ ++ +F     F++   
Sbjct  70    PLSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNS  129

Query  1331  HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSE  1152
              PL + L+ GLA  E ++WA+HRK+I+PAF+ +K+K M P+   SC E+I  KWE   S 
Sbjct  130   IPLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEII-TKWEKQMSV  188

Query  1151  KNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWL  972
             +   + DV PYL   TSDVISRTAFG SY EG ++F LQ E AELT QV  SV+ P W  
Sbjct  189   EGSSELDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGWRF  248

Query  971   LSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--------  816
             L +KR+RRM EID EIR  + G+I  RE+ M+     +D+    L+    +         
Sbjct  249   LPTKRNRRMKEIDKEIRASLMGIIKNREKAMRAGEAANDDLLGILMETSFREIEEHGNNK  308

Query  815   --GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDF  642
               GFS ++VIEEC+ FYFAGQE+TS  L W M+LLS HQ WQ+RARQEV QVFG+NKPD+
Sbjct  309   NVGFSMNDVIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPDY  368

Query  641   DGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDV  462
             DGLN LKI+ MIL EVLRLYPP     R +++ETKLG + LP  + + L  +LV +DP++
Sbjct  369   DGLNHLKIVQMILYEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQIGLPMILVHQDPEL  428

Query  461   WGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSF  282
             WG DA EFKPERFAEG++KA KN++++ PF  GPR C+G NFA++EAK+A A ILQ +SF
Sbjct  429   WGDDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMATAMILQNYSF  488

Query  281   HLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              LSPSY H+P  V TL P+ G  L+L K+
Sbjct  489   ELSPSYVHAPTAVPTLHPELGTQLILRKL  517



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   528 bits (1361),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 260/498 (52%), Positives = 344/498 (69%), Gaps = 11/498 (2%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             WA RVV W+WL+P+KLE++LRQQGL GN YR   GD KE++  T +A SKP++LS DI P
Sbjct  19    WAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIAP  78

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSG  1302
             RV+PF+H  V  YGKN FVW G  PRVII+ PE ++ +     +F +P+P+PLVK L +G
Sbjct  79    RVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLATG  138

Query  1301  LACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQP  1122
             +A YE ++WA+HR+II+P F+ +K+K M P+   SC EMI++ WE L  +++ C+ DV P
Sbjct  139   IAFYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVE-WESLVLKESSCELDVWP  197

Query  1121  YLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMH  942
             Y +  T+DVISRTAFG SY EG K+F L  EQ +L  +V+ SVY P W  L +K +++M 
Sbjct  198   YFQNLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYIPGWRFLPTKTNKKMK  257

Query  941   EIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVI  792
              ID EIR L+ G+I KRE  +K      D+    L+   +K           G S  +VI
Sbjct  258   GIDREIRALLMGIINKREGAIKAGKATKDDLLGVLMESNVKEIREHGNNKKVGMSMHDVI  317

Query  791   EECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILT  612
             EEC+ FYFAGQE+TS  LVW M+LL  +Q WQD AR+EV +VFG NKPDFDGL  LK++T
Sbjct  318   EECKLFYFAGQETTSGLLVWTMVLLGQYQDWQDHAREEVIEVFGSNKPDFDGLIHLKVVT  377

Query  611   MILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKP  432
             MIL+EVLRLYP      R   ++T+L    LP  + + L +LLV  D  +WG DA EFKP
Sbjct  378   MILHEVLRLYPALSLMTRITSKKTQLANYSLPAGVEVALPTLLVHHDKQLWGDDAQEFKP  437

Query  431   ERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSP  252
             ERF+EGV KATKN+  + PFG GPR CIG NFAM+EAK+A++ ILQ F+F LSPSYAH+P
Sbjct  438   ERFSEGVLKATKNKFTYFPFGGGPRICIGQNFAMVEAKVALSLILQHFTFELSPSYAHAP  497

Query  251   CFVVTLKPQFGAPLVLHK  198
                +T++PQFGA ++LHK
Sbjct  498   SSHLTIRPQFGAHIILHK  515



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   528 bits (1361),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 262/514 (51%), Positives = 360/514 (70%), Gaps = 14/514 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V++ F FI++   +I+A R++ W+WL+P++LE+ L+QQGL GNSYR+ +GD KEM  +  
Sbjct  9     VALSFTFITI---LIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIK  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A S+PI++SDDI+ R+ PF++ ++ KYGK+ F+W GP PRV I EPEL+++V   +T+F
Sbjct  66    EATSRPISISDDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P+ H LVK LVSGL   + ++WA+HRKII+PAF  +K+K M P+   SC +MI  KWE
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKVKNMLPAFHLSCSDMI-SKWE  184

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
                S +  C+ DV PYL+  T D ISRTAFG +Y EG  +F LQ EQA+L  Q   S + 
Sbjct  185   GKLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFI  244

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +K ++RM +   E+  L+ G+I KRE+ MK     +D+    LL    K    
Sbjct  245   PGWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLNDDLLGILLESNFKEIQE  304

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S  +VI+EC+ FYFAGQE+TS  L+W MILLS H  WQ RAR+EV  VFG+
Sbjct  305   HGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMILLSKHPNWQARAREEVLHVFGN  364

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             NKP+ DGLN LKI+ MIL+EVLRLYPP P   RT+YE+ ++G+M LP  + + L ++LV 
Sbjct  365   NKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVH  424

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EF PERF++G  KATK+ ++F PFGWG R CIG NFA++EAK+ +A IL
Sbjct  425   HDHEIWGEDAREFNPERFSQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAMIL  484

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             QRFSF LSPSY+H+PC +VTLKPQ+GA L+LH I
Sbjct  485   QRFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 263/507 (52%), Positives = 345/507 (68%), Gaps = 10/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             I +  VV WAC+++ W WLKP+KLEK LR+QG  GNSYR  +GD KE   L+ +AKSKPI
Sbjct  12    IVIVTVVTWACKILNWAWLKPKKLEKQLRRQGFRGNSYRFLFGDVKEHGILSRQAKSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHP  1326
             +L DDI PRV+P Y      YGKN + W GP P + I +P+ ++EVF N   F++PK +P
Sbjct  72    SLDDDIAPRVVPLYDQREKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNP  131

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN  1146
             L K L +GLA  E ++WA+HRKII+PAF+ +K+K M P+   SC E+I K  +L+  ++ 
Sbjct  132   LGKILTTGLAIREGEKWAKHRKIINPAFHQEKLKLMLPAFYQSCTEIISKWEKLMIGDQG  191

Query  1145  WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLS  966
              C+ DV PYL   TSDVISRTAFG +Y EG ++F LQ E A++  Q + SVY P W  + 
Sbjct  192   SCELDVWPYLVKLTSDVISRTAFGSNYEEGIRIFQLQTELADIALQALQSVYIPGWRYVP  251

Query  965   SKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------  816
             +KR+RRM E+D EIR  +  +I KRE  MK      D+    L+   LK           
Sbjct  252   TKRNRRMKELDKEIRVSLADIIRKREIAMKTGEAAKDDLLGLLMESNLKEIKEHGNNKLK  311

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G S D+VI+EC+ FYFAGQE+TS  L+W M+LLS HQ WQ  AR+EV QV G  KPDFDG
Sbjct  312   GISRDDVIDECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAREEVLQVLGDKKPDFDG  371

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             LNRLKI+ MI  EVLRLYPP P   R + +ETK+G++ LP   ++ L +LLV  D  +WG
Sbjct  372   LNRLKIVQMIFYEVLRLYPPLPVLSRYVEKETKIGDLILPAESVIALQTLLVHHDKKLWG  431

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EG++KATKN++++ PF WGPR CIG NFA++EAK+A+A ILQ FSF L
Sbjct  432   DDAKEFKPERFSEGISKATKNQVSYFPFSWGPRICIGQNFALVEAKMAMAMILQNFSFEL  491

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P   + L+PQ G  L+L K+
Sbjct  492   SPSYVHAPHAFIFLQPQHGVYLILRKL  518



>ref|XP_010060782.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   527 bits (1358),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 260/509 (51%), Positives = 357/509 (70%), Gaps = 3/509 (1%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +++ +  + L   +  +  WA RVV WVWL+P++LE+ LRQQGL+G  Y   +GD KE +
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
              L  +A SKPI +SDDI PR+LPF H +   YGK+ F+W GP PRV I+ PE ++E+F  
Sbjct  61    RLLTEANSKPIAVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSK  120

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                + RP  +PLVK L +GL  +E ++WARHRKII+PAF+ +K+K M P+  SSC EM+ 
Sbjct  121   INDYPRPGSNPLVKLLTNGLFDHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMV-  179

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              +WE L S +  C+ D    L+  T +VISRTAFG S+ EG ++  LQ EQA+LT   + 
Sbjct  180   GRWEKLVSVERSCEIDAWVDLQNLTREVISRTAFGSSFEEGKRISELQGEQAQLTIIALQ  239

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  + +K +RRM  ID E+R L+  +I +RE+ ++E     D+    LL   +K
Sbjct  240   SVYIPGWRFVPTKMNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMK  299

Query  818   S--GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
                G S  +V+EEC+ FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV Q+FG  KPD
Sbjct  300   ENVGMSLHDVMEECRLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPD  359

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              DGL+ LKI+TMILNEVLRLYPP     R + +ETKLG++ +PP + L++ +LL+  D +
Sbjct  360   PDGLSHLKIVTMILNEVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKE  419

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG DA EFKPERFAEGV+KATKN+++F PFGWGPR CIG NFA++EAK+A+A ILQ+F+
Sbjct  420   LWGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFT  479

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             F LSPSYAH+P  V+TL+P++G  ++L K
Sbjct  480   FELSPSYAHAPSNVITLQPRYGVQVILRK  508



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   527 bits (1357),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 267/520 (51%), Positives = 350/520 (67%), Gaps = 14/520 (3%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             M+ + S V++L    S   +VI + R++ W W KP+K EK LRQQGL GNSY +  GD K
Sbjct  1     MEVLYSLVAVL----SASFLVILSWRILNWAWFKPKKREKCLRQQGLRGNSYNLVLGDMK  56

Query  1547  EMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEV  1368
             E   +T +AKSKPIN ++DI+ RV+PF    +  YG+N + W+GP P V++ +PE ++EV
Sbjct  57    ETVRMTQEAKSKPINFTNDIVSRVMPFIDKTIKTYGENSYAWAGPMPAVLLMDPEHIKEV  116

Query  1367  FMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEE  1188
                +  + +P  +PL K L +GL  YE  +W++HRK+I+PAF+ +K+K M P+   SC E
Sbjct  117   MNKSFNYLKPPGNPLSKLLATGLVSYETDKWSKHRKLINPAFHLEKVKLMLPAFRLSCFE  176

Query  1187  MIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQ  1008
             M+  KWE L SEK  C+ DV P L+A TSDVISRTAFG +Y EG K+F LQ EQAEL   
Sbjct  177   MV-SKWEQLISEKGSCELDVWPELQALTSDVISRTAFGSNYEEGQKIFELQKEQAELILL  235

Query  1007  VIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv  828
                S Y P W  + +KR++RM  I  E+R L+  +I  R + MK     +D+    LL  
Sbjct  236   AARSPYVPGWRFVPTKRNKRMKGIAKEVRSLVMDMINNRVKAMKAGEAKNDDLLAILLES  295

Query  827   lLKS---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
               K          G + DEVIEEC+ FYFAGQE+TS  LVW +ILLS HQ WQDRAR EV
Sbjct  296   NFKEIQEHEDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDWQDRARDEV  355

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
             QQVFG  KP+F+ LN LK++TMILNEVLRLYPP     R   E TKLGE+ LP  + L+L
Sbjct  356   QQVFGSKKPEFEDLNHLKVITMILNEVLRLYPPVVMLGRMTPETTKLGELTLPAGVQLLL  415

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
              ++L+  D  +WG DA EFKPERF+EG+ KATK +L + PFGWGPR CIG NFAM+E+K+
Sbjct  416   PAILLHHDSKIWGDDAKEFKPERFSEGILKATKGQLTYFPFGWGPRICIGQNFAMVESKL  475

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             A+A ILQRFSF LSP YAH+P  ++TL+PQ GA L+L K+
Sbjct  476   ALAMILQRFSFELSPLYAHAPHTIITLQPQHGAQLILRKL  515



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   527 bits (1357),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 267/520 (51%), Positives = 350/520 (67%), Gaps = 14/520 (3%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             M+ + S V++L    S   +VI + R++ W W KP+KLEK LRQQGL GNSY + +GD K
Sbjct  1     MEILYSLVAVL----SASFLVILSWRILNWAWFKPKKLEKCLRQQGLRGNSYNLVFGDMK  56

Query  1547  EMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEV  1368
             E   +T +AKSKP+N ++DI+ RV+PF    +  YG+N + W+GP P V++  PE ++EV
Sbjct  57    ETVRMTQEAKSKPMNFTNDIVSRVMPFIDKTIKTYGENSYTWAGPMPAVLLMYPEHIKEV  116

Query  1367  FMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEE  1188
                +  + +P  +PL K L +GLA YE  +W++HRK+ISPAF+ +K+K M P+   SC E
Sbjct  117   MNKSFNYLKPPGNPLTKLLATGLANYETDKWSKHRKLISPAFHLEKVKFMLPAFRWSCFE  176

Query  1187  MIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQ  1008
             M+  KWE L SEK  C+ DV P L+  TSDVISRTAFG +Y EG K+F LQ EQAEL   
Sbjct  177   MV-SKWEQLVSEKESCELDVWPELQTLTSDVISRTAFGSNYEEGQKIFELQKEQAELILL  235

Query  1007  VIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv  828
                S Y P W  + +KR++RM  I  E+R L+  +I  R + MK     +D+    LL  
Sbjct  236   AARSPYVPGWRFVPTKRNKRMKGIAKEVRSLVMDMINNRVKAMKAGEAKNDDLLDILLES  295

Query  827   lLKS---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
               K          G + DEVIEEC+ FYFAGQE+TS  LVW +ILLS HQ WQDRAR EV
Sbjct  296   NFKEIQQHGDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDWQDRARDEV  355

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
             QQVFG  KP+F+ LN LK++TMILNEVLRLYPP     R   E TKLGE+ LP  + L+L
Sbjct  356   QQVFGSKKPEFEDLNHLKVITMILNEVLRLYPPGVMLGRMTTETTKLGELTLPAGVQLLL  415

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
              ++L+  D  +WG DA EFKPERF+EG+ KATK +L + PFGWGPR CIG NFA +E+K+
Sbjct  416   PAILLHHDSKIWGDDAKEFKPERFSEGILKATKGQLTYFPFGWGPRICIGQNFATVESKL  475

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             A+A ILQRFSF LSP YAH+P  ++TL+PQ GA L+L K+
Sbjct  476   ALAMILQRFSFELSPLYAHAPHTIITLQPQHGAQLILRKL  515



>ref|XP_004294187.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   527 bits (1357),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 269/519 (52%), Positives = 357/519 (69%), Gaps = 17/519 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             SWV++  +F+S+   + W+  V+ WVWLKP+KLE+ LR+QG  GNSYR+ YGDTKE   +
Sbjct  7     SWVALSLVFVSIVVRLAWS--VLDWVWLKPKKLERCLRKQGFKGNSYRILYGDTKENVIM  64

Query  1532  TAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
               KAKSKP+NLS   DI PRV P  H  V  YGKN  VW GP P+V I  PE +++VF  
Sbjct  65    LKKAKSKPMNLSTSHDIAPRVTPLLHQTVKTYGKNSLVWMGPIPQVNIMNPEDLKDVFTE  124

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
              + F++P  +PLVKFL +GL  +E ++WA+HR+II+P F+ +K+K M P+   SC+EMI 
Sbjct  125   LSDFQKPHSNPLVKFLATGLVIHEGEKWAKHRRIINPTFHFEKLKRMLPAFYQSCDEMI-  183

Query  1178  KKWELLTS-EKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVI  1002
             K+WE + S E +  + DV P L+  T+DVISRTAFG SY EG K+F L  EQA    + I
Sbjct  184   KEWETVVSKESSSHEIDVWPSLQNVTADVISRTAFGSSYQEGRKIFELLKEQAVYAMKSI  243

Query  1001  HSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlL  822
              SVY P W  + +K ++RM +ID EIR ++ G+I KRE+ ++      D+    L+   L
Sbjct  244   QSVYIPGWRFVPTKMNKRMKQIDKEIRNVLMGIISKREQAIEVGEAIKDDLLGALMESNL  303

Query  821   KS-----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
             K            G S ++VIEEC+ FYFAGQE+TS  LVW M+LL  +Q WQ  AR+EV
Sbjct  304   KEIRDHGKNNKDVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQNWQHLAREEV  363

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
              QVFG NKP+FDGL  LK++TMIL EVLRLYP      RT +++T+LG+  LP  + + L
Sbjct  364   LQVFGMNKPEFDGLTHLKVVTMILLEVLRLYPAVVVLSRTTHKKTQLGKFSLPAGVEVEL  423

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
              +LL+  D ++WG DA EF+PERF+EGV+KATK  L+F PFG GPR CIG NFAMMEAK+
Sbjct  424   PTLLIHHDKELWGDDAKEFRPERFSEGVSKATKGHLSFFPFGAGPRICIGQNFAMMEAKL  483

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             A+A ILQ F+F LSPSY H+P  +VTL+PQFGAP++LHK
Sbjct  484   ALALILQHFTFELSPSYTHAPSNLVTLQPQFGAPIILHK  522



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   526 bits (1356),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 259/514 (50%), Positives = 353/514 (69%), Gaps = 11/514 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
              + + LFI +   +IWA +++ W+WLKP+KLEK+LR+QGL GNSYR+  GD +++  +  
Sbjct  4     TTAIVLFILMTLSLIWAWKILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDIRDLLKMRK  63

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +  SKP+NLSDDI PRV  ++H +V KYGKN F+W GP PRV IS+PEL++ V      F
Sbjct  64    ETTSKPMNLSDDIAPRVFSYFHHSVAKYGKNSFMWFGPTPRVNISDPELIKYVLNKIYDF  123

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P   PLV+ L +GL   E ++W++HRK+I+PAF  +K+K M P    SC+++I  KWE
Sbjct  124   QKPNASPLVRLLANGLVNLEGEKWSKHRKLINPAFNIEKLKIMLPIFFKSCDDLI-TKWE  182

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              + S    C+ DV P+L+   SDVISRTAFG SY EG ++F LQ EQAELT++V+  V+ 
Sbjct  183   RMLSSDGSCELDVWPFLQNLASDVISRTAFGSSYEEGKRIFQLQIEQAELTKKVMIQVFI  242

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +   RRM EID EI+  +  +I KRE  +K      D+    LL +  K    
Sbjct  243   PGWRFLPTSTHRRMKEIDREIKASLTDMINKREIALKAGEATKDDLLGILLELNHKEMEE  302

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S D+VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG+
Sbjct  303   HDNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWAMMLLSRYPDWQARAREEVLQVFGN  362

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
              KPDFDGLN+LKI+TMIL EVLRLYPP+  T R+ +++ KLG + LP  + + L  +LV 
Sbjct  363   KKPDFDGLNQLKIVTMILYEVLRLYPPAIATSRSTHKDVKLGNLTLPAGVQITLPIVLVH  422

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA  F PERF+ G++KAT  R +F PFG GPR CIG NF+M+EAK+A+A IL
Sbjct  423   HDSELWGEDAKVFNPERFSGGISKATNGRFSFFPFGGGPRICIGQNFSMLEAKMAMAMIL  482

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ++FSF LSPSYAH+P  V+TL+P++G  L+L K+
Sbjct  483   KKFSFELSPSYAHAPTQVITLQPKYGVHLILRKV  516



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   526 bits (1355),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 258/516 (50%), Positives = 358/516 (69%), Gaps = 15/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V++ F FI++   +I+A R++ WVWL+P+KLE+ LR+QGL GNSYR+ +GD +EM+ +
Sbjct  4     SSVAVSFAFITL---LIFAWRLLNWVWLRPKKLERCLRKQGLTGNSYRLLHGDFREMSRM  60

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A S PI+ SDDI+ RVLPF++ ++ KYGKN F W GP P V I EPEL+++V + + 
Sbjct  61    NNEANSGPISFSDDIVKRVLPFFNHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVLLKHN  120

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
             +F++P PHPL K L +G+   E +QW + RKII+PAF+ +K+K M  +   SC +M+  K
Sbjct  121   VFQKPPPHPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMV-NK  179

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE   S  + C+ D+ PYL+  T DVISRTAFG SY EG ++F LQ EQA L  QV  SV
Sbjct  180   WEKKLSMDDSCELDIWPYLQILTGDVISRTAFGSSYEEGRRIFQLQKEQAHLVAQVTQSV  239

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W    +K +RRM +I NE+  L+KG+I KRE+ MK     + +    L+    +  
Sbjct  240   YVPGWRFFPTKINRRMRQIRNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYREM  299

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  +VIEEC+ FYFAGQE+TS  L+W M+LLS H  WQ RAR+EV QVF
Sbjct  300   QENDERKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVF  359

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD DGLN LKI+TMI +EVLRLYPP+   IRT++ ++++G + L   +++ L  LL
Sbjct  360   GNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRTVFADSQVGGLYLSDGVLIALPILL  419

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  + ++WG DA EF P RF+EGV+KA K +++F PFG+GPR C+G NFAMMEAK+A+A 
Sbjct  420   IHHNHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAM  479

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  ++ ++PQ GA L+LH +
Sbjct  480   ILQRFSFDLSPSYAHAPSSLL-MQPQHGAHLILHGL  514



>ref|XP_004295683.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   526 bits (1356),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 267/521 (51%), Positives = 358/521 (69%), Gaps = 17/521 (3%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             + + V++  +F+S+  +V WA  ++ WVW KP+KLE+ LRQQG  GN+YR+FYGD KE A
Sbjct  5     VATSVALSLVFVSI--IVRWAWSLLDWVWFKPKKLERCLRQQGFQGNAYRLFYGDMKENA  62

Query  1538  TLTAKAKSKPINLSD--DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVF  1365
              +  +AKSKP+NLS   DI PRV+P     V  YGKN FVW GP PRV I  PE +++VF
Sbjct  63    IMVKEAKSKPMNLSTSHDISPRVIPLLDQTVKTYGKNSFVWVGPLPRVNIMNPEDLKDVF  122

Query  1364  MNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEM  1185
                + F +P  +PL+K L +GLA YE ++WA+HR+II+P F+ +K+K M P+   SC +M
Sbjct  123   AKPSDFPKPVSNPLIKLLSTGLANYEGEKWAKHRRIINPTFHSEKVKRMLPAFYQSCNDM  182

Query  1184  IMKKWELLTS-EKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQ  1008
             I K+WE + S E + C+ DV P L+  T+DVISRTAFG SY EG K+F L  EQA    +
Sbjct  183   I-KEWETVVSKEGSSCEIDVWPSLQNLTADVISRTAFGSSYQEGQKIFELLKEQAVYAMK  241

Query  1007  VIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv  828
              +  VY P W  + +K ++RM +I  EIRGL++G+I KRE+ +K      D+    LL  
Sbjct  242   TVQRVYIPGWRFVPTKMNKRMKQIHEEIRGLVEGIINKREQAIKAGEATKDDLLGALLES  301

Query  827   lLKS-----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQ  681
              +K            G S ++VIEEC+ FYFAGQE+TS  LVW M+LL  +Q WQD+AR+
Sbjct  302   NMKDIQDHGKNNKNVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQNWQDQARE  361

Query  680   EVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiil  501
             EV QVFG NKPDFDGL  LK +TM+L EVLRLYP      RT  ++T+ G+  LP  + +
Sbjct  362   EVLQVFGMNKPDFDGLTHLKAVTMVLLEVLRLYPALVVVSRTTRKKTQFGKFSLPAGVQV  421

Query  500   ilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEA  321
              L +LL+  D ++WG DA EFKPERF+EGV+KATK +L+F PFG GPR CIG NFAM EA
Sbjct  422   GLPALLIHHDKELWGDDAKEFKPERFSEGVSKATKGQLSFFPFGAGPRICIGQNFAMTEA  481

Query  320   KIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             K+A+A ILQ F+F LSPSYAH+P  ++TL+PQ+GAP++LHK
Sbjct  482   KLALALILQHFTFELSPSYAHAPSALITLQPQYGAPVMLHK  522



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   526 bits (1355),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 259/502 (52%), Positives = 346/502 (69%), Gaps = 12/502 (2%)
 Frame = -2

Query  1673  AVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSD  1494
              V IW  RV+ WVW +P+KLEK LR+QGL GNSY++ YGD KE++ +  +A SKP+NLSD
Sbjct  20    VVCIW--RVLNWVWFRPKKLEKLLRKQGLKGNSYKILYGDMKELSGMIKEANSKPMNLSD  77

Query  1493  DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             DI PR++PF+   + KYGK  FVW GP P V+I +PEL++E+F    L+++P  +P+ K 
Sbjct  78    DIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVLIMDPELIKEIFSKYYLYQKPHGNPVTKL  137

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             LV GL   E+ +WA+HRKII+PAF+ +K+K M P+   SC EM+ K WE + S K   + 
Sbjct  138   LVQGLVSLEEDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLCK-WEDIVSIKGSHEI  196

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV P+LE  +SDVISRTAFG ++ EG ++F LQ EQA+   + I SVY P W  L +KR+
Sbjct  197   DVWPHLEQLSSDVISRTAFGSNFEEGKRIFELQKEQAQYFVEAIRSVYIPGWRFLPTKRN  256

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddee---------nldllgvlLKSGFSTD  801
             RRM E++ ++R  ++G+I KR + MK     +++                    S  S +
Sbjct  257   RRMKEVEKDVRASIRGIIDKRVKAMKAGEASNEDLLGILLESNFTEAEQHRHKDSAMSIE  316

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             EVI+EC+ FY AGQE+TS  LVW +ILLS HQ WQ RAR+EV QVFG+ KPDFDGLNRLK
Sbjct  317   EVIQECKLFYVAGQETTSVLLVWTLILLSRHQDWQSRAREEVFQVFGNQKPDFDGLNRLK  376

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMIL E LRLY P    IR   E+  LG + LP  ++L L  +L+  D ++WG DA +
Sbjct  377   VVTMILYESLRLYSPVVSLIRRPNEDAILGNVSLPEGVLLSLPVILLHHDEEIWGKDAKK  436

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERF +GV+ ATK ++ F PF WGPR CIG NFAM+EAK A+A ILQRFSF LSPSYA
Sbjct  437   FNPERFRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKTALAMILQRFSFELSPSYA  496

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P  ++T++PQ GAPL+LHKI
Sbjct  497   HAPQSILTMQPQHGAPLILHKI  518



>ref|XP_009343590.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   525 bits (1353),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 264/501 (53%), Positives = 344/501 (69%), Gaps = 12/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V  WA RVV W+WL+P+KLE++LRQQGL GNSYR   GD KE   +  +A SKP+NLS D
Sbjct  17    VTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERTMMLKQAYSKPMNLSHD  76

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PRVLPF + +V  YGKN F+W+GP PRV I+ PE ++++      F + K +P VK L
Sbjct  77    IAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTKIEDFPKLKSNPYVKLL  136

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
             V+G A Y+ ++W RHR+II+PAF+ DK+K M P+   S  EMI K+WE L  +   C+ D
Sbjct  137   VTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMI-KEWESLVLKAGSCELD  195

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             VQP LE  T+D+ISR+AFG SY EG K+F L  EQ +L  +VI +VY P W  + +K ++
Sbjct  196   VQPCLENLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSKVIQNVYIPGWRFVPTKMNK  255

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTD  801
             +M  ID EI GL+ G+I KRE G++      D+    L+   LK           G STD
Sbjct  256   KMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKEIKEHGNNKRVGMSTD  315

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             +VIEEC+ FYFAGQE+TS  LVW M+LL  +Q WQDRAR+EV QVFG NKPDFDG+  LK
Sbjct  316   DVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLK  375

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMIL+EVLRLY P+P  +RT  ++T+     LP  + + L  LL+  D ++WG DA E
Sbjct  376   VVTMILHEVLRLY-PAPLLVRTTDKKTEFRNFSLPAGVEVALPMLLIHHDRELWGDDAQE  434

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             FKPERF+EGVAK TKN+  + PF  GPR CIG NFAM+EAK+AI+ ILQ F+F LSPSYA
Sbjct  435   FKPERFSEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYA  494

Query  260   HSPCFVVTLKPQFGAPLVLHK  198
             H+P   + L PQFGA ++LHK
Sbjct  495   HAPSAKLMLHPQFGAHIILHK  515



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   525 bits (1352),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 260/511 (51%), Positives = 357/511 (70%), Gaps = 10/511 (2%)
 Frame = -2

Query  1697  LFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK  1518
             L LF+     VI+A R++ W W +PRKL+K LRQQGL GNSY++ +GD KE++     A+
Sbjct  8     LVLFLLAITFVIYAWRLLDWAWFRPRKLDKCLRQQGLKGNSYKLIFGDIKELSKSIEDAE  67

Query  1517  SKPINLSDDIL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR  1341
             SKP+++SDD L PR+LP++   + KYGKNCF+W G  P VI+ +PE++++VF  + L+++
Sbjct  68    SKPLDVSDDDLTPRILPYFVQTIKKYGKNCFIWIGTKPLVIVGDPEVIRDVFNKHALYQK  127

Query  1340  PKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
             PK  PL K L  G+  YE+ +WA+HRKI++PAF+ +KIK M  +V  SC EM+ +  E +
Sbjct  128   PKSTPLTKLLAQGIVSYEEVKWAKHRKILNPAFHMEKIKDMLQAVHLSCSEMVSQWEEAV  187

Query  1160  TSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPE  981
             + +++  + D+ PYL+  TSDVIS TAFG +Y EG K+F LQ EQAE    V  ++Y P 
Sbjct  188   SMKESSTELDIWPYLQRLTSDVISHTAFGSNYEEGRKIFELQKEQAEHVIAVSRTLYIPG  247

Query  980   WWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-----  816
             W  L +KR+RRM EI+ +++  ++G+I KR +G+K    + D+    LL    K      
Sbjct  248   WRFLPTKRNRRMKEIEGKVQTTIRGIIDKRVKGIKAGEANTDDLLGILLESNFKEIEQHG  307

Query  815   ----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKP  648
                 G +  EVIEEC+ FYFAGQE+TS  LVW MILLS H  WQ RAR+EV QVFG   P
Sbjct  308   NKDFGMTIKEVIEECKLFYFAGQETTSVLLVWTMILLSRHPDWQVRAREEVLQVFGDGMP  367

Query  647   DFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDP  468
              FDGLNRLK++TMIL+E LRLYPP     R +  +TKLGE+ LP  ++L L ++LV  D 
Sbjct  368   GFDGLNRLKVVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPTILVHHDK  427

Query  467   DVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRF  288
             ++WG DA EFKPERF EG++KATK ++ F PFG GPR CIG NFAM+EAK+A+A ILQRF
Sbjct  428   EIWGEDATEFKPERFNEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRF  487

Query  287   SFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +F LSP Y H+P  V+T++P++GAPLVLHK+
Sbjct  488   AFELSPLYTHAPQSVITMQPKYGAPLVLHKL  518



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score =   525 bits (1351),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 262/498 (53%), Positives = 347/498 (70%), Gaps = 11/498 (2%)
 Frame = -2

Query  1658  ACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPR  1479
             A RV+ WVWL+P+ LEK LRQQGL GNSYR++ GD +E + +  +A SKP+NLS D  PR
Sbjct  23    AWRVLNWVWLRPKDLEKCLRQQGLAGNSYRLWSGDLRESSIMLKEAMSKPMNLSHDTAPR  82

Query  1478  VLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGL  1299
             VLPF H +V+ YGKN F+W GP PRV I+ PE ++++F  +  F +P  +PLVK L +GL
Sbjct  83    VLPFVHQSVSTYGKNSFMWIGPTPRVNITNPEDLKDIFTKHEDFPKPALNPLVKLLATGL  142

Query  1298  ACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPY  1119
             A YE  +WA+HR+I++PAF+ +K+K M PS   SC EMI ++WE L S+ + C+ DV PY
Sbjct  143   ANYEGDKWAKHRRIVNPAFHSEKLKRMLPSFYQSCSEMI-EEWESLVSKDSSCELDVWPY  201

Query  1118  LEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHE  939
             L+  T+DVISRT+FG SY EG ++F L   Q EL  + I SVY P W  L +K ++ M  
Sbjct  202   LQNVTADVISRTSFGSSYKEGREIFQLLKVQTELAIKTIQSVYIPGWRFLPTKMNKSMKG  261

Query  938   IDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVIE  789
             +D +IR L+ G+I KRE  +K      D+    LL    K           G ST +V+E
Sbjct  262   VDKKIRELLMGIINKREEAIKAGKATKDDLLGLLLDSNFKEIKEHGNKRKVGMSTQDVLE  321

Query  788   ECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTM  609
             EC+ FYFAGQE+TS  LVW M+LLS +Q WQDRAR+EV QVFG NKPDFDGLN LK++TM
Sbjct  322   ECKLFYFAGQETTSVLLVWTMVLLSENQNWQDRAREEVLQVFGGNKPDFDGLNHLKVVTM  381

Query  608   ILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPE  429
             IL E LRLYPP     R ++++T+  E  LP  + + L ++LV  D ++W  DA +FKPE
Sbjct  382   ILLEALRLYPPVVMLTRMIHKKTQFVEFSLPAGVEISLPTVLVHHDKELWCDDATQFKPE  441

Query  428   RFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             RF++GV+KATKN+L + PFG G R CIG NFAMMEAK+A+A ILQ F+F LSPSYAH+P 
Sbjct  442   RFSDGVSKATKNKLIYFPFGGGARICIGQNFAMMEAKLALALILQHFTFELSPSYAHAPS  501

Query  248   FVVTLKPQFGAPLVLHKI  195
               +TL+PQFGA ++LHK+
Sbjct  502   RKLTLQPQFGAHIILHKL  519



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   525 bits (1351),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 258/513 (50%), Positives = 348/513 (68%), Gaps = 11/513 (2%)
 Frame = -2

Query  1703  SILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             + + LF  +   +IWA R++ W+WLKP+KLEK LR+QGL GNSYR+  GD K++  +  +
Sbjct  5     TAIILFTLMTLSLIWAWRILNWIWLKPKKLEKELREQGLKGNSYRLLVGDIKDLLKIRKE  64

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             A SKP+NLSDDI+PRV  F    V K+GKN F+W GP PRV I++PE +++V      F+
Sbjct  65    ATSKPMNLSDDIVPRVYSFVQQTVAKHGKNSFIWFGPTPRVNITDPEQIKDVINKIYDFQ  124

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +P  +PLV+ L  GL C E +QW++HRKII+PAF+ +K+K + P    SC+++I  KWE 
Sbjct  125   KPNVNPLVRLLGCGLVCLEGEQWSKHRKIINPAFHLEKLKIILPIFHKSCDDLI-SKWEK  183

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
             + S    C+ DV P+L+   SD+ISR AFG SY EG ++F LQ EQAELT ++I  VY P
Sbjct  184   MLSSDGSCEMDVWPFLQNLASDLISRAAFGSSYEEGKRIFQLQTEQAELTTKIIEKVYIP  243

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  L +   RRM EI+ ++R  +  +I  RER +       D+    LL    K     
Sbjct  244   GWRFLPTTTPRRMKEIERDVRASLTDMINTRERALMAGEATKDDLLGILLESNHKEMEEH  303

Query  815   ------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                   G S D+VIEEC+ FYFAG E+TS  LVW ++LLS +  WQ RAR+EV QVFG+N
Sbjct  304   DNNKNVGMSLDDVIEECKLFYFAGAETTSVLLVWTIVLLSRYPDWQARAREEVLQVFGNN  363

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             KPDFDGL+ LKI+TMIL EVLRLYPP     R+++++ KLG + LP  + + L  +LV  
Sbjct  364   KPDFDGLSHLKIVTMILYEVLRLYPPVIELARSVHKDVKLGNLTLPAGVQITLPIVLVHH  423

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             D ++WG DA  F PERF+EGV KAT  R +F+PFG GPR CIG NF+M+EAK+AIA ILQ
Sbjct  424   DSELWGDDAKVFNPERFSEGVLKATNGRNSFVPFGGGPRICIGQNFSMLEAKMAIAMILQ  483

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             RFSF LSPSYAH+P  ++TL+PQ+GA ++L K+
Sbjct  484   RFSFELSPSYAHAPTALITLQPQYGAHIILRKV  516



>ref|XP_010060779.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Eucalyptus 
grandis]
Length=510

 Score =   524 bits (1349),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 262/509 (51%), Positives = 352/509 (69%), Gaps = 7/509 (1%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             IQS   +  L +    +  WA RVV  VWL+P++LE+ LRQQGL+G  Y   +GD KE +
Sbjct  5     IQSIAVVTILAV----LTTWAWRVVNSVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
              L  +A SKPI + DDI PR+LPF H +   YGK+ F+W GP PRV I+ PE ++E+F  
Sbjct  61    RLLKEAYSKPITIFDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSK  120

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                + RP  +PLVK L  GL  +E ++WARHRKII+PAF+ +K+K M P+  SSC EM+ 
Sbjct  121   INDYPRPGSNPLVKLLADGLTSHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMV-  179

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              +WE L S +  C+ D    L+  T +VISRTAFG S+ EG ++F LQ EQA+LT   + 
Sbjct  180   GRWEKLVSVERSCEIDAWVDLQNLTGEVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQ  239

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  + +K +RRM  ID E+R L+  ++ +RE+ ++E     D+    LL   +K
Sbjct  240   SVYIPGWRFVPTKMNRRMKSIDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMK  299

Query  818   S--GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
                G S  +VIEEC+ FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV Q+FG  KPD
Sbjct  300   ENVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPD  359

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              DGL+ LKI+TMILNEVLRLYPP     R +  ETKLG++ +PP + L + +LL+  D +
Sbjct  360   PDGLSHLKIVTMILNEVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDKE  419

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG DA EFKPERFAEGV+KATKN+++F PFGWGPR CIG NFA++EAK+A+A ILQ+F+
Sbjct  420   LWGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFT  479

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             F LSPSYAH+P  V+TL+P++G  ++L K
Sbjct  480   FDLSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_006348402.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=466

 Score =   522 bits (1345),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 246/431 (57%), Positives = 318/431 (74%), Gaps = 9/431 (2%)
 Frame = -2

Query  1463  HLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLACYED  1284
             H    + G NCF W GP PR+ + EPEL++E+ MNN +FK+PKP PLV+ LVSG++ YED
Sbjct  37    HDMGVENGNNCFTWIGPEPRIFVMEPELIKEIVMNNNIFKKPKPTPLVQLLVSGISSYED  96

Query  1283  QQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN-WCDFDVQPYLEAF  1107
             Q+WA+HRKI++ AFY +K+KCM P++  SCE+M M KWE+L   KN  C+ DV PY E  
Sbjct  97    QKWAKHRKILNTAFYAEKLKCMVPAMHKSCEDM-MNKWEILICNKNKSCELDVHPYFEDL  155

Query  1106  TSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEIDNE  927
             TSDVISRTAFG SY EG K+F LQ E AELTRQ   SVY P W  L ++R+RRM  IDNE
Sbjct  156   TSDVISRTAFGSSYQEGMKIFQLQKELAELTRQAFQSVYIPGWRFLPTRRNRRMKGIDNE  215

Query  926   IRGLMKGLIGKRERGMKEKvgdd-------deenldllgvlLKSGFSTDEVIEECQHFYF  768
             ++  ++ ++ KR+R M      +            ++     K G +TDEVIEEC+ FYF
Sbjct  216   LKHTLRKIVNKRDRSMNLGETQEDLLGILLKSNMKEIQQNGSKFGMTTDEVIEECKVFYF  275

Query  767   AGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLR  588
             AGQE++S+ LVW M+LLS+HQ WQ RAR+EVQQVF +N PDF+GLNRLKI+TMILNEVLR
Sbjct  276   AGQETSSNLLVWTMVLLSVHQNWQTRAREEVQQVFHNNNPDFEGLNRLKIVTMILNEVLR  335

Query  587   LYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVA  408
             LYPP+PY +R   +ETKLG+M +PP +IL++ ++ +  + ++WG D  EFKP+RF +G+A
Sbjct  336   LYPPAPYFLRKANQETKLGKMNIPPEVILMIPTIFIHHNEELWGDDVKEFKPDRFFQGIA  395

Query  407   KATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKP  228
             KATK++L FLPF WGPR CIGNNFAMME KIA+A ILQRF F LSPSY H+P +VVTL+P
Sbjct  396   KATKDKLCFLPFSWGPRICIGNNFAMMETKIALAMILQRFEFELSPSYTHAPTYVVTLQP  455

Query  227   QFGAPLVLHKI  195
             Q GA L+L K+
Sbjct  456   QCGAHLILKKL  466



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   524 bits (1349),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 257/511 (50%), Positives = 355/511 (69%), Gaps = 10/511 (2%)
 Frame = -2

Query  1697  LFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK  1518
             L  F+     VI+A +++ W W +PRKLEK LR+QGL GNSY++ +GD KE+A      K
Sbjct  8     LVSFLLTITSVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELAKSFEDVK  67

Query  1517  SKPINL-SDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR  1341
             SKP+N+  DDI PR++P++   + K+GKNCF+W GP P V++++ E++++VF    L+++
Sbjct  68    SKPLNVFDDDITPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVNDAEVIRDVFNKYVLYQK  127

Query  1340  PKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
             PKP PL K L  GLA YE+ +WA HRKI++PAF+ +KIK M P++  SC EM+ +  E +
Sbjct  128   PKPTPLTKLLAQGLASYEEDKWAMHRKILNPAFHMEKIKNMVPAIHLSCTEMVSQWEESI  187

Query  1160  TSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPE  981
             +++   C+ D+ PYL+  +SDVISRTAFG +Y EG  +F LQ EQA+   +   ++Y   
Sbjct  188   STKGTSCEIDIWPYLQKLSSDVISRTAFGSNYEEGRMIFELQKEQAQHFIEATRTLYILG  247

Query  980   WWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-----  816
                L +K++RRM EID  ++ +++G+I KR + +K    + D+    LL    K      
Sbjct  248   SRFLPTKKNRRMKEIDKNVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHG  307

Query  815   ----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKP  648
                 G ST E+IEEC+ FYFAGQE+TS  LVW MILLS H  WQ RAR+EV QVFG +K 
Sbjct  308   NKDFGMSTREIIEECKLFYFAGQETTSVLLVWTMILLSRHLDWQTRAREEVLQVFGDSKL  367

Query  647   DFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDP  468
             +FDGLNRLKI+TMILNE LRLYPP+    R     TKLGE+ LP  ++L+L  +L+  D 
Sbjct  368   EFDGLNRLKIVTMILNESLRLYPPADSLNRKTTTNTKLGELSLPAGVMLVLPIILLHHDK  427

Query  467   DVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRF  288
             ++WG DA EFKPERF+EGV+KATK ++ F PFG GPR CIG NF M+EAK+A+A ILQ F
Sbjct  428   EIWGEDATEFKPERFSEGVSKATKGQMTFFPFGGGPRICIGLNFTMIEAKMALAMILQHF  487

Query  287   SFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SF LSPSY H+P  V+T++PQ+GAPL+LHK+
Sbjct  488   SFELSPSYTHAPQSVITIQPQYGAPLILHKL  518



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   524 bits (1349),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 268/513 (52%), Positives = 356/513 (69%), Gaps = 11/513 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
              S+      V  V+  A RV+ WVWL+P+KLE+ LRQQGL GNSYR+  GDTKE + +  
Sbjct  7     ASVALRVFLVSTVITLAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVK  66

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +AKSKP+NLS DI PRVLPF H +VT YGKN F+W GP PRV IS P  +++VF N   F
Sbjct  67    EAKSKPMNLSHDITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDF  126

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P  +PLVK L +GL  YE ++WA+HRKII+PAF+ +K+K M P+   SC EMI ++WE
Sbjct  127   QKPVINPLVKLLATGLPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHLSCSEMI-EEWE  185

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              L S++  C+ DV PYLE+  +DVISR +FG SY EG K+F L  EQA+LT + + SVY 
Sbjct  186   RLVSKEGSCELDVWPYLESLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQSVYI  245

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L ++ ++RM  ID EI+G ++ +I  RE  ++      D+    LL   LK    
Sbjct  246   PGWRFLPTRSNKRMKAIDKEIKGSLRDIISTREEAIRMGEATKDDLLGILLESNLKEIRE  305

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S ++VIEEC+ FYFAGQE+TS  L+W ++LLS +Q WQ RAR EV QVFG 
Sbjct  306   NGNTKNVGMSIEDVIEECKLFYFAGQETTSVLLLWTLVLLSQNQNWQARARDEVLQVFGS  365

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             NKPDFDGLN LK++TMIL EVLRLYP      RT + +T LG++ LP  + + L  LL+ 
Sbjct  366   NKPDFDGLNHLKVVTMILLEVLRLYPSVVALPRTTHNKTHLGKLSLPAGVEVSLPILLLH  425

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA  F PERF+EGV+KA+KN+ A+ PFG GPR CIG NFAM+EAK+A + +L
Sbjct  426   HDKELWGEDAIGFNPERFSEGVSKASKNQFAYFPFGGGPRICIGQNFAMLEAKLAFSLLL  485

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             QRF+F LSPSYAH+P  +++L+PQ+GA ++LHK
Sbjct  486   QRFTFELSPSYAHAPSLIISLQPQYGAHIILHK  518



>ref|XP_009356829.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   523 bits (1348),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 263/501 (52%), Positives = 343/501 (68%), Gaps = 12/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V  WA RVV W+WL+P+KLE++LRQQGL GNSYR   GD  E   +  +A SKP+NLS D
Sbjct  17    VTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLTERTMMLKQAYSKPMNLSHD  76

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PRVLPF + +V  YGKN F+W+GP PRV I+ PE ++++      F + K +P VK L
Sbjct  77    IAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTKIEDFPKLKSNPYVKLL  136

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
             V+G A Y+ ++W RHR+II+PAF+ DK+K M P+   S  EMI K+WE L  +   C+ D
Sbjct  137   VTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMI-KEWESLVLKAGSCELD  195

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             VQP LE  T+D+ISR+AFG SY EG K+F L  EQ +L  +VI +VY P W  + +K ++
Sbjct  196   VQPCLENLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSKVIQNVYIPGWRFVPTKMNK  255

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTD  801
             +M  ID EI GL+ G+I KRE G++      D+    L+   LK           G STD
Sbjct  256   KMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKEIKEHGNNKRVGMSTD  315

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             +VIEEC+ FYFAGQE+TS  LVW M+LL  +Q WQDRAR+EV QVFG NKPDFDG+  LK
Sbjct  316   DVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLK  375

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMIL+EVLRLY P+P  +RT  ++T+     LP  + + L  LL+  D ++WG DA E
Sbjct  376   VVTMILHEVLRLY-PAPLLVRTTDKKTEFRNFSLPAGVEVALPMLLIHHDRELWGDDAQE  434

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             FKPERF+EGVAK TKN+  + PF  GPR CIG NFAM+EAK+AI+ ILQ F+F LSPSYA
Sbjct  435   FKPERFSEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYA  494

Query  260   HSPCFVVTLKPQFGAPLVLHK  198
             H+P   + L PQFGA ++LHK
Sbjct  495   HAPSAKLMLHPQFGAHIILHK  515



>ref|XP_009343589.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=515

 Score =   523 bits (1347),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 262/498 (53%), Positives = 347/498 (70%), Gaps = 12/498 (2%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             WA RVV W+WL+P+KLE++LRQQGL GN YR   GD KE++  T +A SKP++LS  I P
Sbjct  19    WAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFKSGDMKEISMTTEQAYSKPMSLSHYIAP  78

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSG  1302
             RV+PF+H  V  Y KN FVW G  PRVII+ PE ++ +      F +P+P+PLVK L +G
Sbjct  79    RVIPFHHRLVNTYRKNSFVWMGTIPRVIITNPEDLKYILTKMEEFPQPEPNPLVKLLATG  138

Query  1301  LACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQP  1122
             +A YE ++WA+H++II+P F+ +K+K M P+   SC EMI+ +WE L  ++  C+ DV+P
Sbjct  139   IALYEGEKWAKHQRIINPVFHLEKLKRMLPAFYESCSEMIV-EWESLVLKEGSCELDVRP  197

Query  1121  YLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMH  942
              LE  T+D+ISR+AFG SY EG K+F L  EQA+L  +VI +VY P W  + +K +++M 
Sbjct  198   CLENLTADMISRSAFGSSYKEGRKIFQLLREQAQLVTKVIQNVYIPGWRFVPTKMNKKMK  257

Query  941   EIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVI  792
              ID EIRGL+ G+I KRE G++      D+   +L+   LK           G S D+VI
Sbjct  258   GIDKEIRGLLMGIINKREEGIRAGEATKDDLLGNLMESNLKEIKEHGNDKTVGMSMDDVI  317

Query  791   EECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILT  612
             EEC+ FYFAGQE+TS  LVW M+LL  +Q WQDRAR+EV QVFG NKPDFDG+  LK++T
Sbjct  318   EECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLKVVT  377

Query  611   MILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKP  432
             MIL+EVLRLY PSP  +RT  + T+L    LP  + + L  LL+  D ++WG DA EFKP
Sbjct  378   MILHEVLRLY-PSPLLVRTTSKTTELRNFSLPAGVEVALPLLLIHHDRELWGDDAQEFKP  436

Query  431   ERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSP  252
             ERF+EGVAK TKN+  + PF  GPR CIG NFAM+EAK+AI+ ILQ F+F LSPSYAH+P
Sbjct  437   ERFSEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYAHAP  496

Query  251   CFVVTLKPQFGAPLVLHK  198
                + L PQFGA ++LHK
Sbjct  497   SAKINLHPQFGAHIILHK  514



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   523 bits (1347),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 260/499 (52%), Positives = 342/499 (69%), Gaps = 11/499 (2%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             WA +++ W WLKP+++EK LR+QG  GNSYR  +GD +E A L+ +AKSKPI+  DDI P
Sbjct  39    WAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSKQAKSKPISFEDDIAP  98

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSG  1302
             RV+P Y   V  YGK C+ W GP P + I +P+ ++EVF     F++PK +PL K L +G
Sbjct  99    RVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTG  158

Query  1301  LACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQP  1122
             LA +E ++WA+HRKII+PAF+ +K+K M P+   SC E+I  KWE L S +  C+ DV P
Sbjct  159   LASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEII-SKWENLMSTEGSCELDVWP  217

Query  1121  YLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMH  942
             Y+   TSDVISRTAFG +Y EG ++F LQ E A+L  Q + SVY P W  + +KR+RRM 
Sbjct  218   YIVNLTSDVISRTAFGSNYEEGIRIFQLQTELADLALQALQSVYIPGWRYVPTKRNRRMK  277

Query  941   EIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVI  792
             E+D EIR  +  +I KRE  MK      D+    L+   LK           G S D+VI
Sbjct  278   ELDKEIRVRLADIIRKREIAMKTGEAAKDDLLGLLMESNLKEIKEHGNNKLKGISRDDVI  337

Query  791   EECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILT  612
             +EC+ FYFAGQE+TS  L+W M+LLS HQ WQ  AR+EV QVFG  KPDFDGLNRLKI+ 
Sbjct  338   DECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAREEVLQVFGDKKPDFDGLNRLKIVQ  397

Query  611   MILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKP  432
             MI  EVLRLYPP P   R + +ETK+G++ LP   ++ L +LLV  D  +WG DA EFKP
Sbjct  398   MIFYEVLRLYPPLPVLSRYVEKETKIGDLILPAESVIALQTLLVHHDKKLWGDDAKEFKP  457

Query  431   ERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSP  252
             ERF+EG++KATKN++++ PF WGPR CIG NFA++EAK+A+A ILQ FSF LS SY H+P
Sbjct  458   ERFSEGISKATKNQVSYFPFAWGPRICIGQNFALVEAKMAMAMILQNFSFELSASYVHAP  517

Query  251   CFVVTLKPQFGAPLVLHKI  195
                + L+PQ GA L+L K+
Sbjct  518   HAFIFLQPQHGAHLILRKL  536



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score =   522 bits (1344),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 258/496 (52%), Positives = 344/496 (69%), Gaps = 3/496 (1%)
 Frame = -2

Query  1679  VPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINL  1500
             +  +  WA R V WVWL+P++LE+ LRQQGL+G SY    GD KE   +  +AKSKPI +
Sbjct  14    LAVLTTWAWRAVNWVWLRPKRLERLLRQQGLSGKSYTFLVGDLKENLRMLKEAKSKPIAV  73

Query  1499  SDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLV  1320
             SDDI PR+LPF H +   YGK+ F W GP PRV I+ PE ++EVF     + +P  +PLV
Sbjct  74    SDDIKPRLLPFLHQSFQTYGKDSFTWMGPTPRVNITNPEQIKEVFSKIYDYPKPASNPLV  133

Query  1319  KFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWC  1140
             K L  GLA +E ++WARHRKII+PAF+ +K+K M P+   SC EM+  +WE    E+  C
Sbjct  134   KLLADGLANHEGEKWARHRKIINPAFHMEKLKLMLPAFYLSCTEMV-DRWEKSVLEERSC  192

Query  1139  DFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSK  960
             + D    L+  T DVISRTAFG S+ EG ++F LQ EQA L  + + SVY P W  + +K
Sbjct  193   EVDAWVDLQNLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWRFVPTK  252

Query  959   RSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--GFSTDEVIEE  786
              +RRM  I+ E++ ++  +I +R + ++      D+    LL   +K   G S  +VIEE
Sbjct  253   MNRRMKNINKEVQAVLMDIIRRRVKAIRAGDAAGDDLLGLLLESNMKEDVGMSLHDVIEE  312

Query  785   CQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMI  606
             C+ FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV Q FG  KPDFDGL+ LKI+TMI
Sbjct  313   CKLFYFAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSRKPDFDGLSHLKIVTMI  372

Query  605   LNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPER  426
             LNEVLRLYPP+    R + +ETKLG++ LP  + L +S+LL+  D ++WG DA EFKPER
Sbjct  373   LNEVLRLYPPAIVMARKVPKETKLGKLTLPAGVQLSMSTLLIHHDKELWGEDAEEFKPER  432

Query  425   FAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCF  246
             FAEGV+ ATKN++ F PFGWGPRTC+G NFAM+EAK+A+A ILQ+F+F LSPSYAH+P  
Sbjct  433   FAEGVSNATKNQVCFFPFGWGPRTCVGQNFAMIEAKMALAMILQQFTFELSPSYAHAPLT  492

Query  245   VVTLKPQFGAPLVLHK  198
             + TL+PQ+G  ++LHK
Sbjct  493   IFTLQPQYGVQVILHK  508



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   522 bits (1345),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 257/511 (50%), Positives = 361/511 (71%), Gaps = 10/511 (2%)
 Frame = -2

Query  1697  LFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK  1518
             L LF+     VI+A R++ W W +PRKLEK LR+QGL GNSY++ YGD KE++     AK
Sbjct  9     LALFLLAITFVIYAWRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKELSKSIEDAK  68

Query  1517  SKPINLSDDIL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR  1341
             SKP+N SDD L PR+LP++   + KYGKNCF+W GP P VI+ +PE++++VF  + L+++
Sbjct  69    SKPLNASDDDLTPRILPYFVQTIKKYGKNCFIWVGPKPLVIVGDPEVIRDVFNKHALYQK  128

Query  1340  PKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
             PK  P  K L  G+  YED +WA+HR+I++PAF+ +KIK M  +V  SC EM+ +  E +
Sbjct  129   PKYPPQTKLLAKGILSYEDDKWAKHRRILNPAFHMEKIKDMLHTVHLSCSEMVSQWEEAV  188

Query  1160  TSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPE  981
             + +++  + D+ PYL+  TSDVISRTAFG +Y EG K+F LQ EQA+   +V  ++Y   
Sbjct  189   SMKESSTELDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKEQAKHVIEVSRTLYILG  248

Query  980   WWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-----  816
             W  L +KR+RRM EI+ E++  ++G+I KR +GMK    + D+    LL    K      
Sbjct  249   WRFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESNFKEIEQHG  308

Query  815   ----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKP  648
                 G +  +VIEEC+ F+FAGQE+TS +LVW MILLS H  WQ RAR+EV Q+FG   P
Sbjct  309   NKNFGMTIKDVIEECKLFFFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQLFGDGMP  368

Query  647   DFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDP  468
             +FDGLNRLK++TMIL+E LRLYPP+    R +  + KLG++ LP  ++L L ++LV  D 
Sbjct  369   EFDGLNRLKVVTMILHESLRLYPPTAALGRRITTKMKLGKLNLPEGVMLSLPTILVHHDK  428

Query  467   DVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRF  288
             ++WG DA +FKPE+F+EG++KATK ++ F PFG GPR CIG NFAM+EAK+A+A ILQRF
Sbjct  429   EIWGEDATKFKPEKFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRF  488

Query  287   SFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +F LSPSY H+P  V+T++P++GAPL+LHK+
Sbjct  489   AFELSPSYTHAPQSVITMQPKYGAPLMLHKL  519



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   522 bits (1344),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 256/515 (50%), Positives = 355/515 (69%), Gaps = 11/515 (2%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S++ +  +  ++  +  WA RV+ WVWL+P++LE  LR+QGL GNSYR++ GD KE + +
Sbjct  4     SFLKLSSVVFAILLITTWAWRVLNWVWLRPKRLENCLRKQGLKGNSYRLWSGDLKESSLM  63

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A SKPINLS+DI  R+ PF    V  YGK+ F+W GP PRV I+ PE ++++F    
Sbjct  64    IKEASSKPINLSEDITARIFPFGLHTVNNYGKDSFMWIGPTPRVSITNPEYIKDIFNKLG  123

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F +P+  PLVK L +G+A YE ++W RHRKII+PAF+ +K+K + P+   SC EM + K
Sbjct  124   DFPKPQSIPLVKLLATGVATYEGEKWTRHRKIINPAFHMEKLKRLVPAFYLSCSEM-LNK  182

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE L + +  C+ DV  YL+  T DVISRTAFG SY EG ++F LQ EQ EL  + + +V
Sbjct  183   WERLLNSEGSCELDVWSYLQNMTGDVISRTAFGSSYEEGRRIFQLQKEQGELAIKSLQTV  242

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W  + +K +RRM +I NEI  L+K +I KRE  M+     +D+    L+   LK  
Sbjct  243   YIPGWRFVPTKLNRRMKKIYNEIEALVKNIIHKREGAMRAGEAPNDDLLGILMESNLKEI  302

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  +VIEEC+ FY AGQE+TS  LVW M+LLS   +WQDRAR+EV Q+F
Sbjct  303   QEHGNNKNMGISIRDVIEECKLFYIAGQETTSTLLVWTMVLLSRFPSWQDRAREEVLQIF  362

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+NKP FDGL +LK++TMI  EVLRLYPP     R + ++T+LG + LP  + + + ++L
Sbjct  363   GNNKPGFDGLTQLKVVTMIFYEVLRLYPPLILFTRKVEKKTQLGNLSLPAGVEVSIPTIL  422

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             V RD ++WG DA +FKPERFAEG++K TK +++F PFGWGPR C+G NFAM+EAK+A+A 
Sbjct  423   VHRDTELWGEDAKDFKPERFAEGMSKVTKGQVSFFPFGWGPRICVGQNFAMVEAKMALAL  482

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             ILQRF+F LSPSYAH+P  ++TL+PQ+GA ++LHK
Sbjct  483   ILQRFTFELSPSYAHAPLTILTLQPQYGAHIILHK  517



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   522 bits (1344),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/513 (51%), Positives = 347/513 (68%), Gaps = 12/513 (2%)
 Frame = -2

Query  1703  SILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             SI F  + V  +V WA  V+ W+WL+P+KLEK+LRQQGL GNSYR+ +GD KE + +  K
Sbjct  7     SIAFTIVIV-TLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESSIMLKK  65

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             AK++P++L DD   RV PF       YGKN F+W GP PRV I+ P+ ++E+F     F 
Sbjct  66    AKARPLSLDDDAAVRVNPFLPKLFKDYGKNSFMWFGPTPRVNITNPDQIKEIFTKINDFP  125

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +   +PL + L  GL  YE +QWA+HRKII+PAF  +K+K M P+   S  ++I  +WE 
Sbjct  126   KINSNPLARILGVGLVNYEGEQWAKHRKIINPAFRQEKLKLMLPAFCQSSSDII-TEWEK  184

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
             L S +  C+ DV PYL   T DVISRTAFG +Y EG ++F LQ+E AELT QVI SVY P
Sbjct  185   LMSTEGSCELDVWPYLANLTGDVISRTAFGSNYEEGRRIFQLQSELAELTIQVIRSVYIP  244

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  L +KR++RM E+D EI   + G+I  RE+ MK     +D+    L+    +     
Sbjct  245   GWRFLPTKRNKRMKELDKEISTALMGIIKNREKAMKAGEAANDDLLGILMDTNFREIEEH  304

Query  815   ------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                   G S ++V+EEC+ FYFAGQE+TS  L W M+LLS HQ WQ+RARQEV QVFG+N
Sbjct  305   GNNKNVGMSFNDVMEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNN  364

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             KPD+DGLN LKI+ MI NEVLRLYPP+    R + +ETKLG + L   + + L  ++V  
Sbjct  365   KPDYDGLNHLKIVQMIFNEVLRLYPPAVMLARAVNKETKLGNLILLAGVQISLPVIMVHH  424

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             DP++WG DA EFKPERF+EG++K  +N++++ PF WGPR CIG NFA++EAKIA+A ILQ
Sbjct  425   DPELWGDDAIEFKPERFSEGISKVNRNQVSYFPFAWGPRICIGLNFALVEAKIALAMILQ  484

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              FSF LSPSY H+P  V+TL P+FG  L+L K+
Sbjct  485   NFSFELSPSYVHAPTAVLTLHPEFGTHLILRKL  517



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   521 bits (1341),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 255/511 (50%), Positives = 354/511 (69%), Gaps = 10/511 (2%)
 Frame = -2

Query  1697  LFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK  1518
             L  F+    +VI+A +++ W W +PRKLEK LR+QGL GNSY++ +GD KE+A     A 
Sbjct  8     LVSFLLTITIVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELAKSFEDAN  67

Query  1517  SKPINLSDD-ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR  1341
             SKP+ +SDD I PR++P++   + K+GKNCF+W GP P V++ EPE++++VF    L+++
Sbjct  68    SKPLKVSDDDICPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVREPEVIRDVFNKYVLYQK  127

Query  1340  PKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
             PK  P+ K L  G++ YE+ +W  HRKI++PAF+ +KIK M P+V  SC EM+ +  E +
Sbjct  128   PKSTPITKLLAQGVSSYEEDKWEMHRKILNPAFHMEKIKSMVPAVHLSCTEMVSQWEESI  187

Query  1160  TSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPE  981
             +++   C+ D+ PYL+  TSDVISRTAFG +Y EG K+F LQ E A+   +   ++Y P 
Sbjct  188   STKGTSCEIDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKELAQHVIEATRTLYIPG  247

Query  980   WWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-----  816
                L +K++RRM EID +++ +++G+I KR + +K    + D+    LL    K      
Sbjct  248   SRFLPTKKNRRMKEIDKKVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHG  307

Query  815   ----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKP  648
                 G +T E+IEEC+ FYFAGQE+TS  L W MILLS H  WQ  AR+EV QVFG  K 
Sbjct  308   NKDFGMTTREIIEECKLFYFAGQETTSVLLGWAMILLSKHPDWQAHAREEVLQVFGDGKL  367

Query  647   DFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDP  468
             +FDGLNRLKI+TMILNE LRLYPP   T R     TKLGE+ LP  ++L+L  +L+  D 
Sbjct  368   EFDGLNRLKIVTMILNETLRLYPPVDATSRKTTTNTKLGELSLPAGVMLLLPIILLHHDK  427

Query  467   DVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRF  288
             ++WG DA EFKPERF+EGV+KATK ++ F PFG GPR CIG NFAM+EAK+A+A ILQ F
Sbjct  428   EIWGEDATEFKPERFSEGVSKATKGQMTFFPFGGGPRICIGLNFAMIEAKMALAMILQHF  487

Query  287   SFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SF LSPSY H+P  V+T++PQ+GAPL+LH++
Sbjct  488   SFELSPSYTHAPQSVITIQPQYGAPLILHRL  518



>ref|XP_010542332.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=509

 Score =   520 bits (1338),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 259/492 (53%), Positives = 342/492 (70%), Gaps = 3/492 (1%)
 Frame = -2

Query  1664  IWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDIL  1485
             +W  R ++WVWLKP+ LE  LR+QGL G  Y    GD +   ++  +A+SKPINL+DDI 
Sbjct  19    LWIWRFLKWVWLKPKILESRLRRQGLVGTHYTPLVGDVRRNFSMIKEARSKPINLTDDIT  78

Query  1484  PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVS  1305
             PRVLPF    +  +GK  F W GP P + I+ PE ++EVF     F++P   PL + + +
Sbjct  79    PRVLPFPLTMLKTHGKTFFTWLGPIPAITITNPEQIKEVFNKVYDFEKPHTFPLARLIAT  138

Query  1304  GLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK-NWCDFDV  1128
             GLA Y+  +WA+HRKII+PAF+ +KIK M P+   SC E I+ +WE L S+K + C+ DV
Sbjct  139   GLANYDGDKWAKHRKIINPAFHLEKIKNMVPAFYQSCSE-IVGEWERLVSDKGSSCEVDV  197

Query  1127  QPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRR  948
              P+L   T+DVISRTAFG SY EG ++F LQ E A+L  Q     Y P W  L +K +RR
Sbjct  198   WPWLVNMTADVISRTAFGSSYREGQRIFQLQAELAQLIVQAFRKAYIPGWRYLPTKSNRR  257

Query  947   MHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK-SGFSTDEVIEECQHFY  771
             M EID EIR ++ G+IGKRE+  +    D     L+      K +G S +EV+EEC+ FY
Sbjct  258   MKEIDREIRAILSGIIGKREKAREGPNNDLLGILLESNSGQSKGNGMSLEEVMEECKLFY  317

Query  770   FAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVL  591
             FAGQE+TS  LVW M+LLS HQ WQ RAR+EV QV G  KPD D LN+LK++TMI  EVL
Sbjct  318   FAGQETTSVLLVWTMVLLSQHQDWQARAREEVMQVLGDKKPDMDSLNQLKVITMIFYEVL  377

Query  590   RLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGV  411
             RLYPP     R +++E KLG++ LP  + L L  +L+QRD ++WG+DAGEFKPERF +G+
Sbjct  378   RLYPPVVQLNRAVHKEQKLGDLTLPSGVHLSLPIMLIQRDTELWGSDAGEFKPERFKDGI  437

Query  410   AKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLK  231
             +KAT+N+++FLPFGWGPR CIG NFA++EAK+A+A ILQRFSF LSP+Y H+P  VVT+ 
Sbjct  438   SKATRNQVSFLPFGWGPRICIGQNFALIEAKMALALILQRFSFELSPTYIHAPYTVVTIH  497

Query  230   PQFGAPLVLHKI  195
             PQFGA LVLHK+
Sbjct  498   PQFGAHLVLHKL  509



>ref|XP_010060776.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67641.1| hypothetical protein EUGRSUZ_F01387 [Eucalyptus grandis]
Length=510

 Score =   519 bits (1337),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 255/496 (51%), Positives = 342/496 (69%), Gaps = 3/496 (1%)
 Frame = -2

Query  1679  VPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINL  1500
             +  +  WA R V WVWL+P++LE+ LRQQGL+G  Y   +GD KE   +  +AKSKPI +
Sbjct  14    LAVLTTWAWRAVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENLRMLKEAKSKPIAV  73

Query  1499  SDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLV  1320
             SDDI PR+LPF H +   YGK+ F W GP PRV I+ PE ++E+F     + +P  + LV
Sbjct  74    SDDIKPRLLPFLHRSFQTYGKDWFTWMGPIPRVNITNPEQIKEIFSKIYDYPKPASNALV  133

Query  1319  KFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWC  1140
             K L  GLA +E ++WARHRKII+PAF+ +K+K M P+  SSC EM+  +WE    E+  C
Sbjct  134   KLLADGLANHEGEKWARHRKIINPAFHMEKLKHMLPAFYSSCTEMV-DRWEKSVLEERSC  192

Query  1139  DFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSK  960
             + D    L+  T DVISRTAFG S+ EG ++F LQ EQA L  + + SVY P W  + +K
Sbjct  193   EVDAWVDLQNLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWRFVPTK  252

Query  959   RSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK--SGFSTDEVIEE  786
              +RRM  ID E++ L+  ++ +RE+ ++      D+    LL   +K  +G S  +VIEE
Sbjct  253   MNRRMQNIDKEVQALLMDIVRRREKAIRAGGAAGDDLLGLLLESNMKENAGMSLHDVIEE  312

Query  785   CQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMI  606
             C+ FY AGQE+TS  LVW M+LLS+H  WQ RAR+EV Q FG  KPDFDGL+ LKI+TMI
Sbjct  313   CKLFYIAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSKKPDFDGLSHLKIVTMI  372

Query  605   LNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPER  426
             LNEVLRLYPP     R + +ETKLG++ LP  + + + +LL+  D ++WG DA EFKPER
Sbjct  373   LNEVLRLYPPVVVLARKVPKETKLGKLTLPAGVQVSMPTLLIHHDKELWGEDAEEFKPER  432

Query  425   FAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCF  246
             F EGV+KATKN+++F PFGWGPR C+G NFAMMEAK+A+A ILQ+F+F LS SYAHSP  
Sbjct  433   FTEGVSKATKNQVSFFPFGWGPRICVGQNFAMMEAKMALAMILQQFTFELSASYAHSPLT  492

Query  245   VVTLKPQFGAPLVLHK  198
              +TL+PQ+G  ++LHK
Sbjct  493   KITLQPQYGVQVILHK  508



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   519 bits (1337),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 263/519 (51%), Positives = 356/519 (69%), Gaps = 14/519 (3%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             + SWV++L + + V  V+ WA RV+ WVWL+P+KLEK LR+QGL GNSYR+ +GDTK+++
Sbjct  1     MASWVAVLSV-VWVSMVIAWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLS  59

Query  1538  TLTAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVF  1365
              +  + +SKPI LS   DI P V PF+H  V  YGKN FVW GP PRV I  PE +++ F
Sbjct  60    KMLEQTQSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTF  119

Query  1364  MNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEM  1185
               +  F +   +P++K L  G+   E +QWA+HRKII+PAF+ +K+K M P    SC EM
Sbjct  120   NRHDDFHKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEM  179

Query  1184  IMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQV  1005
             I  KWE L S+++ C+ DV PYLE FTSDVISR AFG SY EG K+F L  E+A++    
Sbjct  180   I-NKWESLVSKESSCELDVWPYLENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVA  238

Query  1004  IHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl  825
             + SVY P W  L +K++++  EI NEI+GL+KG+I KRE  MK      D+    L+   
Sbjct  239   MRSVYIPGWRFLPTKQNKKAKEIHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESN  298

Query  824   LK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
              +          +G S ++VI EC+ FYFAGQE+TS  LVW M+LLS +Q WQ RAR+EV
Sbjct  299   FREIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEV  358

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
              QVFG N P ++ L++LK++TMIL EVLRLYP      RT +++T+LG++ LP  + + L
Sbjct  359   LQVFGSNIPTYEELSQLKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSL  418

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
               LLV  D ++WG DA EFKPERF+EGV+KATKN+  + PFG GPR CIG NFAMMEAK+
Sbjct  419   PILLVHHDKELWGEDANEFKPERFSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKL  478

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             A++ IL+ F+  LSP YAH+P   +TL+PQ+GA ++LHK
Sbjct  479   ALSLILRHFALELSPLYAHAPSVTITLQPQYGAHIILHK  517



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   519 bits (1337),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 256/516 (50%), Positives = 353/516 (68%), Gaps = 14/516 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V+I F+FI++   +I+A R++ WVWL+P+KLE+ LRQQGL GNSYR+ +GD +EM+ +
Sbjct  15    SSVAISFVFITL---LIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRM  71

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A S+PI+ SDDI+ RVLPF+  ++ KYGKN F+W GP P V I +PEL+ +V + + 
Sbjct  72    INEANSRPISFSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELISDVLLKHN  131

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++   HPL K L SG+A  E +QW + RKII+PAF+ +K+K M  +   SC +M+  K
Sbjct  132   AFQKAPRHPLRKLLASGIASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMV-NK  190

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE   S    C+ D+ PYL+  T DVISRTAFG SY EG ++F LQ EQA L  QV  SV
Sbjct  191   WEKQLSLDGSCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLAVQVTRSV  250

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W    +K +RRM +I +E+  L+KG+I KRE+ M+     +D+    L+    +  
Sbjct  251   YVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREM  310

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  +VIEEC+ FY AGQE+TS  L+W M+LLS H  WQ  AR+EV +VF
Sbjct  311   QENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQACAREEVLRVF  370

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD D LN LKI+TMI +EVLRLYPP P   R ++ ++++G + LP  + + L  LL
Sbjct  371   GNKKPDGDDLNHLKIVTMIFHEVLRLYPPVPMLTRAVFADSQVGGLYLPDGVQIALPILL  430

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  D  +WG DA EF P RF+EGV+KA K++++F PFG+GPR C+G NFAMMEAK+A+A 
Sbjct  431   IHHDDKIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAM  490

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSYAH+P  ++T++PQ GA L+LH +
Sbjct  491   ILQRFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  526



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   519 bits (1336),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 252/504 (50%), Positives = 352/504 (70%), Gaps = 9/504 (2%)
 Frame = -2

Query  1682  SVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN  1503
             SV  ++I A R + W W+ P+K+EK LR+QGL GNSYR  +GDT++M  +  +AKSKPI+
Sbjct  12    SVIVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGRMLEEAKSKPIS  71

Query  1502  LSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPL  1323
             L+DDI PR++P  +  +   GKN F W GP P ++I +PE ++EVF  N  +++P+ +P+
Sbjct  72    LTDDIFPRIMPLINETMQHKGKNSFFWLGPRPAMVILDPEQVKEVFTKNFTYQKPRANPI  131

Query  1322  VKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW  1143
              K L  GLA  + ++WA+HR++++PAF+ +K+K M P+   SC EM + KWE L   +  
Sbjct  132   SKLLALGLASLDTEKWAKHRRLLNPAFHVEKLKYMVPAFYLSCNEM-LSKWENLAPAEGS  190

Query  1142  CDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSS  963
              + DV PYL+ FTSDVISRTAFG +Y +G ++F LQ+EQA    QV+ S+Y P W  + +
Sbjct  191   FELDVWPYLQIFTSDVISRTAFGSNYEKGRRIFELQSEQALYFEQVMQSIYLPGWSFVPT  250

Query  962   KRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdd--------deenldllgvlLKSGFS  807
             KR++RM +I  E+  L+ G+I +R + ++              +    ++     K+G S
Sbjct  251   KRNKRMQKIFKEVNSLVMGIINERLKEIQTGEATSDDLLGILLESNLNEIRQHGNKNGLS  310

Query  806   TDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNR  627
              +EVIEEC+ FY AGQE+TS  LVW +ILLS H  WQ RAR EV QVF +N+PD   LN 
Sbjct  311   LEEVIEECKLFYLAGQETTSGLLVWTLILLSQHFDWQARARDEVLQVFDNNEPDISKLNH  370

Query  626   LKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADA  447
             LKI+TMILNEVLRLYPP+    R   EETKLG++ LP  + + ++ +L+Q+D D+WG DA
Sbjct  371   LKIVTMILNEVLRLYPPAANFFRMNPEETKLGDLSLPEGMFIFVAPILLQQDKDLWGDDA  430

Query  446   GEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPS  267
              EFKPERF+EGV+KATK  L+F PFGWGPRTCIG NFAM+EAK+A+A IL+RFS+ LSPS
Sbjct  431   KEFKPERFSEGVSKATKGNLSFFPFGWGPRTCIGQNFAMLEAKMALALILRRFSWELSPS  490

Query  266   YAHSPCFVVTLKPQFGAPLVLHKI  195
             YAH+P  V+TL+PQ+GA L+L K+
Sbjct  491   YAHAPQVVLTLQPQYGAQLILKKL  514



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   518 bits (1335),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 252/520 (48%), Positives = 362/520 (70%), Gaps = 13/520 (3%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             M+++ S V++ F+ + +   + W  + + WVW++P+K+EK L+ +G  G+SY++  GD K
Sbjct  1     MEKLNSTVAVSFVIMII--FLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLLGDMK  58

Query  1547  EMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEV  1368
             E+ T+  +AK+KP+N ++D + RVLP +   + +YGKNCF+W GP P + I++PEL++E+
Sbjct  59    EINTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNCFMWLGPKPTMFITDPELIREI  118

Query  1367  FMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEE  1188
                + ++++ + +P+ K L  GLA YE ++WA+HR+II+PAF+ DK+K M PS   SC +
Sbjct  119   LSKSYIYQKIQGNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCD  178

Query  1187  MIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQ  1008
             M ++KWE + S +   + DV P+L+  TSD ISRTAFG +Y EG ++F LQ EQAEL  Q
Sbjct  179   M-LRKWESIVSSEG-SEIDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQAELILQ  236

Query  1007  VIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv  828
                 +Y P W  + +KR++RM +I  E+R L+ G+I KR R MK      D+    LL  
Sbjct  237   AARWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLES  296

Query  827   lLKS---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
               K          G + DEVIEEC+ FYFAGQE+TS  LVW +ILLS H  WQ+RAR+EV
Sbjct  297   NFKEIQMHRNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEV  356

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
             +QVFG NKPD++ L +LK++TMI NEVLRLYPP     RT++EETKLG + LP  ++L+L
Sbjct  357   RQVFGSNKPDYETLKQLKVVTMIFNEVLRLYPPGIMIGRTVHEETKLGNLSLPAGMLLML  416

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
              ++ +  D ++WG DA EFKPERF EGV KATK + A+ PF WGPR CIG NFAM+EAK+
Sbjct  417   PAIWLHHDNEIWGDDAKEFKPERFGEGVNKATKGKFAYFPFSWGPRICIGLNFAMLEAKM  476

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             A+A ILQ ++F LSPSYAH+P  ++TL+PQ GAPL+L K+
Sbjct  477   AVAMILQHYAFELSPSYAHAPHTIITLQPQHGAPLILRKL  516



>ref|XP_010275158.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=527

 Score =   518 bits (1335),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 255/522 (49%), Positives = 356/522 (68%), Gaps = 12/522 (2%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             M+ I  +  I   F+    +++WA R + WVWLKP+KLE++LR+QG+ G+SY + YG  +
Sbjct  1     MNMIGEYFFISSAFLIFGLILLWAWRFLNWVWLKPKKLERFLREQGIKGHSYGLLYGTLR  60

Query  1547  EMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEV  1368
             E + +  + +SKP NLS DI PRVLPF H     YG+    W G +PRV I +P L++++
Sbjct  61    EESRMMKEVQSKPTNLSHDIAPRVLPFIHQTFKDYGRTSLCWIGTSPRVNILDPTLIRDI  120

Query  1367  FMNN-TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCE  1191
               N    F+ PK +PLV+ LV+GL  YED QWA+HR+IISPAF+ +K+K M P+  +S  
Sbjct  121   LSNKFGQFQMPKLNPLVRLLVTGLLSYEDDQWAKHRRIISPAFHQEKLKLMLPAFYASFA  180

Query  1190  EMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTR  1011
             E++  +W  LT+ K  C+ D+ P ++  T+DVISR  FG  Y EG K+F LQNE ++LT 
Sbjct  181   ELV-SRWNKLTTPKGSCELDIWPEIQNVTTDVISRALFGSGYEEGQKIFQLQNELSKLTL  239

Query  1010  QVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRE----------RGMKEKvgd  861
             QV+ SVY P +  L +K++ RM EI+ EI+ ++ G+I K+E            +   + D
Sbjct  240   QVLQSVYIPGFRFLPTKKNNRMKEIEKEIQTVLTGIINKKEATPSVGEVSSSDLLSLLID  299

Query  860   ddeenldllgvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQ  681
              ++  +   G    +G +  EVIEEC+ FYFAGQE+TS+ LVW M++LS+H  WQ RAR+
Sbjct  300   SNKNYIQEHGSKKNAGMTIKEVIEECKLFYFAGQETTSNLLVWTMVVLSMHMDWQTRARE  359

Query  680   EVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiil  501
             EV + FG++ P + GL+ LKI+TMIL EVLRLYPP+    R+ Y+ TKLGE+ LPP + L
Sbjct  360   EVLKFFGNDIPSYGGLSHLKIVTMILYEVLRLYPPTVTIGRSTYKNTKLGEISLPPGVHL  419

Query  500   ilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEA  321
              +  LL+  D + WG DA EFKPERFAEGV+KAT N+++F PFGWGPR CIG NFAM EA
Sbjct  420   EMPILLLHHDLEFWGEDAQEFKPERFAEGVSKATNNQVSFFPFGWGPRICIGQNFAMTEA  479

Query  320   KIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             K+A+A ILQ FSF LSPSY H+PCFV+TL+PQ+GA ++ HK+
Sbjct  480   KMALAMILQHFSFELSPSYTHAPCFVLTLQPQYGAQIIFHKL  521



>ref|XP_010060773.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67635.1| hypothetical protein EUGRSUZ_F01380 [Eucalyptus grandis]
Length=510

 Score =   518 bits (1334),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 254/489 (52%), Positives = 338/489 (69%), Gaps = 3/489 (1%)
 Frame = -2

Query  1658  ACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPR  1479
             A RVV W WL+P++LE +LRQQGL+G  Y   +GD KE + L   A SKPI +SDDI PR
Sbjct  21    AWRVVNWTWLRPKRLEGFLRQQGLSGKPYTFLFGDLKEDSRLLRIANSKPIAISDDIKPR  80

Query  1478  VLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGL  1299
             +LPF H +   YGK+ F+W GP PRV ++ PE ++E+F     + +P   PL K L+ GL
Sbjct  81    LLPFVHQSFQTYGKDSFMWIGPTPRVNLTNPEQLKEIFSKMYDYHKPTRSPLSKLLLGGL  140

Query  1298  ACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPY  1119
               +E ++WARHRKII+PAF+ +K+K M P+  SSC EM+  +WE L SE+  C+ DV   
Sbjct  141   PFHEGEKWARHRKIINPAFHMEKLKLMLPAFCSSCTEMV-HRWEKLVSEERSCEVDVWVD  199

Query  1118  LEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHE  939
             L+  T DVISRTAFG  Y EG ++F LQ E   LT + + SVY P W  L +K +RRM  
Sbjct  200   LQNLTRDVISRTAFGSRYEEGKRIFELQEELGVLTIKALRSVYIPGWRFLPTKMNRRMKN  259

Query  938   IDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKSG--FSTDEVIEECQHFYFA  765
             I  E++ L+  +I +RE+ ++      D+    LL   +K     S  +VIEEC  FY A
Sbjct  260   IGKEVQALLTDIIRRREKAIRGGEATGDDLLGLLLESNMKDNVRMSLHDVIEECNLFYVA  319

Query  764   GQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRL  585
             GQE+TS  LVW M+LLS+H  WQ RAR+E+ Q FG  KPDF GL+ LKI+TMILNEVLRL
Sbjct  320   GQETTSALLVWTMVLLSVHPDWQARAREEILQTFGSRKPDFGGLSHLKIVTMILNEVLRL  379

Query  584   YPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAK  405
             YPP     R +++ETKLG++ LP  + L +  LL+  D ++WG DA EFKPERFA+GV+K
Sbjct  380   YPPVTIMARNVHKETKLGKLTLPSGVQLSVPVLLIHHDKELWGEDAEEFKPERFADGVSK  439

Query  404   ATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQ  225
             ATKN+++FLPFGWGPR C+G NFAM+EAK+++A ILQRF+F LSPSY H+PC  +TL+PQ
Sbjct  440   ATKNQVSFLPFGWGPRICVGQNFAMIEAKMSLAMILQRFTFELSPSYVHAPCIALTLQPQ  499

Query  224   FGAPLVLHK  198
             +GA ++LHK
Sbjct  500   YGAQVILHK  508



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   518 bits (1334),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 260/501 (52%), Positives = 345/501 (69%), Gaps = 14/501 (3%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V IW  RV+ WVW +P+KLEK  R+QGL GNSYR+ YGD KE++ +  +A SKP+NLSDD
Sbjct  21    VCIW--RVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSGMIEEANSKPMNLSDD  78

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PR++PF+   + KYGK  FVW GP P V I +PEL++EVF  N L+++P  +PL K L
Sbjct  79    IAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKNYLYEKPHSNPLTKLL  138

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL   E  +WA+HRKII+PAF+ +K+K M P+   SC EM + KWE + + +   + D
Sbjct  139   AQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEM-LSKWEDIVAVEGSHEID  197

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             + P L+  +SDVISRTAFG SY EG ++F LQ EQA+   + I S+Y P W  L +KR+R
Sbjct  198   IWPGLQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKAIRSIYIPGWRFLPTKRNR  257

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTDE  798
             RM EI+ +++  + G+I KR   MK    ++++    LL    K          G S +E
Sbjct  258   RMKEIEKDVQASITGIIDKR--AMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSIEE  315

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW +ILLS HQ WQ +AR+EV QVFG  KPDFDGLNRLKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTLILLSRHQDWQAQAREEVLQVFGSQKPDFDGLNRLKI  375

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +  +L E LRLYPP     R   E+T LG++ LP  +++ L  +L+  D ++WG DA +F
Sbjct  376   VRELLYESLRLYPPVVSLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKF  435

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
             KPERF +GV+ A K ++ + PF WGPR CIG NFAM+EAK A+A ILQRFSF LSPSYAH
Sbjct  436   KPERFRDGVSSAAKGQVTYFPFTWGPRICIGLNFAMLEAKTALAMILQRFSFELSPSYAH  495

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  ++TL+PQ+GAPL+LHKI
Sbjct  496   APQSIITLQPQYGAPLILHKI  516



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   518 bits (1333),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 262/514 (51%), Positives = 354/514 (69%), Gaps = 14/514 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V++ F FI++   +I+A RV+ W+WL+P++LE+ L+QQGL GNSYR+ YGD KEM+ +  
Sbjct  9     VALSFAFITI---LIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIK  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A S+PI+ SDDIL RV PF++ ++ KYGK+ F+W G  PRV I EPEL+++V   +T+F
Sbjct  66    EATSRPISFSDDILQRVAPFHYHSIKKYGKSSFIWMGLKPRVNIMEPELIRDVLSMHTVF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P+ H L K   SGL   E ++WA+HRKII+PAF  +K+K M P+   SC +MI  KWE
Sbjct  126   RKPRVHALGKQPASGLFFLEGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMI-SKWE  184

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
                S    C+ DV PYL+  T D ISRTAFG +Y EG  +F LQ EQA+L  Q   S   
Sbjct  185   XKLSTXGSCEXDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSQSACI  244

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +K ++RM +   E+  L+ G+I KRE+ MK     +D+    LL    K    
Sbjct  245   PGWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLNDDLLGILLESNFKEIQE  304

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S  +VI+EC+ FYFAGQE+TS  L+W M+LLS H  WQ RAR+EV  VFG+
Sbjct  305   HGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVFGN  364

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             NKP+ DGLN LKI+ MIL+EVLRLYPP P   RT+YE+ ++G+M LP  + + L ++LV 
Sbjct  365   NKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVH  424

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EF PERF++G  KATK+ ++F PFGWG R CIG NFA++EAK+ +A IL
Sbjct  425   HDHEIWGEDAREFNPERFSQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAMIL  484

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             QRFSF LSPSY+H+PC +VTLKPQ+GA L+LH I
Sbjct  485   QRFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_008366858.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=516

 Score =   517 bits (1332),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 261/501 (52%), Positives = 342/501 (68%), Gaps = 12/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V  WA RVV W+WL+P+KLE++LRQQGL GNSYR   GD KE   +  +A SKP+NLS D
Sbjct  17    VTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERTMMLKQAYSKPMNLSHD  76

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PRVLPF + +V  YGKN F+W+GP PRV I+ PE ++++      F + K +P VK L
Sbjct  77    IAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTKIEDFPKLKSNPYVKLL  136

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
             V+G A YE ++W RHR+II+PAF+ DK+K M P+   S  EMI K+WE L  ++  C+ D
Sbjct  137   VTGTAHYEGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSSEMI-KEWESLVLKEGSCELD  195

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V+P LE  T+D+ISR+AFG SY EG K+F L  EQ +L  +VI +VY P W  + +K ++
Sbjct  196   VRPCLENLTADMISRSAFGSSYKEGRKIFQLLREQLQLVTKVIQNVYIPGWRFVPTKMNK  255

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTD  801
             +M  ID EI GL+ G+I KRE G++      D+    L+   LK           G    
Sbjct  256   KMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKEIKEHGNNKGVGMXMY  315

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             +VIEEC+ FYFAGQE+TS  LVW M+LL  +Q WQDRAR+EV QVFG NKPDFDG+  LK
Sbjct  316   DVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDRAREEVLQVFGSNKPDFDGIIHLK  375

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMIL+EVLRLY P+P  +RT  ++T+     LP  + + L  LL+  D ++WG DA E
Sbjct  376   VVTMILHEVLRLY-PAPLLVRTTSKKTEFRNFSLPAGVEVALPMLLIHHDRELWGDDAQE  434

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             FKPERF+EGVAK TKN+  + PF  GPR CIG NFAM+EAK+AI+ ILQ F+F LSPSYA
Sbjct  435   FKPERFSEGVAKTTKNKFTYFPFSGGPRVCIGQNFAMVEAKLAISLILQHFTFELSPSYA  494

Query  260   HSPCFVVTLKPQFGAPLVLHK  198
             H+P   + L PQFGA ++LHK
Sbjct  495   HAPSAKLILHPQFGAHIILHK  515



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   517 bits (1332),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 260/501 (52%), Positives = 345/501 (69%), Gaps = 14/501 (3%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V IW  RV+ WVW +P+KLEK  R+QGL GNSYR+ YGD KE++ +  +A SKP+NLSDD
Sbjct  21    VCIW--RVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSGMIEEANSKPMNLSDD  78

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PR++PF+   + KYGK  FVW GP P V I +PEL++EVF  N L+++P  +PL K L
Sbjct  79    IAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKNYLYEKPHSNPLTKLL  138

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL   E  +WA+HRKII+PAF+ +K+K M P+   SC EM + KWE + + +   + D
Sbjct  139   AQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEM-LSKWEDIVAVEGSHEID  197

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             + P L+  +SDVISRTAFG SY EG ++F LQ EQA+   + I S+Y P W  L +KR+R
Sbjct  198   IWPGLQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKAIRSIYIPGWRFLPTKRNR  257

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTDE  798
             RM EI+ + +  + G+I KR + MK    ++++    LL    K          G S +E
Sbjct  258   RMKEIEKDSK--VTGIIDKRVKAMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSIEE  315

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW +ILLS HQ WQ +AR+EV QVFG  KPDFDGLNRLKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTLILLSRHQDWQAQAREEVLQVFGSQKPDFDGLNRLKI  375

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +  +L E LRLYPP     R   E+T LG++ LP  +++ L  +L+  D ++WG DA +F
Sbjct  376   VRELLYESLRLYPPVVSLTRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKF  435

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
             KPERF +GV+ A K ++ + PF WGPR CIG NFAM+EAK A+A ILQRFSF LSPSYAH
Sbjct  436   KPERFRDGVSSAAKGQVTYFPFTWGPRICIGLNFAMLEAKTALAMILQRFSFELSPSYAH  495

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  ++TL+PQ+GAPL+LHKI
Sbjct  496   APQSIITLQPQYGAPLILHKI  516



>ref|XP_010060784.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67652.1| hypothetical protein EUGRSUZ_F01400 [Eucalyptus grandis]
Length=510

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 255/509 (50%), Positives = 351/509 (69%), Gaps = 3/509 (1%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +++ +  + L   +  +  WA RVV WVW++P++LE+ LRQQGL+   Y   +GD KE +
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWVRPKRLERLLRQQGLSRKPYTFLFGDLKENS  60

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
              L  +A SKPI +SDDI PR+LPF H +   YGK+ F+W GP P V I+ PE ++E+F N
Sbjct  61    RLLTEANSKPIAISDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPGVRITNPEQLKEIFSN  120

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                + +P P+PLVK L  GL  +E ++W R+RKII+PAF+ +K+K M P+  SSC EM+ 
Sbjct  121   INDYPKPGPNPLVKLLGDGLVNHEGEKWTRYRKIINPAFHMEKLKLMLPAFYSSCTEMV-  179

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              +WE L S +  C+ D    L+  T +VISRTAFG S+ EG ++F LQ EQA L    + 
Sbjct  180   GRWEKLVSVERSCEIDAWVDLQNLTREVISRTAFGSSFEEGKRIFELQGEQAHLAIIALQ  239

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  + +K +RRM  ID E+R L+  +I +RE+ ++E     D+    LL   +K
Sbjct  240   SVYIPGWRFVPTKMNRRMKNIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMK  299

Query  818   S--GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
                G S  +VIEEC+ FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV Q+FG  KPD
Sbjct  300   ENVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPD  359

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              DGL+ LKI+TMILNEVLRLYPP     R + +ETKLG++ +PP + L + +LL+  D +
Sbjct  360   PDGLSHLKIVTMILNEVLRLYPPVTELARKVPKETKLGKLTIPPGVQLSMPTLLIHHDKE  419

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG DA EFKPERFAEGV+ ATKN+++F PFGWGPR CIG NFA++EAK+A+A ILQ+F+
Sbjct  420   LWGEDAEEFKPERFAEGVSMATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFT  479

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             F LSPSYAH+P  V+ L+P++G  ++L K
Sbjct  480   FELSPSYAHAPSNVLILQPRYGVQVILRK  508



>ref|XP_008226214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=518

 Score =   516 bits (1330),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 258/519 (50%), Positives = 352/519 (68%), Gaps = 14/519 (3%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             + SWV++L + + V  V+ WA RV+ WVWL+P+KLE+ LR+QGL GNSY++ +GDTKE +
Sbjct  1     MASWVAVLSV-VWVSMVIAWAWRVLNWVWLRPKKLERSLREQGLTGNSYKLLFGDTKESS  59

Query  1538  TLTAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVF  1365
              +  +A+SKPI LS   DI PRV+PF H  V  YGKN FVW GP P+V I  PE ++E+F
Sbjct  60    MMLDQAQSKPIKLSTSHDIAPRVMPFVHQTVNTYGKNSFVWMGPIPKVNIMNPEDLKEIF  119

Query  1364  MNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEM  1185
               +  F+RP  +P++  L  GL  +ED +WA+HRKII PAF+ +K+K M P+   SC EM
Sbjct  120   NKDQNFRRPSANPMIDLLAQGLLAFEDGKWAKHRKIIHPAFHLEKLKGMLPTFYQSCSEM  179

Query  1184  IMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQV  1005
             I  +WE L S++  C+ DV P L+  ++D+ISR AFG SY EG K+F L  EQ +     
Sbjct  180   I-NEWERLVSKEGSCELDVWPCLQTLSADMISRAAFGSSYQEGRKIFQLLREQEKFYATA  238

Query  1004  IHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl  825
             I SVY P    L +K+++RM +I  EI  L+KG+I KRE  MK       +    L+   
Sbjct  239   IQSVYIPGSRFLPTKQNKRMKKIYEEISVLLKGIINKREEAMKLGEASKHDLLGILMESN  298

Query  824   LK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
             LK          +G S ++VIEEC+ FY AGQE+TS  LVW M+LLS +Q WQ RAR+EV
Sbjct  299   LKEIREHGNHRNTGMSLEDVIEECKLFYLAGQETTSVLLVWAMVLLSQNQNWQARAREEV  358

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
              QVF  N P +D L+ LK++TM+L EVLRLYP +   +RT  ++T+LG+  LP  + + +
Sbjct  359   SQVFESNPPTYDTLSHLKVVTMVLLEVLRLYPAAVELLRTSRKKTQLGKFSLPAGVEVSI  418

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
               +L   D ++WG DA EFKPERF+EGVAKATKN+ A+ PFG GPR CIG NFAM+EAK+
Sbjct  419   HIMLAHHDKELWGEDADEFKPERFSEGVAKATKNQFAYFPFGAGPRICIGQNFAMLEAKL  478

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             A++ ILQ F+F LSPSYAH+P  ++TL+PQ+GA ++L K
Sbjct  479   ALSLILQHFTFELSPSYAHAPLTLITLQPQYGAHIILSK  517



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   516 bits (1329),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 355/517 (69%), Gaps = 15/517 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V++  +++S+  V+ WA RV+ WVWL+P+KLEK LR+QGL GNSYR+ +GDTK+++ +
Sbjct  7     SCVALCVVWVSI--VITWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKM  64

Query  1532  TAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
               + +SKPI LS   DI P V PF+H  V  YGKN FVW GP PRV I  PE +++ F  
Sbjct  65    LEQTQSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNR  124

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
             +  F +   +P++K L  G+   E +QWA+HRKII+PAF+ +K+K M P    SC EMI 
Sbjct  125   HDDFHKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMI-  183

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              KWE L S+++ C+ DV PYLE FTSDVISR AFG SY EG K+F L  E+A++    + 
Sbjct  184   NKWESLVSKESSCELDVWPYLENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMR  243

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  L +K++++  EI NEI+GL+KG+I KRE  MK      D+    L+    +
Sbjct  244   SVYIPGWRFLPTKQNKKAKEIHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNFR  303

Query  818   ----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQ  669
                       +G S ++VI EC+ FYFAGQE+TS  LVW M+LLS +Q WQ RAR+EV Q
Sbjct  304   EIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQ  363

Query  668   VFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililss  489
             VFG N P ++ L++LK++TMIL EVLRLYP      RT +++T+LG++ LP  + + L  
Sbjct  364   VFGSNIPTYEELSQLKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPI  423

Query  488   lLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAI  309
             LLV  D ++WG DA EFKPERF+EGV+KATKN+  + PFG GPR CIG NFAMMEAK+A+
Sbjct  424   LLVHHDKELWGEDANEFKPERFSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLAL  483

Query  308   ATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             + IL+ F+  LSP YAH+P   +TL+PQ+GA ++LHK
Sbjct  484   SLILRHFALELSPLYAHAPSVTITLQPQYGAHIILHK  520



>ref|XP_010092744.1| Secologanin synthase [Morus notabilis]
 gb|EXB52089.1| Secologanin synthase [Morus notabilis]
Length=558

 Score =   517 bits (1332),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 264/528 (50%), Positives = 346/528 (66%), Gaps = 51/528 (10%)
 Frame = -2

Query  1631  LKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVLPFYHLAV  1452
             L+P++LEK LR+QGL GNSYR  +GD KE  ++  +A+SKPINLSDDI  RV PF    V
Sbjct  31    LRPKRLEKCLRKQGLKGNSYRFLFGDLKESISMYKEARSKPINLSDDITTRVFPFVLQTV  90

Query  1451  TKYG----------------------------------------KNCFVWSGPAPRVIIS  1392
              KYG                                        K+ F+W GP PRV I+
Sbjct  91    QKYGMYLYSTQSGGQTVIFGTQGSQIDHKTLFNKRKAFSFPVSGKDSFMWIGPNPRVNIT  150

Query  1391  EPELMQEVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAP  1212
              PE ++++F     F +P  +PLV+ L +GLA YE ++WA+HRKII+PAF+ +K+K M P
Sbjct  151   NPEHLKDIFNKIGDFPKPHNNPLVELLATGLASYEGEKWAKHRKIINPAFHVEKLKHMLP  210

Query  1211  SVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQN  1032
             +   SC EM +KKWE   + +  C+ DV PYL+  T DVISRTAFG SY EG ++F LQ 
Sbjct  211   AFYLSCNEM-LKKWESFLNNEGSCEIDVWPYLQNMTGDVISRTAFGSSYEEGRRIFQLQR  269

Query  1031  EQAELTRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgddde  852
             EQAEL  + I +VY P W    +  ++RM E+D+E++GL+K +I KRE+ M+     +D+
Sbjct  270   EQAELAIKAIQTVYVPGWRFAPTTLNKRMKEVDHEVQGLLKDIIHKREKAMRAGEAPNDD  329

Query  851   enldllgvlLKS----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQT  702
                 L+    K           G S  +VIEEC+ FYFAGQE+TS  LVW M+LLS +  
Sbjct  330   LLGILMESNFKEIQEHGNNKNMGISIRDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPD  389

Query  701   WQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMK  522
             WQ RAR+EV QVFG+N PDFDGL  LKI+TMIL EVLR YPP     RT+ ++T+LG + 
Sbjct  390   WQARAREEVLQVFGYNNPDFDGLGHLKIVTMILYEVLRFYPPVILLTRTVQKQTQLGNLS  449

Query  521   LPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGN  342
             LPP + + L  +LV RD ++WG DA EFKPERFAEGV+KATK +++F PFGWGPR CIG 
Sbjct  450   LPPGVQISLPVILVHRDTNLWGEDAKEFKPERFAEGVSKATKGQVSFFPFGWGPRICIGQ  509

Query  341   NFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             NFAM+EAK+A+A ILQRF+F LSPSYAH+PC V+TL+PQ+GA + LHK
Sbjct  510   NFAMIEAKMALALILQRFTFELSPSYAHAPCTVITLQPQYGAHITLHK  557



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   515 bits (1327),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 251/509 (49%), Positives = 354/509 (70%), Gaps = 14/509 (3%)
 Frame = -2

Query  1685  ISVPAVVI---WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKS  1515
             +S+  V+I   W  + + WVW++P+K+EK L+ +G  G+SY++ +GD KE+ T+  +AK+
Sbjct  11    VSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKEINTMVEEAKT  70

Query  1514  KPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPK  1335
             KP+N ++D + RVLP +   + +YGKN F+W GP P + I++PEL++E+   + ++++ +
Sbjct  71    KPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREILSKSYIYQKIQ  130

Query  1334  PHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTS  1155
              +P+ K L  GL  YE ++WA+HRKII+PAF+ DK+K M PS   SC +M ++KWE + S
Sbjct  131   GNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDM-LRKWESIAS  189

Query  1154  EKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWW  975
              +   + DV P+LE  TSD ISRTAFG +Y +G ++F LQ EQAEL  Q    +Y P W 
Sbjct  190   SEG-SEIDVWPFLETLTSDAISRTAFGSNYEDGRQIFELQKEQAELILQAARWLYIPGWR  248

Query  974   LLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-------  816
              + +KR++RM +I  E+R L+ G+I KR R MK      D+    LL    K        
Sbjct  249   FVPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHGNK  308

Query  815   --GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDF  642
               G + DEVIEEC+ FYFAGQE+TS  LVW +ILLS H  WQ+RAR+EV QVFG NKPD+
Sbjct  309   NFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVHQVFGSNKPDY  368

Query  641   DGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDV  462
             D LN+LK++TMI NEVLRLYPP     RT++E+TKLG + LP  I L+L ++ +  D ++
Sbjct  369   DALNQLKVVTMIFNEVLRLYPPGITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHDNEI  428

Query  461   WGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSF  282
             WG DA EFKPERF+EGV KATK + A+ PF WGPR C+G NFAM+EAK+A+A ILQ ++F
Sbjct  429   WGDDAKEFKPERFSEGVNKATKGKFAYFPFSWGPRICVGLNFAMLEAKMALALILQHYAF  488

Query  281   HLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              LSPSYAH+P  ++TL+PQ GAPL+L K+
Sbjct  489   ELSPSYAHAPHTIITLQPQHGAPLILRKL  517



>gb|KCW67648.1| hypothetical protein EUGRSUZ_F01396 [Eucalyptus grandis]
Length=519

 Score =   515 bits (1327),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 256/518 (49%), Positives = 355/518 (69%), Gaps = 12/518 (2%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +++ +  + L + +  +  WA RVV WVW++P++LE+ LRQQGL+G  Y   +GD KE +
Sbjct  1     MEASIQSIGLAMVLAVLTTWAWRVVNWVWVRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYG---------KNCFVWSGPAPRVIISEP  1386
              L  +A SKPI +SDDI PR+ PF H +   Y          K+ F+W GP PRV I+ P
Sbjct  61    RLLTEANSKPIAISDDIKPRLFPFLHQSSQTYAMHFFIVSLRKDSFMWIGPTPRVRITNP  120

Query  1385  ELMQEVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSV  1206
             E ++E+F N   + +P  +PLVK LV GLA +E ++W RHRKII+PAF+ +K+K M P+ 
Sbjct  121   EQLKEIFSNINDYPKPASNPLVKLLVDGLANHEGEKWVRHRKIINPAFHMEKLKLMLPAF  180

Query  1205  TSSCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQ  1026
              SSC EM+  +WE L S +  C+ D    L+  T +V+SRTAFG S  EG ++  LQ EQ
Sbjct  181   YSSCAEMV-GRWEKLVSVERSCEIDAWVDLQNLTREVLSRTAFGSSLEEGKRICELQGEQ  239

Query  1025  AELTRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeen  846
             A+LT     SVY P W  + +K +RRM  ID E+R L+  +I +RE+ ++E     D+  
Sbjct  240   AQLTIIAFQSVYIPGWRFVPTKMNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLL  299

Query  845   ldllgvlLKS--GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQ  672
               LL   +K   G S  +VIEEC+ FYFAGQE+TS  LVW M+LLS+H  WQ RAR+EV 
Sbjct  300   GLLLESNMKENVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVL  359

Query  671   QVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilils  492
             ++FG  KPD DGL+ LKI+TMILNEVLRLYPP+   +R + +ETKLG++ +P  + L + 
Sbjct  360   RIFGSGKPDPDGLSHLKIVTMILNEVLRLYPPATDLVREVLKETKLGKLTIPTGVQLSMP  419

Query  491   slLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIA  312
             +LL+  D ++WG DA EFKPERFAEGV+KATKN+++F PFGWGPR CIG NFA++EAK+A
Sbjct  420   TLLIHHDKELWGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMA  479

Query  311   IATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             +A ILQ+F+F LSPSYAH+P  V+TL+P++G  ++L K
Sbjct  480   LAMILQQFTFELSPSYAHAPSNVITLQPRYGVQVILRK  517



>emb|CBI39884.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   513 bits (1321),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 249/493 (51%), Positives = 339/493 (69%), Gaps = 37/493 (8%)
 Frame = -2

Query  1673  AVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSD  1494
             A++  A R    VWL+PR+LE+ LR+QGL GNSYR  +GD K+++ +  +A S+PINLSD
Sbjct  15    ALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSIMLKEANSRPINLSD  74

Query  1493  DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             DI+PRV+PF +  + +YGKN F W GP PRV I +PEL++EVF+    F++ KP+PL  F
Sbjct  75    DIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEAGRFQKQKPNPLANF  134

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             L++GL  YE ++WA+HRK+++PAF+ +K+K M+P+   SC +MI K  E+++ E + C+ 
Sbjct  135   LLTGLVSYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSCRQMISKMEEMVSPEGS-CEL  193

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV P+L+  T+D +SRTAFG SY EG ++F L  EQ  LT +V  SVY P WW L +KR+
Sbjct  194   DVWPFLKNLTADALSRTAFGSSYEEGRRLFQLLQEQTYLTMEVFQSVYIPGWWYLPTKRN  253

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKSGFSTDEVIEECQHF  774
             +RM +ID E+   M+                                    EVIEEC+ F
Sbjct  254   KRMKKIDKEMNTFMQ------------------------------------EVIEECKLF  277

Query  773   YFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEV  594
             Y AGQE+TS+ L+W M+LLS H  WQ  AR+EV QVFG NKP+F GL+RLK++TMI  EV
Sbjct  278   YLAGQETTSNLLLWTMVLLSKHPNWQTLAREEVFQVFGKNKPEFAGLSRLKVVTMIFYEV  337

Query  593   LRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEG  414
             LRLYPP     R +YE+  LGE+ LP  + ++L ++LV  DP++WG D  EFKPERF+EG
Sbjct  338   LRLYPPGATLNRAVYEDINLGELYLPSGVEIVLPTILVHHDPEIWGDDVKEFKPERFSEG  397

Query  413   VAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTL  234
             V KATK ++++ PFGWGPR CIG NFAM EAK+A+A ILQ F+F LSPSY H+P  V+TL
Sbjct  398   VMKATKGQVSYFPFGWGPRICIGQNFAMAEAKMALAMILQCFTFELSPSYTHAPTSVLTL  457

Query  233   KPQFGAPLVLHKI  195
             +PQ+GA L+LHKI
Sbjct  458   QPQYGAHLILHKI  470



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   514 bits (1324),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 251/509 (49%), Positives = 353/509 (69%), Gaps = 14/509 (3%)
 Frame = -2

Query  1685  ISVPAVVI---WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKS  1515
             +S+  V+I   W  + + WVW++P+K+EK L+ +G  G+SY++ +GD KE+ T+  +AK+
Sbjct  11    VSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKEINTMVEEAKT  70

Query  1514  KPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPK  1335
             KP+N ++D + RVLP +   + +YGKN F+W GP P + I++PEL++E+   + +++  +
Sbjct  71    KPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREILSKSYIYQEIQ  130

Query  1334  PHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTS  1155
              +P+ K L  GL  YE ++WA+HRKII+PAF+ DK+K M PS   SC +M ++KWE + S
Sbjct  131   GNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDM-LRKWESIAS  189

Query  1154  EKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWW  975
              +   + DV P+LE  TSD ISRTAFG +Y +G ++F LQ EQAEL  Q    +Y P W 
Sbjct  190   SEG-SEIDVWPFLETLTSDAISRTAFGSNYEDGRQIFELQKEQAELILQAARWLYIPGWR  248

Query  974   LLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-------  816
              + +KR++RM +I  E+R L+ G+I KR R MK      D+    LL    K        
Sbjct  249   FVPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHGNK  308

Query  815   --GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDF  642
               G + DEVIEEC+ FYFAGQE+TS  LVW +ILLS H  WQ+RAR+EV QVFG NKPD+
Sbjct  309   NFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVHQVFGSNKPDY  368

Query  641   DGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDV  462
             D LN+LK++TMI NEVLRLYPP     RT++E+TKLG + LP  I L+L ++ +  D ++
Sbjct  369   DALNQLKVVTMIFNEVLRLYPPGITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHDNEI  428

Query  461   WGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSF  282
             WG DA EFKPERF+EGV KATK + A+ PF WGPR C+G NFAM+EAK+A+A ILQ ++F
Sbjct  429   WGDDAKEFKPERFSEGVNKATKGKFAYFPFSWGPRICVGLNFAMLEAKMALALILQHYAF  488

Query  281   HLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              LSPSYAH+P  ++TL+PQ GAPL+L K+
Sbjct  489   ELSPSYAHAPHTIITLQPQHGAPLILRKL  517



>ref|XP_004294189.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=518

 Score =   513 bits (1322),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 269/515 (52%), Positives = 357/515 (69%), Gaps = 14/515 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             SWV++  +F+S+   V WA  ++ W+ LKP+KLE+ LR+QGL G SYR  YGD KE + L
Sbjct  7     SWVALSLVFVSI--TVRWAWSMLDWLRLKPKKLERCLREQGLQGKSYRFLYGDLKENSIL  64

Query  1532  TAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
               +A+SKP+ LS   DI PR++PF    +  YGKN FVW+GP PRV I  PE M++VF  
Sbjct  65    LNQARSKPMKLSASHDIAPRLIPFLDQTIKNYGKNSFVWNGPVPRVTIMNPEDMKDVFTK  124

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                F+RP P+PL+K L +G+A YE ++WA+HRKII+P F+ +K+K M P+   SC+EMI 
Sbjct  125   LDDFRRPPPNPLLKLLTTGVASYEGEKWAKHRKIINPTFHVEKLKIMLPAFHKSCDEMI-  183

Query  1178  KKWELLTS-EKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVI  1002
             K+WE L S E + C  DV P L+  T+DVISRTAFG SY EG K+F L  EQA L    +
Sbjct  184   KEWESLASKEGSSCQLDVWPSLQHLTADVISRTAFGSSYQEGRKIFELLKEQAMLVISSL  243

Query  1001  HSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl-  825
              SVY P W  L +K++ RM +ID E++GL+KG+I +RE+ ++      D+    L+    
Sbjct  244   QSVYIPGWRFLPTKKNNRMKKIDKEVKGLLKGIISEREKTIEAGEATKDDLLGALMESKF  303

Query  824   ------LKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                    K G S+D+VIEEC+ FYFAGQE+TS  LVW MILL  +Q WQDR RQEV QVF
Sbjct  304   KDTQGDGKGGMSSDDVIEECKLFYFAGQETTSVLLVWTMILLGQNQNWQDRERQEVLQVF  363

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G NKPDFDGL  LK++TM+L EVLRLYP      RT   ET+LG++ LP  + + L +LL
Sbjct  364   GSNKPDFDGLTHLKVVTMVLLEVLRLYPALVLVTRTTGRETQLGKLSLPAGVQVSLPTLL  423

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             + RD ++WG DA EF PERF+EGV+KATK+ ++F PFG GPR CIG NFAM+EAK+A++ 
Sbjct  424   IHRDKELWGDDANEFNPERFSEGVSKATKSPISFFPFGGGPRICIGQNFAMLEAKLALSL  483

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             ILQ F F LSPSYAH+P   + ++PQ+GAP++L K
Sbjct  484   ILQHFHFELSPSYAHAPSSPM-IRPQYGAPIILQK  517



>ref|XP_010064522.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67638.1| hypothetical protein EUGRSUZ_F01383 [Eucalyptus grandis]
Length=510

 Score =   513 bits (1321),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 253/499 (51%), Positives = 343/499 (69%), Gaps = 5/499 (1%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             ++V   + W   VV W WL+P+++E  LRQQGL+G  +   +GD KE++ L  +AKSKP 
Sbjct  14    LAVLTTLAWM--VVNWAWLRPKRIEGLLRQQGLSGRPHTFLFGDLKEISRLMREAKSKPF  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHP  1326
              LSDDI PR+LP  H +   YGKN F+W GP P V I+ PEL++E+F     +++P   P
Sbjct  72    GLSDDIKPRLLPLVHQSFQTYGKNSFMWIGPTPTVNITNPELLKEIFSKMYDYRKPPRSP  131

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN  1146
             L+K L  GLA +E ++W +HRKII+PAF+ +K+K   P+  SSC EM+  +WE L SE  
Sbjct  132   LLKLLFGGLAFHEGKKWVQHRKIINPAFHVEKLKLTLPAFYSSCTEMV-GRWEYLVSEVR  190

Query  1145  WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLS  966
              C+ D    L+  + D+ISRTAFG  Y EG ++F LQ E A LT + + SVY P W  L 
Sbjct  191   SCEVDAWVDLQNLSRDLISRTAFGSRYAEGKRIFELQEELALLTMKALQSVYIPGWRFLP  250

Query  965   SKRSRRMHEIDNEIRGLMKGLIGKRERGMK--EKvgdddeenldllgvlLKSGFSTDEVI  792
             ++ +RRM  ID E++ L+  +I +RE+ ++  E  GDD    L    +   +G S  +V 
Sbjct  251   TRMNRRMKNIDKEVQALLMDIIRRREKAIRGGEAAGDDLLGLLLESNMKENAGMSFHDVT  310

Query  791   EECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILT  612
             EEC+ FY AGQE+TS  LVW M+LLS+H  WQ RAR+EV Q FG  KPDF  L+ LKI+T
Sbjct  311   EECKFFYVAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSRKPDFGELSHLKIVT  370

Query  611   MILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKP  432
             MILNEVLRLYPP     R +++ETKLG++ LP  + + + +LL+ RD D+WG DA EFKP
Sbjct  371   MILNEVLRLYPPVITLAREVHKETKLGKLTLPTGVQVSMPTLLIHRDKDLWGEDAEEFKP  430

Query  431   ERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSP  252
             ERFAEGV++ATKN+++F PFGWGPRTC+G NFAM+EAKIA+A ILQ+FSF LSP Y H+P
Sbjct  431   ERFAEGVSEATKNQVSFFPFGWGPRTCVGQNFAMLEAKIALAMILQQFSFELSPFYVHAP  490

Query  251   CFVVTLKPQFGAPLVLHKI  195
             C V+TL+PQ G  ++LHK+
Sbjct  491   CNVLTLQPQHGVQVILHKV  509



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   512 bits (1319),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 256/521 (49%), Positives = 359/521 (69%), Gaps = 16/521 (3%)
 Frame = -2

Query  1727  MDRIQSWVSILF-LFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDT  1551
             M+ + S V+++F +F+SV A   W  R + WVWL+PRK+EK LR+QG NGNSYR   GD+
Sbjct  1     MEILYSLVAVIFGVFVSVNA---W--RFLNWVWLEPRKVEKRLREQGFNGNSYRFLVGDS  55

Query  1550  KEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             KEM+++  +A+SKPIN S+DI+ RV+PF H ++ KYG+NCF+W GP P  +IS+PE+++E
Sbjct  56    KEMSSMGEEAQSKPINFSNDIVHRVMPFIHHSLHKYGENCFIWFGPKPAALISDPEMIKE  115

Query  1370  VFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCE  1191
             +   N +F++   +PL + L  G+A YE  +W +HR++I+PAF+ +K+K M PS   SC 
Sbjct  116   IMSKNYVFQKIS-NPLDQLLAKGVAAYEADKWDKHRRLINPAFHLEKLKHMVPSFYLSCA  174

Query  1190  EMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTR  1011
             +M+ K  E + +++  C+ DV PYL++ +SDVISRTAFG +Y EG K+F LQ EQ E   
Sbjct  175   DMLSKWDEKIVAKEGSCEVDVWPYLQSMSSDVISRTAFGSNYEEGRKIFELQREQEEHLL  234

Query  1010  QVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdd--------d  855
             Q + ++Y P W  L +KR+RRM EI  E+   + G+I KR + ++    +         +
Sbjct  235   QALQTLYIPGWRFLPTKRNRRMKEIVKEVESTILGIIKKRMQMIEAGESNSDDLLGILLE  294

Query  854   eenldllgvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
                 ++     +SG S  EVI+EC+ FY AGQE+TS  + W MILLS H  WQ RAR EV
Sbjct  295   SNFREIQQNGTQSGMSMKEVIDECKLFYIAGQETTSSLITWTMILLSKHSGWQARARDEV  354

Query  674   QQVFG-HNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiili  498
              QV G   KPDF  LNRLKI+ MI +EV+RLYPP+    R +++ET LG + LP  + L+
Sbjct  355   LQVLGTAGKPDFQHLNRLKIVNMIFHEVMRLYPPAVMLGRAIHKETPLGNVTLPAGLQLL  414

Query  497   lsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAK  318
             L ++ V  DP +WG DA EFKPERF++GVAKAT  + ++ PFG GPR CIG NFAM+EAK
Sbjct  415   LPTVAVHHDPKIWGDDAKEFKPERFSDGVAKATNVQFSYFPFGGGPRICIGQNFAMLEAK  474

Query  317   IAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +A+A ILQR+SF LSPSYAH+P  +VTL+PQFGA L+L K+
Sbjct  475   MALAMILQRYSFELSPSYAHAPNMIVTLQPQFGAHLILRKL  515



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   512 bits (1319),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 250/510 (49%), Positives = 351/510 (69%), Gaps = 15/510 (3%)
 Frame = -2

Query  1685  ISVPAVVI---WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKS  1515
             IS+  V+I   W  + + WVW+ P+K+EK L+ +G  G+SY+   GD KEM ++  +AKS
Sbjct  10    ISLVIVIIFLRWIWKFLDWVWIHPKKMEKRLKLEGFKGSSYKFLLGDMKEMNSMVEEAKS  69

Query  1514  KPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPK  1335
             KPIN ++D + RV P ++  + +YGKNC++W GP P ++ISEPE ++E+   + ++++ +
Sbjct  70    KPINFTNDYISRVFPHFNKFMMQYGKNCYIWLGPKPTMLISEPEFIREILSKSYIYQKIQ  129

Query  1334  PHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTS  1155
              +P+ K L  GLA YE ++WA+HR+II+PAF+ DK+K M PS   SC +MI  KW+ + S
Sbjct  130   GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMI-NKWDNIVS  188

Query  1154  EKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWW  975
              K   + DV P+L+  TSD ISRTAFG +Y EG ++F LQ EQA+L  Q    +Y P W 
Sbjct  189   SKG-SEVDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAARWIYIPGWR  247

Query  974   LLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-------  816
              + +KR++R+ +I NE+R L+ G+I  R + MKE     D+    LL    K        
Sbjct  248   FVPTKRNKRIKQIANEVRSLVLGIINNRIKEMKEGEATKDDLLGILLESNFKEIQIHHEN  307

Query  815   ---GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
                G + DEVIEEC+ FYFAGQE+TS  LVW +ILLS H  WQ+RARQEV QVFG NKPD
Sbjct  308   KNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHLDWQERARQEVHQVFGSNKPD  367

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
             +D LN+LK++TMI NEVLRLYPP     R + +ETKLG + LP  ++L+L ++ +Q D +
Sbjct  368   YDMLNQLKVVTMIFNEVLRLYPPGAMIGRRVQKETKLGNLSLPAGMLLLLPTIYLQHDNE  427

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG DA EF P+RF+EGV KATK + A+ PF WGPR CIG NFAM+EAK+A+A ILQ ++
Sbjct  428   IWGDDAKEFNPKRFSEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAKMALAMILQHYA  487

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
               LSPSY+H+P  ++TL+PQ GAPL+L K+
Sbjct  488   LELSPSYSHAPHTIITLQPQHGAPLILRKL  517



>ref|XP_009339349.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=532

 Score =   512 bits (1319),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 256/498 (51%), Positives = 343/498 (69%), Gaps = 11/498 (2%)
 Frame = -2

Query  1658  ACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPR  1479
             A RV+ WVWL+P+KLEK LRQQGL GNSYR++ GD KE++ +  +A SKP+N S D  PR
Sbjct  36    AWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNHSHDTAPR  95

Query  1478  VLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGL  1299
             VLP+ H +V+ YGKN F+W GP PRV I+ PE ++ +F  +  F +   +PLVK L++GL
Sbjct  96    VLPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKLTANPLVKLLLTGL  155

Query  1298  ACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPY  1119
             A Y  ++WA+HRKII+PAF+ +K+K M P++  SC EMI ++WE L S+++  + DV PY
Sbjct  156   ANYGGEKWAKHRKIINPAFHSEKLKRMLPAIYQSCSEMI-EEWESLVSKESSYELDVWPY  214

Query  1118  LEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHE  939
             L+  T+DVISRT+FG SY EG ++F L   Q ELT +   SVY P W  L +K ++R+  
Sbjct  215   LQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTMKTKQSVYIPGWRFLPTKMNKRLKG  274

Query  938   IDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVIE  789
             +D EIR L+ G+I KRE  +K      D+    LL    K           G S  +++ 
Sbjct  275   VDKEIRELLMGIINKREEAIKAGEAAKDDLLGLLLESNNKEIKEHGNKKEVGMSIQDILG  334

Query  788   ECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTM  609
             EC+ FYFAGQE+TS  LVW M+LLS +Q WQDRAR+EV QVFG  KPD DGLN LK++T 
Sbjct  335   ECKLFYFAGQETTSTLLVWTMVLLSENQNWQDRAREEVLQVFGGEKPDVDGLNHLKVVTT  394

Query  608   ILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPE  429
             IL E LRLYP      R ++++T+  E  LP  + + L ++L+  D ++WG DA +FKP 
Sbjct  395   ILLEALRLYPSIVTLSRMIHKKTQFTEFSLPAGVEISLPTVLIHHDKELWGDDATQFKPM  454

Query  428   RFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             RFAEGV+KATKN+L + PFG G R CIG NFAMMEAK+A+A ILQ F+F LSPSYAH+P 
Sbjct  455   RFAEGVSKATKNKLTYFPFGGGARICIGQNFAMMEAKLAVALILQHFTFKLSPSYAHAPS  514

Query  248   FVVTLKPQFGAPLVLHKI  195
              + TL+PQFGA +VLHK+
Sbjct  515   GITTLQPQFGAHIVLHKL  532



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   511 bits (1317),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 263/501 (52%), Positives = 348/501 (69%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             +IWA R++ W+WLKP+KLEK LR+QGL GNSYR+  GD K++  +  +A +KP+NLSDDI
Sbjct  17    LIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDIKDLLKIRKEATTKPMNLSDDI  76

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLV  1308
             +PRV  F H +VTK+GKN F+W GP PRV I++P+ +++V      F++P  +PLV+ L 
Sbjct  77    VPRVYSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLA  136

Query  1307  SGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDV  1128
             +GL   E +QW++HRKII+PAF+ +K+K M P    SC++MI  KWE + S    C+ DV
Sbjct  137   NGLVSLEGEQWSKHRKIINPAFHLEKLKIMLPIFHKSCDDMI-SKWEKMLSSDGSCEMDV  195

Query  1127  QPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRR  948
              P+L+ F SDVISR AFG SY EG ++F LQ EQAELT +++  VY P W  L +   RR
Sbjct  196   WPFLQNFASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRR  255

Query  947   MHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDE  798
             M EID +I+  +  +I  RER +K      D+    LL    K           G S D+
Sbjct  256   MKEIDRDIKASLTDMINNRERALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDD  315

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG+NKPDFDGL+ LKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKI  375

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R ++++ KLG + LP  + + LS ++V  D ++WG DA  F
Sbjct  376   VTMILYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVF  435

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERF+EGV KAT  R +F PF  GPR CIG NF+M+EAK+AIA ILQRFSF LSPSYAH
Sbjct  436   NPERFSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAH  495

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  V+TL+PQ+GA ++LHK+
Sbjct  496   APATVITLQPQYGAHIILHKL  516



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   511 bits (1315),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 255/517 (49%), Positives = 347/517 (67%), Gaps = 15/517 (3%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             I  + S + L ISV      A R  +W WL P+KLEK L++QGL GN Y++ YGD KE+A
Sbjct  8     IAVFSSCILLLISV-----LAWRAFKWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKEIA  62

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
             T   +A SKPIN+S+D +PRV+P +  AV KYG+N ++W GP P V+I  PE ++E+   
Sbjct  63    THFKEAHSKPINVSEDFIPRVIPHFCAAVKKYGENTYIWHGPKPMVLILNPEHIREITTK  122

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
               +F++   +PL K L +GL  Y+  +WA+HRK+I+PAF+ +K+K M PS  +S  EM +
Sbjct  123   LYIFQKAPANPLTKLLATGLVSYDGDKWAKHRKLITPAFHVEKLKHMVPSFYASASEM-L  181

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              KWE + S    C+ DV P ++  TSD ISRTAFG +Y EG ++F LQ EQAE   + + 
Sbjct  182   DKWEAIVSTNGSCELDVWPDIQTLTSDAISRTAFGSNYQEGKRIFELQREQAEHFLKAVE  241

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  L +K +RRM +I  +++  ++ +I  R + MKE     D+    LL    K
Sbjct  242   SVYIPGWRFLPTKLNRRMKQIAKDVQESIREIINARLKAMKEGEACADDLLGILLESNSK  301

Query  818   S---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
                       G +  +VIEEC+ FYFAGQE+TS  LVW M+LLS H  WQ RAR+EV Q 
Sbjct  302   EIDDHGNKDFGMTIGDVIEECKLFYFAGQETTSVMLVWTMVLLSRHPNWQARAREEVLQH  361

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG+NKPDF GLN LK++TMIL+EVLRLYPP P   R   E+ +LG + LP  + + L ++
Sbjct  362   FGNNKPDFKGLNHLKLVTMILHEVLRLYPPVPAIPRRTDEDIQLGNLTLPAQVQVSLPAI  421

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
             L+  DP++WG D  EFKPERFA+GV+ ATK + A+ PFGWGPR CIG NFAM+EAK+A+A
Sbjct  422   LLHYDPEIWGDDVEEFKPERFADGVSNATKGQTAYFPFGWGPRICIGQNFAMLEAKLAVA  481

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              +LQRFSF LSPSY H+P  V+T++PQ+GA L+LHK+
Sbjct  482   MLLQRFSFELSPSYTHAPRAVITIQPQYGARLILHKL  518



>ref|XP_010275170.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   510 bits (1314),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 254/514 (49%), Positives = 356/514 (69%), Gaps = 13/514 (3%)
 Frame = -2

Query  1700  ILFLFISVPAVVI-WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             ++ + ++ P +++ W   VV  +W KP KLE+ LR+QGL G  +R+  G+ K+   +  +
Sbjct  5     LIVVILAFPVLILSWIWSVVYSIWWKPMKLERNLREQGLKGPPHRLLSGNLKDELRMRKE  64

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLF  1347
             A S+P+NLS +I+PRV+PF H  +  YGK    W G  PRV I  PEL++++  N    F
Sbjct  65    AWSRPMNLSHNIVPRVVPFTHQTIKTYGKMSVTWFGRTPRVNIMHPELIKDILSNKFGHF  124

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++PK + L+K L +GLA YE ++WA+HR+II+PAF+ +K+K M P+  +SC E I + WE
Sbjct  125   EKPKLNQLIKLLANGLANYEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCSETITR-WE  183

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              L + K  C+ DV P  +  T DVISRTAFG SY EG ++F LQNEQA+L  Q   S+Y 
Sbjct  184   KLVALKGCCELDVWPEFQNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKLVVQAALSIYI  243

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P + LL +KR+ RM EID E+RGL++G+I KRE+ +K      ++    LL    K    
Sbjct  244   PGYSLLPTKRNNRMKEIDREVRGLLRGIINKREKAIKLGEASQNDLLGLLLESNFKEIQE  303

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G + D+VIEEC+ FYFAGQE+T++ LVW M++LS+H  WQ R+R+EV Q FG 
Sbjct  304   HDNAKNLGMNIDDVIEECKLFYFAGQETTANLLVWTMVVLSMHPEWQIRSREEVLQAFGK  363

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             +KPDFDGLN LK++TMIL EVLRLYPP+    R  Y++ KLG + LPP + L+L ++L+ 
Sbjct  364   DKPDFDGLNHLKVVTMILYEVLRLYPPAVILTRHTYKKIKLGGIYLPPGVELLLPTILIH  423

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
                ++WG DA EFKPERF+ GV+KATKN+++F PFGWGPR CIG NFAM EAK+A+A IL
Sbjct  424   HSRELWGEDAQEFKPERFSSGVSKATKNQVSFFPFGWGPRICIGQNFAMTEAKMALALIL  483

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             Q+FSF LSPSYAH+P  ++TL+PQ+GA ++LHK+
Sbjct  484   QQFSFELSPSYAHAPYTIITLQPQYGAQIILHKL  517



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   510 bits (1314),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 262/501 (52%), Positives = 347/501 (69%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             +IWA R++ W+WLKP+KLEK LR+QGL GNSYR+  GD  ++  +  +A SKP+NLSDDI
Sbjct  17    LIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDMNDLLKMRKEATSKPMNLSDDI  76

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLV  1308
             +PRV  F H +VTK+GKN F+W GP PRV I++P+ +++V      F++P  +PLV+ L 
Sbjct  77    VPRVYSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLA  136

Query  1307  SGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDV  1128
             +GL   E +QW++HRKII+PAF+ +K+K M P    SC+++I  KWE + S    C+ DV
Sbjct  137   NGLVSLEGEQWSKHRKIINPAFHLEKLKIMLPIFHKSCDDLI-SKWEKMLSSDGSCEMDV  195

Query  1127  QPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRR  948
              P+L+ F SDVISR AFG SY EG ++F LQ EQAELT +++  VY P W  L +   RR
Sbjct  196   WPFLQNFASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRR  255

Query  947   MHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDE  798
             M EID +I+  +  +I  RER +K      D+    LL    K           G S D+
Sbjct  256   MKEIDRDIKASLTDMINNRERALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDD  315

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG+NKPDFDGL+ LKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKI  375

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R ++++ KLG + LP  + + LS ++V  D ++WG DA  F
Sbjct  376   VTMILYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVF  435

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERF+EGV KAT  R +F PF  GPR CIG NF+M+EAK+AIA ILQRFSF LSPSYAH
Sbjct  436   NPERFSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAH  495

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  V+TL+PQ+GA ++LHK+
Sbjct  496   APATVITLQPQYGAHIILHKL  516



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score =   510 bits (1314),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 253/513 (49%), Positives = 345/513 (67%), Gaps = 14/513 (3%)
 Frame = -2

Query  1700  ILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKA  1521
             I F+F+       W  R + W+WL P+KLEK LR+QG  GN YR++ GD  ++  +  +A
Sbjct  8     IWFVFMVCLLRCGW--RFLNWIWLTPKKLEKCLREQGFAGNPYRLYSGDLNDVVAMEEEA  65

Query  1520  KSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR  1341
             KSKP+N S DI+PRV+P  H  + KYGKN F+W GP PRV+I +PE ++        F++
Sbjct  66    KSKPMNFSHDIVPRVIPSMHHTIKKYGKNSFMWLGPNPRVLIMDPEQLKAALSLYNDFQK  125

Query  1340  PKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
             P  +PLV+ L  GL  +E ++W +HRKII+ AF+ +K+K M P++  SC EMI  KWE +
Sbjct  126   PTTNPLVRLLFDGLINHEGEKWVKHRKIINHAFHFEKLKDMVPTMFESCNEMI-SKWEKM  184

Query  1160  TSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPE  981
             TS+   C+ DV PYL++ T+DVISRTAFG +Y EG  +F+   E   L  Q  ++VY P 
Sbjct  185   TSKDGSCELDVVPYLQSLTADVISRTAFGSTYEEGKIIFNHFKELIRLVLQASNTVYLPG  244

Query  980   WWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-----  816
             W  L +K + RM +I  EI+ ++  +I KR+R MKE      ++ L +L     +     
Sbjct  245   WRFLPTKSNNRMKKITKEIKTILMNIIDKRQRTMKEDETMHSDDLLGILLESNSNEIKEH  304

Query  815   -----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNK  651
                  G S +++IEEC+ FYFAGQE+T+  LVW M+LL  +  WQDRAR EV QVFG++K
Sbjct  305   GNVNIGMSINDLIEECKIFYFAGQETTAVLLVWTMVLLGSYTKWQDRARAEVLQVFGNDK  364

Query  650   PDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMY-EETKLGEMKLPPNiililsslLVQR  474
             PDFDGLNRLKI+TMILNEVLRLYPP     R +  +ET+LG +K    + L    +L+ R
Sbjct  365   PDFDGLNRLKIVTMILNEVLRLYPPGSAVSRNLVKKETRLGNLKFSSGVTLSFPIILIHR  424

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             D ++WG DA EF PERFAEGV+KATKN+ AF PFGWGPR C+G NFAM+EAKIA++ ILQ
Sbjct  425   DKELWGEDADEFNPERFAEGVSKATKNQTAFFPFGWGPRICVGQNFAMIEAKIALSIILQ  484

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              FSF LSPSY H+P  ++T++PQ GA ++LHK+
Sbjct  485   HFSFELSPSYTHAPISILTIQPQHGAHIILHKL  517



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   510 bits (1313),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 256/505 (51%), Positives = 348/505 (69%), Gaps = 10/505 (2%)
 Frame = -2

Query  1682  SVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN  1503
             S   +++ A RV+ W WL+P+KLEK L++QGL GN YR+ YGD KE++TL  +A+SKPIN
Sbjct  13    SCAVILVLAWRVLNWAWLRPKKLEKQLKEQGLKGNPYRLLYGDFKEISTLIREAQSKPIN  72

Query  1502  LSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPL  1323
             LSDDILPR+LP +  A+ KYGK+ +VW GP P V I EPEL++EV     LF++P+ +PL
Sbjct  73    LSDDILPRILPAFPDALKKYGKSTYVWLGPTPMVYILEPELIREVMQKIYLFQKPRLNPL  132

Query  1322  VKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW  1143
                L+ GL  Y+  +WA+ RK+I+PAF+ +K+K M PS  +S  + I+ KW+ + +    
Sbjct  133   SLLLIEGLVNYDGDKWAKQRKLINPAFHVEKLKHMLPSFYTSASD-ILNKWKEVVAPNGS  191

Query  1142  CDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSS  963
              + DV P LE  TSD ISRTAFG +Y EG ++F LQ EQ+E   +V+ SV  P W  + +
Sbjct  192   SELDVWPDLETLTSDAISRTAFGSNYEEGRRIFELQREQSEYWLKVVQSVDIPGWRFVPT  251

Query  962   KRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---------SGF  810
             KR+RRM +I   ++  +  +I  R + ++E     D+    LL    K         +G 
Sbjct  252   KRNRRMKQIAKAVQDTILEIINSRIKAVREGKAYGDDLLGILLESNFKEINNHGQDGAGM  311

Query  809   STDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLN  630
             +  EVIEEC+ FYFAGQE+TS  LVW MILLS +  WQ RAR+EV Q+FG  KPDFDGLN
Sbjct  312   TIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPDWQARAREEVLQLFGTRKPDFDGLN  371

Query  629   RLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGAD  450
             RL ++TMIL+EVLRLY P P   R + EETKLG M+LP +++L L  +++  D ++WG D
Sbjct  372   RLNLVTMILHEVLRLYAPVPALSRRVAEETKLGSMRLPADVLLSLPVMVLHHDTEIWGDD  431

Query  449   AGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSP  270
             A EFKPERFAEGV  ATK ++AF PFGWGPR CIG +FAM+EAK+ +  IL+ FSF LSP
Sbjct  432   AKEFKPERFAEGVPHATKGQVAFFPFGWGPRVCIGQHFAMLEAKLVLVMILRSFSFELSP  491

Query  269   SYAHSPCFVVTLKPQFGAPLVLHKI  195
             SY+H+P  ++TL+PQ GA L+LHK+
Sbjct  492   SYSHAPRAIITLQPQHGAHLILHKL  516



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   509 bits (1312),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 251/516 (49%), Positives = 344/516 (67%), Gaps = 8/516 (2%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             M    S++ +L     V +V+ W  +V+ WVW KPRKLEK L+QQG  GN Y++FYGD K
Sbjct  1     MKTTHSFMIVLVSSCLVLSVLAW--KVLSWVWFKPRKLEKHLKQQGFKGNPYKLFYGDFK  58

Query  1547  EMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEV  1368
             E+ TL  +A SKPI+LSDDI+PRV+P +   V KYGKN ++W GP P ++I +PEL ++V
Sbjct  59    EIGTLFQEAYSKPISLSDDIVPRVIPHFLGTVNKYGKNAYLWFGPKPTMLIMDPELTRKV  118

Query  1367  FMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEE  1188
                  +F++P+ HPL K L  G   YE  +WA+HRK+++ AF+ +K+K M P+  +S  E
Sbjct  119   TQKMEIFQKPQFHPLSKLLAQGTLVYEGDKWAKHRKLLNQAFHMEKLKLMVPAFYTSASE  178

Query  1187  MIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQ  1008
             M + KWE   S K   + DV P+L+  T D ISRTAFG  Y +G ++F LQ EQA+   +
Sbjct  179   M-LSKWEEGISAKGSIELDVWPHLQTMTGDAISRTAFGSKYEKGRRIFELQTEQAQHLVK  237

Query  1007  VIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMK-----EKvgdddeenl  843
              + S+Y P    L +KR+RRM +I  E+   +  +I  R   ++     +          
Sbjct  238   AVQSMYIPGLRFLPTKRNRRMKQIATEVNDSIGEIIRTRLNALRTGEASDDDMLSLLLES  297

Query  842   dllgvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                    + G +T E++EEC+ FYFAGQE+T+  LVW MILLS++  WQ+ AR+EV Q F
Sbjct  298   SSQETDKEFGMTTKEIVEECKLFYFAGQETTAVLLVWTMILLSMYPDWQEHAREEVLQHF  357

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G N PDFDGLNRL+I+TMIL+EVLRLYPP P   +T+ EETKLG +  P   +L + ++L
Sbjct  358   GTNIPDFDGLNRLRIVTMILHEVLRLYPPFPILGQTVAEETKLGNLTFPSGQLLTVPTIL  417

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  DP++WG D  EFKPERFA+GV+ ATK ++ F PFGWGPR CIG NFAM+EAK+ +A 
Sbjct  418   LHHDPEIWGEDVKEFKPERFADGVSHATKGQVVFFPFGWGPRICIGQNFAMLEAKLVLAM  477

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              LQRFSF LSPSY+H+P   VTL+PQFGA L+LHK+
Sbjct  478   ALQRFSFELSPSYSHAPYSAVTLQPQFGAHLILHKM  513



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   509 bits (1312),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 249/501 (50%), Positives = 337/501 (67%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             V WA R++ W+WL+P+KLE+ LR+QGL GN YR+  GD K++  +  +AKSKP+NLSDDI
Sbjct  21    VTWAWRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKSKPMNLSDDI  80

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLV  1308
             LPRV P+   +VTK+GKN F+W GP PRV +++PE +++V      F +     LVK L 
Sbjct  81    LPRVFPYVQQSVTKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFPKSDGDRLVKLLA  140

Query  1307  SGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDV  1128
             +GL  YE ++W++HR+II+PAF  +K+K M P    SC ++I  KWE + S    C+ D+
Sbjct  141   TGLVSYEGEKWSKHRRIINPAFNLEKLKIMLPIFFQSCNDLI-TKWEGMLSSDGSCEMDI  199

Query  1127  QPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRR  948
              P+L+   SDVI+R AFG SY EG ++F LQ EQ E T  V+  VY P W  L +   RR
Sbjct  200   WPFLQNLASDVIARAAFGSSYEEGRRIFQLQKEQVEHTMSVLVKVYIPGWRFLPTTTHRR  259

Query  947   MHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDE  798
             M +ID EI+  +K +I KRER +K      +     LL    K           G S ++
Sbjct  260   MKKIDREIKASLKEMINKRERALKAGEATKNNLLDILLESNHKEVEEHGNNRNVGMSLED  319

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG+ KPDFDGL+ LKI
Sbjct  320   VIEECKLFYFAGQETTSGLLVWTMVLLSRYPDWQARAREEVLQVFGNKKPDFDGLSHLKI  379

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     RT++++ KLG   LP  + L L  +L   D ++WG DA  F
Sbjct  380   VTMILYEVLRLYPPVIALARTVHKDVKLGNRTLPAGVQLYLPIVLFHHDRELWGDDAEVF  439

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERF+EGV KAT  +++F PFGWGPR C+G NF+++EAK+A++ ILQ FSF LSP+YAH
Sbjct  440   NPERFSEGVLKATNGKVSFFPFGWGPRICVGQNFSLLEAKMAVSMILQHFSFELSPAYAH  499

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  V+TL+PQ+GA ++L K+
Sbjct  500   APTTVITLRPQYGAHIILRKV  520



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   509 bits (1311),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 249/514 (48%), Positives = 348/514 (68%), Gaps = 13/514 (3%)
 Frame = -2

Query  1700  ILFLFISVPAVVIWAC--RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             I+ +F    A+ ++ C  +V+ WVW +P+KLEK LR+QGLNGNSYR  YGD K+ + +  
Sbjct  2     IVTIFCCAIAITLFVCLWKVLNWVWFQPKKLEKLLRKQGLNGNSYRFLYGDMKDFSKMIK  61

Query  1526  KAKSKPINLSD-DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTL  1350
             +A SKP+N+ D D+ PR++PF+   + KYGK CF W GP P+++I +PEL++EV     +
Sbjct  62    EANSKPMNMDDHDLAPRMVPFFLETIKKYGKKCFTWMGPRPQILIMDPELIKEVLSKTYV  121

Query  1349  FKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKW  1170
             +++P  +PL    V GL  YE  +WA+HRKII+PAF+ +K+K M P+   SC EM + KW
Sbjct  122   YQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEM-LSKW  180

Query  1169  ELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVY  990
             E +   +   + DV P+L+  T DVISRTAFG SY EG K+F LQ EQA+   +VI SVY
Sbjct  181   EDVVRVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQHFLEVIRSVY  240

Query  989   SPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--  816
              P W  L +KR+RRM E+ N++R  ++G+I KR + M+    D+++    LL    K   
Sbjct  241   IPGWRFLPTKRNRRMKELKNDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIE  300

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S +EVIEEC+ FYFAG E+TS +++W ++LLS H  WQ+RAR+EV QV G 
Sbjct  301   LHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRHPDWQERAREEVLQVLGS  360

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
              KPDFDGLN LK++TMIL E LRLY P     R +YE+  LGE+ LP  +++ L  +L+ 
Sbjct  361   RKPDFDGLNHLKVVTMILYESLRLYSPITVLTRRVYEDITLGEVSLPTGVLVSLPMILLH  420

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D D+WG DA +F PERF+EG++ ATK ++ + PF WGPR CIG NFA++EAK+ +  IL
Sbjct  421   HDKDIWGEDATKFNPERFSEGISSATKGQVTYFPFAWGPRICIGQNFAILEAKMTLCMIL  480

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             Q FSF LSPSY H+P  +VT +PQ+GAPL+ HK+
Sbjct  481   QSFSFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  514



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   509 bits (1311),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 254/501 (51%), Positives = 343/501 (68%), Gaps = 12/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             ++ WA +++ WVW KP++LEK LRQQG  GNSYR  +GD  EM  +  +A SKPI+ S +
Sbjct  20    ILKWAWKILNWVWFKPKELEKCLRQQGFKGNSYRFLFGDVNEMMKMGKEALSKPIDFSHN  79

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PRV+PF+H  +T YGKNC  W GP P ++I +PEL++EV   N +F++P   PL K  
Sbjct  80    IWPRVMPFFHKTITTYGKNCLAWYGPRPAIVIVDPELIREVLTKNYIFQKPPGTPLTKLA  139

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
              +GLA YE  +WA+HR++I+PAF+ DK+K M P+   +  EM + KWE + S     + D
Sbjct  140   ANGLAGYEADKWAKHRRLINPAFHLDKLKHMLPAFLLTASEM-LSKWEKVVSTGG-SEID  197

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V PYL+  TSD ISRTAFG SY EG K+F LQ EQ EL  Q+  S+Y P W  + +K +R
Sbjct  198   VWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQMELLLQIARSLYIPGWRFIPTKTNR  257

Query  950   RMHEIDNEIRGLMKGLIGKR----ERG-----MKEKvgdddeenldllgvlLKSGFSTDE  798
             RM +I NE+R L+ G+I KR    E G     +   +   + + +   G   K G S DE
Sbjct  258   RMKQIFNEVRVLILGIIKKRMSMIENGEAPDDLLGTLLASNLKEIQQHGNNKKFGMSIDE  317

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FY AGQE+TS  LVW MILL  +  WQ++AR+EV QVFG++  D+D LN+LKI
Sbjct  318   VIEECKLFYLAGQETTSALLVWTMILLCKYPIWQEQAREEVLQVFGNDDLDYDKLNQLKI  377

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMILNEV+RLYP   +  R + +ETKLG + LP  + L+L+++L+  D ++WG DA EF
Sbjct  378   VTMILNEVMRLYPSGYFINRMVIKETKLGNLYLPAGVQLLLATILLHHDTEIWGDDAMEF  437

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERF+EGVAKATK +L F PF WGPR CIG NFAM+EAK+ IA IL+ ++F LSPSYAH
Sbjct  438   NPERFSEGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMTIAMILKHYAFELSPSYAH  497

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P   + L+PQ+GA L+LHK+
Sbjct  498   AP-HPLLLQPQYGAHLILHKL  517



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   509 bits (1311),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 252/522 (48%), Positives = 347/522 (66%), Gaps = 11/522 (2%)
 Frame = -2

Query  1730  TMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDT  1551
              +D I + + ++  F+ +  ++I   ++V W+W +P+KLEK LR+QG  GNSYR+ +GD 
Sbjct  4     VVDTISNRIVMIISFVLLLVLLILGWKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDL  63

Query  1550  KEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             KE A +  +A SKP+N S+ I PRV+P  +  +  YGKN F+W GP PRV I +PE ++ 
Sbjct  64    KESAAMRKEAMSKPMNFSNHIAPRVIPSVYHTIQIYGKNSFMWLGPMPRVHIMDPEQIKT  123

Query  1370  VFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCE  1191
             VF     F++P  +PL + LV G+A  E ++WA+HRKII+PAF+ +K+K M P+   SC 
Sbjct  124   VFSFINDFQKPTMNPLTRLLVQGIANLEGEKWAKHRKIINPAFHLEKLKDMVPAFYHSCN  183

Query  1190  EMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTR  1011
             EM+  KWE + S +  C+ DV P L+   SDVISRTAFG SY +G K+F LQ E   L  
Sbjct  184   EMV-SKWESMVSREGSCELDVMPCLKNMASDVISRTAFGSSYEKGXKIFKLQTELGNLVI  242

Query  1010  QVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllg  831
             Q    +Y P W  L +K +R+M EI  EI  L+ G++ +RE+ M        +    L+ 
Sbjct  243   QASLGIYIPGWSFLPTKSNRKMKEISKEITTLILGIMNEREKSMNAGEAIQTDLLSILME  302

Query  830   vlLKS----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQ  681
               +            G S +EVIEEC+ FY AGQE+T+  LVW M+LLS +  WQ+RAR 
Sbjct  303   SNMNEIKQHGNNKDIGMSIEEVIEECKLFYIAGQETTATLLVWTMVLLSSYSEWQERARA  362

Query  680   EVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiil  501
             EV ++FG+ KP++DGLNRLK++TMI NEVLRLYPP     R + +ETKLG + LP  ++L
Sbjct  363   EVFEIFGNKKPNYDGLNRLKVVTMIFNEVLRLYPPVSIFGRIVRKETKLGNLTLPKGVML  422

Query  500   ilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEA  321
              L  +L+QRDP++WG DA EF PERF+EGV+KATKN  AF+PFGWGPR CIG NF M+EA
Sbjct  423   GLPIVLIQRDPELWGEDAHEFNPERFSEGVSKATKNPCAFIPFGWGPRICIGLNFTMIEA  482

Query  320   KIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             K+ ++ ILQRFSF LSPSY HSP   +T +PQ GA ++LHK+
Sbjct  483   KMTLSMILQRFSFELSPSYTHSPSASLTTQPQHGAHIILHKL  524



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   509 bits (1311),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 253/517 (49%), Positives = 355/517 (69%), Gaps = 16/517 (3%)
 Frame = -2

Query  1703  SILFLFISVPAVVI---WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
              ILF  +   AV+    WA +   WVWL PRKLEK LR+QG+ G SY+   G+ K++ + 
Sbjct  4     GILFTLLVTCAVIYISSWAWKAFVWVWLNPRKLEKCLREQGIKGPSYKFLSGNLKDIVSA  63

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-  1356
             T +A++KP+ LS  I+PRV+PF H  V KYGK  F+W GP  RV I +P++++++  N  
Sbjct  64    TQEARAKPMELSHKIVPRVMPFVHQTVEKYGKLSFIWYGPYCRVNIMDPDMIRDILSNKF  123

Query  1355  TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMK  1176
               F++ + +PL K L+SG+  YE ++W +HR+I++PAF+ +K+K M P++ +SC EM+  
Sbjct  124   GHFEKIRTNPLGKLLISGVVSYEGEKWVKHRRILNPAFHLEKLKMMLPAIYTSCSEMV-N  182

Query  1175  KWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHS  996
             KWE++ S+ + C+ DV P+L+  T+DVISRTAFG SY EG ++F LQ+EQA L  + + S
Sbjct  183   KWEMMVSQDS-CELDVWPHLQNLTADVISRTAFGSSYEEGRRIFQLQSEQAGLVIKALQS  241

Query  995   VYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS  816
             +Y P    L +KR+ RM EI  E R L++ ++ KRE+ MK     +D+    L+    K 
Sbjct  242   IYIPGLRFLPTKRNNRMKEIYGEARVLLRDIVNKREKAMKIGEAHNDDLLGLLMESNFKE  301

Query  815   ----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
                       G + DEVI+EC+ FYFAGQE+TS  LVW M++LS+H  WQ++AR+EV QV
Sbjct  302   ITDNVNSKNFGMTIDEVIDECKLFYFAGQETTSTLLVWTMVVLSMHPDWQEKAREEVLQV  361

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG   PDFDGLN LKI+TMIL EVLRLYPP+    R  Y+  KLGE+ LP  + L + +L
Sbjct  362   FGGKDPDFDGLNHLKIVTMILYEVLRLYPPAVLMARGTYKTMKLGEITLPAGVHLAMPTL  421

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
             LV  D ++WG DA +F PERF+ GV+KATKN+++F PF WGPR CIG NFA++E+K+AIA
Sbjct  422   LVHHDRELWGEDAEDFNPERFSGGVSKATKNQVSFFPFSWGPRICIGQNFALLESKMAIA  481

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              ILQRFSF LS +Y H+P  V+TL+PQ GA L+LHK+
Sbjct  482   MILQRFSFELSSTYVHAPYTVITLQPQHGAQLILHKL  518



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   508 bits (1309),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 256/517 (50%), Positives = 348/517 (67%), Gaps = 12/517 (2%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVI-WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMAT  1536
             S  +I  + + +  ++I  A R++ W+WL+P+KLE++LRQQGL GNSYR + GD KE++T
Sbjct  4     SVATIGAVLVGITVIIIAGAWRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKEIST  63

Query  1535  LTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN  1356
             +  +A SKP++LS DI PRV+PF +  V  YGKN FVW GP PRV I++PE M+ +    
Sbjct  64    MIKQAYSKPVSLSHDIAPRVIPFDYQLVNTYGKNYFVWMGPTPRVNITDPEDMKTILTKM  123

Query  1355  TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMK  1176
               F +P  +PL K L +G+A  E ++WA+HR+II+P F+ +K+K M P    SC EMI+ 
Sbjct  124   DDFPKPXANPLXKLLXTGIALCEGEKWAKHRRIINPVFHIEKLKRMLPEFYQSCSEMIV-  182

Query  1175  KWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHS  996
             +WE L  ++  C+ DV PY E  T+DVISRTAFG SY EG K+F L  EQA+L  +V+ S
Sbjct  183   EWESLVLKEGSCELDVWPYFENMTADVISRTAFGSSYKEGRKIFQLLKEQAKLAIKVVQS  242

Query  995   VYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv----  828
             VY P    L +K + +M EID EIR L+ G+I  RE  ++      D+    L+      
Sbjct  243   VYIPGARFLPTKINMKMKEIDREIRALLMGIINXREDAIRAGEATKDDLLGVLMESNLNE  302

Query  827   ------lLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
                     K G S  +VIEEC+ FYFAGQE+TS  LVW M+LL  +Q WQDRAR+EV QV
Sbjct  303   IKEHGNNKKVGMSMHDVIEECKLFYFAGQETTSVLLVWTMVLLGQYQNWQDRAREEVLQV  362

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG NKP+F G+  LK++TMIL+EVLRLYP      RT  ++T+L +  LP  + + LS+L
Sbjct  363   FGSNKPEFXGIIHLKVVTMILHEVLRLYPALTVMTRTTNKKTQLSKYSLPAGVEVALSTL  422

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
             LV  D  +WG DA EFKPERF+EG+ KATKN+  + PFG GPR CIG NFAM+EAK+A++
Sbjct  423   LVHHDKQLWGDDAHEFKPERFSEGIXKATKNKFMYFPFGGGPRNCIGQNFAMVEAKLALS  482

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              ILQ F+F LS SYAH+P   + ++PQFGA ++LHK+
Sbjct  483   LILQHFTFELSASYAHAPSSNLIIQPQFGAHIILHKL  519



>ref|XP_010535012.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=510

 Score =   508 bits (1307),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 258/510 (51%), Positives = 350/510 (69%), Gaps = 7/510 (1%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S+ S+  L      ++ W  R V+WVWLKP+ LE  L++QGL+G  Y  F GD +  +++
Sbjct  4     SFSSMAALVALAMVLMAWIWRFVKWVWLKPKFLENRLKRQGLSGTPYTPFVGDMRRNSSM  63

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
              ++A+SKPINL+DDI PRVLP     +  +GK+ F W GP P + ++ PE ++EVF  N 
Sbjct  64    LSEARSKPINLTDDITPRVLPLPLTMLKTHGKSFFTWLGPIPVITLTNPEQIKEVF--NK  121

Query  1352  LFKRPKPH--PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
             ++   KPH  PLV+ + SGL  Y+  +WA+HR+II+PAF+ +KIK M P+   SC E I+
Sbjct  122   IYDYEKPHTFPLVRLIASGLVNYDGDKWAKHRRIINPAFHLEKIKNMVPAFYQSCSE-IV  180

Query  1178  KKWELLTSEK-NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVI  1002
             ++WE L ++K + C+ D+ P+L   T+DVISRTAFG +Y EG  +F LQ E A+L  Q  
Sbjct  181   QEWERLAADKGSSCEVDIWPWLVNLTADVISRTAFGSNYREGQMIFKLQAELAQLLTQAF  240

Query  1001  HSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlL  822
                Y P +    +K +RRM EID EIR  + G+IGKR    +    D     L+      
Sbjct  241   RKAYIPGYRYFPTKSNRRMKEIDREIRATLSGIIGKRVEAREAPNDDLLGILLESNSGQS  300

Query  821   K-SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
             K +G S +EV++EC+ FYFAGQE+TS  LVW MILLS HQ WQ RAR+EV QV G  KPD
Sbjct  301   KGNGMSIEEVMQECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVMQVLGDRKPD  360

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              D LN+LK++TMIL EVLRLYPP+    R +++ETKLG++ LP  + + L  LL+QRD +
Sbjct  361   IDSLNQLKVVTMILYEVLRLYPPATQLSRAVHKETKLGDLTLPGGVHVALPILLIQRDVE  420

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG+DAGEFKPERF +G++KATKN+++FLPFGWGPR CIG NFA++E+K A+A IL+RFS
Sbjct  421   LWGSDAGEFKPERFKDGISKATKNQVSFLPFGWGPRICIGQNFALLESKTALALILRRFS  480

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             F LSPSY H+P  V TL PQFGA LVL K+
Sbjct  481   FELSPSYVHAPYTVFTLHPQFGAHLVLRKL  510



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   507 bits (1306),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 255/501 (51%), Positives = 343/501 (68%), Gaps = 12/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V+ WA R++ +VWLKP+ LEK LR+QG  G++Y+  +GD KEM+ +  +A SKP+N S D
Sbjct  19    VLRWAWRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKEMSKMGEEAWSKPVNFSHD  78

Query  1490  -ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
              I PRV PF H  +T YGKNCFVW GP P V+I +PE+++EV M N +F++P  +PL K 
Sbjct  79    TIWPRVNPFIHKIITNYGKNCFVWFGPRPAVVIMDPEVIKEVMMKNYVFQKPGGNPLTKL  138

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             L +G+A YE  +WA HR++++PAF+ DK+K M P+   +  EM + KWE + S +   + 
Sbjct  139   LATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTGNEM-LSKWEKIVSREG-SEI  196

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV PYL+  TSD ISRTAFG SY EG K+F LQ EQ +L  +V  ++Y P W  L +KR+
Sbjct  197   DVLPYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILEVSRTIYIPGWRFLPTKRN  256

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvg--------dddeenldllgvlLKSGFSTDE  798
             +RM +I NE+R L+  +I KR R ++                          K G S DE
Sbjct  257   KRMKQIFNEVRTLILEIINKRMRMIEAGESHDDLLGILLSSNLKEIQQHGNKKFGMSIDE  316

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW MILLS H  WQDRAR+EV QVFG N+ D+D LN+LK+
Sbjct  317   VIEECKLFYFAGQETTSTLLVWTMILLSQHPNWQDRAREEVLQVFGSNEVDYDKLNQLKV  376

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMILNEVLRLYP      R +  +TKLG + LP  + L+L ++L+Q D  +WG DA EF
Sbjct  377   VTMILNEVLRLYPAGYMMTRMVKTKTKLGNLCLPGGVQLLLPTILLQHDTKIWGDDAMEF  436

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERF++G+ KATK +L F PFGWGPR CIG NFAM+EAK+A+A IL+ ++F LS SY+H
Sbjct  437   NPERFSDGILKATKGQLVFFPFGWGPRICIGQNFAMLEAKMAMAMILKHYAFELSSSYSH  496

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P   + L+PQFGAPL+L+K+
Sbjct  497   AP-HPLMLQPQFGAPLILYKL  516



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   507 bits (1306),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 260/529 (49%), Positives = 354/529 (67%), Gaps = 21/529 (4%)
 Frame = -2

Query  1742  LSNPTMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVF  1563
             + N    +I +   I+FL       V  A  +++W+W+KP+KLE  LR+QGL GNSYR+F
Sbjct  1     MGNAHNSKIAAICLIIFL-------VYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLF  53

Query  1562  YGDTKEMATLTAKAKSKPI-NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEP  1386
             YGD KE++    +  SKPI NLS+++ PR++P+Y   + KYGK CFVW GP P ++I+EP
Sbjct  54    YGDMKELSKSLKEINSKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEP  113

Query  1385  ELMQEVFMNNTLFKRPK-PHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPS  1209
             EL++E+F  N +F++P  P+PL K L  G+  YE+++WA+HRKI++PAF+ +K+K M P+
Sbjct  114   ELIKEIFGKNYVFQKPNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPA  173

Query  1208  VTSSCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNE  1029
                SC EM + KWE +   K   + D+ P+L+  TSDVISR AFG SY EG ++F LQ E
Sbjct  174   FYLSCSEM-LNKWEEIIPVKESNELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEE  232

Query  1028  QAELTRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddee  849
             QAE   +  +SVY P      +K ++RM E + E+R  +  LI  R +  +E  G    +
Sbjct  233   QAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITCLIDNRLKAKEEGNGKALND  292

Query  848   nldllgvlLKS-----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQT  702
             +L  + +   S           G S  EVIEEC+ FYFAGQE+TS  LVW +ILL  +  
Sbjct  293   DLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPE  352

Query  701   WQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMK  522
             WQ+RAR+EV Q FG +KP FD L RLKI+TMIL E LRLYPP     R   EETKLGE+ 
Sbjct  353   WQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELD  412

Query  521   LPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGN  342
             LP   +L + ++L+  D ++WG DA EF PERF+EGVAKATK ++ + PFG GPR CIG 
Sbjct  413   LPKGALLFIPTILLHLDKEIWGEDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQ  472

Query  341   NFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             NFA++EAK+AIA ILQRFSF LSPSY HSP  VVTLKP++GAPL++H++
Sbjct  473   NFAILEAKMAIAMILQRFSFELSPSYTHSPYTVVTLKPKYGAPLIMHRL  521



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   507 bits (1306),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 246/513 (48%), Positives = 350/513 (68%), Gaps = 12/513 (2%)
 Frame = -2

Query  1703  SILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             SI+F+ + + A+  WA R++ W+W++P++LE+ LR+QGL GN YR+  GD KE+  L  +
Sbjct  11    SIVFVIV-ILALTSWAWRMLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQME  69

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             A+SKP+NLS DI+PRV    H +V K+GKN F+W GP PRV +++PEL+++V    + F+
Sbjct  70    ARSKPMNLSHDIVPRVFAHLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFR  129

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +P+ +PL K L +GL  Y+ ++W +HR++I+PAF  +K+K M P    SC ++I+K WE 
Sbjct  130   KPEANPLAKLLATGLVNYDGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIK-WEG  188

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
             + S    C+ DV P+L+   SDVI+RTAFG S+ EG ++F LQ E AELT +VI  VY P
Sbjct  189   MLSYDGSCEMDVWPFLQNLASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIP  248

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  + +  +RRM EID  I+  +  +I KRE+  K      D+    LL    K     
Sbjct  249   GWRFVPTATNRRMKEIDRYIKASLTDMIKKREKAPKTGEATRDDLLGILLESNHKEIQEH  308

Query  815   ------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                   G + ++VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG  
Sbjct  309   RNNENVGMNLNDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVFGKQ  368

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
              P+FDGL+ LKI+TMIL EVLRLYPP     R+++ + KLG + LP  + + L  ++V  
Sbjct  369   APNFDGLSHLKIVTMILYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIMVHH  428

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             D ++WG DA EF PERF+EGV+KAT  R++F PFGWGPR CIG NF+++EAK+A++ ILQ
Sbjct  429   DRELWGDDAKEFNPERFSEGVSKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQ  488

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              FSF LSP+Y H+P  V+TL+PQ+GA ++L K+
Sbjct  489   HFSFELSPAYTHAPFTVITLQPQYGAHVILRKV  521



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   507 bits (1305),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 248/501 (50%), Positives = 350/501 (70%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             + WA RV+ W W +PR+LE+ LR QGLNG  YR  YGD KE+  L  +A++KP+ L+ +I
Sbjct  23    LAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPMPLAHNI  82

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLFKRPKPHPLVKFL  1311
             +PR+LPF+H A+ +YGK  F W GP P+V I++PEL++EV  N   +F +P  +PL +F 
Sbjct  83    IPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPLSRFF  142

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL  YE ++W +HR+I++PAF+ +K+K M P+ ++ C ++ M +WE +   +   + D
Sbjct  143   SKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDL-MDRWENMAGSEACYELD  201

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P L++F+ DVISRTAFG SY EG ++F LQ+EQAEL  QV+ ++Y P +  L + +++
Sbjct  202   VWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTPKNK  261

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---------SGFSTDE  798
             R+  ID EIR +++G+I KRE+ +K      D+    L+   +K         +G +T++
Sbjct  262   RIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGMTTED  321

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  L W MI LS+H TWQ RAR+EV +VFG NKPDFDGL+ LKI
Sbjct  322   VIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKI  381

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R  Y+  K+G++  PP ++L+L ++ V  DP++WG DA EF
Sbjct  382   VTMILYEVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKDASEF  441

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERFAEGV+KA+K ++AF PFG GPR CIG NFA++EAK+ ++ ILQ FSF LSPSYAH
Sbjct  442   NPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSPSYAH  501

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  V TL PQ GA + L K+
Sbjct  502   APHTVFTLHPQHGAQIRLRKL  522



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   506 bits (1304),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 247/518 (48%), Positives = 352/518 (68%), Gaps = 12/518 (2%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +Q  + I   F+ V   + W  + + WVW+ P+KLEK L+ +GL G+SY+   GD KE+ 
Sbjct  2     VQINIKIAISFVIVIIFLRWIWKFLDWVWIHPKKLEKRLKLEGLKGSSYKFLLGDMKEIN  61

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
             ++  +AKSKPIN ++D + RV P ++  + +YGKNC+ W GP P ++ISEPE ++E+   
Sbjct  62    SMVEEAKSKPINFTNDYISRVFPHFNKLMMQYGKNCYTWLGPKPTMLISEPEFVREILSK  121

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
             + ++++ + +P+ K L  GLA YE  +WA+HR+II+PAF+ DK+K M PS   SC +MI 
Sbjct  122   SYIYQKIQGNPITKLLAQGLASYETDKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMIN  181

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
             K   +++S+ +  + DV P+L+  TSD ISRTAFG +Y EG ++F LQ EQA+L  Q   
Sbjct  182   KLDNIVSSKGS--EIDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAAR  239

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
              +Y P W  + +KR++R+ +I NE+R L+ G+I  R + MKE     D+    LL    K
Sbjct  240   WIYIPGWRFVPTKRNKRIKQIANEVRSLVLGIINNRIKEMKEGEATKDDLLGILLESNFK  299

Query  818   S----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQ  669
                        G + DEVIEEC+ FYFAGQE+TS  LVW +ILLS H  WQ++ARQEV Q
Sbjct  300   EIQIHHENKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHLDWQEKARQEVHQ  359

Query  668   VFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililss  489
             VFG NKP++D LN+LK++TMI NEVLRLYPP     R + +ETKLG + LP  ++L+L +
Sbjct  360   VFGSNKPNYDMLNQLKVVTMIFNEVLRLYPPGTMIGRRVQKETKLGHLSLPAGMLLLLPT  419

Query  488   lLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAI  309
             + +Q D ++WG DA EF P RF+EGV KATK + A+ PF WGPR CIG NFAM+EAK+A+
Sbjct  420   IYLQHDNEIWGDDAKEFNPMRFSEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAKMAL  479

Query  308   ATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             A ILQ ++  LSPSY+H+P  ++TL+PQ GAPL+L K+
Sbjct  480   AMILQHYALELSPSYSHAPHTIITLQPQHGAPLILRKL  517



>ref|XP_003525967.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=518

 Score =   506 bits (1304),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 248/513 (48%), Positives = 342/513 (67%), Gaps = 11/513 (2%)
 Frame = -2

Query  1703  SILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             +++F+   +  V I   + + W+WL+P++ E++LR+QGL GNSY +F+GD K ++TL  K
Sbjct  7     TMMFVGFCIAFVTILLTKALSWLWLEPKRAERYLRRQGLKGNSYTLFFGDIKAISTLIQK  66

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             AKSKPI+++DD+ PR++PF H  +  YGKN F W GP P V I +PE ++EV      F 
Sbjct  67    AKSKPIDINDDVTPRLVPFQHQLIRNYGKNSFFWYGPKPVVHIMDPEAIREVLNLINDFP  126

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +P   PL KFL++GL   +  +W++HRKII+PAF   K+K + P++  SC +M M +W++
Sbjct  127   KPTLTPLSKFLITGLVDLDGDKWSKHRKIINPAFNLAKLKLVLPAMYHSCNQM-MNEWKM  185

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
             L S+K  C  DV P+L + T DVISRTAFG  Y EG  VF LQ EQAELT +V  SVY P
Sbjct  186   LVSKKESCMVDVWPFLNSLTGDVISRTAFGSCYEEGKIVFQLQKEQAELTAKVFQSVYIP  245

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  + +K ++RM EID EIR ++ G+I K+E  MK     +D     LL    K     
Sbjct  246   GWRFVPTKLNKRMKEIDFEIRNVLSGIIQKQEAAMKTCKAPNDNLLGLLLESNQKEIEDR  305

Query  815   ------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                   G +TD+VI EC+ FYFAGQE+TS  L W M+LLS    WQ  AR+EV  +FG  
Sbjct  306   GHRKDVGMNTDDVINECKLFYFAGQETTSVLLNWTMVLLSRFPNWQTLAREEVIGIFGTK  365

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             +PD+DGLNRLK++TMIL EVLRLYPP     R + +E ++G + LP   +  +  +LV  
Sbjct  366   EPDYDGLNRLKVVTMILYEVLRLYPPVTAITRVVRKEARVGNLTLPAGALATIPIVLVHH  425

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             D ++WG+DA EFKPERF+EG+ KAT  +++FLPF WGPR CIG NFA++EAK+A+  ILQ
Sbjct  426   DSELWGSDAKEFKPERFSEGILKATNGQVSFLPFAWGPRICIGQNFALLEAKMALCLILQ  485

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              FSF LS SY H+P  V+T +PQFG P++ HK+
Sbjct  486   NFSFELSASYTHAPFTVITAQPQFGTPIIFHKL  518



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   507 bits (1305),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 260/529 (49%), Positives = 354/529 (67%), Gaps = 21/529 (4%)
 Frame = -2

Query  1742  LSNPTMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVF  1563
             + N    +I +   I+FL       V  A  +++W+W+KP+KLE  LR+QGL GNSYR+F
Sbjct  11    MGNAHNSKIAAICLIIFL-------VYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLF  63

Query  1562  YGDTKEMATLTAKAKSKPI-NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEP  1386
             YGD KE++    +  SKPI NLS+++ PR++P+Y   + KYGK CFVW GP P ++I+EP
Sbjct  64    YGDMKELSKSLKEINSKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEP  123

Query  1385  ELMQEVFMNNTLFKRPK-PHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPS  1209
             EL++E+F  N +F++P  P+PL K L  G+  YE+++WA+HRKI++PAF+ +K+K M P+
Sbjct  124   ELIKEIFGKNYVFQKPNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPA  183

Query  1208  VTSSCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNE  1029
                SC EM + KWE +   K   + D+ P+L+  TSDVISR AFG SY EG ++F LQ E
Sbjct  184   FYLSCSEM-LNKWEEIIPVKESNELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEE  242

Query  1028  QAELTRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddee  849
             QAE   +  +SVY P      +K ++RM E + E+R  +  LI  R +  +E  G    +
Sbjct  243   QAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITRLIDNRLKAKEEGNGKALND  302

Query  848   nldllgvlLKS-----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQT  702
             +L  + +   S           G S  EVIEEC+ FYFAGQE+TS  LVW +ILL  +  
Sbjct  303   DLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPE  362

Query  701   WQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMK  522
             WQ+RAR+EV Q FG +KP FD L RLKI+TMIL E LRLYPP     R   EETKLGE+ 
Sbjct  363   WQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELD  422

Query  521   LPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGN  342
             LP   +L + ++L+  D ++WG DA EF PERF+EGVAKATK ++ + PFG GPR CIG 
Sbjct  423   LPKGALLFIPTILLHLDKEIWGEDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQ  482

Query  341   NFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             NFA++EAK+AIA ILQRFSF LSPSY HSP  VVTLKP++GAPL++H++
Sbjct  483   NFAILEAKMAIAMILQRFSFELSPSYTHSPYTVVTLKPKYGAPLIMHRL  531



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   506 bits (1304),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 252/508 (50%), Positives = 343/508 (68%), Gaps = 13/508 (3%)
 Frame = -2

Query  1682  SVPAVVIWAC--RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKP  1509
             S  A+ +  C  RV+ W+W +P+KLEK L++QG+ GNSY + YGDTKE++    +  SK 
Sbjct  13    SAIAITLLLCLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSLRIKEVTSKS  72

Query  1508  INL-SDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKP  1332
             ++L  DDI  R +PF+   + KYGK  F+W GP P V I +P+L++EVF    ++++ K 
Sbjct  73    MSLYDDDIAQRSMPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKT  132

Query  1331  HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSE  1152
             +PL K L  GL   E  +WA+HRKII+PAF+ +K+K M P+   SC EM + KWE + S 
Sbjct  133   NPLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEM-LSKWEDIVSV  191

Query  1151  KNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWL  972
             +   + DV P+L+  TSDVISRTAFG SY EG ++F LQ EQA+   + + SVY P W  
Sbjct  192   ERAYEIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSF  251

Query  971   LSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--------  816
             L +KR+RRM EI+  ++  ++G+I KR + MK    ++++    LL    K         
Sbjct  252   LPTKRNRRMKEIERHVQATIRGIIDKRVKAMKGGEANNEDLLGILLESNFKEIEQHGDKN  311

Query  815   -GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFD  639
              G S +EVIEEC+ FYFAGQE+TS  LVW +ILL  H  WQ RAR+EV QVFG+ KPDFD
Sbjct  312   FGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRAREEVLQVFGNRKPDFD  371

Query  638   GLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVW  459
             GLN LK++TMIL E LRLYPP     R + E+T LG+M LP  ++L L ++L+  D ++W
Sbjct  372   GLNHLKVVTMILYESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHDEEIW  431

Query  458   GADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFH  279
             G DA +F PERF EGV+ ATK ++ F PF WGPR CIG NFAM+EAK+ +A ILQRFSF 
Sbjct  432   GEDAKKFNPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSFD  491

Query  278   LSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LS SYAH+P  V+T +PQ+GAPL+LH++
Sbjct  492   LSSSYAHAPHSVITTQPQYGAPLILHRL  519



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   506 bits (1303),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 252/507 (50%), Positives = 349/507 (69%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             I V  ++++  +V+ W W KP+KLEK+LR+ GL GN Y++ YGD+KE+     +A+SKPI
Sbjct  12    ICVAILLVYTWKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKELTNKLNEARSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPH  1329
             N +DDI  R++PF+  ++ K GKN FVW GP P V+I++PE ++ +F  N  + K+  P+
Sbjct  72    NFNDDIAQRLIPFFLDSINKNGKNSFVWLGPYPIVLITDPEHVKVIFTKNYGYQKQAHPN  131

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  K L  GLA  E+ +WA+HRKII+PAF+ +K+K M P+   SC EMI  KWE +  ++
Sbjct  132   PFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEMI-SKWEDIVPKE  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L+  T +VISRTAFG SY EG  VF LQ EQAE    +  SVY P    L
Sbjct  191   TSVELDVWPDLQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVIDITRSVYIPGSRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR++RM  I+ +++  ++ +I KR R M+      ++    LL   +K          
Sbjct  251   PTKRNKRMLAIEKQVQTTIRRIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKEF  310

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +T E+IEEC+ FYFAGQE+TS  LVW MILLS+H  WQ RAR+EV QVFG+ KP+ +G
Sbjct  311   GMTTIELIEECKLFYFAGQEATSVLLVWTMILLSLHPEWQVRAREEVLQVFGNEKPNLEG  370

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             L+RLKI+TMIL+E LRL+PP P   R    E KLGE+ LP  ++L + ++L+  D ++WG
Sbjct  371   LSRLKIMTMILHETLRLFPPVPTYRRRNKHEVKLGELSLPSGVLLFIPTVLIHYDKELWG  430

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+KATK +++F+PFGWGPR CIG NFAMMEAK+AIA ILQ+FSF L
Sbjct  431   EDAKEFKPERFSEGVSKATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFSFKL  490

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P  ++T +PQ+GAPL++ K+
Sbjct  491   SPSYTHAPVAIITTQPQYGAPLLMRKL  517



>ref|XP_004166892.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=516

 Score =   506 bits (1302),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 244/496 (49%), Positives = 334/496 (67%), Gaps = 11/496 (2%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             ++  W+W +P+KLEK LRQQG  GNSYR+ +GD KE A +  +A SKP+N S+ I PRV+
Sbjct  22    KLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPRVI  81

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
             P  +  + +YGKN F+W GP PRV I +PE ++ VF     F++P  +P  K LV G+  
Sbjct  82    PSIYHTIQRYGKNSFMWLGPIPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGIVN  141

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLE  1113
              + ++W +HRKII+PAF+ +K+K M P+   SC EM+  KWE + S++  C+ DV PYL+
Sbjct  142   LDGEKWVKHRKIINPAFHLEKLKDMVPAFYHSCNEMV-SKWESMVSKEGSCELDVMPYLK  200

Query  1112  AFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEID  933
                SDVISRTAFG SY +G K+F LQ E      Q    +Y P W  L +K +R+M EI 
Sbjct  201   XMASDVISRTAFGSSYEKGKKIFKLQTELTNFVIQTTLGIYIPGWRFLPTKLNRKMKEIS  260

Query  932   NEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVIEEC  783
              EI  L+ G++ +RE+ MK       +    L+   +            G S ++VIEEC
Sbjct  261   KEITTLILGIMDEREKSMKAGEAIQTDLLSILMESNMNEIKQHGNKKXIGMSIEDVIEEC  320

Query  782   QHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMIL  603
             + FY AGQE+T+  LVW MILLS +  WQ+RAR EV ++FG+ +P++DGLNRLK++TMI 
Sbjct  321   KLFYIAGQETTATLLVWTMILLSSYSEWQERARAEVFEIFGNKQPNYDGLNRLKVVTMIF  380

Query  602   NEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERF  423
             NEVLRLYPP    +R + +ET+LG + LP  ++L L  +L+QRDP++WG DA EF PERF
Sbjct  381   NEVLRLYPPGSLFVRIVRKETRLGNLTLPGGVMLGLPIVLIQRDPELWGEDAHEFNPERF  440

Query  422   AEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFV  243
             + GV+KATKN  AF+PFGWGPR CIG  FAM+EAK+A++ ILQRFSF LSPSY HSP   
Sbjct  441   SGGVSKATKNPSAFIPFGWGPRICIGQTFAMIEAKMALSMILQRFSFELSPSYTHSPIAS  500

Query  242   VTLKPQFGAPLVLHKI  195
             +T +PQ GA ++LHK+
Sbjct  501   LTTQPQHGAHIILHKL  516



>ref|XP_011083293.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=510

 Score =   505 bits (1301),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 248/498 (50%), Positives = 343/498 (69%), Gaps = 13/498 (3%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             R+V +VW++PR++EKWLR+QG  GN YRV+YGD K++  ++  A S PI+L  DILP VL
Sbjct  14    RIVNYVWVRPRRVEKWLREQGWKGNPYRVWYGDLKDVGRMSVAAHSNPISLHQDILPYVL  73

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
             PF+H  +TKYGK C +W GP+PR+I++EP+L++EV   + +F +   HPL K L+SGL  
Sbjct  74    PFHHHIITKYGKRCLIWQGPSPRIIVTEPDLIKEVLNKHEVFVKVYAHPLNKLLISGLTV  133

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWC-DFDVQPYL  1116
             +E Q+WA+HR+I++PAF   K+K M P +  SC E++ KKW+ +  +K    + DV P+ 
Sbjct  134   HEGQKWAKHRRILNPAFTITKLKDMIPMMHVSCTELV-KKWQSMFGDKGSSHEIDVWPFF  192

Query  1115  EAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEI  936
             E  T+DVISRTAFG ++ +G KVF LQ EQA+L  Q+  +VY P    L   + +RM EI
Sbjct  193   ENLTADVISRTAFGSNFEQGKKVFLLQREQAQLIVQLSRTVYIPGLRFLPMGKIKRMKEI  252

Query  935   DNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVIEE  786
             D E+R +++G+I +RE  M+      ++    LL    +           G S ++VI+E
Sbjct  253   DREVRDVLRGIIQRREEAMRVGEKTSNDMLGILLESNSREVEGDGNRKELGISIEDVIDE  312

Query  785   CQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMI  606
             C+ FYFAGQE+TS+ LVW M++LSIHQ WQ +AR+EV QVFG + PDFDGLN+LK + +I
Sbjct  313   CKLFYFAGQETTSNLLVWTMVMLSIHQNWQTQAREEVLQVFGKSIPDFDGLNQLKKVNLI  372

Query  605   LNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPER  426
             L+EVLRLYPP+    R   E+ KLG+  LP    L+L  L V  D ++WG DA EFKPER
Sbjct  373   LHEVLRLYPPATTIARVTREKIKLGDTTLPAGTGLVLPILFVHHDKEIWGDDAKEFKPER  432

Query  425   FAEGVAKATKNRL-AFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             FA+GVA ATK R+ AF PF  GPR CIG NF+M+EAK+ +A ILQ FSF LSPSY H+P 
Sbjct  433   FAQGVANATKGRIAAFFPFSLGPRICIGQNFSMVEAKLVLAMILQHFSFELSPSYEHAPV  492

Query  248   FVVTLKPQFGAPLVLHKI  195
              V+TL+P++GA ++  KI
Sbjct  493   PVLTLQPKYGAKIMFSKI  510



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   505 bits (1301),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 252/521 (48%), Positives = 348/521 (67%), Gaps = 12/521 (2%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             MD+IQ  V+I    I+V A+ +   +V+ WVW +P+KLEK LR+QGL GNSYR+ YGD K
Sbjct  1     MDKIQILVTICCCVIAV-ALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMK  59

Query  1547  EMATLTAKAKSKPINLS-DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             + + +  +A SKP+N+S DD+ PR++PF+   + KYGK CF W GP P+++I +PEL++E
Sbjct  60    DFSGMIKEANSKPMNISNDDLSPRLVPFFLEIIKKYGKKCFTWMGPRPQILIMDPELIKE  119

Query  1370  VFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCE  1191
             V     ++++P  +PL    V GL  YE  +WA+HRKII+PAF+ +K+K M P+   SC 
Sbjct  120   VLSKTYVYQKPHANPLGTLFVQGLVTYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCS  179

Query  1190  EMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTR  1011
             EM + KWE +   +   + DV P+L+  T DVISRTAFG SY EG K+F LQ EQ +   
Sbjct  180   EM-LSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQTQHFL  238

Query  1010  QVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllg  831
             +V  SVY P W  L +KR+RRM EI  ++R  ++G+I KR + M+    D+++    LL 
Sbjct  239   EVTRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLE  298

Query  830   vlLKS---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQE  678
                K          G S +EVIEEC+ FYFAG E+TS +++W ++LLS    WQ RAR+E
Sbjct  299   SNFKEIELHGNKDFGMSIEEVIEECKLFYFAGTETTSVWILWTLVLLSRCPDWQARAREE  358

Query  677   VQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiili  498
             V QV G  KPDFDGLN LK++TMIL E LRLY P     R +YE+  LGE+ LP  +++ 
Sbjct  359   VLQVLGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLTRRIYEDITLGEVSLPTGVLVS  418

Query  497   lsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAK  318
             L  +L+  D D+WG DA +F PERF EG++ ATK ++ + PF WGPR CIG NFAM+EAK
Sbjct  419   LPIILLHHDKDIWGEDANKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAK  478

Query  317   IAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             + +  ILQ FSF LSPSY H+P  +VT +PQ+GAPL+ HK+
Sbjct  479   MTLCMILQSFSFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  519



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   505 bits (1301),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 255/510 (50%), Positives = 347/510 (68%), Gaps = 11/510 (2%)
 Frame = -2

Query  1697  LFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK  1518
             +   I V  ++++  RV+ W W +P+KLE +LRQ+GL GN Y++ YGD  E+     +AK
Sbjct  8     IIAIICVAILLVYTWRVLNWAWFRPKKLENFLRQRGLKGNPYKLLYGDLNELTKSIVEAK  67

Query  1517  SKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KR  1341
             SK IN+SDDI  R++PF+  ++ K GK+ F+W GP P V+I+ PE ++E+   N ++ K+
Sbjct  68    SKSINISDDITQRLIPFFLDSINKNGKSSFMWLGPYPTVLITNPEHVKEILTKNYVYLKQ  127

Query  1340  PKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
               P+P  K L  GL   E+ +WA+HRKII+PAF+ +K+K M P+   SC EMI  KWE +
Sbjct  128   THPNPFAKLLAQGLVLVEEDKWAKHRKIINPAFHVEKLKHMLPAFYMSCSEMI-SKWEDI  186

Query  1160  TSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPE  981
              S++   + DV P L+  TS+VISRTAFG SY EG  VF LQ EQAE    +  S+Y P 
Sbjct  187   VSKETSYELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQQEQAEHIMDISRSIYIPG  246

Query  980   WWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-----  816
                L +KR++RM EI+ +I+  ++ +I KR R M+      D+    LL   +K      
Sbjct  247   SRFLPTKRNKRMLEIEKQIQTTIRHIIDKRLRAMEAGETSKDDLLGILLESNMKEIEQHG  306

Query  815   ----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKP  648
                 G +T EVIEEC+ FYFAGQE+TS  LVW M+LL +H  WQ RAR+EV QVFG+ KP
Sbjct  307   NKDFGLTTTEVIEECKLFYFAGQETTSVLLVWTMVLLCLHPEWQVRAREEVLQVFGNEKP  366

Query  647   DFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDP  468
             D +GL+ LKI+TMIL E LRL+PP P   R   EE KLGE++LP  +ILI+ ++ +  D 
Sbjct  367   DLEGLSHLKIVTMILYETLRLFPPLPVFSRRNKEEVKLGELQLPAEVILIIPAIFIHYDK  426

Query  467   DVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRF  288
             ++WG DA EFKPERF+EGV+KATK +++F+PFGWGPR CIG NFAMMEAK+AIA ILQ+F
Sbjct  427   EIWGEDAKEFKPERFSEGVSKATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKF  486

Query  287   SFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             SF LSPSY H+P   +T+ PQ+GAPL+L K
Sbjct  487   SFELSPSYTHAPFATITIHPQYGAPLLLRK  516



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   505 bits (1301),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/514 (47%), Positives = 344/514 (67%), Gaps = 10/514 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             + ++  ++ +  +++   ++V W+W +P+KLEK LR+QG  GNSYR+ +GD KE A +  
Sbjct  8     IGVIISYVLLLLLLLLGWKLVDWIWFRPKKLEKILRRQGFAGNSYRILHGDLKESAAMRE  67

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A SKP+N S+ I PRV+P  +  +  YGK   +W GP PRV I +PE ++ VF +   F
Sbjct  68    EAMSKPMNFSNHIAPRVIPSVYHTIQLYGKKSMMWLGPMPRVHIMDPEQLKIVFSSINDF  127

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P  +PL + LV GLA  E Q+W +HRKII+PAF+ +K+K M P+   SC   ++ KWE
Sbjct  128   QKPTMNPLTRLLVQGLASLEGQKWVKHRKIINPAFHVEKLKDMVPAFYHSCYNEMVSKWE  187

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              + S +  C+ DV PYL+   SDVISRTAFG SY +G K+F LQ E A L  Q    +Y 
Sbjct  188   GMVSREGSCELDVMPYLQNMASDVISRTAFGSSYEKGKKIFELQTELANLVIQANLGIYI  247

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +K +R+M EI  EI  L+ G++ ++E+ +K       +    L+   +     
Sbjct  248   PGWRFLPTKSNRKMKEISKEITTLILGIMNEKEKSIKAGEAIQTDLLSILMESNMNEIKQ  307

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S ++VIEEC+ FY AGQE+T+  LVW M+LLS +  WQ+RAR EV ++FG+
Sbjct  308   HGNNKNIGMSIEDVIEECKLFYIAGQETTATLLVWTMVLLSSYSEWQERARAEVFEIFGN  367

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
              KPD+DGLNRLK++TMI NEVLRLYPP     R + +ET+LG + LP  ++L L  +L+ 
Sbjct  368   KKPDYDGLNRLKVVTMIFNEVLRLYPPVNMFGRIIRKETRLGNLTLPEGVMLGLPVVLIH  427

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              DP++WG DA EF PERF+EG++KATKN  AF+PFGWGPR CIG NFAM+EAK+A++ IL
Sbjct  428   LDPELWGEDAHEFNPERFSEGISKATKNPSAFIPFGWGPRICIGQNFAMIEAKMALSIIL  487

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             QRFSF LSPSY H+P  V+T +PQ GA ++LHK+
Sbjct  488   QRFSFELSPSYTHAPIAVLTTQPQHGAHIILHKL  521



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   505 bits (1300),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 251/523 (48%), Positives = 352/523 (67%), Gaps = 16/523 (3%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWAC--RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGD  1554
             M++I+  V+I        A+ ++ C  +V+ WVW  P+KLEK LR+QGLNGNSYR+ YGD
Sbjct  1     MEKIEMIVTIC---CCATAITLFVCLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGD  57

Query  1553  TKEMATLTAKAKSKPINLSD-DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELM  1377
              K+++ +  +A SKP+N+SD ++ PR++PF+   + KYGK  F+W GP P+++I +PEL+
Sbjct  58    MKDLSGMIKEANSKPMNMSDHNLAPRMVPFFLETIKKYGKKSFIWMGPRPQILIMDPELI  117

Query  1376  QEVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSS  1197
             +EV   N ++++P  +PL    V GL  YE  +WA+HRKII+PAF+ +K+K M P+   S
Sbjct  118   KEVLSKNYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLS  177

Query  1196  CEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAEL  1017
             C EM + KWE +   +   + DV P+L+  T DVISRTAFG SY EG K+F LQ EQA+ 
Sbjct  178   CSEM-LSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQAQH  236

Query  1016  TRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldl  837
               +VI SVY P W  L +KR+RRM EI  ++R  ++G+I KR + M+    D+++    L
Sbjct  237   FLEVIRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGIL  296

Query  836   lgvlLKS---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRAR  684
             L    K          G S +EVIEEC+ FYFAG E+TS +++W ++LLS +  WQ RAR
Sbjct  297   LESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDWQARAR  356

Query  683   QEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNii  504
             +EV QVFG  KPDFDGLN LK++TMIL E LRLY P     R +YE+  LGE+ LP  ++
Sbjct  357   EEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLARRIYEDITLGEVSLPTGVL  416

Query  503   lilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMME  324
             + L  +L+  D D+WG DA +F PERF EG++ ATK ++ + PF WGPR CIG NFAM+E
Sbjct  417   VSLPIILLHHDKDIWGEDANKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLE  476

Query  323   AKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             AK+ +  ILQ F F LSPSY H+P  +VT +PQ+GAPL+ HK+
Sbjct  477   AKMTVCMILQSFFFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  519



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   504 bits (1299),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 349/507 (69%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             I V  ++++  RV+ W W KP+KLEK+LR+ GL GN Y++ YGD+KE+     +A+SKPI
Sbjct  12    ICVVTLLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLLYGDSKELTNKLNEARSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPH  1329
             N SDDI  R++PF+  ++ K GK+ FVW GP P V+I+ PE ++E+F  N  + K+  P+
Sbjct  72    NFSDDIAQRLVPFFIDSINKNGKSSFVWLGPCPIVLITYPEHVKEIFTKNCAYQKQAHPN  131

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  K L  GLA  E+ +WA+HRKII+PAF+ +K+K M P+   SC EM + KWE +  ++
Sbjct  132   PFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCTEM-LSKWEEIIQKE  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L+  T +VISRTAFG SY EG  VF LQ EQAE    +  SVY P    L
Sbjct  191   TSVELDVWPDLQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVIDITRSVYIPGSRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +K+++RM EI+ +++  ++ +I KR R M+      ++    LL   +K          
Sbjct  251   PTKKNKRMLEIEKQVQTTIRRIIDKRLRAMEAGEPSKNDLLGILLESNMKEIEQHGSKDF  310

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +T E+IEEC+ FYFAGQE+TS  LVW MILLS+H  WQ RAR+EV QVFG+ KP+ +G
Sbjct  311   GMTTIELIEECKLFYFAGQEATSVLLVWTMILLSVHPEWQVRAREEVLQVFGNEKPNLEG  370

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             L+RLKI+TMIL+E LRL+PP P   R    E KLGE+ LP  ++L + ++L+  D ++WG
Sbjct  371   LSRLKIVTMILHETLRLFPPVPTYRRRNIHEVKLGELSLPAGVLLFIPTVLIHYDKELWG  430

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+ ATK +++F+PFGWGPR CIG NFAMMEAK+AIA ILQ+F F L
Sbjct  431   EDAKEFKPERFSEGVSNATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFCFEL  490

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY+H+P  ++T +PQ+GAPL++ K+
Sbjct  491   SPSYSHAPVAIITTQPQYGAPLLMRKL  517



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   504 bits (1298),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 255/514 (50%), Positives = 345/514 (67%), Gaps = 14/514 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +S+ FL +    +++W  R++ WVW++P++LE+ LR+QGL GNSYR   GD KE   ++ 
Sbjct  9     ISLSFLVV---GILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A+SKP+ LSDDI   V PF H  V   GK+ F W GP PRV I EPE ++E+F     F
Sbjct  66    QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P  +PLV  LVSGL   + ++WA+HRKII+PAF+ DK+K M P+   SC EMI  KWE
Sbjct  126   QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMI-SKWE  184

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              L   +   + DV PYL   T DVISR AFG SY EG ++F L  +Q  LT QV+ S Y 
Sbjct  185   KLVFLEGSSELDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQSAYI  244

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +K +R+M  I  +I+  +KG+I KRE   K     +D+    L+   ++    
Sbjct  245   PGWRYLPTKTNRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQE  304

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S ++VIEEC+ FYFAGQE+TS  LVW MILL+ H  WQ +AR+EV +VFG 
Sbjct  305   QGDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTKAREEVLEVFGD  364

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             +KPD DGLNRLK++TMIL EVLRLYP      R++ ++TKLG++ LP    + L  LL+ 
Sbjct  365   SKPDSDGLNRLKVVTMILYEVLRLYPAGVALGRSVPKDTKLGKLLLPAGAEITLPVLLIH  424

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EF P+RF+EGV+KATK+++ + PFGWGPR CIG NFA+MEAK+A+A IL
Sbjct  425   HDQELWGDDAHEFNPDRFSEGVSKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAMIL  484

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ++F F LSPSYAHSPC  +TL+PQ GA ++LHK+
Sbjct  485   RQFWFELSPSYAHSPCTFITLRPQHGAHIILHKL  518



>ref|XP_004295684.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   504 bits (1299),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 256/519 (49%), Positives = 357/519 (69%), Gaps = 17/519 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             SWV++  +F+S+   + W+  V+ WVWLKP+KLE+ LR+QG  GNSYR+ YGDTK+ + +
Sbjct  7     SWVALSLVFVSIVVRLAWS--VLDWVWLKPKKLERCLREQGFKGNSYRILYGDTKDESIM  64

Query  1532  TAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
              A+AKSKP+N+S   DI P++  F    V  YGKN FVW GP PRV +  PE ++EVF  
Sbjct  65    RAEAKSKPMNISTSHDIGPQLDAFVDKTVKSYGKNSFVWIGPIPRVNVMNPEELKEVFTR  124

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
             +  F+RP  +PL+  L SGL   E ++WA+HR+II+PAF+ +K+K M P+   S +EMI 
Sbjct  125   HEEFRRPITNPLILLLTSGLNFCEGEKWAKHRRIINPAFHFEKLKLMIPAFHQSFDEMI-  183

Query  1178  KKWE-LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVI  1002
             K+WE  ++ E +  + DV P L++ T+DVISRTAFG +Y EG ++F L  EQ     + +
Sbjct  184   KEWESAVSKEGSSAELDVWPSLQSMTADVISRTAFGTNYQEGRQMFELLREQTIHVTKAL  243

Query  1001  HSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlL  822
             HS+Y P W  L +KR+ R+++I+ EI G+++G+I  RE+  +      D+    L+   L
Sbjct  244   HSIYIPGWRFLPTKRNMRINKINKEINGIVRGIIENREQATRAGEASGDDLLGALMESNL  303

Query  821   KS-----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
             K            G S  +V++EC+ FYFAGQE+TS  LVW MILLS +Q WQD ARQEV
Sbjct  304   KHIQENGKNNKNVGMSIQDVMQECKLFYFAGQETTSVMLVWTMILLSQNQNWQDPARQEV  363

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
              QV G  KPD+DGL+ LK++TMIL EVLRLYP    T R + + T+LG+  LP  + + +
Sbjct  364   LQVSGSKKPDYDGLSHLKVVTMILLEVLRLYPAGGATNRIVPKNTQLGKYSLPAGVEVRV  423

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
               LL+  D ++WG DA EFKPERFAEGV+KATKN+L+++PFG GPR CIG NF+M E K+
Sbjct  424   PILLIHHDKELWGDDANEFKPERFAEGVSKATKNQLSYIPFGAGPRICIGQNFSMTEGKL  483

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             A+A ILQ F+F LSPSYAHSP ++ TL+PQ+GAP++LH+
Sbjct  484   ALALILQHFTFELSPSYAHSPFYLFTLQPQYGAPIILHR  522



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   504 bits (1298),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/513 (49%), Positives = 345/513 (67%), Gaps = 12/513 (2%)
 Frame = -2

Query  1703  SILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             SI+ +  SV  + IWA  ++ WVW KP+KLEK+LRQQGL G+ YR+ +GD KE A +  +
Sbjct  6     SIIGVLCSV-FLTIWAWIILNWVWFKPKKLEKYLRQQGLGGSHYRLLFGDMKETAQMVKQ  64

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             A SKPIN ++DI+PR+LPF    +   G N   W GP+P +++ +PEL++EV   N +++
Sbjct  65    AYSKPINFTNDIVPRILPFVDKLIRSSGTNTLTWMGPSPALLLIDPELVKEVLTKNYVYQ  124

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +P+ +PL K L  G A Y+  +WA++R+IISPAF+ +K+K M P+   SC EM + KWE 
Sbjct  125   KPRNNPLGKLLAEGFATYDTDKWAKNRRIISPAFHLEKLKHMVPAFCLSCSEM-LSKWEN  183

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
                     + DV P +     D+ISRTAFG +Y EG K+F LQ +Q+EL  Q I S+Y P
Sbjct  184   GALADGSLELDVWPDIRTLAGDMISRTAFGSNYEEGRKIFELQMQQSELFEQAIQSIYVP  243

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  L +KR+++M +I  ++R L+ G+I KR R M+E      +    LL    K     
Sbjct  244   GWRFLPTKRNKKMKKIFKDVRSLILGIINKRVRAMQEGEATHSDLLGLLLESNFKEIQEH  303

Query  815   -----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNK  651
                  G +++EVI+EC+ FYFAG E+T+  LVW +ILLS H  WQ RAR EV QVFG+N 
Sbjct  304   GNERFGMTSEEVIQECKLFYFAGHETTAILLVWTLILLSKHSDWQARARDEVLQVFGNNI  363

Query  650   PDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRD  471
             PDF+ LNRLKI+TMILNEVLRLY P     R + E+TKLGE+ LP  + +++ S+L+  D
Sbjct  364   PDFEELNRLKIVTMILNEVLRLYTPGVMISRRVNEDTKLGELSLPSGMFVLMPSILLHHD  423

Query  470   PDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQR  291
             P +WG DA EF PERF+EGVAKATK +  FLPFG GPR CIG NFA++EAK+A+A ILQR
Sbjct  424   PSLWGDDAKEFNPERFSEGVAKATKGQPCFLPFGGGPRICIGQNFALLEAKMALALILQR  483

Query  290   FSFHLSPSYAHSP-CFVVTLKPQFGAPLVLHKI  195
             FSF LSP Y H+P  F+  L+PQ+GA L++ K+
Sbjct  484   FSFELSPLYTHAPYLFLTLLQPQYGAQLIMKKL  516



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   504 bits (1298),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 257/506 (51%), Positives = 342/506 (68%), Gaps = 11/506 (2%)
 Frame = -2

Query  1682  SVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN  1503
             S   V++++ RVV W +++P++LEK+LR+QGL+GNSYR+ YGD KEM  +    +SKPIN
Sbjct  12    SAFVVLMYSWRVVNWAYIRPKRLEKFLRKQGLSGNSYRLVYGDLKEMLKMMEDGRSKPIN  71

Query  1502  LSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPK-PHP  1326
             L DDI PRVL F    V KYG   F+W GP P V IS+PEL++EV     ++++P  P+P
Sbjct  72    LDDDIKPRVLHFVFKTVQKYGTESFLWLGPRPTVTISDPELVKEVMNKYDIYQKPNNPNP  131

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN  1146
             L K L  G+  YE  +WA+HRK+I+PAF+ +K+K M P+   SC+E ++ KWE   S + 
Sbjct  132   LTKLLAQGVVSYEMDKWAKHRKLINPAFHMEKLKLMIPAFYLSCDE-VLNKWEKSLSPEG  190

Query  1145  WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLS  966
              C+ DV PYL+  TSD ISRTAFG SY EG ++F LQ EQAE   +   S+Y P W  + 
Sbjct  191   SCEVDVWPYLQNLTSDAISRTAFGSSYQEGTRIFELQREQAEHVIKASQSIYIPGWRFVP  250

Query  965   SKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------G  813
             +KR++RM EI+ E++  ++ +I +R + MK      ++    LL    +          G
Sbjct  251   TKRNKRMKEIEKEVQSSIRSIISRRIKAMKAGEASSEDLLGILLESNFQEIKQHGNKSFG  310

Query  812   FSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGL  633
              + DEV+EEC+ FYFAGQE+TS  LVW +ILLS    WQ RAR+EV QVFG   PDFD L
Sbjct  311   MTIDEVVEECKLFYFAGQETTSVLLVWTLILLSRFPDWQKRAREEVLQVFGSQTPDFDSL  370

Query  632   NRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGA  453
             N LKI+TMILNEVLRLYPP     R + EETKLG++ LP  + + L  +L+    ++WG 
Sbjct  371   NHLKIVTMILNEVLRLYPPVVGLGRKVTEETKLGKLTLPAGVQISLPIILLHHSREIWGD  430

Query  452   DAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLS  273
             DA +F PERF+EGVAKA K +  F PFGWGPR CIG  FAMMEAK+A+A ILQRFSF LS
Sbjct  431   DAMDFNPERFSEGVAKAQKRQGIFFPFGWGPRICIGQMFAMMEAKVALAMILQRFSFELS  490

Query  272   PSYAHSPCFVVTLKPQFGAPLVLHKI  195
             PSY H+P  ++TL+PQ GA L+LHK+
Sbjct  491   PSYTHAPQTIITLQPQHGAHLLLHKL  516



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   504 bits (1297),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 251/504 (50%), Positives = 341/504 (68%), Gaps = 8/504 (2%)
 Frame = -2

Query  1685  ISVPAVVI--WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSK  1512
             ISV  VV+  W  R+++WVW KP+ LE +LR QGL G SY +  GD K  + +  +A+SK
Sbjct  10    ISVAIVVVSWWIWRILKWVWFKPKMLESYLRGQGLPGTSYTLLVGDVKRNSNMLLEARSK  69

Query  1511  PINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKP  1332
             PI L+DDI  RV+P+       +G+N F W GP P + + +PEL++EVF     F++P  
Sbjct  70    PIKLTDDIASRVVPYPLQMAKTHGRNFFTWLGPIPSITLMDPELIKEVFNKIYNFQKPNV  129

Query  1331  HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSE  1152
              PL + + +GL  Y+D +WA+HR+II+PAF+ +KIK M P+   SC E++  KW+ L S+
Sbjct  130   FPLGRLVATGLFSYDDDKWAKHRRIINPAFHIEKIKSMVPAFHQSCSEVV-GKWDKLASD  188

Query  1151  KNW-CDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWW  975
             K   C+ DV P+L + T DVISRTAFG SY EG+++F LQ+E  EL  Q +   + P + 
Sbjct  189   KGLSCEVDVWPWLGSLTGDVISRTAFGSSYKEGHRIFELQSELTELLIQAVQRFFIPGYR  248

Query  974   LLSSKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFS  807
              L +K +RRM     E++ +++G+I KR    E G               LG    +G S
Sbjct  249   YLPTKDNRRMKVAAREVQDILRGIINKRLAAREAGEAPSNDLLGTLLESNLGEGKGNGMS  308

Query  806   TDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNR  627
              ++V+EEC+ FYFAGQE+TS  LVW MILLS HQ WQ RAR+EV+Q FG  +PD +GLN 
Sbjct  309   IEDVMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQAFGDKEPDTEGLNH  368

Query  626   LKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADA  447
             LK++TMI NEVLRLYPP     R +++ETKLG+M LP  + + L  LLVQ D ++WG DA
Sbjct  369   LKVMTMIFNEVLRLYPPVIQLTRAIHKETKLGDMTLPSGVHITLPILLVQHDTELWGNDA  428

Query  446   GEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPS  267
              EFKPERF +G++KATK++++F PFGWGPR CIG N AM+EAK+A+A ILQRFSF LSPS
Sbjct  429   AEFKPERFKDGISKATKSQVSFFPFGWGPRICIGQNLAMLEAKMAMALILQRFSFELSPS  488

Query  266   YAHSPCFVVTLKPQFGAPLVLHKI  195
             Y H+P  V T+ PQFGAPL+LHK+
Sbjct  489   YVHAPLPVFTVHPQFGAPLILHKL  512



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   504 bits (1297),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 253/501 (50%), Positives = 342/501 (68%), Gaps = 12/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V+ WA R++ +VWLKP+ LEK LRQ+G  GNSY+  +GD KEM+ +  +A SKP+N S D
Sbjct  19    VLRWAWRILNYVWLKPKYLEKQLRQEGFKGNSYKFLFGDMKEMSKMGEEALSKPVNFSHD  78

Query  1490  IL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             ++ PRV PF H  +T YGKN FVW GP P V+I +PE+++EV M N +F++P  +PL K 
Sbjct  79    MIWPRVNPFIHKIITNYGKNSFVWFGPKPAVVIMDPEVIKEVMMKNYVFQKPGGNPLTKL  138

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             L +G+A YE  +WA HR++++PAF+ DK+K M P+   +  EM + KWE + S ++  + 
Sbjct  139   LATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTASEM-LGKWEKIVS-RDGSEI  196

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV  YL+  TSD ISRTAFG SY EG K+F LQ EQ +L  QV  +VY P W  L +KR+
Sbjct  197   DVLSYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILQVSRTVYIPGWRFLPTKRN  256

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvg--------dddeenldllgvlLKSGFSTDE  798
             +RM +I NE+R L+  +I KR R ++                          K   S DE
Sbjct  257   KRMKQIFNEVRTLIFEIINKRMRMIEAGESHDDLLGILLSSNLKEIQQHGNKKFSMSIDE  316

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW MILLS H  WQDRAR+EV QVFG N+ D+D LN+LK+
Sbjct  317   VIEECKLFYFAGQETTSTLLVWTMILLSQHPNWQDRAREEVLQVFGSNEVDYDKLNQLKV  376

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMILNEVLRLYP      R +  +T LG + LP  + L+L ++L+Q D ++WG DA EF
Sbjct  377   VTMILNEVLRLYPAGYMMTRMVQTKTNLGNLCLPGGVQLLLPTILLQHDTEIWGDDAMEF  436

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERF++G+ KATK +L F PFGWGPR CIG NFAM+EAK+A+A IL+ ++F LS SY+H
Sbjct  437   NPERFSDGILKATKGQLVFFPFGWGPRICIGQNFAMLEAKMAMAMILKHYAFELSSSYSH  496

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P   + L+PQ+GAPL+L+K+
Sbjct  497   AP-HPLMLQPQYGAPLILYKL  516



>ref|XP_007022099.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13624.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=518

 Score =   504 bits (1297),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 256/514 (50%), Positives = 347/514 (68%), Gaps = 12/514 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +  L  F+ V  ++I   R++ WVWLKP++LE+ LR+QGL GNSYR   GD KE + ++ 
Sbjct  7     IGTLLSFLVV-GILIGGWRILDWVWLKPKRLERCLRKQGLRGNSYRFLSGDIKESSDMSK  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A+SKP+ LSDDI   V PF H  V  YGKN FVW GP PRV I EPE ++E+F     F
Sbjct  66    QARSKPMPLSDDIAQYVSPFLHQTVKNYGKNSFVWIGPRPRVTIMEPEQIREIFTKFNDF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P+ +P+   LV GLA  + ++WA+HR II+PAF+ DK+K M P+   SC EMI  KWE
Sbjct  126   QKPRSYPVGNLLVCGLANLQGEEWAKHRNIINPAFHQDKLKNMLPAFYQSCIEMI-SKWE  184

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              +   +   + DV PYL   T DVISR AFG SY EG ++F L ++Q  LT QVI SVY 
Sbjct  185   KMVFVEGSSELDVWPYLINLTRDVISRAAFGSSYEEGRRIFQLLDDQINLTMQVIQSVYI  244

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P  W L +K +R++  I  +I+ L+K +I KRE+ +K      D+    L+   +K    
Sbjct  245   PGSWFLPTKTNRKLKVIVKDIKDLLKEMIKKREKAIKAGEASKDDLLGILVESNIKEIQE  304

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S ++VIE+C+ FYFAGQE+TS  LVW MILL+ H  WQ +AR EV QVFG 
Sbjct  305   HGDHKNMGMSIEDVIEDCKLFYFAGQETTSILLVWTMILLARHPHWQTKARAEVSQVFGD  364

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             +KPD +G+NRLK++TMIL EVLRLYP +    R++ +ETKLG+M LP  + + L  LL+ 
Sbjct  365   SKPDSNGMNRLKVVTMILYEVLRLYPAAIALTRSVPKETKLGKMLLPAGVEISLPVLLIH  424

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EF P+RF+EGV+K TK+++ + PFGWGPR CIG NFA+MEAK+A+A IL
Sbjct  425   HDQELWGKDAHEFNPDRFSEGVSKPTKSQVIYFPFGWGPRMCIGMNFALMEAKMALAMIL  484

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ++F   +SPSYAHSPC  +TL+PQ GA L+LHK+
Sbjct  485   RQFWLEISPSYAHSPCIFLTLRPQHGAHLILHKL  518



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   504 bits (1297),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 259/529 (49%), Positives = 353/529 (67%), Gaps = 21/529 (4%)
 Frame = -2

Query  1742  LSNPTMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVF  1563
             + N    +I +   I+FL       V  A  +++W+W+KP+KLE  LR+QGL GNSY +F
Sbjct  1     MGNAHNSKIAAICLIIFL-------VYKAWELLKWIWIKPKKLESCLRKQGLKGNSYGLF  53

Query  1562  YGDTKEMATLTAKAKSKPI-NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEP  1386
             YGD KE++    +  SKPI NLS+++ PR++P+Y   + KYGK CFVW GP P ++I+EP
Sbjct  54    YGDMKELSKSLKEINSKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEP  113

Query  1385  ELMQEVFMNNTLFKRPK-PHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPS  1209
             EL++E+F  N +F++P  P+PL K L  G+  YE+++WA+HRKI++PAF+ +K+K M P+
Sbjct  114   ELIKEIFGKNYVFQKPNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPA  173

Query  1208  VTSSCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNE  1029
                SC EM + KWE +   K   + D+ P+L+  TSDVISR AFG SY EG ++F LQ E
Sbjct  174   FYLSCSEM-LNKWEEIIPVKESNELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEE  232

Query  1028  QAELTRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddee  849
             QAE   +  +SVY P      +K ++RM E + E+R  +  LI  R +  +E  G    +
Sbjct  233   QAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITCLIDNRLKAKEEGNGKALND  292

Query  848   nldllgvlLKS-----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQT  702
             +L  + +   S           G S  EVIEEC+ FYFAGQE+TS  LVW +ILL  +  
Sbjct  293   DLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPE  352

Query  701   WQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMK  522
             WQ+RAR+EV Q FG +KP FD L RLKI+TMIL E LRLYPP     R   EETKLGE+ 
Sbjct  353   WQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELD  412

Query  521   LPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGN  342
             LP   +L + ++L+  D ++WG DA EF PERF+EGVAKATK ++ + PFG GPR CIG 
Sbjct  413   LPKGALLFIPTILLHLDREIWGEDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQ  472

Query  341   NFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             NFA++EAK+AIA ILQRFSF LSPSY HSP  VVTLKP++GAPL++H++
Sbjct  473   NFAILEAKMAIAMILQRFSFELSPSYTHSPYTVVTLKPKYGAPLIMHRL  521



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score =   504 bits (1297),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 246/513 (48%), Positives = 345/513 (67%), Gaps = 11/513 (2%)
 Frame = -2

Query  1703  SILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             S +F  I +  +++WA +++ W+WL+P+KLEK LR+QGL GN YR+  GD KE      K
Sbjct  5     SAIFGCIILLIMLVWAWKMLHWLWLRPKKLEKLLREQGLKGNPYRLLVGDMKEFFKSEMK  64

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             A+SKP+NLSDDI+ RV P+    VTK+GKN F+W GP PRVI+++PEL+++VF     F+
Sbjct  65    ARSKPMNLSDDIVSRVFPYGQQTVTKHGKNSFIWFGPTPRVILTDPELVKDVFNKMYDFQ  124

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +P  +PL++ L +GL  +E+++W  HRKII+PAF+ +K+K M P +  SC +MI  KWE 
Sbjct  125   KPNSNPLIRLLATGLITHEEEKWRMHRKIINPAFHLEKLKMMLPVIFESCNDMI-NKWER  183

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
             + S    C+ DV P ++   SDVI+RTAFG SY EG ++F LQ EQAE+T +++  VY P
Sbjct  184   MLSSDGSCEIDVWPSIQNLASDVIARTAFGSSYEEGIRIFQLQKEQAEITMEILMKVYIP  243

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  L +  +RR+ EID  I   +  +I KRE  +K      ++    LL    K     
Sbjct  244   GWRFLPTTTNRRLKEIDRVIIASLTKIINKRENAIKAGETPKNDLLGILLESNHKEIKEN  303

Query  815   ------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                   G + D+VI+EC+ FY AG+E+TS  LVW MILLS H  WQ RAR+EV QVFG+ 
Sbjct  304   NNNKNVGMNIDDVIKECKLFYLAGEETTSVLLVWTMILLSRHPNWQARAREEVLQVFGNK  363

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             KPDFDGL+ LKI+TMIL EVLRLYPP     R + +  ++G + LP  + + L  + +  
Sbjct  364   KPDFDGLSHLKIITMILYEVLRLYPPLIVLPRAVQKNVRVGNLTLPAGVQIGLPIVWLHH  423

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             + ++WG DA  F PERF+EG+ KAT  +++F PFGWGPR CIG NF+++EAK+AIA ILQ
Sbjct  424   ECELWGDDAKVFNPERFSEGILKATNGKISFFPFGWGPRICIGQNFSLLEAKMAIALILQ  483

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              FSF LSP+YAH+P  ++TL+PQ GA ++L K+
Sbjct  484   HFSFELSPTYAHAPAMIITLQPQHGAHIILRKL  516



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   503 bits (1296),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 245/501 (49%), Positives = 342/501 (68%), Gaps = 13/501 (3%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             WA +++ W+W  P++LEK LR+QG  GN Y++  GD+KE   +  +A SKP++LSDDI+P
Sbjct  19    WAWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVP  78

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSG  1302
             RV  + + +V  +GKN F+W GP PRV I +PE ++++F     F +P  +PL K L +G
Sbjct  79    RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLFKLLATG  138

Query  1301  LACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQP  1122
             LA YE ++W++HR++I+PAF  +K+K M P    SC +++  KWE + S    C+ D  P
Sbjct  139   LAGYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLV-NKWERMLSSDGSCEIDAWP  197

Query  1121  YLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMH  942
             +L+  TSDVI+R+AFG S+ EG ++F LQ EQ +L  QVI  V  P W  L +K  RRM 
Sbjct  198   FLQNMTSDVIARSAFGSSFEEGRRIFQLQREQTKLALQVILKVQIPGWRFLPTKSHRRMK  257

Query  941   EIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS------------GFSTDE  798
             EID +I+  +K +I KRE+ +K+    +D+    LL    K             G S ++
Sbjct  258   EIDRDIKASLKDMIYKREKALKKGEAINDDLLGILLESNHKEIQEHAKGDNKNVGMSLED  317

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ+RAR+EV QVFG+ KP FDGLNRLKI
Sbjct  318   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVFGNQKPSFDGLNRLKI  377

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMILNEVLRLYPP+    R    + KLG + LP  + + L ++LV  D + WG DA +F
Sbjct  378   VTMILNEVLRLYPPALGMNRLAKRDLKLGNITLPAGVQIFLPTVLVHHDCEFWGEDAKQF  437

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERF+EGV KATK R++F PFGWGPR CIG NF+++EAK+A++ ILQ FSF LSP+YAH
Sbjct  438   NPERFSEGVLKATKGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAH  497

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  ++TL+PQ+GA ++LHK+
Sbjct  498   APAMLITLQPQYGAHIILHKV  518



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   503 bits (1296),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 254/514 (49%), Positives = 346/514 (67%), Gaps = 14/514 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +S+ FL +    +++W  R++ WVW++P++LE+ LR+QGL GNSYR   GD KE   ++ 
Sbjct  9     ISLSFLVV---GILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A+SKP+ LSDDI   V PF H  V   GK+ F W GP PRV I EPE ++E+F     F
Sbjct  66    QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P  +PLV  LVSGL   + ++WA+HRKII+PAF+ DK+K M P+   SC EMI  KWE
Sbjct  126   QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMI-SKWE  184

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              L   +   + DV PYL   T DVISR AFG SY EG ++F L  +Q  LT QV+ S Y 
Sbjct  185   KLVFLEGSSELDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQSAYI  244

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +K +R+M  I  +I+  +KG+I KRE   K     +D+    L+   ++    
Sbjct  245   PGWRYLPTKTNRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQE  304

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S ++VIEEC+ FYFAGQE+TS  LVW MILL+ H  WQ +AR+EV +VFG 
Sbjct  305   QGDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTKAREEVLEVFGD  364

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             +KPD DGLNRLK++TMIL+EVLRLYP      R++ ++T+LG++ LP    + L  LL+ 
Sbjct  365   SKPDSDGLNRLKVVTMILHEVLRLYPAVVALGRSVPKDTRLGKLLLPAGAEITLPVLLIH  424

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EF P+RF+EGV+KATK+++ + PFGWGPR CIG NFA+MEAK+A+A IL
Sbjct  425   HDQELWGDDAHEFNPDRFSEGVSKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAMIL  484

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ++F F LSPSYAHSPC  +TL+PQ GA ++LHK+
Sbjct  485   RQFWFELSPSYAHSPCTNITLRPQHGAHIILHKL  518



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   503 bits (1295),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 248/514 (48%), Positives = 339/514 (66%), Gaps = 11/514 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
              S + L + +   +  A RV+ W+WL+P++LE+ LR+QGL GN YR+  GD KE+  +  
Sbjct  4     ASCVCLVVILILALTLAWRVLNWLWLRPKRLERLLREQGLQGNPYRLLVGDLKEIMNMQK  63

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +  SKP+NLS DI+PRV  F    +  +GKN F+W G  PRVII+EPEL+++V      F
Sbjct  64    EVTSKPMNLSHDIVPRVFSFLQHTLNTHGKNSFIWFGRKPRVIITEPELIKDVLNKMHDF  123

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
              +P   PLVK L +GL  +E ++W +HR+IISPAF  +K+K M P    SC ++I+K WE
Sbjct  124   PKPDTSPLVKLLATGLLNHEGEKWNKHRRIISPAFNLEKLKNMLPIFYKSCNDLIIK-WE  182

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
              + S    C+ DV P+L+  +SD I+RTAFG SY EG K+F L  EQAEL  + I  +Y 
Sbjct  183   EMLSSDGSCEIDVWPFLQNLSSDAIARTAFGSSYEEGRKIFQLLKEQAELAMKAIMKLYI  242

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W  L +   RRM EID EI+  +  +I  RE+ +K     +++    LL    K    
Sbjct  243   PGWRFLPTANHRRMKEIDREIKASLTDMISNREKALKAGEATENDLLGILLESNHKETEE  302

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S ++VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG 
Sbjct  303   HGNSKNVGMSLEDVIEECKLFYFAGQETTSALLVWTMVLLSRYPDWQARAREEVLQVFGK  362

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
              KP+FDGL+ LKI++MILNEVLRLYPP+    R +  + KLG + LP  + + L + +V 
Sbjct  363   QKPNFDGLSHLKIVSMILNEVLRLYPPAVGLNRNVDRDMKLGNLSLPAGVQVSLPTTMVH  422

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG D  EFKPERF+EGV KAT  R++F PFGWGPR CIG NF+++EAK+A++TIL
Sbjct  423   HDRELWGDDVNEFKPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSTIL  482

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             Q FSF LSP+YAH+P  V TL+PQ+GA ++L K+
Sbjct  483   QHFSFELSPAYAHAPVTVFTLQPQYGAHVILRKV  516



>ref|XP_009394210.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   503 bits (1296),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 249/501 (50%), Positives = 347/501 (69%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             + WA RV+ W W +PR+LE+ LR QGL G +YR  YGD KE A  + +A++K + L+ +I
Sbjct  23    LAWASRVLNWAWWRPRRLERALRAQGLKGTAYRFPYGDLKENARFSKEARAKSMPLAHNI  82

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLFKRPKPHPLVKFL  1311
             +PR+LPFYH A+ +YGK  F WSGP P+V I++PEL++EV  N    F +P  +PL +F 
Sbjct  83    IPRLLPFYHRAMDEYGKISFTWSGPVPQVAITDPELVREVLSNKFGHFGKPNQNPLARFF  142

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GLA YE ++W +HR+I++PAF+ +K+K M P+ ++ C ++ M +WE +   +   + D
Sbjct  143   ARGLAVYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCSDL-MDRWENMAGSEACYELD  201

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P L++FT DVISRTAFG S+ EG  +F LQ EQAEL  QV+ ++Y P +  L + +++
Sbjct  202   VWPELQSFTGDVISRTAFGSSHKEGRPIFQLQAEQAELLIQVVQNLYVPGYRFLPTPKNK  261

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---------SGFSTDE  798
             R+  ID EIR +++G+I KRE+ +K     +D+    L+   +K         +G +T++
Sbjct  262   RIRAIDREIRSILRGIIKKREQDIKTGKASNDDLLGLLMESNMKHLQEDGNKNAGMTTED  321

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  L W MI LS+H TWQ RAR+EV +VFG +KPDFDGLN LKI
Sbjct  322   VIEECKLFYFAGQETTSVLLTWTMICLSMHPTWQIRAREEVLRVFGDDKPDFDGLNHLKI  381

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R  Y+  KLG++  PP ++L+L  + V  DP++WG D  EF
Sbjct  382   VTMILYEVLRLYPPFILLRRQTYKPMKLGDVVYPPGVLLLLHVIFVHHDPNLWGKDVSEF  441

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERFAEGV+KA+K ++AF PFG GPR CIG NFA++EAK+ ++ ILQ FSF LSPSYAH
Sbjct  442   NPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSPSYAH  501

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  V TL PQ GA + L K+
Sbjct  502   APHAVFTLHPQHGAQIRLRKL  522



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   503 bits (1295),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 252/502 (50%), Positives = 349/502 (70%), Gaps = 13/502 (3%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V+ WA +++ +VWLKP++LEK+LRQQG  GNSY+  +GD KEM  +  +A SKPIN S D
Sbjct  20    VLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKEMKKMGEEAMSKPINFSHD  79

Query  1490  IL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             ++ PRV+PF H  +T YGKNC VW GP P V+I++PEL++EV   N ++++P  +PL K 
Sbjct  80    MIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKEVLTKNFVYQKPLGNPLTKL  139

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
               +G+A YE  +WA HR++++PAF+ DK+K M P+   +  EM+ K  ++++   N  + 
Sbjct  140   AATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTASEMLSKLEKVVSP--NGTEI  197

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV PYL+  TSD ISRTAFG SY EG K+F LQ EQ  L  +V  ++Y P W  L +KR+
Sbjct  198   DVWPYLQTLTSDAISRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFLPTKRN  257

Query  953   RRMHEIDNEIRGLMKGLIGKR----ERG-----MKEKvgdddeenldllgvlLKSGFSTD  801
             +RM +I NE+R L+ G+I KR    E G     +   +   + + +   G   K G S D
Sbjct  258   KRMKQIFNEVRALVFGIIKKRMSMIENGEAPDDLLGILLASNLKEIQQHGNNKKFGMSID  317

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             EVIEEC+ FYFAGQE+TS  LVW MILL  +  WQD+AR+EV QVFG  + D+D LN+LK
Sbjct  318   EVIEECKLFYFAGQETTSSLLVWTMILLCKYPNWQDKAREEVLQVFGSREVDYDKLNQLK  377

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             I+TMILNEVLRLYP      R + +ETKLG + LP  + L+L ++L+Q D ++WG DA E
Sbjct  378   IVTMILNEVLRLYPAGYVINRMVNKETKLGNLCLPAGVQLVLPTMLLQHDTEIWGDDAME  437

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERF++G++KATK +L F PF WGPR CIG NFAM+EAK+A+A IL+ ++F LSPSYA
Sbjct  438   FNPERFSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKTYAFELSPSYA  497

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P   + L+PQ+GA L+L+K+
Sbjct  498   HAP-HPLLLQPQYGAQLILYKL  518



>ref|XP_010465361.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   503 bits (1294),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 248/495 (50%), Positives = 337/495 (68%), Gaps = 7/495 (1%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             W  R + WVW KP+ LE +LR+QGL G  Y    GD K  +++ A+A+SKPI L+DDI P
Sbjct  20    WVWRTLNWVWFKPKMLESYLRRQGLAGTPYTPLVGDVKRNSSMLAEARSKPIQLTDDITP  79

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSG  1302
             RV+PF+   +  +G+  F W GP P V I +PEL++EVF N   F++   +PL + + +G
Sbjct  80    RVVPFHLHMLKTHGRTFFTWLGPIPTVTIMDPELIKEVFNNVNDFQKAHSNPLGRLIATG  139

Query  1301  LACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW--CDFDV  1128
             L  Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++  +W+ L  +K    C+ DV
Sbjct  140   LVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVV-GQWDKLVLDKEGLSCEMDV  198

Query  1127  QPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRR  948
              P+L + T+DVISRTAFG SY EG ++F LQ E A L  Q     + P +  L +K +RR
Sbjct  199   WPWLVSLTADVISRTAFGSSYKEGQRIFELQAELARLLIQNFRKAFIPGYNYLPTKGNRR  258

Query  947   MHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFSTDEVIEECQ  780
             M     EI+ +M G++ +R    E G               LG    +G ST+E++EEC+
Sbjct  259   MKAAAREIKVIMGGIVNRRLRAREAGDAPSDDLLGILLESNLGQEKGNGMSTEELMEECK  318

Query  779   HFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILN  600
              FYFAGQE+T+  LVW M+LLS HQ WQ RAR+EV+QVFG  +PD +GLN+LK++TMIL 
Sbjct  319   LFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGAKEPDTEGLNQLKVMTMILY  378

Query  599   EVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFA  420
             EVLRLYPP     R +++E KLG+M LP  + + L  LLVQRD ++WG DAGEFKPERF 
Sbjct  379   EVLRLYPPVTQLTRAIHKEMKLGDMTLPSGVQISLPILLVQRDTELWGNDAGEFKPERFK  438

Query  419   EGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVV  240
             +GV+KATKN+++F PF WGPR CIG NFAM+EAK+A+A ILQ+FSF LSPSY H+P  V+
Sbjct  439   DGVSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYVHAPHTVI  498

Query  239   TLKPQFGAPLVLHKI  195
             T+ PQFGAPL+LHK+
Sbjct  499   TIHPQFGAPLILHKL  513



>ref|XP_008226302.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=518

 Score =   503 bits (1295),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 248/515 (48%), Positives = 343/515 (67%), Gaps = 12/515 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             VS + + I    ++    +VV WVWLKP+KLE++LRQQGL+GNSYR+  GD  + + +T 
Sbjct  5     VSSMVVAILCVGLITLGWKVVNWVWLKPKKLERYLRQQGLSGNSYRLLIGDLTDNSKMTK  64

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A SKP+  S DI+P VLP       KYGK  F+W GP P V+I + ELM+E    + +F
Sbjct  65    EALSKPMEFSHDIVPYVLPLLQETFNKYGKKSFIWLGPVPSVVIFDAELMRETLTKHRVF  124

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P  +PL+ FLV+GL  YE  +W +H++II+PAF+ DK+K M P+  ++CE M + KWE
Sbjct  125   EKPHSNPLLSFLVTGLLSYEGDKWVKHKRIINPAFHIDKMKDMLPAFHAACENM-LSKWE  183

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
                S K  C+ DV PYL AF+ D ISR AFG ++ EG + F LQ EQ  LTR+V++SVY 
Sbjct  184   THFSSKETCELDVWPYLCAFSGDAISRAAFGSNFEEGERFFELQKEQGALTREVLNSVYI  243

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P    L +K +R M +I +E+   ++G+I KRE+ M+     +D+    LL         
Sbjct  244   PLLRFLPTKMNRSMKQISDEMAICLRGIINKREKAMRAGEATEDDLLGILLKSNFSEIQE  303

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S +EVIEEC+ FY AG+++T D + W ++LL  HQ WQ RAR+EV Q+F +
Sbjct  304   HGDDKDVGMSIEEVIEECKVFYLAGEDTTKDLINWTLVLLGKHQDWQRRAREEVVQIFKN  363

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
              +PD  GLNRLKI+ MIL EVLRLYPP+ +TIR + +ETKLG++ LPP + L +  L V 
Sbjct  364   KQPDHAGLNRLKIVNMILYEVLRLYPPAIFTIREITKETKLGDISLPPGVQLAVPILFVH  423

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLA-FLPFGWGPRTCIGNNFAMMEAKIAIATI  300
              D ++WG D  EFKPERF+EG++KA+KN +A F  F  GPRTCIG NFA+MEAK  I  I
Sbjct  424   HDKEIWGDDVHEFKPERFSEGISKASKNEVAPFFSFSTGPRTCIGQNFALMEAKTVITMI  483

Query  299   LQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LQRF+F LSP+Y HSP  ++TL+PQ+G  ++ HKI
Sbjct  484   LQRFTFELSPAYRHSPLNMLTLEPQYGTQIIFHKI  518



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   503 bits (1295),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 257/501 (51%), Positives = 346/501 (69%), Gaps = 12/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V IW  RV+ W+W +P+KLE  LR+QGL GNSY+V YGD KE + +  +A SKP++LSDD
Sbjct  22    VCIW--RVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKPMSLSDD  79

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             + PR++PF+   + KYGK  F+W GP P V+I +PEL++EV     L+++P  +PL   L
Sbjct  80    VAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGNPLATLL  139

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
             V G+A YE+ +WA+HRKII+PAF+ +K+K M P+   SC EM + KWE + S  +  + D
Sbjct  140   VQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEM-LSKWEDIVSADSSHEID  198

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V  +LE  T DVISRTAFG SY EG K+F LQ EQA+   +V  SVY P    L +KR+R
Sbjct  199   VWSHLEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPTKRNR  258

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTDE  798
             RM EI  ++R  +KG+I KR + MK    ++++    LL   +K          G S +E
Sbjct  259   RMKEIKKDVRASIKGIIDKRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGMSIEE  318

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  L+W ++LLS +Q WQ RAR+E+ QVFG  KPDFDGLN LKI
Sbjct  319   VIEECKLFYFAGQETTSVLLLWSLVLLSRYQDWQARAREEILQVFGSRKPDFDGLNHLKI  378

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL E LRLYP      R   E+  LGE+ LP  +++ L  +L+  D ++WG DA EF
Sbjct  379   VTMILYESLRLYPSLITLTRRCNEDIVLGELSLPAGVLVSLPLILLHHDEEIWGEDAKEF  438

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
             KPERF EG++ ATK +L + PF WGPR CIG NFAM+EAK+A++ ILQRFSF LSPSYAH
Sbjct  439   KPERFREGISSATKGQLTYFPFSWGPRICIGQNFAMLEAKMALSMILQRFSFELSPSYAH  498

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  ++T++PQ+GAPL+ HK+
Sbjct  499   APRSIITVQPQYGAPLIFHKL  519



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   503 bits (1294),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 253/501 (50%), Positives = 345/501 (69%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             +++  +V+ W W  P+K+EK LRQ+GL GN Y++ YGD  E+     +AKSKPIN SDDI
Sbjct  17    LVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPINFSDDI  76

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPHPLVKFL  1311
               R++PF+  A+ K GKN FVW GP P V+I++PE ++E+F  N ++ K+  P+P  K L
Sbjct  77    AQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLL  136

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL   E+ +WA+HRKIISPAF+ +K+K M P+   SC EMI  KWE +  ++   + D
Sbjct  137   AHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMI-SKWEEVVPKETSFELD  195

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P L+  TS+VISRTAFG SY EG  VF LQ EQAE    +  S+Y P    L +KR++
Sbjct  196   VWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMDIGRSIYIPGSRFLPTKRNK  255

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTDE  798
             RM EI+ +++  ++ +I KR + M+E     D+    LL   LK          G +T E
Sbjct  256   RMLEIEKQVQTTIRRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRNDLGITTSE  315

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW MILL +H  WQ RAR+EV Q+FG++KPD +GL+RLKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRARKEVLQIFGNDKPDLEGLSRLKI  375

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL E LRL+PP P   R   EE KLGE+ LP  ++L++ ++LV  D ++WG DA EF
Sbjct  376   VTMILYETLRLFPPLPAFGRRNKEEVKLGELHLPAGVLLVIPAILVHYDKEIWGEDAKEF  435

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
             KPERF+EGV+KAT  +++F+PF WGPR CIG NFAMMEAK+A+  ILQ+FSF LSPSY H
Sbjct  436   KPERFSEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVTMILQKFSFELSPSYTH  495

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  +VT+ PQ+GAPL++ ++
Sbjct  496   APFAIVTIHPQYGAPLLMRRL  516



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   503 bits (1294),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 253/501 (50%), Positives = 345/501 (69%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             +++  +V+ W W  P+K+EK LRQ+GL GN Y++ YGD  E+     +AKSKPIN SDDI
Sbjct  17    LVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPINFSDDI  76

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPHPLVKFL  1311
               R++PF+  A+ K GKN FVW GP P V+I++PE ++E+F  N ++ K+  P+P  K L
Sbjct  77    AQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLL  136

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL   E+ +WA+HRKIISPAF+ +K+K M P+   SC EMI  KWE +  ++   + D
Sbjct  137   AHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMI-SKWEEVVPKETSFELD  195

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P L+  TS+VISRTAFG SY EG  VF LQ EQAE    +  S+Y P    L +KR++
Sbjct  196   VWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMDIGRSIYIPGSRFLPTKRNK  255

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTDE  798
             RM EI+ +++  ++ +I KR + M+E     D+    LL   LK          G +T E
Sbjct  256   RMLEIEKQVQTTIRRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRNDFGITTSE  315

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW MILL +H  WQ RAR+EV Q+FG++KPD +GL+RLKI
Sbjct  316   VIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRARKEVLQIFGNDKPDLEGLSRLKI  375

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL E LRL+PP P   R   EE KLGE+ LP  ++L++ ++LV  D ++WG DA EF
Sbjct  376   VTMILYETLRLFPPLPAFGRRNKEEVKLGELHLPAGVLLVIPAILVHYDKEIWGEDAKEF  435

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
             KPERF+EGV+KAT  +++F+PF WGPR CIG NFAMMEAK+A+  ILQ+FSF LSPSY H
Sbjct  436   KPERFSEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVTMILQKFSFELSPSYTH  495

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  +VT+ PQ+GAPL++ ++
Sbjct  496   APFAIVTIHPQYGAPLLMRRL  516



>ref|XP_006495010.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=519

 Score =   503 bits (1294),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 241/503 (48%), Positives = 351/503 (70%), Gaps = 12/503 (2%)
 Frame = -2

Query  1673  AVVIWACR---VVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN  1503
             A++  AC    ++ WVWLKP+KLEK+LR+QG +GNSY+VF+GD KE+A  T +AKS+PI+
Sbjct  19    AILAVACAWWMLLNWVWLKPKKLEKFLRKQGFSGNSYKVFHGDMKELAQTTKEAKSRPIS  78

Query  1502  LSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPL  1323
             LSDDI  R+LPF+H  +T +GKN F+W GP P + I++P++++E+F+   +F++P+  PL
Sbjct  79    LSDDIARRILPFHHHIITNFGKNSFIWMGPRPNIHITDPKMIREIFLKYDIFQKPRS-PL  137

Query  1322  VKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW  1143
             VK LV+G+A Y  +QW + RKI +PAF+ DK+K M P++  SC +M ++KWE+  S+   
Sbjct  138   VKLLVTGMADYAGEQWFKVRKIATPAFHHDKLKNMLPTIHKSCNDM-LRKWEISVSKDES  196

Query  1142  CDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSS  963
             C+ DV P+++  T+DVISRTAFG S+ EG K+F++  EQ  L  Q     Y P W  + +
Sbjct  197   CELDVWPHIQTLTADVISRTAFGSSFEEGRKIFAVLREQINLLIQASFFAYIPGWRFVPN  256

Query  962   KRSRRMHEIDNEIRGLMKGLIGKRERGMK-------EKvgdddeenldllgvlLKSGFST  804
             + +R++    NE   L+KG+I K+E  +K       + +     E+        ++G S 
Sbjct  257   RLNRKLKSNHNETGELVKGIINKKEEALKVGKASNNDDLLGILMESNHKEIQEKETGLSI  316

Query  803   DEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRL  624
             +EVIEEC+ FY AGQE+T+  LVW M+LL IH  WQ+RAR+EV QVFG+ +P F+ LN+L
Sbjct  317   EEVIEECKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQL  376

Query  623   KILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAG  444
             K+++ IL EVLRLY P+P   R   +E KLGE+ +PP + L L  +LV  D + WG DA 
Sbjct  377   KVVSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAK  436

Query  443   EFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSY  264
             +F PERF+EGV+KA+KN+++F  FGWGPR CIG NFA++E+K+A+A ILQ+F+F LSP+Y
Sbjct  437   KFNPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTY  496

Query  263   AHSPCFVVTLKPQFGAPLVLHKI  195
              H+P    T+ PQ GA ++LHKI
Sbjct  497   IHAPTRGATVYPQHGANIILHKI  519



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   503 bits (1294),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 244/501 (49%), Positives = 344/501 (69%), Gaps = 13/501 (3%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             WA +++ W+W  P++LEK LR+QG  GN Y++  GD+KE   +  +A SKP++LSDDI+P
Sbjct  19    WAWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVP  78

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSG  1302
             RV  + + +V  +GKN F+W GP PRV I +PE ++++F     F +P  +PL+K L +G
Sbjct  79    RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLLKLLATG  138

Query  1301  LACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQP  1122
             LA YE ++W++HR++I+PAF  +K+K M P    SC +++  KWE + S    C+ D  P
Sbjct  139   LADYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLV-NKWERMLSSDGSCEIDAWP  197

Query  1121  YLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMH  942
             +L+  TSDVI+R+AFG S+ EG ++F LQ EQA+L  QVI  +  P W  L +K  RRM 
Sbjct  198   FLQNMTSDVIARSAFGSSFEEGRRIFQLQREQAKLALQVILKIQIPGWRFLPTKSHRRMK  257

Query  941   EIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS------------GFSTDE  798
             EID +I+  +K +I KRE+ +K+    +D+    LL    K             G S ++
Sbjct  258   EIDRDIKASLKDMIYKREKALKKGEAINDDLLGILLESNHKEIQEHAKGDNKNVGMSLED  317

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ+RAR+EV QVFG+ KP FDGLNRLKI
Sbjct  318   VIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVFGNQKPSFDGLNRLKI  377

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMILNEVLRLYPP+    R    + KLG + LP  + + L ++LV  + + WG DA +F
Sbjct  378   VTMILNEVLRLYPPALGMNRLAKRDLKLGNIILPAGVQIFLPTVLVHHNCEFWGEDAKQF  437

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERF+EGV KATK R++F PFGWGPR CIG NF+++EAK+A++ ILQ FSF LSP+YAH
Sbjct  438   NPERFSEGVLKATKGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAH  497

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  ++TL+PQ+GA ++LHK+
Sbjct  498   APAMLITLQPQYGAHIILHKV  518



>ref|XP_008226217.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=522

 Score =   502 bits (1293),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 262/519 (50%), Positives = 348/519 (67%), Gaps = 15/519 (3%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             IQ  V++  + +S+  V+ WA RV+ WVWL+P KLE+ LR+QGL GNSYR+ +GDTKE++
Sbjct  6     IQVCVALSVVLVSI--VIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEIS  63

Query  1538  TLTAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVF  1365
              +  +A+SKPI LS   DI PRV+PF H  V  YG+N FVW GP PRV I  PE +++ F
Sbjct  64    MMVEQAQSKPIKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAF  123

Query  1364  MNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEM  1185
               +  F+R   +P+VK +  GL+  E ++WA+HRKII+PAF+ +K+K M P+   SC EM
Sbjct  124   NKSDEFQRAISNPIVKSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSEM  183

Query  1184  IMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQV  1005
             I  KWE L  ++   + DV PYLE  TSDVISR AFG SY EG K+F L  E+A+     
Sbjct  184   I-NKWESLVFKEGSREMDVWPYLENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIA  242

Query  1004  IHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl  825
               SVY P W  L +K+++RM EI  E+RGL+KG+I KRE  +K            L+   
Sbjct  243   ARSVYIPGWRFLPTKQNKRMKEIHKEVRGLLKGIINKREDAIKAGEAAKGNLLGILMESN  302

Query  824   LK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
              +          +G S ++VI EC+ FYFAGQE+TS  LVW ++LLS +Q WQ RAR+EV
Sbjct  303   FREIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARAREEV  362

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
              QVFG N P +D L+ LK++TMIL EVLRLYP      RT Y++T+LG+  LP  + + L
Sbjct  363   LQVFGTNIPTYDQLSHLKVVTMILLEVLRLYPAVVELPRTTYKKTQLGKFLLPAGVEVSL  422

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
               +L   D ++WG DA EFKPERF+EGV+KATKN+  + PFG GPR CIG NFAM+EAK+
Sbjct  423   HIMLAHHDKELWGEDAKEFKPERFSEGVSKATKNQFTYFPFGAGPRICIGQNFAMLEAKL  482

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             A++ ILQ F+F LSPSYAH+P   +TL PQFGA  +LHK
Sbjct  483   ALSLILQHFTFELSPSYAHAPSVTITLHPQFGAHFILHK  521



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   502 bits (1292),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 257/501 (51%), Positives = 346/501 (69%), Gaps = 12/501 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V IW  RV+ W+W +P+KLE  LR+QGL GNSY+V YGD KE + +  +A SKP++LSDD
Sbjct  16    VCIW--RVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKPMSLSDD  73

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             + PR++PF+   + KYGK  F+W GP P V+I +PEL++EV     L+++P  +PL   L
Sbjct  74    VAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGNPLATLL  133

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
             V G+A YE+ +WA+HRKII+PAF+ +K+K M P+   SC EM + KWE + S  +  + D
Sbjct  134   VQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEM-LSKWEDIVSADSSHEID  192

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V  +LE  T DVISRTAFG SY EG K+F LQ EQA+   +V  SVY P    L +KR+R
Sbjct  193   VWSHLEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPTKRNR  252

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTDE  798
             RM EI  ++R  +KG+I KR + MK    ++++    LL   +K          G S +E
Sbjct  253   RMKEIKKDVRASIKGIIDKRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGMSIEE  312

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  L+W ++LLS +Q WQ RAR+E+ QVFG  KPDFDGLN LKI
Sbjct  313   VIEECKLFYFAGQETTSVLLLWSLVLLSRYQDWQARAREEILQVFGSRKPDFDGLNHLKI  372

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL E LRLYP      R   E+  LGE+ LP  +++ L  +L+  D ++WG DA EF
Sbjct  373   VTMILYESLRLYPSLITLTRRCNEDIVLGELSLPAGVLVSLPLILLHHDEEIWGEDAKEF  432

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
             KPERF EG++ ATK +L + PF WGPR CIG NFAM+EAK+A++ ILQRFSF LSPSYAH
Sbjct  433   KPERFREGISSATKGQLTYFPFSWGPRICIGQNFAMLEAKMALSMILQRFSFELSPSYAH  492

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  ++T++PQ+GAPL+ HK+
Sbjct  493   APRSIITVQPQYGAPLIFHKL  513



>ref|XP_010926866.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   502 bits (1293),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 246/517 (48%), Positives = 352/517 (68%), Gaps = 17/517 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             SW  +  L ++      W  R ++WVW +PR+L++ LR QG+ G  YR  YGD +++  +
Sbjct  12    SWGVVGLLLLAA-----WVVRALEWVWWRPRRLDRVLRDQGIKGTHYRFLYGDVEDVDRV  66

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-  1356
             + +A+SKP+ L+  I+PRVLPF+H  +  +GK  F+W G  PRVI+++PEL++EV     
Sbjct  67    SKEARSKPMPLTHCIVPRVLPFHHQLINDHGKISFMWFGSYPRVILNDPELVREVLSGKF  126

Query  1355  TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMK  1176
               F++PK +PL + LV+G+  YE ++WA+HR+II+PAF+ +K+KCM+P+  + C+E+I K
Sbjct  127   GHFEKPKVNPLARLLVTGVLSYEGEKWAKHRRIINPAFHLEKLKCMSPTFYTCCDELI-K  185

Query  1175  KWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHS  996
             +W++    +  C+ DV P  +  T DVISRTAFG S+ EG ++F L  EQAEL  QVI +
Sbjct  186   RWDMHIRLQGSCELDVWPEFQGLTGDVISRTAFGSSFKEGRRIFQLLEEQAELGIQVIQN  245

Query  995   VYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK-  819
             +Y P +  + +K ++RM EI  EI  L+  +I  RER M+++   DD+    L+    + 
Sbjct  246   IYIPGYRFVPTKTNKRMKEIHREIWALLSRMIEHRERSMRKEGATDDDLLRLLMESNFRY  305

Query  818   ---------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
                      +G + D+VIEEC+ FYFAG E+TS  L W +++L +H +WQ RAR+EV Q+
Sbjct  306   SQEQGGSKNTGMTKDDVIEECKLFYFAGHETTSVLLTWTIVVLGMHPSWQARAREEVLQI  365

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG NKPDFDGL++LKI TMIL EVLRLYPP    +R  Y++ KLG+   PP + L L  L
Sbjct  366   FGKNKPDFDGLSQLKIATMILYEVLRLYPPLSAVVRETYKKMKLGDFSFPPGVQLYLPIL  425

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
             L+  DP  WG DA EF PERFA GV+KA+K + AFLPFGWGPR C+G +FAMMEAK+A+A
Sbjct  426   LIHHDPAFWGEDASEFNPERFASGVSKASKIQGAFLPFGWGPRICVGQSFAMMEAKMALA  485

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              ILQ FSF  SPSYAH+P  VVT+ PQ+GA ++LH++
Sbjct  486   IILQNFSFEPSPSYAHAPYTVVTIHPQYGAQMILHRL  522



>ref|XP_011082965.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=514

 Score =   502 bits (1292),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/506 (48%), Positives = 343/506 (68%), Gaps = 9/506 (2%)
 Frame = -2

Query  1688  FISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKP  1509
              IS    +++A +++ W W +PRKLEK LRQQG  GNSY++F+GD  EM  +T +AKSKP
Sbjct  10    LISCAVALVYAWKILNWAWFRPRKLEKILRQQGFKGNSYKLFFGDFNEMKAMTKEAKSKP  69

Query  1508  INLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH  1329
             ++ S +I+PRV P     V  YG+  F+W GP P VI+ +PE+++E+   + +F++P  +
Sbjct  70    MSFSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKSYVFQKPGGN  129

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  + L  G+A YE  +WA+HR++I+PAF+ +K+K M P+   SC +M + KWE +   +
Sbjct  130   PTSRMLARGIASYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCADM-LSKWEKIVPRE  188

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
               C+ DV PYL+  TSD ISRTAFG SY EG ++F LQ EQAEL  + + +VY P    L
Sbjct  189   GLCELDVWPYLQTLTSDAISRTAFGSSYEEGRRIFELQKEQAELIMEALRTVYIPGSRFL  248

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--------G  813
              +K ++RM++I  E+   + G+I KR + +K      D+    LL   LK         G
Sbjct  249   PTKNNKRMNKIVREVESSVLGIINKRMKAIKAGETAGDDLLGLLLESNLKEIEQHGNKFG  308

Query  812   FSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGL  633
              S  EVIEEC+ FYFAGQE+TS  LVW MILLS H+ WQ+RAR EV Q+FG +KPD+  L
Sbjct  309   MSLKEVIEECKLFYFAGQETTSTLLVWTMILLSKHKDWQERARDEVLQLFGRDKPDYQEL  368

Query  632   NRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGA  453
             N LKI++MI +EVLRLYPP     R   +E+ LG++ LP  + L++ ++L+  D  +WG 
Sbjct  369   NHLKIVSMIFHEVLRLYPPGVMLNRITMKESTLGKVTLPAGVQLLMPAVLLHHDRKIWGD  428

Query  452   DAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLS  273
             DA EFKPERF+EGV+KAT+ +L + PFGWGPR CIG +FAM+EAK+A+A ILQ +SF LS
Sbjct  429   DAEEFKPERFSEGVSKATQGQLVYFPFGWGPRICIGQSFAMLEAKLAMAMILQHYSFELS  488

Query  272   PSYAHSPCFVVTLKPQFGAPLVLHKI  195
             PSY+H+P  V+TL+PQ GA L+L K+
Sbjct  489   PSYSHAPATVITLQPQHGAHLILRKL  514



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   502 bits (1293),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 259/502 (52%), Positives = 342/502 (68%), Gaps = 11/502 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             ++ +  +V+ W W  P+KLE  LRQ+GL GN Y++ YGD  E+     +AKSKPIN SDD
Sbjct  26    LLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKPINFSDD  85

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPHPLVKF  1314
             I  R++PF+  ++ K GK+ F+W GP P V+I++PE ++E+F  N ++ K+  P+P  K 
Sbjct  86    IAQRLIPFFLNSINKNGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTKL  145

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             L  GL   E+ +WA+HRKII+P F+ +K+K M P+    C EMI  KWE +  +    + 
Sbjct  146   LAKGLVSLEEDKWAKHRKIINPTFHVEKLKHMLPAFYVCCSEMI-SKWEEIVPKGTSTEI  204

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV P LE  TS+VISRTAFG SY EG  VF LQ EQAE   +V  S+Y P    L +KR+
Sbjct  205   DVWPDLEKMTSEVISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSRFLPTKRN  264

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTD  801
             +RM EI+ EI+  ++ +I KR R M+      D+    LL   +K          G +T 
Sbjct  265   KRMLEIEKEIQTTIRRIIDKRLRAMEGGETSKDDLLGILLESNMKEIEQHGSKDFGMTTV  324

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             EVIEEC+ FYFAGQE+TS  LVW MILL +H  WQ RAR+EV QVFG++KPD +GL RLK
Sbjct  325   EVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLGRLK  384

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             I+TMIL E LRL+PP P   RT  EE KLGE+ LP  +ILI+ ++LV  D ++WG DA E
Sbjct  385   IVTMILYETLRLFPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYDKEIWGEDAKE  444

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             FKPERF+EGV+KATK + +F+PFG GPR CIG NFAMMEAK+A+A ILQRFSF LSPSY 
Sbjct  445   FKPERFSEGVSKATKGQFSFIPFGGGPRICIGQNFAMMEAKMALAMILQRFSFELSPSYT  504

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P  VVT+ PQ+GAPL++ K+
Sbjct  505   HAPFAVVTIHPQYGAPLLMRKL  526



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   502 bits (1292),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/498 (49%), Positives = 338/498 (68%), Gaps = 13/498 (3%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             +V+ W+WL+P++LEK LR+QG  GN Y +F+GD+KE   +  +A SKP+ LSDDI+PRV 
Sbjct  22    KVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPRVS  81

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
              +   +V K+GKN F+W GP PRV I +PE +++VF  N  F +P  +PLVK L +GLA 
Sbjct  82    AYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATGLAG  141

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLE  1113
             YE ++W++HR+II+PAF  +K+K M P    SC +++  KWE + S +  C+ D  P+L+
Sbjct  142   YEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLV-SKWEGMLSSEGSCEMDAWPFLQ  200

Query  1112  AFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEID  933
               TSDVI+R+AFG SY EG ++F LQ EQ EL  +VI  +  P W  L +K  RRM EID
Sbjct  201   NLTSDVIARSAFGSSYEEGRRIFQLQREQTELLMKVILKIQIPGWRFLPTKTHRRMKEID  260

Query  932   NEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS------------GFSTDEVIE  789
              EI+  +K +I KRE+ +K      ++    LL    K             G S ++VIE
Sbjct  261   REIKASLKNMINKREKALKSGEATKNDLLGILLESNHKEIQEHGNRNSKNVGMSLEDVIE  320

Query  788   ECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTM  609
             EC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+E  QVFG+ KPDFDGL+RLKI+TM
Sbjct  321   ECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQKPDFDGLSRLKIVTM  380

Query  608   ILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPE  429
             IL EVLRLYPP     R + ++ KLG + LP  + + L ++L+  D ++WG DA +F PE
Sbjct  381   ILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHDSELWGEDAKQFNPE  440

Query  428   RFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             RF+EGV KAT  R++F PFGWGPR CIG NF+++EAK+A++ ILQ F F LSP+YAH+P 
Sbjct  441   RFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQNFLFELSPAYAHAPT  500

Query  248   FVVTLKPQFGAPLVLHKI  195
               +T +PQ+GA ++L K+
Sbjct  501   MSITTQPQYGAHIILRKV  518



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   502 bits (1292),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 264/523 (50%), Positives = 350/523 (67%), Gaps = 16/523 (3%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWAC--RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGD  1554
             MD IQ  V +     S  A+ ++ C  +V+ WVWL P+KLE  LR+QGLNGNSY++ YGD
Sbjct  1     MDEIQILVRVC---CSAIAIALFVCLWKVLNWVWLNPKKLENLLRKQGLNGNSYKILYGD  57

Query  1553  TKEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQ  1374
               +   +  +A SKP+NLSDDI PR++PF+     KYGK CF+W GP P+VII +PEL++
Sbjct  58    LNDFIGMIREASSKPMNLSDDIAPRLVPFFLETTKKYGKKCFIWLGPKPQVIIMDPELIK  117

Query  1373  EVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSC  1194
             EV     L+++P  +P    LV GLA YE+ +WA+HRKII+PAF+ +K+K M P+   SC
Sbjct  118   EVLSKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSC  177

Query  1193  EEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELT  1014
              EM + KWE      +  + DV P+L+  T DVISRTAFG SY EG K+F LQ EQA+  
Sbjct  178   TEM-LSKWEDAVPLGSSREIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQTEQAQNF  236

Query  1013  RQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldll  834
                +  VY P    L +KR+RRM EI NE+R  +KG+I KR + MK    D++E+ L +L
Sbjct  237   IDAVREVYIPGRRFLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNNEDLLGIL  296

Query  833   gvl----------LKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRAR  684
                             G S +EVIEEC+ FYFAGQE+TS  LVW ++LLS +Q WQ +AR
Sbjct  297   LESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRYQDWQTQAR  356

Query  683   QEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNii  504
             +EV QVF   KPDFDGLN LK++TMIL E LRLYPP     R + E+  LGE+ LP  ++
Sbjct  357   EEVLQVFESRKPDFDGLNHLKVVTMILYESLRLYPPLITLNRQVNEDIVLGELCLPAGVL  416

Query  503   lilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMME  324
             + L  +L+  D D+WG DA EF PERF EG++ ATK ++ + PF WGPR CIG NFAM+E
Sbjct  417   VSLPMILLHHDKDIWGEDANEFNPERFREGISSATKGKVTYFPFSWGPRICIGQNFAMLE  476

Query  323   AKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             AK+A+  ILQ FSF LSPSY H+P  +VT++PQ+GAPL+LHK+
Sbjct  477   AKMALCMILQSFSFELSPSYTHAPKSLVTMQPQYGAPLILHKL  519



>ref|XP_010926800.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Elaeis guineensis]
Length=519

 Score =   502 bits (1292),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/523 (47%), Positives = 349/523 (67%), Gaps = 19/523 (4%)
 Frame = -2

Query  1730  TMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDT  1551
             +++ + + V +LFL       ++WA R ++WVW +PR+LE  LR QGL+G  YR  YGD 
Sbjct  5     SLEMVGAVVGVLFL-------LVWAVRALEWVWWRPRRLEGLLRAQGLSGTRYRFLYGDL  57

Query  1550  KEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             K+   L   A+SKP+ LS  I PRVLPF+H A+  +GK  F W GP PRVI+ +PEL++E
Sbjct  58    KDNVRLQKAARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPRVILKDPELVRE  117

Query  1370  VFMNN-TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSC  1194
             V  N    F++P  +PL K L  G+A YE ++WA+HR+II+PAF+ +K+K M P++ + C
Sbjct  118   VLSNKFGHFEKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFHLEKLKHMLPTLATCC  177

Query  1193  EEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELT  1014
             +E+I  +W+     + +C+ DV P  + FT DVISR AFG S+ EG ++F LQ EQ EL 
Sbjct  178   DELI-NRWDNHLGSQGYCELDVWPAFQNFTGDVISRAAFGSSFKEGQRIFQLQQEQTELV  236

Query  1013  RQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldll  834
              Q    +Y P +  L +K++ RM+EID EIR L+  +I +RER M++    +D+    L+
Sbjct  237   VQAAQKIYIPGYRFLPTKKNNRMYEIDREIRALLSRMIEQRERAMRKAGVSNDDLLGLLI  296

Query  833   gvlLK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRAR  684
                L+          +G + D+VIEEC+ FYFAG E+TS  L W +++L +H +WQ RAR
Sbjct  297   ESNLRYSQEQGGSKNTGMTKDDVIEECKLFYFAGHETTSVLLTWTVVVLGMHPSWQARAR  356

Query  683   QEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNii  504
             +EV QV+G NKPD+DGL++L+I+TM+L EVLRLYP   + +R  Y+E KLG+   PP + 
Sbjct  357   EEVLQVYGKNKPDYDGLSQLRIVTMVLYEVLRLYPAITFLVRRTYKEMKLGDFTFPPGVQ  416

Query  503   lilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMME  324
             L+L  L +  DP  WG DA EF PERFA GV+KA+K +  F PFG GPR CIG NFAMME
Sbjct  417   LLLPLLFIHHDPQFWGDDATEFNPERFASGVSKASKIQGTFFPFGGGPRICIGQNFAMME  476

Query  323   AKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             AK+A+A ILQ FS   S SYAH+P  V+TL PQ+GA ++LH++
Sbjct  477   AKMALARILQHFSLEPSSSYAHAPYTVITLHPQYGAQIMLHRL  519



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   501 bits (1291),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 246/500 (49%), Positives = 342/500 (68%), Gaps = 13/500 (3%)
 Frame = -2

Query  1658  ACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPR  1479
             A +V+ W+WL+P++LEK LR+QGL GN Y +F GD+KE   +  +A SKP+NLSDDI+PR
Sbjct  20    AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  1478  VLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGL  1299
             V  +   +V K+GKN F+W GP PRV I +PE +++VF     F +P  +PLVK L +GL
Sbjct  80    VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  1298  ACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPY  1119
             A YE ++W++HR+II+PAF  +K+K M P    SC +++  KWE + S +  C+ D  P+
Sbjct  140   AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLV-SKWEGMLSSEGSCEMDAWPF  198

Query  1118  LEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHE  939
             L+   SDVI+R+AFG SY EG ++F LQ EQAEL  +V+  +  P W  L +   RRM E
Sbjct  199   LQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMKE  258

Query  938   IDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS------------GFSTDEV  795
             ID +I+  +K +I KRE+ +K      ++    LL    K             G S +EV
Sbjct  259   IDRDIKASLKDMINKREKALKAGEATKNDLLGILLASNHKEIQEHGNRNNKNVGMSLEEV  318

Query  794   IEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKIL  615
             IEEC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG+ KPDFDGL+RLKI+
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVFQVFGYQKPDFDGLSRLKIV  378

Query  614   TMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFK  435
             TMIL EVLRLYPP     R++ ++ KLG + LP  + ++L ++L+  D   WG DA +F 
Sbjct  379   TMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLPAGVHVLLPTILIHHDRKFWGEDAKQFN  438

Query  434   PERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHS  255
             PERF+EGV KAT  R++F PFGWGPR CIG NF+++EAK+A++ ILQ FSF LSP+YAH+
Sbjct  439   PERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAHA  498

Query  254   PCFVVTLKPQFGAPLVLHKI  195
             P  ++T++PQ+GA ++L K+
Sbjct  499   PIALITIQPQYGAHIILRKV  518



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   501 bits (1291),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 255/510 (50%), Positives = 340/510 (67%), Gaps = 11/510 (2%)
 Frame = -2

Query  1694  FLFISVPAVVIWAC-RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK  1518
             F  + V ++ I+   R+  W+W KP+K+EK+LR+QGLNG SY+  +GD KE+  ++ +AK
Sbjct  7     FFALGVASIFIYLIYRIANWLWFKPKKIEKFLRKQGLNGTSYKFMFGDLKELVQMSNEAK  66

Query  1517  SKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRP  1338
             SKP++L+ DI  RVLPFY+ A++ +GK CF W G  P V +SEP +++EV  N   +++P
Sbjct  67    SKPMSLNHDIANRVLPFYYNALSTHGKTCFTWLGIKPVVHLSEPTMIREVLNNYNQYQKP  126

Query  1337  KP-HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELL  1161
             +  +PL K L  G+A  E  QW +HRKII+PAF+ +K+K M P+   SC EM+ K  E +
Sbjct  127   RAGNPLTKLLARGVADAEADQWVKHRKIINPAFHVEKLKHMVPAFYVSCSEMLDKWGETV  186

Query  1160  TSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPE  981
             T E +  + DV  YL  F++DVISRTAFG SY EG K+F LQ EQA L  +   SVY P 
Sbjct  187   TKESS-GEVDVWTYLSTFSADVISRTAFGSSYEEGRKIFELQREQAVLIIKASQSVYIPG  245

Query  980   WWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-----  816
                L +K ++RM EID EI+  +K +I KR   MK K   +D+    LL    K      
Sbjct  246   LRFLPTKSNKRMKEIDREIKASIKNIIDKRVVAMKAKETSNDDLLGILLDSNDKEIKQHG  305

Query  815   ---GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
                G S ++VIEEC+ FYFAGQE+T   LVW MILL  H  WQ RAR+EV  VFG   PD
Sbjct  306   SKYGLSIEDVIEECKLFYFAGQETTGTMLVWTMILLGHHTDWQRRAREEVLHVFGDKTPD  365

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              DGL+ LK++ +I +EVLRLYPP+    R ++EETKLG + LP   ++ L+ LL   D D
Sbjct  366   IDGLSHLKVINIIFHEVLRLYPPAQLLRRMIHEETKLGNLTLPAGTLVQLNILLSHHDKD  425

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
              WG D  EF PERF+EGV+KATK R  +LPFG GPR C+G NFAM+EAK+A+A ILQRFS
Sbjct  426   TWGEDVHEFNPERFSEGVSKATKGRATYLPFGGGPRICMGQNFAMLEAKMALAMILQRFS  485

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             F +SPSY H+P  + TL+PQFGA L+LHK+
Sbjct  486   FEVSPSYTHAPHSIFTLQPQFGAHLILHKV  515



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   501 bits (1291),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/502 (50%), Positives = 349/502 (70%), Gaps = 13/502 (3%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V+ WA +++ +VWLKP++LEK +RQQG  GNSY+  +GD KE+  +  +A SKPIN S D
Sbjct  20    VLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEAMSKPINFSHD  79

Query  1490  IL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             ++ PRV+PF H  +T YGKNCFVW GP P V+I++PEL++EV   N ++++P   PL K 
Sbjct  80    MIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKEVLTKNFVYQKPPGTPLTKL  139

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
               +G+A YE  +WA HR++++PAF+ DK+K M P+   +  EM+ K  ++++   N  + 
Sbjct  140   AATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTACEMLSKLEKVVSP--NGTEI  197

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV PYL+  TSD ISRTAFG SY EG K+F LQ EQ  L  +V  ++Y P W  L +KR+
Sbjct  198   DVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQLSLILEVSRTIYIPGWRFLPTKRN  257

Query  953   RRMHEIDNEIRGLMKGLIGKR----ERG-----MKEKvgdddeenldllgvlLKSGFSTD  801
             +RM +I NE+R L+ G+I KR    E G     +   +   + + +   G   K G S D
Sbjct  258   KRMKQIFNEVRALVLGIIKKRLSMIENGEAPDDLLGILLASNLKEIQQHGNNKKFGMSID  317

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             EVIEEC+ FYFAGQE+TS  LVW MILL  H +WQD+AR+EV QVFG  + D+D LN+LK
Sbjct  318   EVIEECKLFYFAGQETTSSLLVWTMILLCKHPSWQDKAREEVLQVFGSREVDYDKLNQLK  377

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             I+TMILNEVLRLYP      R + +ETKLG + LP  + L+L ++L+Q D ++WG DA E
Sbjct  378   IVTMILNEVLRLYPAGYAINRMVTKETKLGNLCLPAGVQLLLPTILLQHDTEIWGDDAME  437

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERF++G++KATK +L F PF WGPR CIG NFAM+EAK+A+A IL+ ++F LSPSYA
Sbjct  438   FNPERFSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKNYAFELSPSYA  497

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P   + L+PQ+GA L+L+K+
Sbjct  498   HAP-HPLLLQPQYGAQLILYKL  518



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   502 bits (1292),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 252/505 (50%), Positives = 342/505 (68%), Gaps = 12/505 (2%)
 Frame = -2

Query  1682  SVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN  1503
             ++  V+IWA R++ WVW KP+ LEK LRQQG  GNSY+  +GD KEM  +  +A SKPI+
Sbjct  20    AIILVLIWAWRILNWVWFKPKMLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPID  79

Query  1502  LSDDIL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHP  1326
              S D+  PRV+PF+H  +  YGKNCF W GP P V+I +PEL++EV   N ++++P  +P
Sbjct  80    FSHDMTWPRVMPFFHKTINNYGKNCFGWYGPRPAVVIVDPELIREVLSKNYIYQKPPGNP  139

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN  1146
             L +   +GLA YE  +WA+HR+II+P F+ DK+K M P+   +  EM+ K  E+++ E +
Sbjct  140   LTRLAANGLAGYEADKWAKHRRIINPGFHLDKLKHMLPAFQLTSSEMLNKWKEIISKEGS  199

Query  1145  WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLS  966
               + DV PYL+  TSD ISRTAFG SY EG K+F LQ EQ EL  QV  S+Y P W  + 
Sbjct  200   --EIDVWPYLQTLTSDAISRTAFGSSYEEGKKIFELQKEQMELLLQVARSLYIPGWRFVP  257

Query  965   SKRSRRMHEIDNEIRGLMKGLIGKRERGMKE--------KvgdddeenldllgvlLKSGF  810
             +K +RRM +I NE+  L+ G+I KR + +++         +               K G 
Sbjct  258   TKTNRRMKQIFNEVGALILGIINKRIKMIEDGEIHDDLLSILLASNLQEIQQHGHKKFGM  317

Query  809   STDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLN  630
             S DEVIEEC+ FY AGQE+TS  LVW MILLS +  WQ RARQEV QVF  ++ D+D LN
Sbjct  318   SIDEVIEECKLFYLAGQETTSALLVWTMILLSKYPIWQQRARQEVLQVFESDEFDYDKLN  377

Query  629   RLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGAD  450
              LK++TMILNEVLRLYP + +  R + ++TKLG + LP  + L+L ++L+  D ++WG D
Sbjct  378   HLKVVTMILNEVLRLYPSAYFINRVVTKDTKLGNLCLPSGVQLLLGTILLHHDTEIWGDD  437

Query  449   AGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSP  270
             A EF PERF++GVAKATK +L F PF WGPR CIG NFAM+EAK+AIA IL+ +SF LS 
Sbjct  438   AMEFNPERFSDGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMAIAMILKHYSFELSS  497

Query  269   SYAHSPCFVVTLKPQFGAPLVLHKI  195
             SYAH+P   + L+PQ+GA L+L+K+
Sbjct  498   SYAHAP-HPLLLQPQYGAHLILYKL  521



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   502 bits (1292),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 245/501 (49%), Positives = 349/501 (70%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             + WA RV+ W W +PR+LE+ LR QGLNG  YR  YGD KE+  L  +A++KP+ L+ +I
Sbjct  23    LAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPMPLAHNI  82

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLFKRPKPHPLVKFL  1311
             +PR+LPF+H A+ +YGK  F W GP P+V I++PEL++EV  N   +F +P  +PL +F 
Sbjct  83    IPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPLSRFF  142

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL  YE ++W +HR+I++PAF+ +K+K M P+ ++ C ++ M +WE +   +   + D
Sbjct  143   SKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDL-MDRWENMAGSEACYELD  201

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P L++F+ DVISRTAFG SY EG ++F LQ+EQAEL  QV+ ++Y P +  L + +++
Sbjct  202   VWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTPKNK  261

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---------SGFSTDE  798
             R+  ID EIR +++G+I KRE+ +K      D+    L+   +K         +G +T++
Sbjct  262   RIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGMTTED  321

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  L W MI LS+H TWQ RAR+EV +VFG NKPDFDGL+ LKI
Sbjct  322   VIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKI  381

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R  Y+  K+G++  PP ++L+L ++ V  DP++WG DA EF
Sbjct  382   VTMILYEVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKDASEF  441

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERFAEGV+KA+K ++AF PFG GPR CIG NF+++EAK+ ++ ILQ F F LSPSYAH
Sbjct  442   NPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFSLLEAKMGLSMILQHFYFDLSPSYAH  501

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  + TL PQ GA + L K+
Sbjct  502   APRTIFTLFPQRGAQIRLRKL  522



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   501 bits (1291),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 253/507 (50%), Positives = 347/507 (68%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             I V  ++++  RV+ W WLKP+KLEK+LR+ GL GN Y++++GD KE      +AKSKPI
Sbjct  12    ICVAVLLVYTWRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFTNKLNEAKSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPH  1329
             N SDDI  R++PF+  ++ K GK+ FVW GP P V+I++PE ++E+F  N ++ K   P+
Sbjct  72    NFSDDIAQRLIPFFCDSINKNGKSSFVWLGPYPVVLITDPEHVKEIFTKNYVYQKETHPN  131

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  K L  GLA  E+ +WA+HRKII+PAF  +K+K M P+   SC E+I  KWE +  ++
Sbjct  132   PFSKLLAIGLAKLEEDKWAKHRKIINPAFQTEKLKHMLPAFYQSCSEII-SKWEEIIPKE  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L+  T++VISRTAFG SY EG  VF LQNEQAE    +  S+Y P    L
Sbjct  191   TSFELDVWPDLQLMTAEVISRTAFGSSYEEGRIVFELQNEQAEYVTDINRSIYIPGSRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR +RM EI+ +++  +K +I KR R M+      ++    LL   +K          
Sbjct  251   PTKRYKRMLEIEKQVQTTIKRIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKDF  310

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +T EVI+EC+ FYFAGQE+T+  LVW MILL +H  WQ RAR+E  QVFG+ KP+ +G
Sbjct  311   GMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQVFGNEKPNLEG  370

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             L+RLKI+TMIL+E LRL+PP P   R    E KLGE+ LP  ++L++ ++L+  D ++WG
Sbjct  371   LSRLKIVTMILHETLRLFPPVPTYRRRNKHEVKLGELSLPAGVLLVIPAILIHYDKELWG  430

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+KATK R++F+PF  GPR CIG NFAMMEAKI IA ILQ+FSF L
Sbjct  431   EDAKEFKPERFSEGVSKATKGRISFIPFTGGPRVCIGQNFAMMEAKIGIAMILQKFSFEL  490

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSYAH+P   +T+ PQ+GAPL++ K+
Sbjct  491   SPSYAHAPFATITIHPQYGAPLLMRKL  517



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   501 bits (1290),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 246/500 (49%), Positives = 344/500 (69%), Gaps = 12/500 (2%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             WA  V+  +W +P KLEK  R+QG+ G      +G+ K+   +  +A SKP+NLS DI P
Sbjct  19    WAWSVLYSIWWRPMKLEKCFREQGIEGPPRIWLHGNLKDEVRMRNEALSKPMNLSHDIAP  78

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLFKRPKPHPLVKFLVS  1305
             RV+PF H  + KYG     W G  PR+ + +P+L++++  N    F++PK +PL++  V 
Sbjct  79    RVVPFVHQTIEKYGNMSVTWFGRTPRINVMDPDLIKDILSNKFGQFEKPKSNPLIRLFVD  138

Query  1304  GLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQ  1125
             GL  +E ++WA+HR+II+PAF+ +K+K M P+  +SC EMI K WE L + +  C+ D+ 
Sbjct  139   GLVSHEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCFEMITK-WEKLVALEGSCELDIW  197

Query  1124  PYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRM  945
             P L+  T DVISRTAFG SY EG ++F LQNEQA++   V  S+Y P + LL +KR+ RM
Sbjct  198   PELQNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKIVMDVALSIYIPGYRLLPTKRNNRM  257

Query  944   HEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEV  795
              EID E+RGL++ ++ KRE+ +K      D+    LL    K           G + DEV
Sbjct  258   KEIDREVRGLLRRIVNKREKAIKLGEASKDDLLGLLLESNFKEIREHGNEKNIGMNVDEV  317

Query  794   IEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKIL  615
             IEEC+ FYFAGQE+TS+ LVW M++LS+H  WQ RAR+EV Q FG +KPDFDG+N LK++
Sbjct  318   IEECKLFYFAGQETTSNLLVWTMVVLSMHPEWQMRAREEVLQSFGKDKPDFDGINHLKVV  377

Query  614   TMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFK  435
             +MIL EVLRLYPP+    R  Y++ KLG++ LPP + L L ++L+    ++WG DA EFK
Sbjct  378   SMILYEVLRLYPPAVALTRQTYKKVKLGDVYLPPRVELSLPTILIHHSRELWGEDAQEFK  437

Query  434   PERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHS  255
             PERF  GV+KA  N+++F+PFGWGPR CIG NFAM+EAK+A+A ILQ FSF LSPSYAH+
Sbjct  438   PERFLGGVSKAANNQVSFIPFGWGPRICIGQNFAMIEAKMALALILQHFSFELSPSYAHA  497

Query  254   PCFVVTLKPQFGAPLVLHKI  195
             PC ++TL+PQ+GA ++LHK+
Sbjct  498   PCTIITLQPQYGAQIILHKL  517



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   501 bits (1290),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 246/500 (49%), Positives = 342/500 (68%), Gaps = 13/500 (3%)
 Frame = -2

Query  1658  ACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPR  1479
             A +V+ W+WL+P++LEK LR+QGL GN Y +F GD+KE   +  +A SKP+NLSDDI+PR
Sbjct  20    AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  1478  VLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGL  1299
             V  +   +V K+GKN F+W GP PRV I +PE +++VF     F +P  +PLVK L +GL
Sbjct  80    VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  1298  ACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPY  1119
             A YE ++W++HR+II+PAF  +K+K M P    SC +++  KWE + S +  C+ D  P+
Sbjct  140   AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLV-SKWEGMLSSEGSCEMDAWPF  198

Query  1118  LEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHE  939
             L+   SDVI+R+AFG SY EG ++F LQ EQAEL  +V+  +  P W  L +   RRM E
Sbjct  199   LQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMKE  258

Query  938   IDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS------------GFSTDEV  795
             ID +I+  +K +I KRE+ +K      ++    LL    K             G S +EV
Sbjct  259   IDRDIKASLKDMINKREKALKAGEATKNDLLGILLESNHKEIQEHGNRNNKNVGMSLEEV  318

Query  794   IEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKIL  615
             IEEC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG+ KPDFDGL+RLKI+
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVFQVFGYQKPDFDGLSRLKIV  378

Query  614   TMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFK  435
             TMIL EVLRLYPP     R++ ++ KLG + LP  + ++L ++L+  D   WG DA +F 
Sbjct  379   TMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLPAGVHVLLPTILIHHDRKFWGEDAKQFN  438

Query  434   PERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHS  255
             PERF+EGV KAT  R++F PFGWGPR CIG NF+++EAK+A++ ILQ FSF LSP+YAH+
Sbjct  439   PERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYAHA  498

Query  254   PCFVVTLKPQFGAPLVLHKI  195
             P  ++T++PQ+GA ++L K+
Sbjct  499   PTALITIQPQYGAHIILRKV  518



>ref|XP_011009102.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Populus euphratica]
 ref|XP_011009103.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Populus euphratica]
Length=542

 Score =   502 bits (1292),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 258/536 (48%), Positives = 360/536 (67%), Gaps = 19/536 (4%)
 Frame = -2

Query  1751  LSYLSNPTMD---RIQSWVSILFLFISVP--AVVIWACRVVQWVWLKPRKLEKWLRQQGL  1587
             L  LS P +D   R++  V++  + +S+   AV+ WA RV+ WVW +P+K+E+ LRQQG 
Sbjct  9     LISLSYPFLDLFLRVKMTVTVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGF  68

Query  1586  NGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAP  1407
              G  YR+ +GD KE + +  +A++KP+ LSD +LPRV+PF H  V  YGKN F+W GP P
Sbjct  69    AGKPYRLLFGDWKENSDMLKEARTKPLGLSDALLPRVVPFLHQLVKDYGKNSFMWVGPKP  128

Query  1406  RVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKI  1227
             RV I  P+ +++VFM    +++P  HPL+K L  GLA +E ++WA+HRKII+PAF+ +K+
Sbjct  129   RVNIMNPDQIRDVFMKINEYQKPS-HPLLKPLACGLASHEGEKWAKHRKIINPAFHQEKL  187

Query  1226  KCMAPSVTSSCEEMIMKKWELLTS-EKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNK  1050
             K M P+   SC  MI  KWE L S ++  C+ DV P L+    D ISRT+FG +Y EG +
Sbjct  188   KLMIPAFCESCSGMI-NKWEKLVSVDEGSCELDVWPDLQGLACDAISRTSFGSNYEEGKR  246

Query  1049  VFSLQNEQAELTRQVI-HSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKE  873
             +F L  E  +LT  VI  +V  P +  L    +RR+  ID EI+  +  LI KRE+ M  
Sbjct  247   IFDLLKELTDLTVNVIIKAVVIPGYRFLPIPSNRRLKAIDKEIKASLNALINKREKAMSA  306

Query  872   KvgdddeenldllgvlLK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMI  723
                  ++    LL    +          +G S ++VI+EC+ FYFAGQE+TS  L W M+
Sbjct  307   GEDAKNDLLDLLLESNFREIQEHGNSKSAGMSIEDVIDECKIFYFAGQETTSVLLTWTMV  366

Query  722   LLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEE  543
             LL+ +  WQ RAR+EV QVFG+ KPDFDGLN LK++TMIL EVLRLYPP     R ++EE
Sbjct  367   LLAQYPNWQARAREEVVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEE  426

Query  542   TKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWG  363
              KLG + +P  + + + ++L+ +D ++WG DA EFKPERFAEGV+KATK++++FLPFGWG
Sbjct  427   IKLGNLLVPAGVQISVPTILLHQDRELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWG  486

Query  362   PRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             PR C+G NFAM+EAK+A+A ILQR SF LSPSY H+P  V+TL+PQ GAP++L K+
Sbjct  487   PRICVGQNFAMIEAKMALAMILQRCSFELSPSYIHAPRTVITLQPQHGAPMILRKL  542



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   501 bits (1290),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 252/502 (50%), Positives = 349/502 (70%), Gaps = 13/502 (3%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V+ WA +++ +VWLKP++LEK +RQQG  GNSY+  +GD KE+  +  +A SKPIN S D
Sbjct  20    VLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEAMSKPINFSHD  79

Query  1490  IL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             ++ PRV+PF H  +T YGKNCFVW GP P V+I++PEL++EV   N ++++P   PL K 
Sbjct  80    MIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKEVLTKNFVYQKPPGTPLTKL  139

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
               +G+A YE  +WA HR++++PAF+ DK+K M P+   +  EM+ K  ++++   N  + 
Sbjct  140   AATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTACEMLSKLEKVVSP--NGTEI  197

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV PYL+  TSD ISRTAFG SY EG K+F LQ EQ  L  +V  ++Y P W  L +KR+
Sbjct  198   DVWPYLQTLTSDAISRTAFGSSYEEGRKLFELQKEQLSLILEVSRTIYIPGWRFLPTKRN  257

Query  953   RRMHEIDNEIRGLMKGLIGKR----ERG-----MKEKvgdddeenldllgvlLKSGFSTD  801
             +RM +I NE+R L+ G+I KR    E G     +   +   + + +   G   K G S D
Sbjct  258   KRMKQIFNEVRALVLGIIKKRLSMIENGEAPDDLLGILLASNLKEIQQHGNNKKFGMSID  317

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             EVIEEC+ FYFAGQE+TS  LVW MILL  H +WQD+AR+EV QVFG  + D+D LN+LK
Sbjct  318   EVIEECKLFYFAGQETTSSLLVWTMILLCKHPSWQDKAREEVLQVFGSREVDYDKLNQLK  377

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             I+TMILNEVLRLYP      R + +ETKLG + LP  + L+L ++L+Q D ++WG DA E
Sbjct  378   IVTMILNEVLRLYPAGYAINRMVTKETKLGNLCLPAGVQLLLPTILLQHDTEIWGDDAME  437

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERF++G++KATK +L F PF WGPR CIG NFAM+EAK+A+A IL+ ++F LSPSYA
Sbjct  438   FNPERFSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKNYAFELSPSYA  497

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P   + L+PQ+GA L+L+K+
Sbjct  498   HAP-HPLLLQPQYGAQLILYKL  518



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   501 bits (1289),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 251/502 (50%), Positives = 348/502 (69%), Gaps = 13/502 (3%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V+ WA +++ +VWLKP++LEK+LRQQG  GNSY+  +GD KE   +  +A SKPIN S D
Sbjct  20    VLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKETKKMGEEAMSKPINFSHD  79

Query  1490  IL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             ++ PRV+PF H  +T YGKNC VW GP P V+I++PEL++EV   N ++++P  +PL K 
Sbjct  80    MIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKEVLTKNFVYQKPLGNPLTKL  139

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
               +G+A YE  +WA HR++++PAF+ DK+K M P+   +  EM+ K  ++++   N  + 
Sbjct  140   AATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTASEMLSKLEKVVSP--NGTEI  197

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV PYL+  TSD ISRTAFG SY EG K+F LQ EQ  L  +V  ++Y P W  L +KR+
Sbjct  198   DVWPYLQTLTSDAISRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFLPTKRN  257

Query  953   RRMHEIDNEIRGLMKGLIGKR----ERG-----MKEKvgdddeenldllgvlLKSGFSTD  801
             +RM +I NE+R L+ G+I KR    E G     +   +   + + +   G   K G S D
Sbjct  258   KRMKQIFNEVRALVFGIIKKRMSMIENGEAPDDLLGILLASNLKEIQQHGNNKKFGMSID  317

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             EVIEEC+ FYFAGQE+TS  LVW MILL  +  WQD+AR+EV QVFG  + D+D LN+LK
Sbjct  318   EVIEECKLFYFAGQETTSSLLVWTMILLCKYPNWQDKAREEVLQVFGSREVDYDKLNQLK  377

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             I+TMILNEVLRLYP      R + +ETKLG + LP  + L+L ++L+Q D ++WG DA E
Sbjct  378   IVTMILNEVLRLYPAGYVINRMVNKETKLGNLCLPAGVQLVLPTMLLQHDTEIWGDDAME  437

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERF++G++KATK +L F PF WGPR CIG NFAM+EAK+A+A IL+ ++F LSPSYA
Sbjct  438   FNPERFSDGISKATKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKTYAFELSPSYA  497

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P   + L+PQ+GA L+L+K+
Sbjct  498   HAP-HPLLLQPQYGAQLILYKL  518



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   501 bits (1289),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 247/509 (49%), Positives = 345/509 (68%), Gaps = 12/509 (2%)
 Frame = -2

Query  1688  FISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKP  1509
              ++V  +++   +++ W WL P+KLEK LRQQG NGNSYR+ +G+ KEM T+T +A+S+P
Sbjct  14    LLAVGVLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMTRQARSRP  73

Query  1508  INLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH  1329
             ++L+DDI P V+P+YH  VT YGKN   W GP+PRV I +PEL++E+F     F++P+ +
Sbjct  74    MSLTDDIAPYVIPYYHQTVTNYGKNSIRWFGPSPRVTIMDPELIREIFNKFNEFQKPRIN  133

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             PL+  L SG+   E ++WA+HRKII+P+F+ DK+K M P+    C EMI +KWE   S  
Sbjct  134   PLITLLFSGILTLEGERWAKHRKIITPSFHLDKLKNMLPAFYECCTEMI-EKWEEAVSVN  192

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L   T DVISR AFG SY EG ++F L +EQ  L  + + S+Y P W  L
Sbjct  193   GSSEVDVWPCLVNLTRDVISRAAFGSSYEEGRRIFLLLDEQTNLLTETVQSLYVPGWRFL  252

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +K ++++  +D EI+  ++ L+  RE+ +K     +D+    L+    K          
Sbjct  253   PTKTNKKLKLMDKEIKDSLRELVKNREKAVKAGEVKNDDLLGILVESNFKEIEEHGDRKN  312

Query  815   -GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFD  639
              G S  +V++EC+ FY AGQE+TS  LVW M+LL+ +  WQ +AR+EV QVF   KPD D
Sbjct  313   MGMSIQDVVDECKLFYIAGQETTSVLLVWTMVLLARNPDWQTKAREEVFQVFSDGKPDPD  372

Query  638   GLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVW  459
             GL+ LK++TMILNEVLRLYPP     R+M ++ KLG++ LP   ++ +  LL+  D ++W
Sbjct  373   GLSHLKVMTMILNEVLRLYPPVVMLGRSMAKDMKLGKLLLPAGAVISIPVLLIHHDQEIW  432

Query  458   GADAGEFKPERFAEGVAKATK-NRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSF  282
             G DA EF+PERFAEGV+KATK N+LAF PFG GPR CIG NFA+MEAK+ +A IL+RF F
Sbjct  433   GDDAHEFRPERFAEGVSKATKSNQLAFFPFGGGPRICIGQNFALMEAKMVLAMILKRFRF  492

Query  281   HLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              LSPSYAHSP  V+TL+PQ GA L+LHK+
Sbjct  493   ELSPSYAHSPITVITLRPQHGAHLILHKL  521



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   501 bits (1289),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 249/513 (49%), Positives = 348/513 (68%), Gaps = 12/513 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             + I     ++  V+ WA R++ +VW KP+KLEK LRQQG  GNSY++ YGD KEM  +  
Sbjct  8     LKIAIFSFAIILVLGWAWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIE  67

Query  1526  KAKSKPINLSDDIL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTL  1350
             +A SKPI+ S D++ PR+ PF H  +T YGKNCFVW GP P V+I+EP+L++EV   N +
Sbjct  68    EATSKPIDFSHDLIWPRINPFIHKTITNYGKNCFVWFGPKPAVLITEPKLIKEVLTKNYV  127

Query  1349  FKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKW  1170
             +++ +  PL+K  +SGLA +E  +WA HR+I++PAF+ DK+K M P+   +  EM +  W
Sbjct  128   YQKARGSPLLKLAISGLAAHEKDKWATHRRILNPAFHIDKLKHMLPAFKLTVNEM-LNIW  186

Query  1169  ELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVY  990
             + + S K+  + DV PYL+  TSD ISRTAFG +Y EG K F LQ EQ EL  ++ HS+Y
Sbjct  187   KEVIS-KDGTEIDVWPYLQTLTSDAISRTAFGSNYEEGKKNFELQKEQIELISKMTHSIY  245

Query  989   SPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKE--------Kvgdddeenldll  834
              P W  + +K+++RM +I  E++ L+ G+I KR R ++          +           
Sbjct  246   IPGWRFVPTKKNKRMMQIFYEVKALILGIINKRMRMIEAGESHDDLLSILLTSNLKEIQQ  305

Query  833   gvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                 K G S DEVIEEC+ FYFAGQE+TS  LVW MILL  +  WQ+RAR+EV QVF  +
Sbjct  306   HGNKKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLCKYPIWQERAREEVLQVFASD  365

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             + D+D LN+LK++TMILNEVLRLY       R +  ETKLG++ LP  + LIL+++LV  
Sbjct  366   ELDYDKLNQLKVVTMILNEVLRLYTSVYAINRMVNTETKLGDLCLPSGVQLILATMLVHH  425

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             D ++WG DA EFKPERF+EG++KATK ++ F PF WGPR CIG NFAM+EAK+A+  IL+
Sbjct  426   DTEIWGDDAMEFKPERFSEGISKATKGQVVFFPFNWGPRICIGQNFAMLEAKMAMVMILK  485

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              ++F LSPSYAH+P   + L+PQ+GA L++HK+
Sbjct  486   HYAFELSPSYAHAP-HPLLLQPQYGAQLIMHKL  517



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score =   501 bits (1289),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 252/513 (49%), Positives = 347/513 (68%), Gaps = 12/513 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             ++++    ++  V+ WA R++ WVW KP+KLEK LRQQG  GNSY+  +GD KEM  +  
Sbjct  10    LNLVLFSCAIILVLRWAWRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGDVKEMMKMGK  69

Query  1526  KAKSKPINLSDDIL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTL  1350
             +A SKPI+ S D++ PRV+PF+H  +  YGKNCF W GP P V+I +PEL++EV   N +
Sbjct  70    EALSKPIDFSHDMIWPRVMPFFHKTINNYGKNCFAWYGPRPAVVIVDPELIREVLTKNYI  129

Query  1349  FKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKW  1170
             +++P  +PL +   +GLA YE  +WA+HR+I++PAF+ DK+K M P+   +  E+ +KKW
Sbjct  130   YQKPPGNPLTRLAANGLAGYEADKWAKHRRIVNPAFHLDKLKHMLPAFQLTSSEL-LKKW  188

Query  1169  ELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVY  990
             + + S K   + DV PYL+  TSD ISRTAFG SY EG K+F LQ EQ  L  QV  S+Y
Sbjct  189   KEIIS-KEGSEIDVWPYLQTLTSDAISRTAFGSSYEEGKKIFELQKEQMGLLLQVARSLY  247

Query  989   SPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKE--------Kvgdddeenldll  834
              P W  + +K +RRM +I NE+  L+ G+I KR + +++         +           
Sbjct  248   IPGWRFVPTKTNRRMKQIFNEVGALILGIIKKRIKMIEDGEIHDDLLSILLTSNLQEIQQ  307

Query  833   gvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                 K G S DEVIEEC+ FY AGQE+TS  LVW MILLS +  WQ+RAR+EV QVF  +
Sbjct  308   HGHKKFGMSIDEVIEECKLFYLAGQETTSALLVWTMILLSKYPIWQERAREEVLQVFESD  367

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             + D+D LN LK +TMILNEVLRLYP   +  R + ++TKLG + LP  + L+L ++L+  
Sbjct  368   EFDYDKLNHLKSVTMILNEVLRLYPSGYFINRVVTKDTKLGNVCLPSGVQLLLGTILLHH  427

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             D ++WG DA EF PERF++GVAKATK +L F PF WGPR CIG NFAM+EAK+AIA IL+
Sbjct  428   DTEIWGDDAMEFNPERFSDGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMAIAMILK  487

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              +SF LSPSYAH+P   + L+PQ+GA L+L+K+
Sbjct  488   HYSFELSPSYAHAP-HPLLLQPQYGAHLILYKL  519



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   501 bits (1290),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 248/498 (50%), Positives = 334/498 (67%), Gaps = 13/498 (3%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             ++V W+W +P+KLEK LRQQG  GNSYR+ YGD KE A +  +A SKP+N S+ I PRV+
Sbjct  29    KLVDWIWFRPKKLEKLLRQQGFTGNSYRILYGDLKERAAMRDQAISKPMNFSNHIAPRVI  88

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKP--HPLVKFLVSGL  1299
             P  H  +  YGKN F+W GP PRV I +PE ++ VF     +++P    +PL K L  GL
Sbjct  89    PSVHHTIQHYGKNSFMWIGPIPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLADGL  148

Query  1298  ACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPY  1119
               +E  +W +HRKII+PAF+ +K+K M P+   SC+EMI  KWE + S +  C+ DV PY
Sbjct  149   LNHEGHKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMI-SKWESMVSVQGSCELDVMPY  207

Query  1118  LEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHE  939
             L+  T+DVISRTAFG SY +G K+F LQ E AE+  +    +Y P W  L +K + +M  
Sbjct  208   LQNMTADVISRTAFGSSYEKGKKIFKLQTELAEMVIRSTLGIYIPGWRFLPTKSNNKMKV  267

Query  938   IDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVIE  789
             I  EI  L+ G+I +RE  MK       +    L+   L            G S ++VI+
Sbjct  268   ISKEISTLIMGIINERETSMKAGEATQTDLLSILMESNLNEIKQHGNNKDIGMSIEDVID  327

Query  788   ECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTM  609
             EC+ FY AGQE+T+  L W M+LLS +  WQ+RAR EV ++FG+ KPD+DGL+RLK++TM
Sbjct  328   ECKLFYIAGQETTATLLTWTMVLLSSYSEWQERARAEVFEIFGNKKPDYDGLSRLKVVTM  387

Query  608   ILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPE  429
             ILNEVLRLYPP     R + +ETKLG++ LP  ++L L ++L+Q DP++WG DA EFKPE
Sbjct  388   ILNEVLRLYPPVSMFGRFIKKETKLGKLTLPAGVMLGLPTVLIQCDPELWGEDAHEFKPE  447

Query  428   RFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             RF EGV+KATKN  AF+PFGWGPR CIG NFAM+EAK+ ++ ILQRFS  LS SY H+P 
Sbjct  448   RFFEGVSKATKNSGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSLELSSSYTHAPI  507

Query  248   FVVTLKPQFGAPLVLHKI  195
               +T +PQ GA ++LHK+
Sbjct  508   VAITTQPQHGAHIILHKL  525



>ref|XP_010927467.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   501 bits (1289),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 254/521 (49%), Positives = 350/521 (67%), Gaps = 17/521 (3%)
 Frame = -2

Query  1712  SWVSILFLFIS----VPAVVI-WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             ++VS   L+IS    V A+++ WA   ++WVW +PR+LE+ LR QGL G  YR  +GD K
Sbjct  2     AFVSAEMLWISGWGLVAALLLGWAVSALEWVWWRPRRLERALRAQGLKGTRYRFLHGDQK  61

Query  1547  EMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEV  1368
             E   L  +A SKP+  S  I+PR+LP  H A+ K GK  F W GP PRVII +P L +E+
Sbjct  62    EYHRLHKEALSKPMAFSHQIIPRILPHLHQAIKKNGKISFTWFGPKPRVIIMDPGLTREI  121

Query  1367  FMNN-TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCE  1191
               N    F++P  +PL + LV+GL  YE ++WA+HR+II+PAF+ +K+KCM P+ ++ C+
Sbjct  122   LSNKFGHFEKPHSNPLGRLLVAGLVRYEGEKWAKHRRIINPAFHLEKLKCMMPAFSTCCD  181

Query  1190  EMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTR  1011
             E+I  KWE L + K  C+ DV P  ++FT DVISRTAFG ++ EG ++F LQ EQA+L  
Sbjct  182   ELI-NKWERLVASKGSCELDVWPEFQSFTGDVISRTAFGSNFREGQRIFHLQEEQAQLVV  240

Query  1010  QVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllg  831
             Q + ++Y P +  L +K+++RM EID EIR L++ +I +RE  ++++   +D+    L+ 
Sbjct  241   QALQNIYIPGFRFLPTKKNKRMKEIDIEIRSLLRSMIEQREMVIRKEGASNDDLLGLLME  300

Query  830   vlLK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQ  681
                +          SG ST++VIEEC+ FYFAG E+TS  L W ++ LS+H +WQ RAR+
Sbjct  301   SNFRYSKENGGSKNSGMSTEDVIEECKLFYFAGHETTSVLLTWTLVALSMHPSWQARARE  360

Query  680   EVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiil  501
             EV  VFG NKPD+DGL+RLKI+TM+L EVLRLYPP     R  ++E KLG+   P  + L
Sbjct  361   EVHGVFGKNKPDYDGLSRLKIVTMVLYEVLRLYPPVILLQRKTFKEMKLGQFTFPDGVEL  420

Query  500   ilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEA  321
              L  + +  DP+ WG DA EF PERFAEGV+KA+K   AF PF  GPR CIG +FAMMEA
Sbjct  421   SLPIIFIHHDPEFWGEDASEFNPERFAEGVSKASKIPGAFFPFSGGPRICIGQSFAMMEA  480

Query  320   KIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             K+A+A ILQ F F LSPSYAH+P  V TL PQ GA ++LH+
Sbjct  481   KMALARILQHFMFELSPSYAHAPYTVATLHPQHGAQIILHR  521



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   501 bits (1289),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 254/496 (51%), Positives = 342/496 (69%), Gaps = 11/496 (2%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             +V+ W W +P+K+E  LRQ+GL GN Y++ YGD  E+     +AKSKPIN SDDI  R++
Sbjct  31    KVLNWAWFRPKKMENCLRQRGLKGNPYKLLYGDLNELTKSVIEAKSKPINFSDDIAQRLI  90

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPHPLVKFLVSGLA  1296
             PF+  A+ K GKN FVW GP P V+I++PE ++E+F  N ++ K+  P+P  K L  GL 
Sbjct  91    PFFLNAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAHGLI  150

Query  1295  CYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYL  1116
               E+ +WA+HRKII+PAF+  K+K M PS   SC EMI  KWE +  ++   + D+ P L
Sbjct  151   SLEEDKWAKHRKIINPAFHVQKLKHMLPSFYLSCSEMI-SKWEEVVPKETSFELDIWPDL  209

Query  1115  EAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEI  936
             +  TS+VISRTAFG SY EG  VF LQ EQAE   ++  S+Y P    L +KR++RM EI
Sbjct  210   QIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMEIGRSIYIPGSRFLPTKRNKRMLEI  269

Query  935   DNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTDEVIEEC  783
             + +++  +K +I KR + M+E     D+    LL   LK          G +T EVIEEC
Sbjct  270   EKQVQTTIKRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRKEFGITTSEVIEEC  329

Query  782   QHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMIL  603
             + FYFAGQE+TS  LVW MILL +H  WQ RAR+EV QVFG++KPD +GL+RLKI+TMIL
Sbjct  330   KLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLSRLKIVTMIL  389

Query  602   NEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERF  423
              E LRL+PP P   R   EE KLG++ LP  ++LI+ ++LV  D ++WG DA EFKPERF
Sbjct  390   YETLRLFPPLPAFGRRNKEEVKLGKLHLPAGVLLIIPAILVHYDKEIWGEDAKEFKPERF  449

Query  422   AEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFV  243
              EGV+KAT  +++F+PF WGPR CIG NFAMMEAK+A+A ILQ+FSF LSPSY H+P  +
Sbjct  450   KEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVAMILQKFSFELSPSYTHAPFAI  509

Query  242   VTLKPQFGAPLVLHKI  195
             VT+ PQ+GAPL++ ++
Sbjct  510   VTIHPQYGAPLLMRRL  525



>ref|XP_008226216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   500 bits (1287),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 347/517 (67%), Gaps = 15/517 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             S V++  + +S+  V+ WA RV+ WVWL+P KLE+ LR+QGL GNSYR+ +GDTKE++ +
Sbjct  7     SCVALSVVLVSI--VIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMM  64

Query  1532  TAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
               +A+SKPI LS   DI PRV+PF H  V  YG+N FVW GP PRV I  PE +++ F  
Sbjct  65    VEQAQSKPIKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAFNK  124

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
             +  F+R   +P+VK +  GL+  E ++WA+HRKII+PAF+ +K+K M P+   SC EMI 
Sbjct  125   SDEFQRAISNPIVKSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSEMI-  183

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              KWE L  ++   + DV PYLE  TSDVISR AFG SY EG K+F L  E+A+       
Sbjct  184   NKWESLVFKEGSREMDVWPYLENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIAAR  243

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             SVY P W  L +K+++RM EI  E+RGL+KG+I KRE  +K            L+    +
Sbjct  244   SVYIPGWRFLPTKQNKRMKEIHKEVRGLLKGIINKREDAIKAGEAAKGNLLGILMESNFR  303

Query  818   ----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQ  669
                       +G S ++VI EC+ FYFAGQE+TS  LVW ++LLS +Q WQ RAR+EV Q
Sbjct  304   EIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTLVLLSQNQDWQARAREEVLQ  363

Query  668   VFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililss  489
             VFG N P +D L+ LK++TMIL EVLRLYP      RT Y++T+LG+  LP  + + L  
Sbjct  364   VFGTNIPTYDQLSHLKVVTMILLEVLRLYPAVVELPRTTYKKTQLGKFLLPAGVEVSLHI  423

Query  488   lLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAI  309
             +L   D ++WG DA EFKPERF+EGV+KATKN+  + PFG GPR CIG NFAM+EAK+A+
Sbjct  424   MLAHHDKELWGEDAKEFKPERFSEGVSKATKNQFTYFPFGAGPRICIGQNFAMLEAKLAL  483

Query  308   ATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             + ILQ F+F LSPSYAH+P   +TL PQFGA  +LHK
Sbjct  484   SLILQHFTFELSPSYAHAPSVTITLHPQFGAHFILHK  520



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   500 bits (1287),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 259/520 (50%), Positives = 351/520 (68%), Gaps = 11/520 (2%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             MD+IQ  V++    I++ A+ +   +V+ WVW  P+KLE  LR+QGLNGNSY++ YGD  
Sbjct  1     MDKIQILVTVCCFAIAI-ALFVCLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLN  59

Query  1547  EMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEV  1368
             +   +  +A SKP+NLSDDI PR++PF+   + KYGK CF+W GP P+VII +P+L++EV
Sbjct  60    DFIGMIREATSKPMNLSDDIAPRLVPFFLETIKKYGKKCFIWLGPKPQVIIMDPKLIKEV  119

Query  1367  FMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEE  1188
                  L+++P  +P    LV GLA YE+ +WA+HRKII+PAF+ +K+K M P+    C E
Sbjct  120   LSKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLCCTE  179

Query  1187  MIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQ  1008
             M+ K  + +    +  + DV P+L+  T DVISRTAFG SY EG K+F LQ EQA+    
Sbjct  180   MLGKLEDAIPVGSSH-EIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQNFID  238

Query  1007  VIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv  828
              +  VY P    L +KR+RRM EI NE+R  +KG+I KR + MK    D+++    LL  
Sbjct  239   AVREVYVPGRRFLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNEDLLGILLES  298

Query  827   lLKS---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
               K          G S +EVIEEC+ FYFAGQE+TS  LVW ++LLS +Q WQ +AR+EV
Sbjct  299   NFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRNQDWQTQAREEV  358

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
              QVFG  KPDFDGLN LK++TMIL E LRLYPP     R + E+  LGE+ LP  +++ L
Sbjct  359   LQVFGSRKPDFDGLNHLKVVTMILYESLRLYPPLITLNRQVNEDIVLGELSLPAGVLVSL  418

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
               +L+  D +VWG DA +F PERF EG++ ATK ++ + PF WGPR CIG NFAM+EAK+
Sbjct  419   PVILLHHDEEVWGEDANKFNPERFREGLSSATKGQVTYFPFSWGPRICIGQNFAMLEAKM  478

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             A+  ILQ FSF LSPSY H+P  +VT++PQFGAPL+LHK+
Sbjct  479   ALCMILQSFSFELSPSYTHAPKAIVTMQPQFGAPLILHKL  518



>ref|XP_004307203.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=543

 Score =   501 bits (1289),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 248/514 (48%), Positives = 334/514 (65%), Gaps = 14/514 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +++  + +S+ +   W  RV+ WVWLKP+KLEK LRQQGL GNSYRV  GD KE   +  
Sbjct  32    IALSIVLLSIASSCAW--RVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVMK  89

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A SKP+NLSDD  PRVLPF H  +TK+GKN F W G  PRV I  P+ + E+      F
Sbjct  90    EACSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTKYDDF  149

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             +RP   P+VK L  GLA  E ++W + RKII+PAF+ +K+K M P++  SC +MI  KWE
Sbjct  150   RRPHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCTDMI-TKWE  208

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
             ++ S++  C+ D+ P+L+  + DVISRTAFG SY EG  +F LQ EQ EL  + + S Y 
Sbjct  209   IMVSKEGSCELDIWPFLQNLSGDVISRTAFGSSYEEGRTIFELQKEQTELLIKALFSAYI  268

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl------  825
             P +  L +K +RRM  I  E+   MK +I  +   ++    D   + L +L         
Sbjct  269   PGFRFLPTKLNRRMKAISKEVEATMKRIISNKVEAIRAGDEDAKNDLLGILLESNWKEIR  328

Query  824   -----LKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFG  660
                     G S +EVI EC+ FY AG E+TS  L W MILL  +  WQ RARQEV QVFG
Sbjct  329   QYGGNKNLGMSIEEVIGECKLFYLAGAETTSILLTWTMILLCRYPNWQARARQEVLQVFG  388

Query  659   HNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLV  480
              NKPDFDGL  LK++TMI+ EVLRLYPP P   R + +ET+LG + LP  + L L   L+
Sbjct  389   SNKPDFDGLIHLKVVTMIIYEVLRLYPPVPMMTRAVQKETQLGNLLLPSGVQLSLPIFLI  448

Query  479   QRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATI  300
             QRD  +WG DA EF P+RF+EG++KATK +++++PFGWGPR CIG NF +MEAK+A++ +
Sbjct  449   QRDQTLWGEDANEFNPQRFSEGISKATKGQVSYIPFGWGPRICIGQNFGLMEAKMALSLM  508

Query  299   LQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             L  F+F LSPSY H P  ++T +PQ+GA ++LHK
Sbjct  509   LHSFTFELSPSYIHGPMTIITTQPQYGAHIILHK  542



>ref|XP_010694547.1| PREDICTED: cytochrome P450 72A15-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   499 bits (1286),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 248/515 (48%), Positives = 344/515 (67%), Gaps = 15/515 (3%)
 Frame = -2

Query  1697  LFLFISVPAVVI--WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             LF+ I +   VI  W  +++ WVW +P+KLEK LR+QGL GNSY+   GD KE   + A+
Sbjct  4     LFIAIGIALCVILTWVWKILNWVWFRPKKLEKQLRKQGLKGNSYKWLVGDMKETFRMRAE  63

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             A+ KPI  ++D   RVLPF    V KYG+NC+ W GP P + I+EPEL++E F     F+
Sbjct  64    ARGKPIPFTNDYYSRVLPFLDQHVNKYGENCWTWFGPVPAINIAEPELIREAFTRMNEFQ  123

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             + + +PL+  LV GL  YE ++WA+HRK+++PAF+ +K+K M P+  +S  E I+ KWE 
Sbjct  124   KTRLNPLIGLLVPGLVGYEGEKWAKHRKLVNPAFHMEKLKLMIPAFGASVTE-IINKWEK  182

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
             +  E    + DV PYL + ++DVISR AFG SY EG ++F L  EQ ++T ++  SVY P
Sbjct  183   IVPESGSSEIDVWPYLMSLSADVISRAAFGSSYEEGKRIFELLKEQTQITLRLFQSVYIP  242

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  + +K +R+M EI+++I+ L+ GLI KR++ M+      D+    L+    K+    
Sbjct  243   GWRYVPTKTNRKMKEINSQIQNLLTGLINKRKKAMEAGEVAKDDLLGILMDSNFKASQNV  302

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                      S  ++I+EC+ FYFAGQE+TS  LVW MILL  HQ WQ RAR+EV   FG+
Sbjct  303   GSHKQLLAMSFQDMIDECKLFYFAGQETTSTLLVWTMILLGKHQDWQTRAREEVLATFGN  362

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYE-ETKLGEMKLPPNiililsslLV  480
             N+PDFDGLN LK + MI+ EVLRLYP      R ++  ETKLG + +P   ++ LS L V
Sbjct  363   NQPDFDGLNHLKTVAMIIYEVLRLYPAVVSASRMVHNRETKLGNLLVPRGAMVSLSILHV  422

Query  479   QRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATI  300
              +DP +WG DA EFKPERF+EG+AKATK  ++F PFGWGPR CIG NFA+ EAK+A++ I
Sbjct  423   HQDPRLWGDDAKEFKPERFSEGIAKATKGNISFFPFGWGPRICIGQNFAIAEAKMALSMI  482

Query  299   LQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LQRFSF LSPSY H+P  V+TL+PQ+GA L+L ++
Sbjct  483   LQRFSFELSPSYTHAPTTVITLQPQYGAHLILQRV  517



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   499 bits (1285),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/498 (49%), Positives = 337/498 (68%), Gaps = 13/498 (3%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             +V+ W+WL+P++LEK LR+QG  GN Y +F+GD+KE   +  +A SKP+ LSDDI+PRV 
Sbjct  22    KVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPRVS  81

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
              +   +V K+GKN F+W GP PRV I +PE +++VF  N  F +P  +PLVK L +GLA 
Sbjct  82    AYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATGLAG  141

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLE  1113
             YE ++W++HR+II+PAF  +K+K M P    SC +++  KWE + S +  C+ D  P+L+
Sbjct  142   YEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLV-SKWEGMLSSEGSCEMDAWPFLQ  200

Query  1112  AFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEID  933
               TSDVI+R+AFG SY EG ++F LQ EQ E   +VI  +  P W  L +K  RRM EID
Sbjct  201   NLTSDVIARSAFGSSYEEGRRIFQLQREQTEHLMKVILKIQIPGWRFLPTKTHRRMKEID  260

Query  932   NEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS------------GFSTDEVIE  789
              EI+  +K +I KRE+ +K      ++    LL    K             G S ++VIE
Sbjct  261   REIKASLKNMINKREKALKSGEATKNDLLGILLESNHKEIQEHGNRNSKNVGMSLEDVIE  320

Query  788   ECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTM  609
             EC+ FYFAGQE+TS  LVW M+LLS +  WQ RAR+E  QVFG+ KPDFDGL+RLKI+TM
Sbjct  321   ECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQKPDFDGLSRLKIVTM  380

Query  608   ILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPE  429
             IL EVLRLYPP     R + ++ KLG + LP  + + L ++L+  D ++WG DA +F PE
Sbjct  381   ILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHDSELWGEDAKQFNPE  440

Query  428   RFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             RF+EGV KAT  R++F PFGWGPR CIG NF+++EAK+A++ ILQ F F LSP+YAH+P 
Sbjct  441   RFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQNFLFELSPAYAHAPT  500

Query  248   FVVTLKPQFGAPLVLHKI  195
               +T +PQ+GA ++L K+
Sbjct  501   MSITTQPQYGAHIILRKV  518



>ref|XP_006495017.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Citrus 
sinensis]
Length=519

 Score =   499 bits (1285),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/503 (47%), Positives = 354/503 (70%), Gaps = 12/503 (2%)
 Frame = -2

Query  1673  AVVIWACR---VVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN  1503
             A++  AC    ++ WVWLKP+KLEK+LR+QG +GNSY+VF+GD KE+A  T +AKS+PI+
Sbjct  19    AILAVACAWWMLLNWVWLKPKKLEKFLREQGFSGNSYKVFHGDMKELAQTTKEAKSRPIS  78

Query  1502  LSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPL  1323
             LSDDI  R+LPF+H  +T +GKN F+W GP P + I++P++++E+F+ + +FK+ +  PL
Sbjct  79    LSDDIARRILPFHHHIITNFGKNSFIWMGPRPNINITDPKMIREIFLKHDIFKKLRS-PL  137

Query  1322  VKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW  1143
              K L++G+  Y+ +QW + RKI +PAF+ DK+K M P++  SC +M ++KWE+  S+   
Sbjct  138   AKLLITGMVGYDGEQWFKVRKIATPAFHHDKLKNMLPTIHKSCNDM-LRKWEMSFSKDES  196

Query  1142  CDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSS  963
             C+ DV P+++  T+DVISRTAFG ++ EG K+F + +EQ  L  Q     Y P W  + +
Sbjct  197   CELDVWPHIQTLTADVISRTAFGSNFEEGRKIFEVLSEQINLVIQASLFAYIPGWRFVPN  256

Query  962   KRSRRMHEIDNEIRGLMKGLIGKRERGMK-------EKvgdddeenldllgvlLKSGFST  804
             K +R+++   NE+  L+KG++ KR+  +K       + +     E+        ++G S 
Sbjct  257   KLNRKLNSNHNEMGELVKGIVNKRKEALKFGKASNNDDLLGILMESNHKEIQEKETGMSI  316

Query  803   DEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRL  624
             +EVIEEC+ FY AGQE+T+  LVW M+LL IH  WQ+RAR+EV QVFG+ +P F+ LN+L
Sbjct  317   EEVIEECKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQL  376

Query  623   KILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAG  444
             K+++ IL EVLRLY P+P   R   +E KLGE+ +PP ++L L  +LV  D + WG DA 
Sbjct  377   KVVSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVLLSLQIMLVHHDHEYWGDDAK  436

Query  443   EFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSY  264
             +F P+RF+EGV+KA+KN+++F  FGWGPR CIG NFA++E+K+A+A ILQ+F+F LSP+Y
Sbjct  437   KFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTY  496

Query  263   AHSPCFVVTLKPQFGAPLVLHKI  195
              H+P   VT+ PQ GA ++LHKI
Sbjct  497   MHAPTRGVTVYPQHGANIILHKI  519



>ref|XP_008219294.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=515

 Score =   499 bits (1284),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 254/516 (49%), Positives = 345/516 (67%), Gaps = 25/516 (5%)
 Frame = -2

Query  1709  WVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLT  1530
             WVSI         V+ WA R + WVWL+P+KLE+ LR+QG  GNSYR+ +GDTK+ + + 
Sbjct  12    WVSI---------VIAWAWRALNWVWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMML  62

Query  1529  AKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN  1356
              +A+SKP+ LS   DI PRV+PF H +V  YG+N FVW GP P+V I  PE ++E+F  +
Sbjct  63    RQAQSKPMKLSTSHDIAPRVMPFVHQSVNTYGRNSFVWMGPIPKVNIMNPEDLKEIFNKH  122

Query  1355  TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMK  1176
                +R   +P++  LV GL    D++WA+HRKII+PAF+ +K+K M P+   SC EMI  
Sbjct  123   ENMQRTVANPIIDLLVQGLGSTVDEKWAKHRKIINPAFHLEKLKGMLPTFYQSCNEMI-N  181

Query  1175  KWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHS  996
             +WE L S++  C+ DV P L   ++DVISR AFG SY EG K+F L  +Q +     I S
Sbjct  182   EWESLVSKEGSCELDVWPCLLNMSADVISRAAFGSSYQEGRKIFQLLQQQTKNYAAAIQS  241

Query  995   VYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK-  819
             VY P    L SK ++RM EI+ EIR L++G+I KRE  +K     + +    LL   LK 
Sbjct  242   VYIP---FLPSKHNKRMKEINKEIRVLLRGIINKREEAIKMGEASNHDLLGILLESNLKE  298

Query  818   ---------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
                      +G S ++VIEEC+ FYFAGQE+TS  LVW ++LLS +Q WQ RAR+EV Q 
Sbjct  299   IREHGNKRNTGMSVEDVIEECKLFYFAGQETTSTLLVWAIVLLSQNQKWQARAREEVLQA  358

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG N P FD L++LK++TM+L EVLRLYPP     RT+  +T+LG+  LP  + + L  L
Sbjct  359   FGSNPPTFDALSQLKVVTMVLLEVLRLYPPGIELPRTLRRKTQLGKFSLPAGVDVSLHIL  418

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
             LV  + ++WG DA EFKPERF+EG++KATKN+ A+ PFG GPR CIG NFAM+EAK+A++
Sbjct  419   LVHHNKELWGEDAHEFKPERFSEGISKATKNQFAYFPFGAGPRICIGQNFAMLEAKLALS  478

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
              ILQ F+F LSPSYAH+P  +  L+PQ+GA ++L K
Sbjct  479   LILQHFTFELSPSYAHAPALLTILQPQYGAHIILSK  514



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   499 bits (1284),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 255/507 (50%), Positives = 346/507 (68%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             +SV   +++  +V+ WVW +P+KLEK LRQ+GL GN Y++ YGD  E+     +AKSKPI
Sbjct  9     VSVAIFLVYTWKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPI  68

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPH  1329
             N SDDI  R++PF+  A+ K GK  FVW GP P V+I+ PE ++E+   + ++ K+  P+
Sbjct  69    NFSDDIAQRLIPFFLNAINKNGKTSFVWLGPYPVVLITAPEHVKEILTKSYVYLKQTHPN  128

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             PL K L   L   E+++WA+HRKII+PAF+ +K+K M P+   SC EM + KWE +  ++
Sbjct  129   PLTKLLAQSLVNLEEEKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEM-LSKWEEIVPKE  187

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                +FDV P L+  TS+VISRTAFG SY EG  VF LQ EQAE   +   S+Y P    L
Sbjct  188   TSFEFDVWPDLQVMTSEVISRTAFGSSYQEGRIVFELQKEQAEYVMEKGRSIYVPGSRFL  247

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +K ++RM EI+ EI+  ++ +I KR R MK    ++++    LL   L+          
Sbjct  248   PTKTNKRMLEIEKEIQTTIRRIIDKRLRAMKAGETNNEDLLGILLESNLEEIELHGSKEF  307

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +  EVIEEC+ FYFAGQE+TS  LVW MILL +H  WQ  AR+EV QVFG++KPD +G
Sbjct  308   GMTASEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVLAREEVLQVFGNDKPDLEG  367

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             LNRLKI+TMIL E LRL+PP P   R   EE KLGE+ LP  ++L++ ++LV  D ++WG
Sbjct  368   LNRLKIVTMILYETLRLFPPLPVFGRRTKEEVKLGELNLPDGVVLLIPAVLVHYDKEIWG  427

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+KAT  +++++PFG GPR CIG NFAM+EAK AI  ILQRFSF L
Sbjct  428   EDAKEFKPERFSEGVSKATNGQVSYIPFGGGPRICIGQNFAMLEAKTAITMILQRFSFEL  487

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P  VVT+ PQ+GAPL++ K+
Sbjct  488   SPSYTHAPFAVVTIHPQYGAPLLMRKL  514



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score =   498 bits (1283),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 254/507 (50%), Positives = 343/507 (68%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             I V  ++I   +V+ W W +P+KLEK+  Q GL G  Y++ YGD  E+     +AKSKPI
Sbjct  11    ICVAILLICTWKVLNWAWFRPKKLEKYFIQNGLKGKPYKLLYGDLNELTKSIVEAKSKPI  70

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF-KRPKPH  1329
             N SDDI  R++PF+  ++ K GK+ F+W GP P ++I++PE ++E+F  N ++ K+  P+
Sbjct  71    NFSDDIAQRLIPFFLDSINKNGKSSFMWLGPYPVILITDPEHVKEIFTKNYVYLKQTHPN  130

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P+ K L  GLA  E  +WA+HRKII+P F+ +K+K M P+   SC EM + KWE +    
Sbjct  131   PMTKLLAQGLANIEGDKWAKHRKIINPVFHVEKLKHMLPAFYMSCSEM-LSKWEEIVPTG  189

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L+  TS+VISRTAFG SY EG  VF LQ EQAE   +   S+Y P    L
Sbjct  190   TSFELDVWPDLQIMTSEVISRTAFGSSYEEGRTVFELQKEQAEYVIEKGQSIYIPGSRFL  249

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR++RM EI+ EI+  ++ +I KR R M+      D+    LL   LK          
Sbjct  250   PTKRNKRMLEIEKEIQTTIRCIIDKRLRAMEAGDTSKDDLLGILLESNLKEIELHGKKDF  309

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +  +V++EC+ FYFAGQE+TS  LVW MILL +H  WQ RAR+EV Q+FG+NKPD +G
Sbjct  310   GMTISDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQIFGNNKPDLEG  369

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             LNRLKI+TMIL E LRL+PP P   R   EE KL E+ LP  ++LI+ ++LV  D ++WG
Sbjct  370   LNRLKIVTMILYETLRLFPPLPIFGRRTEEEVKLRELNLPAGVLLIIPTILVHYDKEIWG  429

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+KATK +++F+PF WGPR CIG NFAMMEAK+A+A ILQRFSF L
Sbjct  430   EDAKEFKPERFSEGVSKATKGQVSFIPFSWGPRVCIGQNFAMMEAKMALAMILQRFSFEL  489

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P  VVT+ PQ+GAPL++HK+
Sbjct  490   SPSYTHAPFAVVTIHPQYGAPLLMHKL  516



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   499 bits (1284),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 250/497 (50%), Positives = 332/497 (67%), Gaps = 12/497 (2%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             R + W+WL P+KLEK LR+QG  GNSYR++ GD K++  ++ +AKSKP+N S DI PRV+
Sbjct  26    RFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPRVI  85

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
             P  H  + KYGKN FVW GP PRV I +PE ++        F++P  +PLVK L  GL  
Sbjct  86    PSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDGLIN  145

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLE  1113
             +E ++W +HRKI++ AF+ +K+K M P++  SC EMI   WE + S+   C+ DV PYL+
Sbjct  146   HEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMI-NTWEKMVSKDGSCELDVMPYLQ  204

Query  1112  AFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEID  933
                +DVISRTAFG +Y EG  +F+   E   LT Q  + VY P    L +K + RM +I 
Sbjct  205   NLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRRFLPTKSNNRMKKIT  264

Query  932   NEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl----------LKSGFSTDEVIEEC  783
              EI+ ++  +I KR+R MKE      ++ L +L             +  G S +++IEEC
Sbjct  265   KEIKTMLMNVIDKRQRTMKEGETMQSDDLLGILLESNFNEIKEHGNVNLGMSINDLIEEC  324

Query  782   QHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMIL  603
             + FYFAGQE+T+  LVW MILL  +  WQDRAR EV QVFG+NKPDFDGLNRLKI+TMIL
Sbjct  325   KIFYFAGQETTAVLLVWTMILLGSYTKWQDRARAEVLQVFGNNKPDFDGLNRLKIVTMIL  384

Query  602   NEVLRLYPPSPYTIRTMYE-ETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPER  426
             NEVLRLY P+    R + + ETKLG    P  ++L    +L+  D ++WG DA EF PER
Sbjct  385   NEVLRLYSPASVLSRKLVKRETKLGNFTFPSGVMLSFPVILIHLDKEIWGEDANEFNPER  444

Query  425   FAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCF  246
             FAEGV+KATKN+  F PFGWGPR CIG NFAM+EAKIA++ ILQ FSF LSPSY H+P  
Sbjct  445   FAEGVSKATKNQTGFFPFGWGPRICIGQNFAMIEAKIALSIILQHFSFELSPSYTHAPIS  504

Query  245   VVTLKPQFGAPLVLHKI  195
             ++T +PQ GA ++LHK+
Sbjct  505   ILTTQPQHGAHIILHKL  521



>ref|XP_010535013.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=510

 Score =   498 bits (1283),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 252/493 (51%), Positives = 330/493 (67%), Gaps = 7/493 (1%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             W  R V+WVWLKP+ LE  L++QGL+G +Y    GD +  +++  +A+SKPINL+DDI P
Sbjct  21    WIWRFVKWVWLKPKFLENCLKRQGLSGTTYTPLVGDVRRNSSMLTEARSKPINLTDDITP  80

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH--PLVKFLV  1308
             RVLP     +  +GK+ F W GP P + ++ PE ++EVF  N ++   KPH  PLV+ + 
Sbjct  81    RVLPLPLTMLKTHGKSFFTWLGPIPVITLTNPEQIKEVF--NKVYDYEKPHIFPLVRLIA  138

Query  1307  SGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWC-DFD  1131
             +GL  Y+  +WA+HR+II+PAF+ +KIK M P+   SC E+I  +WE L +EK      D
Sbjct  139   TGLVNYDGDKWAKHRRIINPAFHLEKIKNMIPAFYQSCSEII-DEWERLVAEKGSSRGVD  197

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P+L   T+DVISRTAFG SY EG  +F LQ E A+L  Q     Y P      +K +R
Sbjct  198   VWPWLVNLTADVISRTAFGSSYREGQMIFKLQGEIAQLLSQAFQKAYIPGHRYFPTKSNR  257

Query  950   RMHEIDNEIRGLMKGLIGKR-ERGMKEKvgdddeenldllgvlLKSGFSTDEVIEECQHF  774
             RM EID EIR ++ G+IGKR   G                      G S +EV++EC+ F
Sbjct  258   RMKEIDREIRAILSGIIGKRVGAGEAPNDDLLGILLESNSVQSKGKGMSIEEVMQECKLF  317

Query  773   YFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEV  594
             YFAGQE+TS  LVW MILLS HQ WQ RAR+EV QV G  KPD D LN+LK++TMIL EV
Sbjct  318   YFAGQETTSVLLVWTMILLSQHQDWQARAREEVIQVLGDRKPDIDSLNQLKVVTMILYEV  377

Query  593   LRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEG  414
             LRLYPP     R +++E KLG++ LP  + + L  +LVQRD ++WG+DAGEFKPERF +G
Sbjct  378   LRLYPPVTQVSRAVHKEMKLGDLTLPGGVHVDLPIMLVQRDVELWGSDAGEFKPERFKDG  437

Query  413   VAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTL  234
             ++KATKN+++F PFGWGPR CIG NFAM+E+K+A+A ILQRFS  LSPSY H+P  V TL
Sbjct  438   ISKATKNQVSFFPFGWGPRICIGQNFAMLESKMALALILQRFSLELSPSYVHAPYTVFTL  497

Query  233   KPQFGAPLVLHKI  195
              PQFGA LVL K+
Sbjct  498   HPQFGAHLVLRKL  510



>ref|XP_008804072.1| PREDICTED: cytochrome P450 72A15-like [Phoenix dactylifera]
Length=523

 Score =   499 bits (1284),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 240/503 (48%), Positives = 342/503 (68%), Gaps = 13/503 (3%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             +++     ++W W +PR+LE+ LR QGL G  YR  YGD ++   L  +A+S P+  S  
Sbjct  21    LLVRGVSALEWAWWRPRRLERALRAQGLKGTRYRFLYGDLRDYDRLNKEARSMPMAFSHQ  80

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLFKRPKPHPLVKF  1314
             I+PRVLP  H A+ K GK  F W GP PRV I +P L +E+  N    F++P  +PL + 
Sbjct  81    IIPRVLPHLHQAIKKNGKTSFTWFGPDPRVAIMDPGLTREILSNKFGHFEKPNSNPLGRL  140

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             L  GLA YE ++WA+HR+II+PAF+ +K+KCM P+ ++ C+E+I  KW+ L + K  C+ 
Sbjct  141   LAGGLASYEREKWAKHRRIINPAFHLEKLKCMLPAFSTCCDELI-DKWDRLVASKGSCEL  199

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV P  ++FT+DVISRTAFG ++ EG ++F LQ EQAEL    + ++Y P +  L +K++
Sbjct  200   DVWPEFQSFTADVISRTAFGSNFREGQRIFHLQEEQAELVIPALQNIYIPGFRFLPTKKN  259

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK-----------SGFS  807
             +RM EI+ EI+ L++ +I +RE  +++    +++    L+    +           SG S
Sbjct  260   KRMKEINIEIQSLLRSMIDRREVAIRKGGTSNEDLLGLLMESNFRHSKENEGGSKNSGMS  319

Query  806   TDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNR  627
              ++VIEEC+ FYFAG E+TS  L W ++ LS+H +WQ RAR+EV QVFG NKPD+DGL+R
Sbjct  320   IEDVIEECKLFYFAGHETTSVLLTWTLVALSLHPSWQARAREEVLQVFGGNKPDYDGLSR  379

Query  626   LKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADA  447
             LKI+TM+L EVLRLYPP+ + +R  Y+E KLG+   P  + L+L  + +  DP+ WG DA
Sbjct  380   LKIVTMVLYEVLRLYPPAVFLLRMTYKEMKLGQFTFPEGVQLLLPIIFIHHDPEFWGEDA  439

Query  446   GEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPS  267
              EF PERFAEGV+KA+K + AF+PFG GPR CIG +FAMMEAK+A+A ILQ F+F LSPS
Sbjct  440   SEFNPERFAEGVSKASKIQGAFIPFGGGPRICIGQSFAMMEAKMALARILQHFTFQLSPS  499

Query  266   YAHSPCFVVTLKPQFGAPLVLHK  198
             YAH+P  V TL PQ GA ++LH+
Sbjct  500   YAHAPYTVATLHPQHGAQIILHR  522



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   498 bits (1281),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 239/495 (48%), Positives = 338/495 (68%), Gaps = 11/495 (2%)
 Frame = -2

Query  1649  VVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVLP  1470
             ++ W+W++P++LE+ LR+QGL GN YR+  GD KE+  L  +A+SKP+NLS DI+PRV  
Sbjct  1     MLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEARSKPMNLSHDIVPRVFA  60

Query  1469  FYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLACY  1290
               H +V K+GKN F+W GP PRV +++PEL+++V    + F++P+ +PL K L +GL  Y
Sbjct  61    HLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRKPEANPLAKLLATGLVNY  120

Query  1289  EDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLEA  1110
             + ++W +HR++I+PAF  +K+K M P    SC ++I+K WE + S    C+ DV P+L+ 
Sbjct  121   DGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIK-WEGMLSSDGSCEMDVWPFLQN  179

Query  1109  FTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEIDN  930
               SDVI+RTAFG S+ EG ++F LQ E AELT +VI  VY P W  + +  +RRM EID 
Sbjct  180   LASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIPGWRFVPTATNRRMKEIDR  239

Query  929   EIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----------GFSTDEVIEECQ  780
              I+  +  +I KRE+  K      D+    LL    K           G + ++VIEEC+
Sbjct  240   YIKASLMDMIKKREKAPKTGEATRDDLLGILLESNHKEIQEHRNNKNVGMNLNDVIEECK  299

Query  779   HFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILN  600
              FYFAGQE+TS  LVW M+LLS +  WQ RAR+EV QVFG   P+FDGL+ LKI+TMIL 
Sbjct  300   LFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVFGKQAPNFDGLSHLKIVTMILY  359

Query  599   EVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFA  420
             EVLRLYPP     R+++ + KLG + LP  + + L  ++V  D ++WG DA EF PERF+
Sbjct  360   EVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIMVHHDRELWGDDAKEFNPERFS  419

Query  419   EGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVV  240
             EGV+KAT  R++F PFGWGPR CIG NF+++EAK+A++ ILQ FSF LSP+Y H+P  V+
Sbjct  420   EGVSKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYTHAPFTVI  479

Query  239   TLKPQFGAPLVLHKI  195
             TL+PQ+GA ++L K+
Sbjct  480   TLQPQYGAHVILRKV  494



>emb|CDX97593.1| BnaA05g24860D [Brassica napus]
Length=512

 Score =   498 bits (1282),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 242/501 (48%), Positives = 337/501 (67%), Gaps = 4/501 (1%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             +++ AV+ W  R + WVW KP+KLE +LR+QGL+G  Y    GD +   T++ +A+SKPI
Sbjct  12    VAIVAVLWWVWRTLNWVWFKPKKLESYLRRQGLSGTPYTPLVGDVRRDYTMSMEARSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHP  1326
              ++DDI+PRV+PF    +  YG   F W GP P + I++PE ++EVF     F++P   P
Sbjct  72    RITDDIVPRVVPFPSHMLKTYGMTFFTWRGPIPTITITDPEQIKEVFNKIYDFQKPHSFP  131

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN  1146
             L + + +GL  Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++ K   ++  + +
Sbjct  132   LGRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGKWDNIVVDKGS  191

Query  1145  WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLS  966
              C+ DV P L + T+DVISRTAFG SY EG ++F LQ E A+L  Q    ++ P +    
Sbjct  192   SCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLLTQAFRRIFIPGYRYYP  251

Query  965   SKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFSTDE  798
             +K +RRM     E++ +++G++ KR    E G               LG    +G S ++
Sbjct  252   TKGNRRMKAAAREVQDILRGIVNKRLRAREAGEAPSEDLLGTLLESNLGQAKGTGMSIED  311

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW M++LS HQ WQ RAR EV+QVFG  +PD +GLN LKI
Sbjct  312   VIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARARDEVKQVFGDKEPDTEGLNHLKI  371

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R +++E KLG++ LP    + L  +LVQRD ++WG DAGEF
Sbjct  372   MTMILYEVLRLYPPVVQLTRAIHKEMKLGDLTLPGGTHISLPVMLVQRDTNLWGNDAGEF  431

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
             KP+RF +GV+KATK++++F+PF WGPR CIG NFAM+EAK+A+A ILQRFSF LSPSY H
Sbjct  432   KPDRFKDGVSKATKSQVSFIPFAWGPRICIGQNFAMLEAKMAMALILQRFSFELSPSYVH  491

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  V TL PQFGA L+LHK+
Sbjct  492   APYNVFTLHPQFGAHLILHKL  512



>ref|XP_009116708.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Brassica rapa]
Length=508

 Score =   497 bits (1280),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 243/492 (49%), Positives = 342/492 (70%), Gaps = 6/492 (1%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             W  R ++WVW KP+ LE +LR+QG+ G  Y    GD K+M+++  +A+SKPI L+DD+ P
Sbjct  20    WVWRTLKWVWFKPKMLESYLRRQGIPGTPYTPLVGDLKKMSSMLTEARSKPIKLTDDVTP  79

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH--PLVKFLV  1308
             RV+P+    +  +G+  + W GP P + I +PE ++EVF  N ++  PKPH  PLV+F+ 
Sbjct  80    RVVPYPFHMLKTHGRTYYTWFGPIPTITIMDPEQIKEVF--NNVYDFPKPHTFPLVRFIA  137

Query  1307  SGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW-CDFD  1131
             +GLA Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++  KW+ L  ++   C+ D
Sbjct  138   TGLASYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVV-GKWDKLVLDRGLSCEVD  196

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P+L + T+DVISRTAFG SY EG ++F LQ E +EL  Q     + P +  L +K +R
Sbjct  197   VWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELSELIIQDFRKAFIPGYSYLPTKDNR  256

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKSGFSTDEVIEECQHFY  771
             RM     EI+ +++G++ KR    +             LG    +G ST++VIEEC+ FY
Sbjct  257   RMKAAAREIQVILRGIVNKRLLAREASDDLLGILLESNLGQDEGNGMSTEDVIEECKLFY  316

Query  770   FAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVL  591
             FAGQE+TS  LVW M++LS HQ WQ RAR+EV+QVFG  KPD +GLN+LK++TMIL EVL
Sbjct  317   FAGQETTSVLLVWTMVMLSQHQDWQARAREEVKQVFGDKKPDAEGLNQLKVMTMILYEVL  376

Query  590   RLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGV  411
             RLYPP    IR +++E K+G++ LP  + + L  LLVQRD ++WG DAGEFKPERF +G+
Sbjct  377   RLYPPVAQLIRAVHKEMKVGDLTLPGGVHINLPILLVQRDTELWGQDAGEFKPERFKDGL  436

Query  410   AKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLK  231
             +KATKN++++ PF WGPR CIG +FA++EAK+A+A ILQRFSF LSPSY H+P  V+T+ 
Sbjct  437   SKATKNQVSYFPFSWGPRICIGQSFALLEAKMAMALILQRFSFELSPSYVHAPYTVMTIH  496

Query  230   PQFGAPLVLHKI  195
             PQFGA L LHK+
Sbjct  497   PQFGAHLTLHKL  508



>ref|XP_010487266.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   498 bits (1281),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 245/496 (49%), Positives = 339/496 (68%), Gaps = 7/496 (1%)
 Frame = -2

Query  1664  IWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDIL  1485
             +W  R ++WVW KP+ LE +LR+QGL G  Y    GD K  +++ A+A+SKPINL+D+I 
Sbjct  19    LWVWRTLEWVWFKPKMLESYLRRQGLAGTHYTPLVGDLKRNSSMLAEARSKPINLTDEIT  78

Query  1484  PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVS  1305
             PRV+PF    +  +G+  F W GP P V I +PEL++EVF     F++P   PL + + +
Sbjct  79    PRVVPFPLHMLKTHGRTFFTWLGPVPVVTIMDPELIKEVFNKVYDFQKPHTFPLGRIIAA  138

Query  1304  GLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW--CDFD  1131
             GL  Y+  +WA++R+II+PAF+ +KIK M P+   SC E++  +W+ L  +K+   C+ D
Sbjct  139   GLVSYDGDKWAKYRRIINPAFHLEKIKNMVPAFHQSCSEVV-GQWDKLVLDKDGSSCEMD  197

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P+L + T+DVISRTAFG SY EG ++F LQ E A L  Q     + P +  L +K +R
Sbjct  198   VWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELATLIIQAFRKAFIPGYNYLPTKGNR  257

Query  950   RMHEIDNEIRGLMKGLIGKRER----GMKEKvgdddeenldllgvlLKSGFSTDEVIEEC  783
             RM     EI+ +M G++ KR R    G               LG    +G +T+E++EEC
Sbjct  258   RMKAAAREIKVIMGGIVNKRLRAREVGEAPSDDLLGILLESNLGQKKGNGMTTEELMEEC  317

Query  782   QHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMIL  603
             + FYFAGQE+T+  LVW M+LLS HQ WQ RAR+EV+QVFG  +PD +GLN+LK++TMIL
Sbjct  318   KLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDTEGLNQLKVMTMIL  377

Query  602   NEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERF  423
              EVLRLYPP     R +++E KLG++ LP  + + L  LLVQRD ++WG DAGEFKPERF
Sbjct  378   YEVLRLYPPVTQLTRAIHKEMKLGDLTLPSGVQISLPILLVQRDTELWGNDAGEFKPERF  437

Query  422   AEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFV  243
              +G++KATKN+++F PF WGPR CIG NFAM+EAK+A+A ILQ+FSF LSPSY H+P  V
Sbjct  438   KDGLSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYVHAPHTV  497

Query  242   VTLKPQFGAPLVLHKI  195
             +T+ PQFGAPL+LHK+
Sbjct  498   ITIHPQFGAPLILHKL  513



>ref|XP_009394217.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=538

 Score =   498 bits (1282),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 249/501 (50%), Positives = 344/501 (69%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             + WA RV+ W W +PR LE+ LR QGLNG +YR  YGD KE A  + +A++KP+ LS +I
Sbjct  39    LAWALRVLNWAWWRPRWLERALRAQGLNGTAYRFPYGDLKENARFSKEARAKPMPLSHNI  98

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLFKRPKPHPLVKFL  1311
             +PR+LPF + A+ +YGK  F W GP P+V I++PEL++EV  N    F +P  +PLV+F 
Sbjct  99    IPRLLPFLNRAMDEYGKISFTWLGPVPQVTITDPELVREVLSNKFGHFGKPNQNPLVRFF  158

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL  YE ++W +HR+I++PAF+ +K+K M P+ ++ C ++ M +WE +   +   + D
Sbjct  159   ARGLFVYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCSDL-MDRWENMAGSEACYELD  217

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P L++FT DVISRTAFG SY EG  +F LQ EQAEL  QV+ ++Y P +  L + +++
Sbjct  218   VWPELQSFTGDVISRTAFGSSYEEGRPIFHLQAEQAELLIQVVQNLYVPGYRFLPTPKNK  277

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---------SGFSTDE  798
             R+  ID EIR +++G+I KRE+ +K      D+    L+   +K         +G +T++
Sbjct  278   RIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKRLQEDGNKNAGMTTED  337

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  L W MI LS+H TWQ RAR+EV +VFG NKPDFDGL+ LKI
Sbjct  338   VIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKI  397

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R  Y+  KLG++  PP ++L+L  + V  DP++WG DA EF
Sbjct  398   VTMILYEVLRLYPPVIILRRQTYKTMKLGDVVYPPGVLLLLHVIFVHHDPNLWGKDASEF  457

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERFAEGV+KA+K ++AF PFG GPR CIG NFA++EAK+ ++ ILQ FSF LSPSYAH
Sbjct  458   NPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFSFDLSPSYAH  517

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  V    PQ GA + L K+
Sbjct  518   APHTVFIHHPQHGAQIRLRKL  538



>emb|CDY20075.1| BnaA01g29270D [Brassica napus]
Length=508

 Score =   497 bits (1279),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 244/490 (50%), Positives = 326/490 (67%), Gaps = 5/490 (1%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             RVV WVW+KP+KLE +LR+QGL G  Y    GD K    +  +A+SKPI L+DDI PR+L
Sbjct  20    RVVNWVWIKPKKLESYLRRQGLPGTPYTPLVGDVKRNVNMLMEARSKPITLTDDITPRLL  79

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
             P        +G+  F+W GP P ++I+ PE ++EVF     F++    PLV+ LV GLA 
Sbjct  80    PLALKMFNSHGRTFFIWLGPVPTIMITNPEHIKEVFSKVYDFEKNASFPLVRLLVGGLAS  139

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW-CDFDVQPYL  1116
             Y+  +WARHR+II+PAF+ +KIK M P+    C E ++ KW+ L  +K   C+ DV P+L
Sbjct  140   YKGDKWARHRRIINPAFHLEKIKNMVPAFYHCCSE-VVGKWDKLVLDKGLSCEVDVWPWL  198

Query  1115  EAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEI  936
              + T+DVIS  AFG SY EG ++F LQ E + L  Q +   Y P      +K ++RM  I
Sbjct  199   VSMTADVISHAAFGSSYREGQRIFELQGELSSLIAQELKKPYIPGLSFFPTKNNKRMKAI  258

Query  935   DNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKSGFSTDEVIEECQHFYFAGQE  756
             D EI  +++G++ KRE G  E                  SG S +EV+ EC+ FYFAGQE
Sbjct  259   DKEIDVILRGMVSKREAGEAEHNDLLGILLASSSEEYGGSGMSVEEVMRECKLFYFAGQE  318

Query  755   STSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN---KPDFDGLNRLKILTMILNEVLRL  585
             +TS  LVW MILLS HQ WQ+RAR+EV+Q+ G N   KPD D LN LK++TMI  EVLRL
Sbjct  319   TTSVLLVWTMILLSHHQDWQERAREEVRQILGDNINTKPDIDSLNNLKVMTMIFYEVLRL  378

Query  584   YPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAK  405
             YPP     RT+ ++ KLGE+ LP  + + + + LV RDP++WG DAGEFKPERF +G++K
Sbjct  379   YPPVAELRRTVNKKMKLGEITLPAGVRVYIPTALVHRDPELWGEDAGEFKPERFKDGISK  438

Query  404   ATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQ  225
             ATKN++ +LPFGWG R CIG NF+++EAK+A+A ILQRFSF LSPSY HSP  V+T +PQ
Sbjct  439   ATKNQVCYLPFGWGLRICIGQNFSLLEAKMAMALILQRFSFELSPSYVHSPQIVMTTRPQ  498

Query  224   FGAPLVLHKI  195
             FGA L+LHK+
Sbjct  499   FGAHLILHKL  508



>ref|XP_010926871.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Elaeis guineensis]
Length=520

 Score =   497 bits (1280),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 245/502 (49%), Positives = 344/502 (69%), Gaps = 11/502 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V+ WA +VV+WVW +PR+LE+ LR QGL G  YR+F+GD K+ A L+ +A+S+PI LS  
Sbjct  20    VLAWAAKVVEWVWWRPRRLERALRAQGLRGTRYRLFHGDLKDNARLSKQARSRPIPLSHQ  79

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT-LFKRPKPHPLVKF  1314
             I+PRVL   H  + +YGK  F W+GP PRV I +P++++EV  N +    +PK  PL K 
Sbjct  80    IIPRVLSHLHQTMKQYGKMSFTWAGPEPRVSIMDPDMIREVLSNKSGHLDKPKQSPLHKL  139

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             L SGLA Y  ++WARHR+I++PAF+ +K+K M P+ ++ C+E+I KKW  L      C+ 
Sbjct  140   LFSGLAYYSGEKWARHRRIVNPAFHLEKLKLMLPAFSTCCDELI-KKWNGLVDSDGSCEL  198

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV     +FT +VIS TAFG ++ EG ++F LQ +QA+L  Q    +Y P + LL +K++
Sbjct  199   DVWHEFISFTGNVISSTAFGSNFREGQRIFELQAKQAKLFVQAAQHLYIPGYRLLPTKKN  258

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---------SGFSTD  801
              +M +ID E+R L++ +I KR + +      +++    LL    +          G +T+
Sbjct  259   NQMKQIDQEVRVLLRSIIEKRLKAIDMGEATNNDLLGLLLESNRRYSQEGGSKIPGMTTE  318

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             +VIEEC+ FYF G E+++  L W M++LS++ TWQ RAR+EV QVFG N PDFDGLNRLK
Sbjct  319   DVIEECRLFYFGGHETSAVLLTWTMVVLSMNSTWQARAREEVLQVFGENNPDFDGLNRLK  378

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             I+ MIL+EVLRLYPP    IR  + E +LG +  PP + L+L  LLV  DP++WG DA E
Sbjct  379   IVNMILHEVLRLYPPGTMIIRKTHREVELGGIIFPPGVQLLLPVLLVHHDPELWGEDAAE  438

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERFA GV+KA++N+ AF PFGWGPR CIG +FAM+EAK+A+A ILQ FSF LSP+YA
Sbjct  439   FNPERFAGGVSKASRNQGAFFPFGWGPRICIGQSFAMIEAKMALARILQHFSFELSPTYA  498

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P  V+TL PQ GA ++LH++
Sbjct  499   HAPHVVITLHPQHGAQIILHRL  520



>ref|XP_004168302.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=523

 Score =   498 bits (1281),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 247/518 (48%), Positives = 332/518 (64%), Gaps = 21/518 (4%)
 Frame = -2

Query  1688  FISVPAVVIWACRV----------VQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
              IS P V+I +  +            W+W  PR+LE+ LR+QG  GNSY++ +GD KE A
Sbjct  7     MISTPIVIITSLVLLLLLFLGWKLADWIWFGPRRLEQLLRRQGFTGNSYKILHGDMKESA  66

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
              +  +A SKP+  S+ I PRV+P  +  + +YGKN  +W GP PRV I +PE ++ VF  
Sbjct  67    AMRKEALSKPMKFSNHIAPRVIPSVYHTIQRYGKNSMMWLGPLPRVHIMDPEQLKTVFSF  126

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                F+RP   P ++ L+ GL   E ++W +HRKII+PAF+ +K+K M P+   SC EM+ 
Sbjct  127   FNDFQRPTTDPFIRLLIHGLVSLEGEKWVKHRKIINPAFHLEKLKAMVPAFYHSCNEMV-  185

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              KWE + S +  C+ DV PYL+   +DVISRTAFG SY  G K+F LQ E   L  Q   
Sbjct  186   SKWESMVSREGSCELDVMPYLQNMAADVISRTAFGSSYERGKKIFKLQTELTNLVIQASL  245

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
               Y P W  L +K +R++ E + EI  L+ G+I ++E+ MK       +    L+   + 
Sbjct  246   ETYIPGWRFLPTKSNRKIKETNREITTLVLGIINEKEKSMKAGEEIQTDLLSILMESNMN  305

Query  818   S----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQ  669
                        G S   VIEEC+ FY AGQE+T+  L+W M+LLS +  WQ+RAR EV +
Sbjct  306   EIKHGRNSKDVGMSIQAVIEECRLFYIAGQETTATLLIWTMVLLSSYSDWQERARAEVFE  365

Query  668   VFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililss  489
             +FG+ KPD+DGLNRLK++TMI NEVLRLYPP     RT  +ETKLG M LP  I+L L  
Sbjct  366   IFGNKKPDYDGLNRLKVVTMIFNEVLRLYPPVSMLGRTTRKETKLGNMTLPGGIMLSLPI  425

Query  488   lLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAI  309
             +L+QRDP++WG DA EF PERF+EGV KATKN  AF+PFGWGPR CIG NFAM+EAK+A+
Sbjct  426   ILIQRDPELWGEDAHEFNPERFSEGVFKATKNPGAFMPFGWGPRICIGQNFAMIEAKMAL  485

Query  308   ATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             + ILQ FSF LSPSY H+P   +T +PQ GA ++LHK+
Sbjct  486   SMILQHFSFELSPSYTHTPFAALTTQPQHGAHIILHKL  523



>ref|XP_004166891.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=523

 Score =   497 bits (1280),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 247/517 (48%), Positives = 337/517 (65%), Gaps = 21/517 (4%)
 Frame = -2

Query  1685  ISVPAVVIWAC----------RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMAT  1536
             IS P V+I +           ++  W+W +P+KLEK LRQQG  GNSYR+ +GD KE A 
Sbjct  8     ISTPTVMIISFVLVLLLLLGWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKESAA  67

Query  1535  LTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN  1356
             +  +A SKP+N S+ I PRV+P  H  +  YGKN F+W G  PRV I +PE ++ VF   
Sbjct  68    MREEAMSKPMNFSNHIAPRVIPSVHQTIQHYGKNSFMWIGTVPRVHIMDPEQLKTVFSFI  127

Query  1355  TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMK  1176
               F+RP  +PL+K   +GL  +E Q+W +HRKIISPAF+  K+K M P    SC EM+  
Sbjct  128   NDFQRPTMNPLLKLFTNGLFSHEGQKWVKHRKIISPAFHLKKLKDMIPEFYHSCNEMV-S  186

Query  1175  KWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHS  996
             KWE + SE+  C+ DV PYL+   SDVISRTAFG SY +G K+F LQ++      Q    
Sbjct  187   KWESMVSEEGSCELDVMPYLQNMASDVISRTAFGSSYEKGKKIFELQSKLGAFAIQSSLG  246

Query  995   VYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS  816
             +Y P W  L +K + +M EI  EI  L+ G++ ++E+ MK       +    L+   L  
Sbjct  247   IYIPGWRFLPTKSNNKMKEISKEISTLILGVMNEKEKSMKAGEAIQTDLLSILIESNLNE  306

Query  815   ----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
                       G S  +VI+EC+ FY  GQE+T+  L+W M++LS +  WQ+RAR+EV ++
Sbjct  307   IKEHGNNKGMGLSIQDVIDECKLFYITGQETTATLLIWTMVMLSSYSEWQERARKEVFEI  366

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG+ KPD+DGL+RLK++TMI NEVLRLYPP     RT+ +ETKLG + LP  ++L L  +
Sbjct  367   FGNKKPDYDGLSRLKVVTMIFNEVLRLYPPVSMYARTVNKETKLGNLTLPAGVMLSLPII  426

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
             L+Q D ++WG DA EF P RF+EGV+KATKN  A++PFGWGPR CIG NFAM+EAK+A++
Sbjct  427   LIQTDRELWGQDAHEFNPNRFSEGVSKATKNPCAYVPFGWGPRICIGLNFAMIEAKMALS  486

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              ILQRFSF LSPSY H+P   +T +PQ GA ++LHK+
Sbjct  487   MILQRFSFQLSPSYTHTPIAGLTTQPQHGAHIILHKL  523



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   497 bits (1280),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/499 (50%), Positives = 336/499 (67%), Gaps = 10/499 (2%)
 Frame = -2

Query  1664  IWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDIL  1485
             + A +V   VWL P+KLEK L++QG  GN Y++ YGD KE++TL  +A SKPINL+DD +
Sbjct  21    VLAWKVFNQVWLTPKKLEKRLKEQGFRGNPYKLLYGDFKEISTLFKEALSKPINLTDDFV  80

Query  1484  PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVS  1305
             PRV+P ++ A  KYGK+ ++W G    V+I +PE ++EV     +F+RP  +PL+K LV 
Sbjct  81    PRVIPHFYAATKKYGKHTYLWQGTELTVVIMDPEHIREVTQKVYIFQRPHSNPLLKLLVQ  140

Query  1304  GLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQ  1125
             GLA Y   +W +HRK+I+PAF+ +K+K M PS  +S  EM M KWE + S     + DV 
Sbjct  141   GLASYNGDKWTKHRKLINPAFHVEKLKHMLPSFYTSASEM-MCKWEDIVSSNGSSELDVW  199

Query  1124  PYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRM  945
             P L+  T D ISRTAFG +Y EG+++F LQ EQ E   +   S+Y P W  + +KR+ RM
Sbjct  200   PDLQTLTCDAISRTAFGSNYKEGSRIFELQREQTEHFIEAARSLYIPGWRFIPTKRNTRM  259

Query  944   HEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTDEVI  792
              +I  +++  +K +I  R + MK     DD+    LL    K          G +  EVI
Sbjct  260   KQIARDVQESIKDIINARLKAMKAAKACDDDLLGILLESNSKEIDHHGNKNFGMTVLEVI  319

Query  791   EECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILT  612
             EEC+ FYFAGQE+TS  LVW MILLS +  WQ RAR+EV Q+FG +KPDFDGLN LK++T
Sbjct  320   EECKLFYFAGQETTSVLLVWTMILLSRYPEWQMRAREEVLQLFGTDKPDFDGLNHLKLIT  379

Query  611   MILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKP  432
             MIL+EVLRLYPP     R   EET+LG + LP  +++ L  +L+  DP++WG D  EFKP
Sbjct  380   MILHEVLRLYPPVTALFRRAAEETRLGNLTLPAGLLVSLPVMLLHHDPEIWGDDVKEFKP  439

Query  431   ERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSP  252
             ERFA+GV+KATK + AF PF WGPR CIG NFAM+EAK+A+  ILQRFSF LSPSY H+P
Sbjct  440   ERFADGVSKATKGQFAFFPFSWGPRICIGQNFAMLEAKLAMTMILQRFSFELSPSYTHAP  499

Query  251   CFVVTLKPQFGAPLVLHKI  195
               + TL+PQFGA L+LH++
Sbjct  500   RAMATLQPQFGAQLILHRL  518



>ref|XP_010927481.1| PREDICTED: cytochrome P450 CYP72A219-like [Elaeis guineensis]
Length=535

 Score =   498 bits (1281),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 244/517 (47%), Positives = 350/517 (68%), Gaps = 17/517 (3%)
 Frame = -2

Query  1712  SWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             SW S+  L ++      WA R ++WVW +PR+LE+ LR QG+ G  YRV  GD K+MA  
Sbjct  13    SWGSVGLLLLAA-----WAVRALEWVWWRPRRLERALRAQGIKGTRYRVLKGDLKDMARF  67

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-  1356
             + +A+SKP+ LS  I+PRVLPF    +  +GK  F+W GP PRVI+++ EL++ +     
Sbjct  68    SKEAQSKPMPLSHCIVPRVLPFIRQVINDHGKISFMWFGPYPRVILNDAELVKGLLSGKF  127

Query  1355  TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMK  1176
               F++PK  PL + LV+G+  +E ++WARHR+II+PAF+  K+KCM P+  + C ++I K
Sbjct  128   GHFEKPKVTPLGRLLVTGVLIHEGEKWARHRRIINPAFHLKKLKCMLPTFYACCHQLI-K  186

Query  1175  KWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHS  996
             +W++    +  C+ D+ P  +  T DVISRTAFG S+ EG ++F L  EQAELT QVI +
Sbjct  187   RWDMHIGLQGSCELDIWPEFQGLTGDVISRTAFGCSFKEGRRIFQLLEEQAELTFQVIRN  246

Query  995   VYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK-  819
             +Y P +  + +K ++RM EI  E R L+  +I +RER M++    +D+    L+    + 
Sbjct  247   IYIPGYRFVPTKTNKRMMEIHRETRALLSRMIEQRERAMRKAGAANDDLLGLLMESNFRY  306

Query  818   ---------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
                      +G + D+VIEEC+ FYFAG E+TS  L W M+ L +H +WQ RAR+EV Q+
Sbjct  307   SQEQGGSTNAGMTKDDVIEECKLFYFAGHETTSVLLTWTMVALGMHPSWQARAREEVLQI  366

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG NKPDFDGL++LKI+TMIL+EVLRLYPP+ + +R  Y++ KLG+   P  + L+L  L
Sbjct  367   FGKNKPDFDGLSQLKIVTMILHEVLRLYPPTAFLLRETYKKMKLGDFSFPQGVQLVLPLL  426

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
             L+  DP+ WG DA EF PERFA GV+ A+K + AF+PFGWGPR C+G +FAMMEAK+ +A
Sbjct  427   LIHHDPEFWGEDASEFNPERFARGVSNASKIQGAFIPFGWGPRICVGQSFAMMEAKMVLA  486

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             TILQ FSF  SPSYAH+P  V+T+ PQ+GA ++L ++
Sbjct  487   TILQNFSFEPSPSYAHAPYTVMTIHPQYGAQIILRRL  523



>emb|CDP15979.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   497 bits (1279),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 256/524 (49%), Positives = 347/524 (66%), Gaps = 14/524 (3%)
 Frame = -2

Query  1727  MDRI-QSWVSILFLFISVPA---VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFY  1560
             MDR   +++S + L  ++ +   +V  A ++ +WVWL P+KLEK LRQQG  GNSY    
Sbjct  1     MDRAPAAYLSSIVLVTALSSAIFLVALAWKLFKWVWLNPKKLEKLLRQQGFRGNSYIPVL  60

Query  1559  GDTKEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPEL  1380
             GD   M+TL  +A SKPINLSDDI+PR++P Y   V K+GKN ++W GP P V I +PEL
Sbjct  61    GDVIAMSTLLKQAHSKPINLSDDIVPRIIPEYLDLVKKHGKNTYIWYGPEPSVCIQDPEL  120

Query  1379  MQEVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTS  1200
             ++E   N  LF +P  + L + L  GL  Y   +WA+HRK+I+PAF+ +K+K M PS  +
Sbjct  121   IREASQNINLFHKPVVNQLTRLLAPGLISYNGDKWAKHRKLINPAFHGEKLKLMLPSFCT  180

Query  1199  SCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAE  1020
             S   M ++KWE + S   +C+ DV P L + +SD ISRTAFG +Y EG  +F LQ EQ E
Sbjct  181   SATAM-LRKWEEIISPTGFCELDVWPSLRSLSSDAISRTAFGSNYEEGRVIFELQGEQCE  239

Query  1019  LTRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenld  840
             L  + + S+  P W  L +KR+RRM +I  ++   ++ +I  R   ++     DD+    
Sbjct  240   LCIKALWSMLIPGWRFLPTKRNRRMGQIFKDVTDSIREIINSRLNEIRAGEFGDDDFLGL  299

Query  839   llgvlLKS---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRA  687
             LL    +          G + +EVIEEC+ FY AGQE+TS  LVW +ILLS+HQ WQ RA
Sbjct  300   LLQSNSQEIDRHGNKDFGMTIEEVIEECRLFYVAGQETTSVLLVWTLILLSVHQEWQTRA  359

Query  686   RQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNi  507
             R EV QVFG   PDFDGLN LK++TM+L EVLRLYPP P   R    ETKLG + LP  +
Sbjct  360   RDEVLQVFGTRIPDFDGLNHLKLVTMVLYEVLRLYPPIPVNGRITAAETKLGNLSLPSGV  419

Query  506   ililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMM  327
             ++++ +LLV  D  +WG DA EFKPERF++G + ATK  +AF PFGWGPR+CIG ++AM+
Sbjct  420   LVLIQTLLVHHDQAIWGEDAKEFKPERFSQGASHATKGNIAFFPFGWGPRSCIGQSYAML  479

Query  326   EAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             EAK+ +A ILQRF F LSPSY+H+P  +VTLKPQ+GAPL+LHK+
Sbjct  480   EAKLVLAMILQRFWFKLSPSYSHAPISLVTLKPQYGAPLILHKL  523



>ref|XP_010502013.1| PREDICTED: cytochrome P450 72A13 isoform X1 [Camelina sativa]
Length=519

 Score =   496 bits (1278),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 245/502 (49%), Positives = 340/502 (68%), Gaps = 13/502 (3%)
 Frame = -2

Query  1664  IWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDIL  1485
             +W  R +QWVW KP+ LE +L++QGL G  Y    GD K  +++ A A+SKPI L+DDI 
Sbjct  19    LWVWRTLQWVWFKPKMLESYLKRQGLAGTPYTPLVGDLKRNSSMLAVARSKPIKLTDDIT  78

Query  1484  PRVLPF------YHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPL  1323
             PRV+PF       H+AV + G+  F W GP P + I +PEL++EVF     F++    PL
Sbjct  79    PRVVPFPLHMLKTHVAVAETGRTFFTWFGPVPVITIMDPELIKEVFNKVYDFQKAHTFPL  138

Query  1322  VKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK--  1149
              + + +GL  Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++  +W+ L  +K  
Sbjct  139   GRIIAAGLVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVV-GQWDKLALDKEG  197

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
             + C+ DV P+L + T+DVISRTAFG SY EG ++F LQ E A+L  Q     + P +  L
Sbjct  198   SSCEMDVWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELAKLIIQAFRKAFIPGYNYL  257

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFSTD  801
              +K +RRM     E++ ++ G++ KR    E G               LG    +G +T+
Sbjct  258   PTKGNRRMKAAAREVKVILGGIVNKRLRAREAGDATSDDLLGILLESNLGQKKGNGMTTE  317

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             E++EEC+ FYFAGQE+T+  LVW M+LLS HQ WQ RAR+EV+QVFG  +PD +GLN+LK
Sbjct  318   ELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDTEGLNQLK  377

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMIL EVLRLYPP     R +++E KLG++ LP  + + L  LLVQRD ++WG DAGE
Sbjct  378   VMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPSGVQISLPILLVQRDTELWGNDAGE  437

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             FKPERF +G++KATKN+++F PF WGPR CIG NFAM+EAK+A+A ILQ+FSF LSPSY 
Sbjct  438   FKPERFKDGLSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYV  497

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P  V+T+ PQFGAPL+LHK+
Sbjct  498   HAPHTVITIHPQFGAPLILHKL  519



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   496 bits (1277),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 256/513 (50%), Positives = 350/513 (68%), Gaps = 11/513 (2%)
 Frame = -2

Query  1703  SILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAK  1524
             + + LF      + WA R++ W+WLKP+KLEK LR+QG  GNSYR+  GD +++     +
Sbjct  6     TAIILFTLTILSLTWAWRMLNWLWLKPKKLEKLLREQGFKGNSYRLLVGDVRDLLKTRKE  65

Query  1523  AKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
             A SKP+NLSDDI PRV  + H +VTKYGKN F+W GP PRV I++PE +++V      F+
Sbjct  66    ATSKPMNLSDDIGPRVFSYVHHSVTKYGKNSFMWFGPIPRVNITDPEQIKDVLNKIYDFR  125

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +P  +PLV+ L +GL  YE ++W +HRKII+PAF+ +K+K M P    SC+++I  KWE 
Sbjct  126   KPNSNPLVRLLANGLVSYEGEKWNKHRKIINPAFHLEKLKIMLPIFFKSCDDLI-SKWEK  184

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
             + S +  C+ DV P+L+   SDVISRTAFG S+ EG ++F LQ EQAELT+Q++  VY P
Sbjct  185   MLSLEGSCEMDVWPFLQNLASDVISRTAFGSSFEEGKRIFQLQIEQAELTKQIMMKVYIP  244

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  L +   +RM EID +I+  +  +I KRE+ +K      D+    LL    +     
Sbjct  245   GWRFLPTTTHKRMKEIDRDIKASLTDMINKREKALKAGEATKDDLLGILLESNHREMEEH  304

Query  815   ------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
                   G S ++VIEEC+ FYFAGQE+TS  LVW M+ LS +  WQ RAR+EV QVFG+ 
Sbjct  305   GNNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVCLSRYPDWQARAREEVFQVFGNK  364

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             KPDFDGL+ LKI+TMILNEVLRLYPP     R+++++ KLG + LP  + + L  +LV  
Sbjct  365   KPDFDGLSHLKIVTMILNEVLRLYPPVIALARSVHKDVKLGNITLPAGVQVSLPVVLVHH  424

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             D ++WG DA  F PERF+EGV KAT  +++F PFG GPR CIG NF+M+EAK+A+A ILQ
Sbjct  425   DCELWGDDAKVFNPERFSEGVLKATNGKVSFFPFGGGPRICIGQNFSMLEAKMAMAMILQ  484

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              FSF LSPSYAH+P  V+TL+PQ+GA ++L K+
Sbjct  485   HFSFELSPSYAHAPATVITLQPQYGAHIILRKV  517



>gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score =   496 bits (1277),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 243/506 (48%), Positives = 342/506 (68%), Gaps = 9/506 (2%)
 Frame = -2

Query  1688  FISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKP  1509
              IS    +++A +++ WVW +PRKLEK LRQQG  GNSY++F+GD  E+  +T +AKSKP
Sbjct  10    LISCAVALVYAWKILNWVWFRPRKLEKILRQQGFKGNSYKLFFGDFNELKAMTKEAKSKP  69

Query  1508  INLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH  1329
             ++ S +I+PRV P     V  YG+  F+W GP P VI+ +PE+++E+   + +F+ P  +
Sbjct  70    MSFSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKSYVFQMPGGN  129

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  + L  G+A YE  +WA+HR++I+PAF+ +K+K M P+   SC +M + KWE +   +
Sbjct  130   PTSRMLARGIASYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCADM-LSKWEKIVPRE  188

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
               C+ DV PYL+  TSD ISRTAFG SY EG ++F LQ EQAEL  + + +V  P    L
Sbjct  189   GLCELDVWPYLQTLTSDAISRTAFGSSYEEGRRIFELQKEQAELIMEALRTVCIPGSRFL  248

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--------G  813
              +K ++RM++I  E+   + G+I KR + +K      D+    LL   LK         G
Sbjct  249   PTKNNKRMNKIVREVESSVLGIINKRMKAIKAGETAGDDLLGLLLESNLKEIEQHGNKFG  308

Query  812   FSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGL  633
              S  EVIEEC+ FYFAGQE+TS  LVW MILLS H+ WQ+RAR EV Q+FG +KPD+  L
Sbjct  309   MSLKEVIEECKLFYFAGQETTSTLLVWTMILLSKHKDWQERARDEVLQLFGRDKPDYQEL  368

Query  632   NRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGA  453
             N LKI++MI +EVLRLYPP     R   +E+ LG++ LP  + L++ ++L+  D  +WG 
Sbjct  369   NHLKIVSMIFHEVLRLYPPGVMLNRISMKESTLGKVTLPAGVQLLMPAVLLHHDRKIWGD  428

Query  452   DAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLS  273
             DA EFKPERF+EGV+KAT+ +L + PFGWGPR CIG +FAM+EAK+A+A ILQ +SF LS
Sbjct  429   DAEEFKPERFSEGVSKATQGQLVYFPFGWGPRICIGQSFAMLEAKLAMAMILQHYSFELS  488

Query  272   PSYAHSPCFVVTLKPQFGAPLVLHKI  195
             PSY+H+P  V+TL+PQ GA L+L K+
Sbjct  489   PSYSHAPATVITLQPQHGAHLILRKL  514



>ref|XP_006495016.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=519

 Score =   496 bits (1277),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 235/503 (47%), Positives = 353/503 (70%), Gaps = 12/503 (2%)
 Frame = -2

Query  1673  AVVIWACR---VVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN  1503
             A++  AC    ++ WVWLKP+KLEK+LR+QG +GNSY+VF+GD KE+A  T +AKS+PI+
Sbjct  19    AILAVACAWWMLLNWVWLKPKKLEKFLREQGFSGNSYKVFHGDMKELAQTTKEAKSRPIS  78

Query  1502  LSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPL  1323
             LSDDI  R+LPF+H  +T +GKN F+W GP P + I++P++++E+F+ + +FK+ +  PL
Sbjct  79    LSDDIARRILPFHHHIITNFGKNSFIWMGPRPNINITDPKMIREIFLKHDIFKKLRS-PL  137

Query  1322  VKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW  1143
              K L++G+  Y+ +QW + RKI +PAF+ DK+K M P++  SC +M ++KWE+  S+   
Sbjct  138   AKLLITGMVGYDGEQWFKVRKIATPAFHHDKLKNMLPTIHKSCNDM-LRKWEMSFSKDES  196

Query  1142  CDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSS  963
             C+ DV P+++  T+DVISRTAFG ++ EG K+F + +EQ  L  Q     Y P W  + +
Sbjct  197   CELDVWPHIQTLTADVISRTAFGSNFEEGRKIFEVLSEQINLVIQASLFAYIPGWRFVPN  256

Query  962   KRSRRMHEIDNEIRGLMKGLIGKRERGMK-------EKvgdddeenldllgvlLKSGFST  804
             K +R+++   NE+  L+KG++ KR+  +K       + +     E+        ++G S 
Sbjct  257   KLNRKLNSNHNEMGELVKGIVNKRKEALKFGKASNNDDLLGILMESNHKEIQEKETGMSI  316

Query  803   DEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRL  624
             +EVIEEC+ FY AGQE+T+  LVW M+LL IH  WQ+RAR+EV QVFG+ +P F+ LN+L
Sbjct  317   EEVIEECKLFYLAGQETTASLLVWTMVLLCIHPEWQERAREEVCQVFGNREPKFEELNQL  376

Query  623   KILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAG  444
             K+++ IL EVLRLY P+P   R   +E KLGE+ +PP ++L L  +LV  D + WG DA 
Sbjct  377   KVVSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVLLSLQIMLVHHDHEYWGDDAK  436

Query  443   EFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSY  264
             +F P+RF+EGV+ A+KN+++F  FGWGPR C+G NFA++E+K+A+A ILQ+F+F LSP+Y
Sbjct  437   KFNPDRFSEGVSNASKNQISFFSFGWGPRICLGQNFALLESKLALAMILQKFTFQLSPTY  496

Query  263   AHSPCFVVTLKPQFGAPLVLHKI  195
              H+P   VT+ PQ GA ++LHKI
Sbjct  497   MHAPTRGVTVYPQHGANIILHKI  519



>ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=530

 Score =   496 bits (1277),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/524 (47%), Positives = 347/524 (66%), Gaps = 13/524 (2%)
 Frame = -2

Query  1730  TMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDT  1551
              +D I +W+ ++ + +   ++++   ++V W+W +P+KLEK LRQQG  GNSYR+ +GD 
Sbjct  4     VLDMISTWLIVVIVVLLSSSLLLLGWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDL  63

Query  1550  KEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             KE A +  +A SKP+N S+ I PRV+P  H  +  YGKN F+W GP PRV I +PE ++ 
Sbjct  64    KESAAMRDQAISKPMNFSNYIAPRVIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKT  123

Query  1370  VFMNNTLFKRPKP--HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSS  1197
             VF     +++P    +PL K L  GL  +E Q+W +HRKII+PAF+ +K+K M P+   S
Sbjct  124   VFSLINDYQKPTASLNPLAKLLADGLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHS  183

Query  1196  CEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAEL  1017
             C+EMI  KWE + S + +C+ DV PYL+  T+DVISRTAFG SY +G K+F LQ E  E+
Sbjct  184   CDEMI-SKWESMVSVEGFCELDVMPYLQNMTADVISRTAFGSSYEKGKKIFKLQTELGEM  242

Query  1016  TRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldl  837
               Q    +Y P W  L +K + +M  I  EI  L+  +I +RE  MK       +    L
Sbjct  243   VMQSTLGIYIPGWRFLPTKSNNKMKVISKEISTLIMDIINERETSMKSGEAIQTDLLSIL  302

Query  836   lgvlLKS----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRA  687
             +   L            G S ++VI+EC+ FY AGQE+T+  L W M+LLS +  WQ+RA
Sbjct  303   MESNLNEIKQHGNNKDIGMSIEDVIDECKLFYIAGQETTATLLTWTMVLLSSYSDWQERA  362

Query  686   RQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNi  507
             R EV ++FG+ KP++DGL+RLK++TMILNEVLRLYPP     R + +ETKLG++ LP  +
Sbjct  363   RAEVFEIFGNKKPNYDGLSRLKVVTMILNEVLRLYPPVSMFGRLVKKETKLGKLTLPAGV  422

Query  506   ililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMM  327
             +L L  +L+Q DP++WG DA EFKPERF+EGV+KA KN  AF+PFGWGPR CIG NFAM+
Sbjct  423   MLGLPVVLMQCDPELWGEDAHEFKPERFSEGVSKAAKNPGAFVPFGWGPRICIGLNFAMI  482

Query  326   EAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             EAK+ ++ ILQRFS  LS SY H+P   +T +PQ GA ++LHK+
Sbjct  483   EAKMTLSMILQRFSLELSSSYTHAPIAAITTQPQHGAHIILHKL  526



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   496 bits (1276),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 252/507 (50%), Positives = 343/507 (68%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             I V  ++++  +V+ W W +P+KLEK+LR+ GL GN Y++ YGD KE+     +AKSKPI
Sbjct  12    ICVAILLVYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELKNKLNEAKSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR-PKPH  1329
             N SD I  R+ PF+  A+ K GK+ FVW GP P V+I+EPE ++E+   N +++R    +
Sbjct  72    NFSDGIAQRINPFFANAIDKNGKSSFVWLGPYPIVLITEPEHVKEILTKNYVYQRQTHAN  131

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  K L  GLA  E+ +WA+HRKII PAF  +K+K M P+   SC EMI  KWE +  ++
Sbjct  132   PFAKKLALGLAKLEEDKWAKHRKIIQPAFQVEKLKHMLPAFYQSCSEMI-SKWEEIIPKE  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L+  T++VISRTAFG SY EG  VF LQ EQAE    +I SVY P    L
Sbjct  191   TPFELDVWPDLQLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVIDIIRSVYIPGTRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR++RM EI+N+++  ++ +I KR R M+       +    LL   ++          
Sbjct  251   PTKRNKRMLEIENKVQTTIRSIIDKRLRAMEAGEASKTDLLGILLESNMREIKQHRSNDF  310

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +T E+IEEC+ FYFAGQE+TS  L W MILLS+H  WQ RAR+EV QVFG+ KP+ +G
Sbjct  311   GITTAEMIEECKLFYFAGQETTSVLLAWTMILLSLHPEWQARAREEVLQVFGNEKPNSEG  370

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             L+RLKI+TMIL+E LRL+P  P   R    E KLGE+ LP  + LI+ ++L+  D ++WG
Sbjct  371   LSRLKIVTMILHETLRLFPSVPTYRRRNKHEVKLGELSLPAGVQLIIPTILIHYDKELWG  430

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+KATK +++F+PFG GPR CIG NFAMMEAK+AIA ILQ+FSF L
Sbjct  431   EDAKEFKPERFSEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKFSFEL  490

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P   +T+ PQ+GAPL++ K+
Sbjct  491   SPSYTHAPVLTITIHPQYGAPLLMRKL  517



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   496 bits (1276),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 345/510 (68%), Gaps = 7/510 (1%)
 Frame = -2

Query  1703  SILFLFISVPAVV--IWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLT  1530
             S +   +S   VV  + A R + W W +P+KL+K L+QQG  GN Y++ YGD K++++L 
Sbjct  6     SFMIALVSSCCVVLSVLAWRALNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDFKQISSLF  65

Query  1529  AKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTL  1350
              +A SKPI+LSDDI+PR++P +  AV KYGKN ++W GP P ++I +PEL+++V     +
Sbjct  66    QEANSKPISLSDDIVPRIVPHFLEAVNKYGKNTYLWFGPRPMMLIMDPELIRKVTHKMDI  125

Query  1349  FKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKW  1170
             F++ +  P  + L+ G+  YE ++WA+ RK+++ AF+ +K+K M P+   S  EM+ K  
Sbjct  126   FQKVRFRPQARLLIGGILVYEGEKWAKQRKLLNQAFHTEKLKLMVPAFYKSASEMLSKWE  185

Query  1169  ELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVY  990
             E+++ + ++   DV P ++  TSD ISRTAFG  Y EG K+F LQ EQA    +   S+Y
Sbjct  186   EMISVKGSFEVVDVWPNIQTMTSDAISRTAFGSRYEEGRKIFELQREQARHLVEATRSIY  245

Query  989   SPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMK-----EKvgdddeenldllgvl  825
              P    L +KR+RRM +I  E+ G ++ +I  R + ++     +                
Sbjct  246   IPGSRFLPTKRNRRMKQIAKEVEGSIREIINARLKALRAGEAIDADMLGILLESTSQETD  305

Query  824   LKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
              +SG +T E+I+EC+ FYFAGQE+T+  LVW MILLS+H  WQ+RAR+EV Q FG + P+
Sbjct  306   GESGMTTGEIIQECKLFYFAGQETTAVLLVWTMILLSMHPDWQERAREEVLQHFGTDMPN  365

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
             FDGLN+LKI+TMIL+EVLRLYPP P   R++ EETK+G + +P   +L L  +L+  DP+
Sbjct  366   FDGLNQLKIVTMILHEVLRLYPPFPNIGRSVAEETKIGNLTIPAGQLLTLPMILLHHDPE  425

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG D  EFKPERFA+GV+ ATK ++ + PFGWGPR CIG NFAM+EAK+A+A ILQRFS
Sbjct  426   IWGQDVKEFKPERFADGVSSATKGQIVYFPFGWGPRICIGQNFAMLEAKLALAMILQRFS  485

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             F LSPSY+H+P   + ++PQFGA L+LHK+
Sbjct  486   FELSPSYSHAPHLTIAIQPQFGAHLMLHKL  515



>emb|CDP11335.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   496 bits (1276),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 334/507 (66%), Gaps = 17/507 (3%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             ++ A +V    WL P++LEK L++QGL GN Y+  +GD K+++TL  +A SK INLSDD+
Sbjct  20    LMLAWKVFNCAWLTPKRLEKRLKEQGLRGNPYKFLHGDFKQISTLLKEAHSKTINLSDDL  79

Query  1487  LPRVLPFYHLAVTKYGK-------NCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH  1329
              PRV+P  H AV KYGK       N ++W GP  RV+I  PE ++E+    ++F++P   
Sbjct  80    FPRVIPHLHEAVKKYGKYYLLFNYNTYIWLGPKLRVVIMNPEHIREITSKLSIFQKPGGT  139

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  K LV GLA Y+  +WA+HRK+I+PAF+ +K+K M PS  +   EM + KWE + S  
Sbjct  140   PDTKLLVQGLASYDGDKWAKHRKLITPAFHVEKLKHMVPSFCTCAGEM-LSKWEKIVSTN  198

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
               C+ DV P L   T D ISRTAFG +Y EG ++F LQ EQA+   + + SVY P W  L
Sbjct  199   GSCELDVWPDLRTLTCDAISRTAFGSNYKEGTRIFELQTEQAQYHLKAVQSVYFPGWRFL  258

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR+RRM +I  ++   ++ +I  R   M+      D+    LL    K          
Sbjct  259   PTKRNRRMKQIAKDVHESIRKIINARLEAMEAGDACADDLLSILLESNSKEIDYHGNKGF  318

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G S  EVIEEC+ FYFAGQE+TS  LVW MILLS +  WQ RAR+EV Q FG NKPD DG
Sbjct  319   GMSIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPNWQARAREEVLQHFGTNKPDLDG  378

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             LN LK++TMIL+EVLRLYPP P   R   EET+LG + LP  + + L ++L+   P++WG
Sbjct  379   LNHLKLVTMILHEVLRLYPPVPELARKAAEETQLGNLTLPSQVQVSLPAMLLHYAPEIWG  438

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              D  EFKPERFA+GV+ AT  ++AF PFGWGPR C+G NFAM+EAK+A+A ILQRFSF L
Sbjct  439   DDVKEFKPERFADGVSNATNGKVAFFPFGWGPRICVGQNFAMLEAKVALAMILQRFSFEL  498

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P  V+TL+PQ+GA L+LHK+
Sbjct  499   SPSYRHAPRVVLTLQPQYGAHLILHKL  525



>gb|EYU26272.1| hypothetical protein MIMGU_mgv1a018891mg [Erythranthe guttata]
Length=526

 Score =   495 bits (1275),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 247/519 (48%), Positives = 345/519 (66%), Gaps = 16/519 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +SI+F  I V A + WA +++ WVW +PRKLEK LRQQGLNGNSYR F GD  +M     
Sbjct  6     LSIIFTSIVVAASMTWAVKLLNWVWFRPRKLEKILRQQGLNGNSYRPFLGDLDDMIKFMK  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
               + K I LSDDILP +  +YH  VTKYG+N F+W GP PRV IS+PE+++E+     +F
Sbjct  66    AEQPKTIELSDDILPHIFAYYHQIVTKYGENSFIWFGPWPRVNISDPEIIKEILSKPDIF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
              +P P    K L+ G+   E ++W++HRKI++PAF+ +K+K M P++  SC  MI K  E
Sbjct  126   HKPLPET-AKILIGGMLLLEGEKWSKHRKIVTPAFHLEKLKNMVPAIGLSCSNMINKLKE  184

Query  1166  LLTSEKNWCDFDVQ--PYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             + +S ++   F++   PY++  T DVISRTAFG SY EG K+F LQ E+ +L  Q++   
Sbjct  185   IASSRRDEGGFEIDMWPYIDDLTGDVISRTAFGSSYEEGRKIFQLQKERVKLALQLLQFS  244

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             + P W  + +K +R++  I NEI  +++G+I KR +   E   +      DLLG++++S 
Sbjct  245   FIPGWRHVPTKVNRKVKAISNEIESILRGIIKKRHKSATETGENGVFFGDDLLGLMMESN  304

Query  815   ------------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQ  672
                         G + +EVIEEC+ FYFAG E+ S  LVW M+LL  H  WQ +AR+EV 
Sbjct  305   ARFTREEGNANEGMTIEEVIEECKLFYFAGSETNSGLLVWTMVLLCKHPEWQTQAREEVM  364

Query  671   QVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilils  492
             +VFG+++P+F GLN LKI+TMIL EVLRLY P+P T+R   E  KLG M +P  + L L 
Sbjct  365   RVFGNSEPNFQGLNHLKIVTMILQEVLRLYSPAPLTVRAPTETVKLGNMTIPLGVHLSLL  424

Query  491   slLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIA  312
                V  DPD+WG DA EF P+RF+EGV+ ATK + +FLPF  GPR C+G+ FAM+EAK+A
Sbjct  425   ISQVHCDPDIWGDDAKEFNPKRFSEGVSNATKIQSSFLPFSSGPRICLGHTFAMIEAKMA  484

Query  311   IATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +A IL+ FSF LSPSY H+P  V+TL+PQ+GAP++L  +
Sbjct  485   LAMILKHFSFELSPSYLHAPFAVITLQPQYGAPMILRSL  523



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   495 bits (1275),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 251/503 (50%), Positives = 340/503 (68%), Gaps = 12/503 (2%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             VV  + + + WVW +PRKLEK L++QG  GN Y++ +GD KEM+TL  +A+SK +NLSDD
Sbjct  20    VVGVSWKALNWVWFRPRKLEKRLKEQGFRGNPYKLLHGDIKEMSTLHKEAQSKNLNLSDD  79

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I+PRV+P Y  AV KYGK  ++W GP P ++I +PE ++E+     +F++P  +PL + L
Sbjct  80    IVPRVIPQYLGAVKKYGKKTYLWLGPKPAMVIMDPEQVKEITQKVYVFQKPHGNPLRRML  139

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               G+  YE  +W +HRK+++PAF+ +K+K M P+   S  E++  KWE + S K   + D
Sbjct  140   TPGIVMYEGDKWTQHRKLLNPAFHIEKLKLMLPAFHKSASEVV-NKWEKVVSPKGSAEVD  198

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS--PEWWLLSSKR  957
             V P L+A TSD ISRTAFG +Y EG ++F LQ EQAE   +   SVY   P +  L +KR
Sbjct  199   VWPNLQALTSDAISRTAFGSNYEEGRRIFELQREQAEHIVEAGGSVYIYIPGFRFLPTKR  258

Query  956   SRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFST  804
              RRM +I  E+   ++ +I  R++ M+      D     +L    +          G +T
Sbjct  259   HRRMKQITKEVNDSIREMIDTRKKAMRAGEARTDNLLGLMLQSNSQEIEKHGNKDYGMTT  318

Query  803   DEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRL  624
             +E+I+EC+ FY AGQE+TS  LVW MI LS +  WQ RAR+EV Q FG N P+FDGLN+L
Sbjct  319   EEIIDECKLFYLAGQETTSALLVWTMIYLSRYPDWQARAREEVLQHFGANDPEFDGLNQL  378

Query  623   KILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAG  444
             KI+ MIL+EVLRL PP   T R + EETKLG + +P  ++L+L  +L+  DPD+WG D  
Sbjct  379   KIVNMILHEVLRLCPPITATARRIAEETKLGNLTIPVGVLLVLPIMLMHHDPDIWGEDVK  438

Query  443   EFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSY  264
             EFKPERFAEGV+ ATK RLAF PFGWGPR CIG NFAM+EAK+A++ ILQRFSF LSPSY
Sbjct  439   EFKPERFAEGVSHATKGRLAFWPFGWGPRICIGQNFAMLEAKLAMSMILQRFSFELSPSY  498

Query  263   AHSPCFVVTLKPQFGAPLVLHKI  195
             AHSP   VTL+PQ+GA L+L K+
Sbjct  499   AHSPRVAVTLRPQYGAHLILRKV  521



>ref|XP_007227257.1| hypothetical protein PRUPE_ppa017915mg [Prunus persica]
 gb|EMJ28456.1| hypothetical protein PRUPE_ppa017915mg [Prunus persica]
Length=515

 Score =   495 bits (1274),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 252/519 (49%), Positives = 348/519 (67%), Gaps = 17/519 (3%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             + S V++L + + V  V+ WA RV+ WVWL+P+KLE+ L++QG  GNSYR+ +GDTK+ +
Sbjct  1     MASCVAVL-IVVWVSIVIAWAWRVLNWVWLRPKKLERCLKEQGFTGNSYRLLFGDTKDSS  59

Query  1538  TLTAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVF  1365
              +  +A+SKP+ LS   DI PRV+PF H  V  YG+N FVW GP P+V I  PE ++E+F
Sbjct  60    MMLRQAQSKPMKLSTSHDIAPRVMPFVHQTVNTYGRNSFVWVGPIPKVNILNPEDLKEIF  119

Query  1364  MNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEM  1185
               +   +R   +P++  LV GL    D++WA+HRKII+PAF+ +K+K M P+   SC EM
Sbjct  120   NKHENIQRTVANPIIDLLVQGLGSTVDEKWAKHRKIINPAFHLEKLKGMLPTFYHSCSEM  179

Query  1184  IMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQV  1005
             I  +WE L S++  C+ DV P L   ++DVISR AFG SY EG K+F L  +Q +     
Sbjct  180   I-NEWERLVSKEGSCELDVWPCLLNMSADVISRAAFGSSYQEGRKIFQLLQQQTKNYAAA  238

Query  1004  IHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl  825
             I SV+ P    L +K  +RM EI+ EIR L++G+I KRE  +K     + +    LL   
Sbjct  239   IQSVHIP---FLPTKHHKRMKEINKEIRVLLRGIINKREEAIKMGEASNHDLLGILLESN  295

Query  824   LK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
             LK          +G S ++VIEEC+ FYFAGQE+TS  LVW ++LLS +Q WQ RAR+EV
Sbjct  296   LKEIREHGNKRNTGMSVEDVIEECKLFYFAGQETTSTLLVWAIVLLSQNQNWQTRAREEV  355

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
              Q FG N P FD L++LK++TM+L EVLRLYPP     RT+  +T+LG   LP  + + L
Sbjct  356   LQAFGSNPPTFDALSQLKVVTMVLLEVLRLYPPGIELPRTLRRKTQLGRFSLPAGVDVSL  415

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
               LLV  + ++WG DA EFKPERF++GV+KATKN+ A+ PFG GPR CIG NFAM+EAK+
Sbjct  416   HILLVHHNEELWGEDAHEFKPERFSDGVSKATKNQFAYFPFGAGPRICIGQNFAMLEAKL  475

Query  314   AIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             A++ ILQ F+F LSPSYAH+P  +  L+PQ+GA ++L K
Sbjct  476   ALSLILQHFTFELSPSYAHAPALLTILQPQYGAHIILSK  514



>ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=530

 Score =   495 bits (1275),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 248/524 (47%), Positives = 346/524 (66%), Gaps = 13/524 (2%)
 Frame = -2

Query  1730  TMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDT  1551
              +D I +W+ ++ + +   ++++   ++V W+W +P+KLEK LRQQG  GNSYR+ +GD 
Sbjct  4     VLDMISTWLIVVIVVLLSSSLLLLGWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDL  63

Query  1550  KEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             KE A +  +A SKP+N S+ I PRV+P  H  +  YGKN F+W GP PRV I +PE ++ 
Sbjct  64    KERAAMRDQAISKPMNFSNYIAPRVIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKT  123

Query  1370  VFMNNTLFKRPKP--HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSS  1197
             VF     +++P    +PL K L  GL  +E Q+W +HRKII+PAF+ +K+K M P+   S
Sbjct  124   VFSLINDYQKPTASLNPLAKLLADGLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHS  183

Query  1196  CEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAEL  1017
             C+EMI  KWE + S + +C+ DV PYL+  T+DVISRTAFG SY +G + F LQ E  E+
Sbjct  184   CDEMI-SKWESMVSVEGFCELDVMPYLQNMTADVISRTAFGSSYEKGKRXFKLQTELGEM  242

Query  1016  TRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldl  837
               Q    +Y P W  L +K + +M  I  EI  L+  +I +RE  MK       +    L
Sbjct  243   VMQSTLGIYIPGWRFLPTKSNNKMKVISKEISTLIMDIINERETSMKSGEAIQTDLLSIL  302

Query  836   lgvlLKS----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRA  687
             +   L            G S ++VI+EC+ FY AGQE+T+  L W M+LLS +  WQ+RA
Sbjct  303   MESNLNEIKQHGNNKDIGMSIEDVIDECKLFYIAGQETTATLLTWTMVLLSSYSEWQERA  362

Query  686   RQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNi  507
             R EV ++FG+ KPD+DGL+RLK++TMILNEVLRLYPP     R + +ETKLG++ LP  +
Sbjct  363   RAEVFEIFGNKKPDYDGLSRLKVVTMILNEVLRLYPPVSMFGRLVKKETKLGKLTLPAGV  422

Query  506   ililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMM  327
             +L L  +L+Q DP++WG DA EFKPERF+EGV+KA KN  AF+PFGWGPR CIG NFAM+
Sbjct  423   MLGLPVVLMQCDPELWGEDAHEFKPERFSEGVSKAAKNPGAFVPFGWGPRICIGLNFAMI  482

Query  326   EAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             EAK+ ++ ILQRFS  LS SY H+P   +T +PQ GA ++LHK+
Sbjct  483   EAKMTLSMILQRFSLELSSSYTHAPIAAITTQPQHGAHIILHKL  526



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 340/507 (67%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             I V  ++++  RV+ W W KP+KLEK+LR+ GL GN Y++FYGD  E+     +A+SKPI
Sbjct  12    ICVAILLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNELTNKLNEARSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR-PKPH  1329
             N SDDI  R++PF+  ++ K GK+ FVW GP P V+I++PE ++E+F  N  +++   P+
Sbjct  72    NFSDDIAQRLIPFFLDSIYKNGKSSFVWLGPYPAVLITDPEHVKEIFTKNYGYQKIAHPN  131

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  K    GLA  E+ +WA+HRKII+PAF+ + +K M P+   SC EMI  KWE +  ++
Sbjct  132   PFAKSFAKGLAFLEEDKWAKHRKIINPAFHFENLKHMLPAFYQSCSEMI-SKWEDIVPKE  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L+  T +VISRTAFG SY EG KVF LQ EQAE    + HSVY P    L
Sbjct  191   TSVELDVWPDLQLMTGEVISRTAFGSSYEEGRKVFELQKEQAEYVMDMTHSVYIPGSRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR++RM EI+ +I+  ++ +I KR R M+      ++    LL   +K          
Sbjct  251   PTKRNKRMKEIEKQIQTTIRRIINKRLRAMEAGETSKNDLLGILLESNMKEIEQHGNKDF  310

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +T E+IEEC+ FYFAGQE  S  L+W MILL +H  WQ RAR+EV QVFG+ K + +G
Sbjct  311   GMTTIELIEECKLFYFAGQEGNSVLLIWTMILLCLHPEWQVRAREEVLQVFGNEKTNLEG  370

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             L+RL I+TMILNE LRL+PP     R + EE KLG++ LP  + L + ++L+  D ++WG
Sbjct  371   LSRLNIVTMILNETLRLFPPVATFRRRIKEEVKLGDLSLPAGVQLFIPTVLIHYDKELWG  430

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+KATK   +F PFG GPR CIG NFAMMEAK+AIA ILQ FSF L
Sbjct  431   EDAKEFKPERFSEGVSKATKGEASFFPFGRGPRICIGQNFAMMEAKMAIAMILQNFSFEL  490

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P  +V+ +PQ+GAPL++ K+
Sbjct  491   SPSYTHAPLAIVSTQPQYGAPLLMRKL  517



>ref|XP_010465357.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 246/510 (48%), Positives = 345/510 (68%), Gaps = 6/510 (1%)
 Frame = -2

Query  1706  VSILFLFISVPAVVI--WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             +S+  + ISV  VV+  W  R +QWVW KP+ LE +LR+QGL G  Y    GD K  A +
Sbjct  3     ISVASVTISVAIVVVSLWVWRTLQWVWFKPKMLESYLRRQGLAGTRYTPLVGDLKRNANM  62

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
              A+A+SKPI L+DD  PR++PF    +  +G+  F W GP P + I +PEL++EVF    
Sbjct  63    LAEARSKPIKLTDDTRPRIVPFPLHMLKTHGRTFFTWLGPIPTITIMDPELIKEVFNKVY  122

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++    PL + +V GL  Y+  +W +HR+II+PAF+ +KIK M P+   SC E + + 
Sbjct  123   DFQKAHTFPLGRLIVPGLVSYDGDKWTKHRRIINPAFHLEKIKNMVPAFHQSCSETVGEW  182

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
              +L++++ + C+ DV P+L + T+DVISRTAFG SY EG ++F LQ E ++L  Q +   
Sbjct  183   DKLVSNKGSSCEVDVWPWLLSMTADVISRTAFGSSYKEGQRIFELQAELSQLIIQAVQKA  242

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKE----Kvgdddeenldllgvl  825
             + P +  L +K +RRM+    E++ +++G+I KR RG +                 LG  
Sbjct  243   FIPGYSYLPTKGNRRMNATAREMKVILRGIIDKRLRGREGGEVPSDDLLGILLESNLGQT  302

Query  824   LKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPD  645
               +G ST+E++EEC+ FYFAGQE+TS  LVW M+LLS HQ WQ RAR+EV+QVFG  +PD
Sbjct  303   KGNGMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPD  362

Query  644   FDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPD  465
              +GLN+LK++T IL EVLRLYPP     RT+ +E KLG+M LP  + + L  LL+QRD +
Sbjct  363   AEGLNQLKVMTTILYEVLRLYPPPCQLTRTINKEMKLGDMTLPSGVQISLPVLLIQRDTE  422

Query  464   VWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFS  285
             +WG DAGEFKPERF +G++KATK +++FL F WGPR CIG N+AM+EAK+A+A ILQ+FS
Sbjct  423   LWGHDAGEFKPERFKDGLSKATKGQVSFLAFAWGPRFCIGQNYAMLEAKMAMALILQKFS  482

Query  284   FHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             F LSPSY H+P  V+T  PQFGAPL+LHK+
Sbjct  483   FELSPSYVHAPDTVLTTHPQFGAPLILHKL  512



>gb|AJD25169.1| cytochrome P450 CYP72A328 [Salvia miltiorrhiza]
Length=517

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 240/507 (47%), Positives = 332/507 (65%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             +S      + C+++ WVW +PR LEK LR+QG  GNSYRV YGD K+M  ++ +A SKP+
Sbjct  10    LSAIVAFTYVCKILNWVWFRPRNLEKRLRRQGFTGNSYRVLYGDLKDMRLMSKEASSKPL  69

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHP  1326
             + S D + R++P +H A+ KYG+NCFVW GP+P +++  PE ++EV   + +F++P   P
Sbjct  70    DFSHDFVHRIMPIFHFALKKYGENCFVWFGPSPAILVMNPESVREVVSKSNVFQKPPGRP  129

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN  1146
              ++ +  GL   E  +WA+HR++I+PAF+  K++ M PS   SC+EM + KW+ +   + 
Sbjct  130   FIRLMSKGLVTLETDKWAKHRRLINPAFHVHKLEHMVPSFYLSCDEM-LSKWDKIVGNEG  188

Query  1145  WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLS  966
              C+ DV PYL+  TSDVISRTAFG SY+EG K+F LQ E A+   +   SVY P +  L 
Sbjct  189   CCEVDVWPYLQTLTSDVISRTAFGSSYLEGRKIFELQRELAQHVMEGNRSVYIPGYRFLP  248

Query  965   SKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdd--------deenldllgvlLKSGF  810
             +K +RR+ EI  E+R  M G+I  R + M+              +  + ++     K G 
Sbjct  249   TKVNRRVKEITKEVRSSMLGIINTRSKAMEAGEASKEDLLGILLESNSKEIEQHGSKHGM  308

Query  809   STDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLN  630
             S DEVIEEC+ FYFAG E+T+  LVW MILLS H+ WQ RAR EV QVF   + D+  LN
Sbjct  309   SMDEVIEECKLFYFAGXETTASLLVWTMILLSKHEDWQSRARDEVLQVFKRGESDYQELN  368

Query  629   RLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGAD  450
              LKIL MIL+EVLRLYPP    +R    E +LG + LP  + L+L  +L+  DP +WG D
Sbjct  369   NLKILGMILHEVLRLYPPGLVLLRFTPNECRLGNVNLPAGVQLMLPLILLHHDPKIWGDD  428

Query  449   AGEFKPERFAEGVAKATK--NRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
             A EF+PERF +GV KA +   +LA+ PFGWGPR CI  NFAM+EAK+A+A ILQR+SF L
Sbjct  429   AEEFRPERFRDGVPKAAQGAGQLAYFPFGWGPRXCIAQNFAMLEAKMAMAMILQRYSFQL  488

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P  V+TL+PQ GA L+L K+
Sbjct  489   SPSYTHAPYKVITLQPQHGAHLILTKL  515



>ref|XP_008798317.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Phoenix dactylifera]
Length=527

 Score =   495 bits (1274),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/502 (49%), Positives = 341/502 (68%), Gaps = 12/502 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             V+ A R ++WVW +P++LE+ LR QGL G+ YR  +GD KE A L  +A+SKP+  S DI
Sbjct  27    VLRAWRGLEWVWWRPKRLERALRGQGLRGSRYRFLHGDLKETARLNKEARSKPMPFSHDI  86

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLFKRPKPHPLVKFL  1311
             +PRV P +H A+ + GK    W GP PRV I  PEL++EV  N    F +PK +PL + L
Sbjct  87    IPRVSPIFHRAIKENGKISITWLGPVPRVTIMNPELVREVLSNKFGHFTKPKLNPLGQLL  146

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GLA YE +QWA+HR+I++PAF+ +K+K M P+ ++ C E++  +WE       + + D
Sbjct  147   ARGLADYEGEQWAKHRRILNPAFHLEKLKRMLPAFSACCGELV-SRWEKSIGSLGYYELD  205

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P L+ FT DVISRTAFG SY EG ++F LQ EQAEL  + + +VY P +  L +  + 
Sbjct  206   VWPELQTFTGDVISRTAFGSSYAEGRRIFQLQAEQAELVIKAVQTVYIPGYRFLPTPINN  265

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK----------SGFSTD  801
             R  EI  E+R L++G+I KRE+ +K     +D+    ++   LK          +G +T+
Sbjct  266   RRKEIYREVRALLRGIIEKREKAIKLGEASNDDLLGVMIEYNLKHFQEHGNSKNTGMTTE  325

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             EVIEEC+ FYFAGQE+TS  L W MI+LS+H +WQ RAR+EV ++FG N+PD+DGLNRLK
Sbjct  326   EVIEECKLFYFAGQETTSVLLTWTMIVLSMHPSWQVRAREEVLELFGKNRPDYDGLNRLK  385

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             I+TMIL EVLRLYPP     R  Y+  KLG++  P  ++L L  + +  DP++WG DA E
Sbjct  386   IVTMILYEVLRLYPPVILLNRITYKTMKLGDITYPAGVLLTLPVIFIHHDPEIWGKDASE  445

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERFAEG++KA+K +LAF PFGWGPRTCIG +FA++EAK+ ++ ILQ +SF LSPSY 
Sbjct  446   FNPERFAEGISKASKGQLAFFPFGWGPRTCIGQSFALLEAKMGLSMILQHYSFELSPSYV  505

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P   +TL+PQ GA + L ++
Sbjct  506   HAPYAAITLQPQHGAQIRLRRV  527



>ref|XP_010275244.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=518

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 249/508 (49%), Positives = 341/508 (67%), Gaps = 12/508 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             IS   ++ W   V+ W+W +P+KLE+ L+QQG+ G+ YR+ +G+ +E   L  +A +KPI
Sbjct  12    ISSVLILSWVAIVLYWIWWRPKKLEQRLKQQGIKGHPYRLLFGNLREEMRLEKEAMAKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEV-FMNNTLFKRPKPH  1329
             +LS +I+PRV+PF H  +  YG+    W G  PRV I++PEL++E+ F     F+RPKP+
Sbjct  72    SLSHNIVPRVIPFVHQTIQNYGRMSISWFGRTPRVYITDPELIKEILFTKFGHFERPKPN  131

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             PL K  + GL  YE ++WA+HR++I+ AF+ +K+K M P+  +SC +++  +W+ L + K
Sbjct  132   PLTKSFLRGLLSYEGEKWAKHRRLINGAFHLEKLKRMLPAFYASCSDLV-TRWDSLIASK  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
               C+ DVQP L+  T D+ISR AFG SY EG +VF L NEQ  L  Q       P +  L
Sbjct  191   GSCELDVQPELQCLTGDIISRAAFGSSYEEGRRVFQLLNEQLNLVIQSAMYYCIPGFRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR+ RM E   E+R +++G++ KRE+ +K      D+    LL   LK          
Sbjct  251   PTKRNNRMKETRRELRTILEGIVSKREKVIKMGETTTDDLLGLLLESNLKEIQEHGNLKN  310

Query  815   -GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFD  639
              G S DEVIEEC+ FYFAGQE+TS FL W M++LS+H  WQ RAR+EV QVFG NKPDFD
Sbjct  311   VGMSIDEVIEECKLFYFAGQETTSVFLTWTMVVLSMHSEWQSRAREEVIQVFGKNKPDFD  370

Query  638   GLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVW  459
             GLN+LKI+TMIL EVLRLYPP+    R  Y+E +LG + LP  + L L  +L+    ++W
Sbjct  371   GLNQLKIVTMILYEVLRLYPPATIFGRHTYKEVRLGNICLPMGVHLSLPIILLHHSHELW  430

Query  458   GADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFH  279
             G DA EFKPERF+EGV+KATKN+L+F PF WGPR CIG NFAM+EAK+A+  ILQ FSFH
Sbjct  431   GEDAQEFKPERFSEGVSKATKNQLSFFPFSWGPRICIGQNFAMIEAKMALTLILQHFSFH  490

Query  278   LSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LSPSY H+P  V +L PQ GA ++L K+
Sbjct  491   LSPSYTHAPHTVASLHPQHGAQIILRKL  518



>ref|XP_010927457.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/514 (47%), Positives = 348/514 (68%), Gaps = 20/514 (4%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V +LFL        + A   + WVW +PR+LE+ LR QGL G  YR  +GD K+   L  
Sbjct  17    VGVLFL--------VRALSALHWVWWRPRRLERALRAQGLEGTRYRFPHGDVKDYDRLDQ  68

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TL  1350
             +A+SKP++ S  I+PRVLP+ H  + K GK  F W GP PRVI+ +P L +E+  N    
Sbjct  69    EARSKPMSFSHQIIPRVLPYLHQTIKKNGKTSFTWFGPEPRVIMMDPGLTREILSNKFGH  128

Query  1349  FKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKW  1170
             F++P  +PL + LV+GLA YE ++WA+HR+II+PAF+ +K+KCM P+ ++ C+E+I  KW
Sbjct  129   FEKPNLNPLGRLLVTGLAIYEGEKWAKHRRIINPAFHLEKLKCMMPAFSACCDELI-NKW  187

Query  1169  ELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVY  990
             + L +    C+ DV P  ++FT+DVISRTAFG ++ EG ++F LQ EQA L  + + ++Y
Sbjct  188   DGLVASNGSCELDVWPEFQSFTADVISRTAFGSNFREGQRIFHLQQEQAGLAIRALQNIY  247

Query  989   SPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---  819
              P +  L +K+++RM EID EIR L+  +I +RE  ++++   +D+    L+    +   
Sbjct  248   IPGFRFLPTKKNKRMKEIDIEIRTLLMRMIERREMAIRKEGTSNDDLLSLLMESNFRHSK  307

Query  818   -------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFG  660
                    SG S +EVI+EC+ FYFAG E+TS  L W ++ LS+H +WQ RAR+EV  VFG
Sbjct  308   ENGGSKNSGMSIEEVIQECKLFYFAGHETTSVLLTWTLVALSMHPSWQARAREEVNGVFG  367

Query  659   HNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLV  480
              NKPD+DGL+RLKI+TM+L EVLRLYPP+   +R  Y+E KLG++  P  + L+L  + +
Sbjct  368   KNKPDYDGLSRLKIVTMVLYEVLRLYPPAVLLMRKTYKEMKLGQITFPEGVQLLLPIIFI  427

Query  479   QRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATI  300
               DP+ WG DA EF PERFA+GV+KA+K + AF PFG GPR CIG +FA++EAK+A+A I
Sbjct  428   HHDPEFWGEDASEFNPERFADGVSKASKIQGAFFPFGGGPRICIGQSFAVIEAKMALARI  487

Query  299   LQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             LQ F+F +SPSYAH+P  V TL PQ GA ++LHK
Sbjct  488   LQHFTFEISPSYAHAPYTVATLHPQHGAQIILHK  521



>ref|XP_011009101.1| PREDICTED: cytochrome P450 CYP72A219-like [Populus euphratica]
Length=547

 Score =   495 bits (1275),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 251/532 (47%), Positives = 353/532 (66%), Gaps = 17/532 (3%)
 Frame = -2

Query  1742  LSNPTMD-----RIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGN  1578
             LS P +D     ++   V+ + + I   AV+ WA RV+ WVW +P+K+E+ LRQQG  G 
Sbjct  17    LSYPFLDLFLSVKMTVIVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGK  76

Query  1577  SYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVI  1398
              YR+  GD KE + +  +A++KP+ LS+ +LPRV+PF H  V  YGKN F+W GP PRV 
Sbjct  77    PYRLLLGDWKESSDMLKEARTKPLGLSEALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVN  136

Query  1397  ISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCM  1218
             I  P+ +++VFM    +++   HPL+K L  GLA +E ++WA+HRKII+PAF+ +K+K M
Sbjct  137   IMNPDQIRDVFMKINEYQKAS-HPLLKALACGLASHEGEKWAKHRKIINPAFHQEKLKLM  195

Query  1217  APSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSL  1038
              P+   SC  MI K  +L+++++  C+ DV P L   T D ISRT+FG +Y EG ++F L
Sbjct  196   IPAFYESCSGMINKWEKLVSADEGSCELDVWPDLRGLTCDAISRTSFGSNYEEGKRIFDL  255

Query  1037  QNEQAELTRQVI-HSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgd  861
               E  +LT  VI  ++  P +  L    +RR+  ID EI+  +  LI KRE+ M      
Sbjct  256   LKEFTDLTVHVIMKAIVIPGYRFLPIPSNRRLKAIDKEIKASLNALISKREKAMSAGEDA  315

Query  860   ddeenldllgvlLKS----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSI  711
              ++    LL    +           G S ++VI+EC+ FYFAGQE+TS  L W M+LL+ 
Sbjct  316   KNDLLDLLLESNFREIQEHGNTKSVGMSIEDVIDECKIFYFAGQETTSVLLTWTMVLLAQ  375

Query  710   HQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLG  531
             +  WQ R R+EV QVFG+ KPDFDGLN LK++TMIL EVLRLYPP     R ++EE KLG
Sbjct  376   YPNWQARGREEVVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLG  435

Query  530   EMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTC  351
              + LP  + + + ++L+ +D ++WG DA EFKPERFAEGV+KATK++++FLPFGWGPR C
Sbjct  436   NLLLPAGVQISVPTILLHQDRELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWGPRIC  495

Query  350   IGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +G NFAM+EAK+A+A ILQR SF LSPSY H+P  V+TL+PQ GAP++L K+
Sbjct  496   VGQNFAMIEAKMALAMILQRCSFELSPSYVHAPHTVITLQPQHGAPMILRKL  547



>emb|CDY32348.1| BnaC01g36670D [Brassica napus]
Length=512

 Score =   494 bits (1271),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 244/501 (49%), Positives = 334/501 (67%), Gaps = 4/501 (1%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             +++ AV+ W  R + WVW KP+ LE +LR+QGL G  Y +  GD K   ++T +A+SKPI
Sbjct  12    VAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEARSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHP  1326
              L+DDI+PRVLPF    +  YG+  F W GP P + I+ PE ++EV      F++P   P
Sbjct  72    KLTDDIVPRVLPFPSHMLKTYGRTFFTWRGPIPTITITNPEQIKEVLNKIYDFQKPNTFP  131

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN  1146
             L + + SGL  Y+  +WA+HR+II+PAF+ DKIK M P+   SC E+++K   ++  + +
Sbjct  132   LSRLVASGLFSYDGDKWAKHRRIINPAFHLDKIKNMVPAFHQSCSEVVVKWDNIVMDKGS  191

Query  1145  WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLS  966
              C+ DV P+L   T+DVISRTAFG SY EG+++F LQ E +EL  Q     + P +  L 
Sbjct  192   SCEVDVWPWLMNMTADVISRTAFGSSYKEGHRIFELQAELSELIIQSFRKAFIPGYSYLP  251

Query  965   SKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFSTDE  798
             +K +RRM     E + +++G++ KR    E G               LG    +G S ++
Sbjct  252   TKGNRRMKAAARESQAILRGIVDKRLRAREAGEAPSQDLLGTLLESNLGQGKGNGMSIED  311

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  LVW MILLS HQ WQ RAR+EV+QVFG  +P+ +GLN+LK+
Sbjct  312   VIEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPNAEGLNQLKV  371

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R +++E KLG + LP  + + L  +LVQRD   WG DA EF
Sbjct  372   MTMILQEVLRLYPPVINMARAIHKEMKLGGVTLPGGVNITLPIMLVQRDIQQWGNDAAEF  431

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
             KPERF +G++KA K++++F+PF WGPR CIG NFAM+EAK+A+A ILQRFSF LSPSY H
Sbjct  432   KPERFKDGISKAAKSQVSFIPFSWGPRICIGQNFAMLEAKMAMALILQRFSFDLSPSYVH  491

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  V TL PQFGA L++HKI
Sbjct  492   APYTVFTLHPQFGAHLIMHKI  512



>ref|XP_008452437.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=522

 Score =   494 bits (1272),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 246/516 (48%), Positives = 339/516 (66%), Gaps = 20/516 (4%)
 Frame = -2

Query  1685  ISVPAVVIWAC---------RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             ISVP V+I +          ++V W+W +P++LE+ LR+QG  GNSYR+ +GD KE A +
Sbjct  8     ISVPTVMIISIVLLLLLLGWKLVDWIWFRPKRLERVLRRQGFAGNSYRILHGDLKESAAM  67

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +A SKP+  S+ I PRV+P  +  +  YGKN F+W G  PRV I +PE ++ VF    
Sbjct  68    REEAMSKPMKFSNHIAPRVIPSVYHTIQLYGKNSFMWIGTMPRVHIMDPEQLKTVFSLIN  127

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F+RP   PL+K   +GL  YE Q+W +HRKIISPAF+  K+K M P    S  EM+  K
Sbjct  128   DFQRPTMSPLLKLFANGLFSYEGQKWVKHRKIISPAFHLKKLKDMIPEFYHSSNEMV-GK  186

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE + S +  C+ DV PYL+   SDVISRTAFG SY +G K+F LQ+E   L  Q    +
Sbjct  187   WESMISREGSCELDVMPYLQNMASDVISRTAFGSSYEKGKKIFELQSELGALVIQSSLGI  246

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P W  L +K +R+M E+  +I  L+ G++ ++E+ MK       +    L+   L   
Sbjct  247   YIPGWRFLPTKSNRKMKELSKKISTLILGVMNEKEKSMKAGEAIQTDLLSILIESNLDEI  306

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S  ++I+EC+ FY  GQE+T+  L+W M+LLS +  WQ+RAR EV ++F
Sbjct  307   KDHRNNKGMGLSIQDIIDECKLFYITGQETTATLLIWTMVLLSSYSKWQERARAEVFEIF  366

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD+DGL+RLK++TMI NEVLRLYPP     RT+ +ETKLG++ LP  ++L L  +L
Sbjct  367   GNKKPDYDGLSRLKVVTMIFNEVLRLYPPVSMYARTVNKETKLGKLTLPAGVMLSLPIIL  426

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +Q DP++WG DA EF P+RF+EGV+KATKN  AF+PFGWGPR CIG NFAM+EAK+A++ 
Sbjct  427   IQTDPELWGQDAYEFNPDRFSEGVSKATKNPFAFVPFGWGPRICIGLNFAMIEAKMALSM  486

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQRFSF LSPSY H+P   +T +PQ GA ++LHK+
Sbjct  487   ILQRFSFELSPSYTHTPHTGLTTQPQHGAHIILHKL  522



>gb|KHG18227.1| Secologanin synthase [Gossypium arboreum]
Length=518

 Score =   494 bits (1271),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 243/497 (49%), Positives = 330/497 (66%), Gaps = 7/497 (1%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             +IW  R + WVWL P++LE+ L+Q+G  GN YR   GD KE  T++ + ++KP+ +SDDI
Sbjct  20    MIWGWRALNWVWLTPKRLERCLKQEGFAGNPYRFLSGDIKESFTMSRQTRAKPMPVSDDI  79

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLV  1308
                VLPF H  +  +G N F+W GP PRV I +PE ++E+F   T F++   +PL +FLV
Sbjct  80    EAYVLPFLHQTIKNHGNNSFMWIGPRPRVTIMDPEKIREIFTKFTDFQKLHSNPLARFLV  139

Query  1307  SGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDV  1128
              GL+  E  QW++HRKI++PAF+ DK+K M P+   SC EMI  KWE + S++ + + DV
Sbjct  140   GGLSNLEGDQWSKHRKIVNPAFHQDKLKNMLPAFYQSCNEMI-SKWEEMVSKEGYSELDV  198

Query  1127  QPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRR  948
              PY+   T DVISR AFG SY EG ++F L  +   LT +V  SVY P W  L +K +R 
Sbjct  199   WPYIVNMTRDVISRAAFGSSYEEGRRIFQLLEDLTSLTIKVFQSVYIPGWRFLPTKTNRE  258

Query  947   MHEIDNEIRGLMKGLIGKRERGMK------EKvgdddeenldllgvlLKSGFSTDEVIEE  786
             +     +I+  ++ +I +RE+ +K      E + D   E+          G S ++VIEE
Sbjct  259   LKMKHKDIKESLREMIKRREKAIKAGEESNEDLLDILVESNIREMEAKHMGMSIEDVIEE  318

Query  785   CQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMI  606
             C+ FYFAGQE+TS  LVW M+LL+ +  WQ +AR EV  V G  KPD DGLNRLK++TMI
Sbjct  319   CKLFYFAGQETTSVLLVWTMVLLARYPDWQTKARDEVLHVLGDRKPDADGLNRLKVVTMI  378

Query  605   LNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPER  426
             L EVLRLYPP     R++ +E K+G + LP    +++  L +  D D WG DA EF+PER
Sbjct  379   LYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDKDHWGDDAHEFRPER  438

Query  425   FAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCF  246
             FAEGV+KATK+++ FLPFGWGPR CIG NFAMME K+A+A ILQRF F LSPSYAHSPC 
Sbjct  439   FAEGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRFWFELSPSYAHSPCT  498

Query  245   VVTLKPQFGAPLVLHKI  195
              +TL+PQ GA ++LHK+
Sbjct  499   TMTLRPQHGAQIILHKL  515



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   494 bits (1271),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 247/508 (49%), Positives = 336/508 (66%), Gaps = 13/508 (3%)
 Frame = -2

Query  1682  SVPAVVIWAC--RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKP  1509
             SV A+ +  C   V+ W+W +P+KLEK L++QG+ GNSY + YGDTKE++    +  SK 
Sbjct  13    SVIAITLLLCIWSVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSMRIKEVTSKS  72

Query  1508  INL-SDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKP  1332
             +++  DDI PR LPF+   + KYGK  F+W GP P V I +P+L++EVF    ++++ K 
Sbjct  73    MSVYDDDIAPRSLPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKT  132

Query  1331  HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSE  1152
             +PL K L  GL   E  +WA+HRKII+PAF+ +K+K M P+   SC EM + KWE + S 
Sbjct  133   NPLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFYLSCTEM-LSKWEDVVSV  191

Query  1151  KNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWL  972
             +   + DV P+L+  TSDVISRTAFG SY EG ++F LQ EQA+   + + SVY P W  
Sbjct  192   ERSHEIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSF  251

Query  971   LSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--------  816
             L +KR+RRM EI+  ++  ++G+I KR + M     ++ +    LL    K         
Sbjct  252   LPTKRNRRMKEIEKHVQATIRGIIDKRVKAMTGGEANNKDLLGILLESNFKEIKQHGDKD  311

Query  815   -GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFD  639
              G S +EVIEEC+ FYFAGQE+TS  LVW +ILL  H  WQ RAR EV QVFG  KPDFD
Sbjct  312   FGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRARTEVLQVFGSRKPDFD  371

Query  638   GLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVW  459
             GL  LK++TMIL E LRLYPP     R + E+  LG++ LP +++L L ++L+  D ++W
Sbjct  372   GLTHLKVVTMILYESLRLYPPVTTVTRRLNEDAVLGDISLPADVLLSLPAVLLHHDEEIW  431

Query  458   GADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFH  279
             G DA +F PERF EGV+ ATK ++ F PF WGPR CIG NFAM+EAK+ +A ILQRFS  
Sbjct  432   GEDAKKFNPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSLD  491

Query  278   LSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LS SY H+   V+T +PQ+GAPL+LHK+
Sbjct  492   LSTSYTHALHSVITTQPQYGAPLILHKL  519



>ref|XP_010926808.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Elaeis guineensis]
Length=519

 Score =   494 bits (1271),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 246/523 (47%), Positives = 348/523 (67%), Gaps = 19/523 (4%)
 Frame = -2

Query  1730  TMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDT  1551
             +++ + + V +LFL       ++WA R ++WVW +PR+LE  LR QGL+G  YR  YGD 
Sbjct  5     SLEMVGAVVGVLFL-------LVWAVRALEWVWWRPRRLEGLLRAQGLSGTRYRFLYGDL  57

Query  1550  KEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             K+   L   A+SKP+ LS  I PRVLPF+H A+  +GK  F W GP P VI+ +PEL++E
Sbjct  58    KDNVRLQKAARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPTVILKDPELVRE  117

Query  1370  VFMNN-TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSC  1194
             V  N    F++P  +PL K L  G+A YE ++WA+HR+II+PAF+ +K+K M P+  + C
Sbjct  118   VLSNKFGHFEKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFHLEKLKHMFPTFATCC  177

Query  1193  EEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELT  1014
             +E+I  +W+     + +C+ DV P  + FT DVISR AFG S+ EG ++F LQ EQ EL 
Sbjct  178   DELI-NRWDNHVGSQAYCELDVWPEFQNFTGDVISRVAFGSSFKEGQRIFQLQEEQMELL  236

Query  1013  RQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldll  834
              Q   ++Y P +  L +K++ RM+EI  EIR L+  +I +RER M++    +D+    L+
Sbjct  237   VQAAQNIYIPGYRFLPTKKNNRMYEIYREIRALLSRMIEQRERAMRKSGATNDDLLGLLI  296

Query  833   gvlLK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRAR  684
                L+          +G + D+VIEEC+ FYFAG ++T   L W +++L +H +WQ RAR
Sbjct  297   ESNLRYSQEQGGSKNTGMTKDDVIEECKLFYFAGHKTTLVLLTWTVVILGMHPSWQARAR  356

Query  683   QEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNii  504
             +EV QV+G NKPD+DGL++L+I+TMIL EVLRLYPP+ + +R  Y+E KLG+   PP + 
Sbjct  357   KEVLQVYGKNKPDYDGLSQLRIVTMILYEVLRLYPPAIFLLRRTYKEMKLGDFTFPPGVQ  416

Query  503   lilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMME  324
             L+L  L +  DP  WG DA EF PERFA GV+KA+K +  F PFG GPR CIG NFAMME
Sbjct  417   LLLPLLFIHHDPQFWGDDATEFNPERFASGVSKASKIQGTFFPFGGGPRICIGQNFAMME  476

Query  323   AKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             AK+A+A ILQ FS   S SYAH+P  V+TL PQ+GA ++LH++
Sbjct  477   AKMALARILQHFSLEPSSSYAHAPYTVITLHPQYGAQIMLHRL  519



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   493 bits (1270),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 253/504 (50%), Positives = 343/504 (68%), Gaps = 15/504 (3%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN-LSDD  1491
             +++A +V+ WVW +PR LEKWLRQ G  GNSYRV +GD+KEM+ +  +AKSKPI+  S+D
Sbjct  17    IVYAWKVLNWVWFRPRNLEKWLRQLGFEGNSYRVLFGDSKEMSNMIKEAKSKPISAFSND  76

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I+ RV+P  H AV+ YG+ C +W GP P V++++ EL++E+   + +F++   +PL + L
Sbjct  77    IVARVIPAIHHAVSMYGEKCILWFGPKPAVLVTDTELIREILSKSYVFQK-NSNPLGRQL  135

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               G+A YE  +WA+HR++I+PAF PDKIK M PS   SC +M + KWE   +++   + D
Sbjct  136   ARGVATYETDKWAKHRRLINPAFQPDKIKQMLPSFYLSCCDM-LSKWEEKLAKEGSSEVD  194

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV--YSPEWWLLSSKR  957
             V PYL+  TSD ISRTAFG SY EG K+F LQ EQAEL  Q + S+    P W  L +K 
Sbjct  195   VWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQAELIMQAVQSINFQIPGWRFLPTKM  254

Query  956   SRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenl----------dllgvlLKSGFS  807
             + RM +I  E+   ++G+I KR + M+ + G    ++L          ++     K G S
Sbjct  255   NIRMKQIVKEVESSIRGIIDKRMKEMEAREGSYSSDDLLGILLDSNFREIKQNGNKFGMS  314

Query  806   TDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNR  627
              DEVIEEC+ FYFAGQE+TS  LVW MILLS H  WQ RAR++V Q FG  KPDF  LN 
Sbjct  315   LDEVIEECKLFYFAGQETTSSLLVWTMILLSKHSDWQSRAREDVLQTFGTRKPDFQELNH  374

Query  626   LKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADA  447
             LKI+TMIL+EVLRLYP      RT  +ET LG+  LP  + LIL  LL+  D  +WG DA
Sbjct  375   LKIVTMILHEVLRLYPAGVNLGRTTRKETPLGKSTLPAGVQLILPVLLLHHDSKMWGDDA  434

Query  446   GEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPS  267
              EF P RF+EGV+KAT  +L++ PFGWGPR C+G +FA++EAK+A+A ILQR+SF LSPS
Sbjct  435   KEFDPNRFSEGVSKATNGKLSYFPFGWGPRICLGQSFAILEAKMALAMILQRYSFQLSPS  494

Query  266   YAHSPCFVVTLKPQFGAPLVLHKI  195
             Y+H+P  V+TL+PQ GA L+L K+
Sbjct  495   YSHAPYTVITLQPQHGAHLILTKL  518



>ref|XP_004300362.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   493 bits (1270),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 254/516 (49%), Positives = 343/516 (66%), Gaps = 17/516 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACR--VVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             VS+  + +S+  + + +C   V+ WVWL+P+ LE+ LRQQG  GNSY++FYGD K+   +
Sbjct  3     VSVAGVALSIVVLGLLSCSWSVLNWVWLRPKILERLLRQQGFQGNSYKLFYGDVKDSYAM  62

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
               +AKSKP+    DI PRV+PF H  V  +GKN F W GP P+V I  PE ++E+     
Sbjct  63    LREAKSKPMKHCHDISPRVIPFVHRTVNIHGKNSFTWFGPKPKVNIINPEDVKEILTKYE  122

Query  1352  LFKRPKPHPLVK-FLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMK  1176
              F  PK  P+ K  L +G A  E ++WARH+KII+PAF+ DK+K M P++  SC+EMI  
Sbjct  123   EF--PKLAPIYKKLLAAGFATLEGEEWARHKKIINPAFHLDKLKSMLPAIQQSCDEMI-N  179

Query  1175  KWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHS  996
             +W+    ++  C+ DV P L++ + DVISRT+FG SY EG  +F L  EQA LT   + S
Sbjct  180   EWKSFVYKEGSCELDVWPSLQSLSDDVISRTSFGSSYEEGKIIFQLLKEQAVLTTNALQS  239

Query  995   -VYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
              V  P W  + +K ++RM E++ EI+G +KG+I  RE+ +K      D+    LL   LK
Sbjct  240   GVNIPGWRFIPTKTNKRMREVNKEIKGSLKGIIHNREKAIKAGEPCKDDLLSILLESNLK  299

Query  818   S----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQ  669
                        G ST++VIE C+ FYF GQE+ +  LVW M+LLS +Q WQ  AR+EV Q
Sbjct  300   VIHEHGNNKNFGMSTEDVIENCKLFYFTGQETITVLLVWTMVLLSQYQNWQTLAREEVLQ  359

Query  668   VFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililss  489
             VFG NKPDFDGLNRLKI+TMIL EVLRLYP +    R  Y+ET+LGE  +P  + + +  
Sbjct  360   VFGSNKPDFDGLNRLKIVTMILREVLRLYPSAVTMTRNTYKETQLGEKTIPAGVEITIPI  419

Query  488   lLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAI  309
             LLVQ D ++WG DA EFKPERFAEGV+K TK +L++ PFG GPR CIG NFAM+EAK+ +
Sbjct  420   LLVQHDEELWGDDAKEFKPERFAEGVSKVTKGQLSYFPFGAGPRVCIGQNFAMIEAKLVV  479

Query  308   ATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLH  201
             A ILQ F+F LSPSYAH+P  + +L+PQ+GA L+LH
Sbjct  480   AVILQHFTFELSPSYAHAPHAIPSLQPQYGAHLILH  515



>ref|XP_010502020.1| PREDICTED: cytochrome P450 72A13 isoform X2 [Camelina sativa]
Length=513

 Score =   493 bits (1269),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 242/496 (49%), Positives = 337/496 (68%), Gaps = 7/496 (1%)
 Frame = -2

Query  1664  IWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDIL  1485
             +W  R +QWVW KP+ LE +L++QGL G  Y    GD K  +++ A A+SKPI L+DDI 
Sbjct  19    LWVWRTLQWVWFKPKMLESYLKRQGLAGTPYTPLVGDLKRNSSMLAVARSKPIKLTDDIT  78

Query  1484  PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVS  1305
             PRV+PF    +  +G+  F W GP P + I +PEL++EVF     F++    PL + + +
Sbjct  79    PRVVPFPLHMLKTHGRTFFTWFGPVPVITIMDPELIKEVFNKVYDFQKAHTFPLGRIIAA  138

Query  1304  GLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK--NWCDFD  1131
             GL  Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++  +W+ L  +K  + C+ D
Sbjct  139   GLVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVV-GQWDKLALDKEGSSCEMD  197

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P+L + T+DVISRTAFG SY EG ++F LQ E A+L  Q     + P +  L +K +R
Sbjct  198   VWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELAKLIIQAFRKAFIPGYNYLPTKGNR  257

Query  950   RMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFSTDEVIEEC  783
             RM     E++ ++ G++ KR    E G               LG    +G +T+E++EEC
Sbjct  258   RMKAAAREVKVILGGIVNKRLRAREAGDATSDDLLGILLESNLGQKKGNGMTTEELMEEC  317

Query  782   QHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMIL  603
             + FYFAGQE+T+  LVW M+LLS HQ WQ RAR+EV+QVFG  +PD +GLN+LK++TMIL
Sbjct  318   KLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDTEGLNQLKVMTMIL  377

Query  602   NEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERF  423
              EVLRLYPP     R +++E KLG++ LP  + + L  LLVQRD ++WG DAGEFKPERF
Sbjct  378   YEVLRLYPPVTQLTRAIHKEMKLGDLTLPSGVQISLPILLVQRDTELWGNDAGEFKPERF  437

Query  422   AEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFV  243
              +G++KATKN+++F PF WGPR CIG NFAM+EAK+A+A ILQ+FSF LSPSY H+P  V
Sbjct  438   KDGLSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYVHAPHTV  497

Query  242   VTLKPQFGAPLVLHKI  195
             +T+ PQFGAPL+LHK+
Sbjct  498   ITIHPQFGAPLILHKL  513



>ref|XP_003543170.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase [Glycine max]
Length=524

 Score =   493 bits (1270),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 249/516 (48%), Positives = 340/516 (66%), Gaps = 19/516 (4%)
 Frame = -2

Query  1694  FLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK-  1518
             FL I+ P VV+W  ++++WVWL+P++LE+ LR QGL GN Y +  GDTKEM T+  +A  
Sbjct  12    FLIIA-PLVVLWCWKLLKWVWLRPKRLERALRAQGLQGNPYSLLIGDTKEMYTVLMQAAR  70

Query  1517  -----SKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
                  S  ++   D  P +  F H  V K+GKN F W G  P+V+I++PE ++EVF    
Sbjct  71    SQQSTSSFLSKDKDAAPHITTFNHHIVNKFGKNSFFWEGTKPKVVITDPEQIKEVFNKIQ  130

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++PK  P+VK L SGLA  E ++W  HRKII+PAF+ +K+K M P     C++M+  K
Sbjct  131   DFEKPKLSPIVKLLGSGLANLEGEKWRTHRKIINPAFHLEKLKVMLPIFLECCDDMV-SK  189

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE L S  +  + DV P+L+  T D+ISRTAFG SY +G ++F L  EQ  L  + + + 
Sbjct  190   WERLLSSNDKSEIDVWPFLQNLTCDIISRTAFGSSYEDGKRIFELLKEQTGLMMK-LQNA  248

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P WWLL +  ++RM +ID EIR L+KG+I KRE  MK     +++    LL       
Sbjct  249   YIPGWWLLPTTTNKRMKKIDTEIRALLKGVINKRENAMKAGEVLNNDLLGMLLESNRMEI  308

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                        ++ EVIEEC  FY AGQE+TS  LVW M+LLS +  WQ+RAR+EV  VF
Sbjct  309   QDHGKNNIIAMTSLEVIEECNAFYIAGQETTSVLLVWTMVLLSRYPHWQERAREEVLHVF  368

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD++GL+ LKI+TMIL EVLRLYPP  Y  R +  + KLG + LP  + + L  LL
Sbjct  369   GNQKPDYNGLSHLKIVTMILYEVLRLYPPLIYFARAIKNDVKLGNLSLPAGVQVSLPILL  428

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             + +D D+WG DA EF PERFAEGVAKATK ++ F PFGWGPR C+G NFA++EAK+ ++ 
Sbjct  429   IHQDRDIWGDDATEFNPERFAEGVAKATKGQVVFFPFGWGPRVCLGQNFALLEAKLVLSL  488

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +LQRFSF LSP+YAH+P  V+TL P+FGA ++LHK+
Sbjct  489   LLQRFSFELSPTYAHAPVTVLTLNPKFGAHIILHKL  524



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   496 bits (1276),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 248/497 (50%), Positives = 329/497 (66%), Gaps = 12/497 (2%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             R + W+WL P+KLEK LR+QG  GNSYR++ GD K++  ++ +AKSKP+N S DI PRV+
Sbjct  92    RFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPRVI  151

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
             P  H  + KYGKN FVW GP PRV I +PE ++        F++P  +PLVK L  GL  
Sbjct  152   PSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDGLIN  211

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLE  1113
             +E ++W +HRKI++ AF+ +K+K M P++  SC EMI   WE + S+   C+ DV PYL+
Sbjct  212   HEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMI-NTWEKMVSKDGSCELDVMPYLQ  270

Query  1112  AFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEID  933
                +DVISRTAFG +Y EG  +F+   E   LT Q  + VY P    L +K + RM +I 
Sbjct  271   NLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRRFLPTKSNNRMKKIT  330

Query  932   NEIRGLMKGLIGKRERGMKEKvgdddee----------nldllgvlLKSGFSTDEVIEEC  783
              EI+ ++  +I KR+R MKE      ++          N       +  G S +++IEEC
Sbjct  331   KEIKTMLMNVIDKRQRTMKEGETMQSDDLLGILLESNFNEIKEHGNVNLGMSINDLIEEC  390

Query  782   QHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMIL  603
             + FYFAGQE+T+  LVW MILL  +  WQDRAR EV QVFG+NKPDFDGLNRLKI+TMIL
Sbjct  391   KIFYFAGQETTAVLLVWTMILLGSYTKWQDRARAEVLQVFGNNKPDFDGLNRLKIVTMIL  450

Query  602   NEVLRLYPPSPYTIRTMYE-ETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPER  426
             NEVLRLY P+    R + + ETKLG    P  ++L    +L+  D ++WG DA EF PER
Sbjct  451   NEVLRLYSPASVLSRKLVKRETKLGNFTFPSGVMLSFPVILIHLDKEIWGEDANEFNPER  510

Query  425   FAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCF  246
             FAEGV+KAT N+  F PFGWGPR CIG NFAM+EAKIA++ ILQ FSF LSPSY H+P  
Sbjct  511   FAEGVSKATXNQTGFFPFGWGPRICIGQNFAMIEAKIALSIILQHFSFELSPSYTHAPIS  570

Query  245   VVTLKPQFGAPLVLHKI  195
             ++T +PQ GA ++LHK+
Sbjct  571   ILTTQPQHGAHIILHKL  587



>emb|CDX98486.1| BnaC05g38890D [Brassica napus]
Length=512

 Score =   493 bits (1269),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 245/504 (49%), Positives = 343/504 (68%), Gaps = 10/504 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             +++ AV+ W  R + WVW KP+ LE +LR+QGL+G+ Y    GD +    ++ +A+SKPI
Sbjct  12    VAIVAVLWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDVRRDNNMSMEARSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH-  1329
              ++DDI+PRV+PF    +  +GK  F W GP P + I++PE ++EVF  N ++   KPH 
Sbjct  72    KITDDIVPRVVPFPSHMLKTHGKTFFTWRGPIPTITITDPEQIKEVF--NKIYDCQKPHS  129

Query  1328  -PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSE  1152
              PL + + +GL  Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++  KW+ L SE
Sbjct  130   FPLSRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVV-GKWDKLVSE  188

Query  1151  K-NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWW  975
             K + C+ DV P L + T+DVISRTAFG SY EG ++F LQ E A+L  Q    ++ P + 
Sbjct  189   KGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLLTQAFRRIFIPGYR  248

Query  974   LLSSKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFS  807
                +K +RRM     E++ +++G++ KR    E G               LG    +G S
Sbjct  249   YYPTKGNRRMKAAAREVQDILRGIVNKRLRAREAGEAPSDDLLGTLLESNLGQAKGTGMS  308

Query  806   TDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNR  627
              ++VIEEC+ FYFAGQE+TS  LVW M++LS HQ WQ +AR+EV+QVFG  +PD +GLN 
Sbjct  309   IEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQAKAREEVKQVFGDKEPDTEGLNH  368

Query  626   LKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADA  447
             LKI+TMIL EVLRLYPP     R +++E KLG++ LP  I + L  +LVQRD ++WG DA
Sbjct  369   LKIMTMILYEVLRLYPPVIQLTRAIHKEMKLGDLTLPGGIHISLPVMLVQRDTNLWGNDA  428

Query  446   GEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPS  267
             G+FKP+RF +GV+KATK++++F+PF WGPR CIG NFAM+EAK+A+A ILQRFSF  SPS
Sbjct  429   GDFKPDRFKDGVSKATKSQVSFIPFAWGPRICIGQNFAMLEAKMAMALILQRFSFEFSPS  488

Query  266   YAHSPCFVVTLKPQFGAPLVLHKI  195
             Y H+P  V TL PQFGA L+LHK+
Sbjct  489   YVHAPYNVFTLHPQFGAHLILHKL  512



>ref|XP_009394216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   493 bits (1270),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 243/501 (49%), Positives = 347/501 (69%), Gaps = 11/501 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             + WA RV+ W W +PR LE+ LR  GLNG +YR  YGD KE A  + +A++KP+ L+ +I
Sbjct  23    LAWALRVLNWAWWRPRWLERALRAHGLNGTAYRFPYGDLKENARFSKEARAKPMPLAHNI  82

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN-TLFKRPKPHPLVKFL  1311
             +PR+LPF + A+ +YGK  F W GP P+V I++PEL++EV  N   +F +P  +PL +F 
Sbjct  83    IPRLLPFLNRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPLSRFF  142

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
               GL  YE ++W +HR+I++PAF+ +K+K M P+ ++ C ++ M +WE +   +   + D
Sbjct  143   SKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDL-MDRWENMAGSEACYELD  201

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P L++F+ DVISRTAFG SY EG ++F LQ+EQAEL  QV+ ++Y P +  L + +++
Sbjct  202   VWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTPKNK  261

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---------SGFSTDE  798
             R+  ID EIR +++G+I KRE+ +K      D+    L+   +K         +G +T++
Sbjct  262   RIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGMTTED  321

Query  797   VIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKI  618
             VIEEC+ FYFAGQE+TS  L W MI LS+H TWQ RAR+EV +VFG NKPDFDGL+ LKI
Sbjct  322   VIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDFDGLSHLKI  381

Query  617   LTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEF  438
             +TMIL EVLRLYPP     R  Y+  K+G++  PP ++L+L ++ V  DP++WG DA EF
Sbjct  382   VTMILYEVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNLWGKDASEF  441

Query  437   KPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAH  258
              PERFAEGV+KA+K ++AF PFG GPR CIG NF+++EAK+ ++ ILQ F F LSPSYAH
Sbjct  442   NPERFAEGVSKASKEQVAFFPFGGGPRICIGQNFSLLEAKMGLSMILQHFYFDLSPSYAH  501

Query  257   SPCFVVTLKPQFGAPLVLHKI  195
             +P  + TL PQ GA + L K+
Sbjct  502   APRTIFTLFPQRGAQIRLRKL  522



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   493 bits (1269),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 248/498 (50%), Positives = 334/498 (67%), Gaps = 13/498 (3%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             + + WVW +P+KLEK L++Q   GN Y++ +GD KEM+TL  +A+SK +NLSDDI+PRV+
Sbjct  28    KALNWVWFRPKKLEKRLKEQRFRGNPYKLLHGDFKEMSTLYTEAQSKNLNLSDDIVPRVI  87

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
             P Y  AV KYGKN ++W GP P ++I +P L++ V     +F++P+ +PL + L  GL  
Sbjct  88    PQYLGAVKKYGKNTYLWFGPRPALVIMDPNLIKAVTQKVDVFQKPRVNPLGRLLAQGLVS  147

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLE  1113
             YE ++WA+ RK+++PAF+ +K+K M P+   S  EM+ K WE + S K   + DV P L+
Sbjct  148   YEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSASEMVTK-WENVVSPKGLAEVDVWPNLQ  206

Query  1112  AFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS--PEWWLLSSKRSRRMHE  939
             A TSD ISRTAFG +Y EG ++F LQ EQ E   Q+  SVY   P +  L +KR+RRM +
Sbjct  207   ALTSDAISRTAFGSNYEEGRRIFELQREQTEHLMQLARSVYINIPGFRFLPTKRNRRMKQ  266

Query  938   IDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK---------SGFSTDEVIEE  786
             I  E+ G ++ +I  R + M+      D+    +L    +         SG +T+E+++E
Sbjct  267   IAREVNGSVREMINTRRKAMRAGEAGSDDLLGLMLQSNSQEIEKHGNKDSGMTTEEIVDE  326

Query  785   CQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMI  606
             C+ FYFAGQE+TS  LVW M+LL  +  WQ RAR+EV Q FG   PDFDGLN LKI+TMI
Sbjct  327   CKLFYFAGQETTSALLVWTMVLLCRYPEWQARAREEVLQQFGTKDPDFDGLNHLKIVTMI  386

Query  605   LNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPER  426
             L+EVLRLYPP     R   EETKLG + LP  + L L  LL+  DPD+WG D  EFKPER
Sbjct  387   LHEVLRLYPPVATMSRRTIEETKLGNLTLPAGVQLTLPILLMHHDPDIWGEDVKEFKPER  446

Query  425   FAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCF  246
             FAEGV+ ATK  +A+ PFGWGPR CIG NFAM+EAK+A++ ILQRFSF LSPSY H+P  
Sbjct  447   FAEGVSHATKGHVAYFPFGWGPRICIGQNFAMLEAKLAMSMILQRFSFELSPSYTHAPGT  506

Query  245   VVTL-KPQFGAPLVLHKI  195
                L +PQ+GA L+L KI
Sbjct  507   ATALVQPQYGAHLILQKI  524



>ref|XP_009147881.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   493 bits (1268),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 246/498 (49%), Positives = 334/498 (67%), Gaps = 10/498 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             ++W  R ++WVW KP+ LE +LR+QG+ G  Y    GD +   +++ +A+SKPI L+DDI
Sbjct  18    LLWIWRTLKWVWFKPKMLESYLRRQGIAGTPYTPLVGDMRRDNSMSKEARSKPIKLTDDI  77

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH--PLVKF  1314
             + RVLPF    +  YG+  F W G  P + I++PE ++EVF  N ++  PKPH  PL   
Sbjct  78    ISRVLPFPSHMLKTYGRTFFTWRGTIPSITITDPEQIKEVF--NKVYDFPKPHTFPLTNL  135

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK-NWCD  1137
             ++SGL  Y+  +WA+HR+II+PAF+ +KIK M P    SC E++  KW+ + S+K + C+
Sbjct  136   IISGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPVFHQSCNEVV-DKWDKMVSDKGSSCE  194

Query  1136  FDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKR  957
              DV P L + T DVISRTAFG SY EG ++F LQ E A+L  Q     Y P +  L +K 
Sbjct  195   VDVWPGLMSITEDVISRTAFGSSYKEGQRIFELQTELAQLIIQAFRKSYIPGYRYLPTKD  254

Query  956   SRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFSTDEVIE  789
             +RR+     E   +++GL+ KR    E G               LG    +G S D+VIE
Sbjct  255   NRRIKAAAKETHDILRGLVNKRLRAREAGEAPNEDLLGILLESNLGQAKGNGMSIDDVIE  314

Query  788   ECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTM  609
             EC+ FYFAGQE+TS  LVW MILLS HQ WQ RAR+EV+QVFG  +PD +GLN LKI+TM
Sbjct  315   ECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPDTEGLNHLKIMTM  374

Query  608   ILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPE  429
             I+NEV+RLYPP     RT+++E KLG++ LP  + + L  +LVQRD  +WG DA EFKPE
Sbjct  375   IINEVIRLYPPVTLLTRTIHKEMKLGDLTLPGGVQINLPIMLVQRDTQLWGNDAAEFKPE  434

Query  428   RFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             RF +GV+KATK++++F PF WGPR CIG NFA++EAK+A+A ILQRFSF LSP+Y H+P 
Sbjct  435   RFEDGVSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPTYVHAPY  494

Query  248   FVVTLKPQFGAPLVLHKI  195
              V TL PQ+GA L+LHK+
Sbjct  495   TVFTLHPQYGAHLILHKL  512



>ref|XP_004488667.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=524

 Score =   493 bits (1269),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 255/525 (49%), Positives = 345/525 (66%), Gaps = 20/525 (4%)
 Frame = -2

Query  1721  RIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEM  1542
             RI S  +  FL ++ P V++W  +++ W+WL+P++LEK LR QGL GN YR+  GDTKEM
Sbjct  4     RITSTNATCFLILA-PLVLLWTWKLLNWLWLRPKRLEKLLRAQGLQGNPYRILIGDTKEM  62

Query  1541  -ATLTAKAKS-KP----INLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPEL  1380
                +   AKS KP    ++L  D+ P V  F H  V K+GKN F+W G  P+VII+ PE 
Sbjct  63    FKVMMENAKSQKPTDNTLSLDKDVAPHVFTFIHHIVHKFGKNSFLWEGTKPKVIITNPEQ  122

Query  1379  MQEVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTS  1200
             ++E+F N   F++PK  PL K L SGLA YE  +W  HRKII+P FY +K+K M P  + 
Sbjct  123   IKEIFNNIHDFEKPKLSPLFKLLGSGLANYEGDKWRMHRKIITPTFYSEKLKIMLPVFSQ  182

Query  1199  SCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAE  1020
             SC +MI  KWE + S+    + D  P+L+  T D+IS+TAFG SY EG K+F L  EQA 
Sbjct  183   SCNDMI-SKWEEMFSDGK-LEIDAWPFLQTLTCDIISKTAFGSSYEEGKKIFDLLKEQAG  240

Query  1019  LTRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenld  840
             L  + + +VY P WWLL +   +RM +ID +I+  +K +I KRE+ M      + +    
Sbjct  241   LIMK-LRNVYIPGWWLLPTTTHKRMTKIDKDIQTSLKAIINKREKAMMAGEVFNKDLLGI  299

Query  839   llgvlLKS----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDR  690
             LL    K           G +  EVIEEC  FY AGQE+TS  LVW MILLS +  WQ R
Sbjct  300   LLESNHKEIQENGNNKTVGMTNQEVIEECNAFYLAGQETTSVLLVWTMILLSRYPDWQAR  359

Query  689   ARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPN  510
             AR+E+ QVFG+  P+ DGL RLKI+ MIL EVLRLYPPS Y  R +++  +LG + LP  
Sbjct  360   AREEILQVFGNQMPNNDGLTRLKIMPMILYEVLRLYPPSIYFNRVVHKNVELGSLSLPAG  419

Query  509   iililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAM  330
             +++ L  LLV  D D+WG DA EFKPERF+EG+AKATK +++F PFGWGPR+CIG NFA+
Sbjct  420   VLISLPILLVHHDRDIWGDDATEFKPERFSEGIAKATKGQVSFFPFGWGPRSCIGQNFAL  479

Query  329   MEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +EAK+ ++ +LQRFSF LSP+YAH+P   +TL P++G  ++LHK+
Sbjct  480   LEAKMILSQLLQRFSFELSPAYAHAPMAAITLCPKYGGHIILHKL  524



>ref|XP_011082969.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   492 bits (1267),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 248/503 (49%), Positives = 335/503 (67%), Gaps = 11/503 (2%)
 Frame = -2

Query  1673  AVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSD  1494
              V+IWA RVV+W +++P+++EK LR+QG NG+SYR+   + KE   +  +AKS PINL D
Sbjct  15    VVLIWAWRVVKWAYMRPKRVEKLLRKQGFNGSSYRLVNRELKERLKMVKEAKSNPINLDD  74

Query  1493  DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPK-PHPLVK  1317
             DI PR+LPFY   +  YG   F+W G +P VIIS+PEL++EV     ++K+ K  +PL +
Sbjct  75    DIKPRILPFYTKTIQTYGTESFMWLGLSPTVIISDPELIKEVMTKTHIYKKIKNANPLTR  134

Query  1316  FLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCD  1137
              L  GL  Y+  +WA+H+KII+PAF+ +K+K M P+   SC+E ++ KWE   S +  C+
Sbjct  135   LLAQGLFSYDLDKWAKHKKIINPAFHMEKLKLMIPAFYLSCDE-VLNKWEKSLSPEGSCE  193

Query  1136  FDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKR  957
              DV P+L+  +SD ISRTAFG SY EG ++F LQ EQA        S+Y P W  + +KR
Sbjct  194   VDVWPFLQNLSSDAISRTAFGSSYQEGRRIFELQREQAGHFFIASRSMYIPGWRFVPTKR  253

Query  956   SRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFST  804
             ++RM EI  E++ L++G+I +R   MK    ++++    LL    +          G + 
Sbjct  254   NKRMKEIAEEVQSLIRGIISRRVEAMKAGEANNEDLLGILLESNAREIEQHGNKTFGMTI  313

Query  803   DEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRL  624
             DEV+EEC+ FYFAGQE+TS  LVW ++LLS +  WQ RAR+EV QVFG   P FDGLN L
Sbjct  314   DEVVEECKLFYFAGQETTSSLLVWTLVLLSRYPDWQKRAREEVLQVFGRQTPAFDGLNYL  373

Query  623   KILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAG  444
             KI+TMIL EVLR YPP     R + EETKLG + LP  + + L  + +  + D+WG DA 
Sbjct  374   KIVTMILYEVLRFYPPVVTLGRRVTEETKLGNLTLPAGVQISLPLISLHHNRDIWGDDAM  433

Query  443   EFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSY  264
             EFKPERF++GVAKA K +  F PFGWG R CIG  FAMMEAK+ +A ILQRFSF LSPSY
Sbjct  434   EFKPERFSQGVAKAQKRQGIFFPFGWGSRICIGQVFAMMEAKVVLAMILQRFSFELSPSY  493

Query  263   AHSPCFVVTLKPQFGAPLVLHKI  195
              H+P  VV L+PQ GA L+LHK+
Sbjct  494   QHAPQRVVALQPQHGAHLLLHKL  516



>emb|CDX98485.1| BnaC05g38900D [Brassica napus]
Length=512

 Score =   492 bits (1267),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 248/504 (49%), Positives = 338/504 (67%), Gaps = 6/504 (1%)
 Frame = -2

Query  1691  LFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSK  1512
             L I++  V  WA R + WVW KP+ LE +LR+QGL+G+ Y    GD K   +L  +A+SK
Sbjct  10    LSIAIAVVSWWAWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDLKRNFSLLKEARSK  69

Query  1511  PINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKP  1332
             PI L+DDI PRV+P+    +  +G+  F W GP P + I +PE ++EVF     F++   
Sbjct  70    PIKLTDDITPRVVPYPLKMLKTHGRTYFTWLGPIPTITIMDPEQIKEVFNKVYDFQKTHT  129

Query  1331  HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSE  1152
              PL + + +GLA Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++  +W+ L SE
Sbjct  130   FPLARLIGTGLASYDCDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVV-GEWDKLVSE  188

Query  1151  KNW-CDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWW  975
             K   C+ DV P L + T+DVISRTAFG SY EG ++F LQ E A+L  Q       P + 
Sbjct  189   KGLSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYS  248

Query  974   LLSSKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFS  807
              L +K +R M     E+  +++G++ KR    E G               LG +  +G S
Sbjct  249   YLPTKENRMMKAKAREVHAILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQVKGNGMS  308

Query  806   TDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNR  627
              ++VIEEC+ FYFAGQE+TS  LVW M+LLS HQ WQ +AR+EV+QVFGH  PD DGLN+
Sbjct  309   NEDVIEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGHKIPDTDGLNQ  368

Query  626   LKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADA  447
             LK++TMIL EVLRLYPP     R +++E KLG++ LP  + + L  LLVQRD ++WG DA
Sbjct  369   LKVMTMILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGDDA  428

Query  446   GEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPS  267
             GEFKPERF EG++KATK++++F PF WGPR CIG NFA++EAK+A+A ILQRFSF LSPS
Sbjct  429   GEFKPERFREGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPS  488

Query  266   YAHSPCFVVTLKPQFGAPLVLHKI  195
             Y H+P  V+T+ PQFGA L+LHK+
Sbjct  489   YVHAPYTVITIHPQFGAHLILHKL  512



>gb|KFK38819.1| hypothetical protein AALP_AA3G164600 [Arabis alpina]
Length=515

 Score =   492 bits (1267),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/497 (49%), Positives = 344/497 (69%), Gaps = 7/497 (1%)
 Frame = -2

Query  1673  AVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSD  1494
             AV+IW  + +   WL+P+K E +L++QGL+G  +    GD  + A++  +AKS+PI+L+D
Sbjct  22    AVLIW--KGLNLAWLRPKKHEAYLKRQGLSGTPFTFLVGDALKEASMVDQAKSRPISLTD  79

Query  1493  DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             D  PRV+P     V  +GK  ++W GPA  VI+++PE ++EV   N  F +P  HP+V+ 
Sbjct  80    DYTPRVMPMILQTVKDHGKTSYMWLGPAASVIVTKPEHIKEVLNRNYDFPKPPMHPIVEL  139

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWC-D  1137
               SG+A YE ++W++HRKII+P+F+ +K+K M P+   SC EMI  KWE L SE+    +
Sbjct  140   FASGVAVYEGEKWSKHRKIINPSFHLEKLKIMIPAFYESCIEMI-SKWESLVSEQGSSNE  198

Query  1136  FDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKR  957
              DV PYL+  TSDVISRTAFG SY EG ++F LQ EQ +   + +   + P    L +K 
Sbjct  199   IDVWPYLQDVTSDVISRTAFGSSYEEGKRIFELQEEQGQRVLKALKLAFIPGLRFLPTKN  258

Query  956   SRRMHEIDNEIRGLMKGLIGKRERGMKE-KvgdddeenldllgvlLKSGFSTDEVIEECQ  780
             + RM +ID E+R  +   I KR+R M+  +   +D   + L       G ST +V+EEC+
Sbjct  259   NMRMKQIDKEVRSRLGDTIKKRQRAMEAGEAPKNDLLGILLESNYGDHGMSTKDVVEECR  318

Query  779   HFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFG-HNKPDFDGLNRLKILTMIL  603
              F+FAGQE+T+D LVW MI+LS H+ WQD+AR+E+ QV G +NKP+FD L+RLKI++MIL
Sbjct  319   LFHFAGQETTADLLVWTMIMLSHHKKWQDQAREEILQVIGENNKPNFDALSRLKIMSMIL  378

Query  602   NEVLRLYPPSPYTIRTMYEETKLGE-MKLPPNiililsslLVQRDPDVWGADAGEFKPER  426
             NEVLRLYPP     RT+ +ETKLGE M LP    +++  L+V RDP++WG D  EFKPER
Sbjct  379   NEVLRLYPPGILLGRTIEKETKLGEDMTLPGGAQVVIPVLMVHRDPELWGEDVHEFKPER  438

Query  425   FAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCF  246
             FA+G++KATKN+++FLPFGWGPR C G NFA+MEAK+A+  IL++FSF LSPSY H+P  
Sbjct  439   FADGISKATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLILRKFSFELSPSYTHAPHT  498

Query  245   VVTLKPQFGAPLVLHKI  195
             V+TL PQFGAPL+ H +
Sbjct  499   VLTLHPQFGAPLIFHML  515



>ref|XP_011082818.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=521

 Score =   492 bits (1267),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 233/516 (45%), Positives = 345/516 (67%), Gaps = 13/516 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +S +F+ + +  ++ WA R++ WVW +P+KLEK LR+QGL GN YR   GD K + ++T 
Sbjct  7     LSSIFISVLIVGLITWAVRILNWVWFRPKKLEKLLRKQGLQGNPYRFLLGDMKTLISVTK  66

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             + ++K I LSD + P +LP+YH  + +YG+N F+W GP+PR+ I++P+LM+E+     +F
Sbjct  67    EEQTKSIQLSDHLAPHILPYYHQIINEYGQNSFIWFGPSPRLNITDPQLMKEILTKPEVF  126

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
              +P P P+ + +  GL   ED++WA+HRKII+PAF+ +K+K M  ++  SC  M+ +KWE
Sbjct  127   HKPLPDPIGETIAGGLLFLEDEKWAQHRKIINPAFHMEKLKNMVSAIRLSCSNMV-EKWE  185

Query  1166  -LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVY  990
              + +  +   + DV P+LE+ + DVISRTAFG S+ EG ++F L  EQ +L  +++   +
Sbjct  186   SMFSRSERSLEIDVWPHLESLSGDVISRTAFGSSHEEGRRIFELHREQVKLVLELLKFFF  245

Query  989   SPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS--  816
              P W  + +K +RRM  I  EI+ L++G+I +RE+ M+      D+    L+   LK   
Sbjct  246   IPGWRFVPTKANRRMRAISKEIQSLLRGIINQREKAMERGETVGDDLLSTLMESNLKEIE  305

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G   ++VI EC+ FYFAG E+TS  LVW M++LS HQ WQ RAR+EV QVF
Sbjct  306   EHGGKKKDVGMDIEDVINECKLFYFAGSETTSLLLVWTMVMLSKHQEWQVRAREEVSQVF  365

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G N+P F+GLNRLK++T IL+EVLRLYPP P   R   +  KLG + LP  + LIL   L
Sbjct  366   GKNEPTFEGLNRLKVVTTILHEVLRLYPPVPLITRAPTKTLKLGNITLPVGVDLILLIGL  425

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  DP +WG D  +FKPERF+EG++ ATK + +F+PF  GPR C+G  FAM+EAK+A+  
Sbjct  426   LHHDPKIWGDDVNQFKPERFSEGISSATKGQFSFIPFSAGPRVCVGQQFAMIEAKLALVM  485

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQ+FSF LS SY H+P  ++TL+PQ+GA L+LH++
Sbjct  486   ILQKFSFELSSSYLHAPFSILTLRPQYGAALILHRL  521



>ref|XP_006407055.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48508.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
Length=512

 Score =   492 bits (1266),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/502 (49%), Positives = 337/502 (67%), Gaps = 6/502 (1%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             +++  V  W  R + WVW KP+ LE +LR+QGL G  Y    GD+K    ++ +A+SKPI
Sbjct  12    VAIAVVSWWVWRTLNWVWFKPKTLESYLRRQGLVGTPYTPLAGDSKRTFNMSMEARSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHP  1326
             NL+DDI+PRVLPF    +  YG+  F W G  P + I +PE ++EVF     F++P   P
Sbjct  72    NLTDDIIPRVLPFSLHMLKTYGRTFFTWRGHIPVITIMDPEQIKEVFNKIYDFQKPHTFP  131

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK-  1149
             L + + +GL  Y+  +WA HR+II+PAF+ +KIK M P+   +C E+I  +W+ L S+K 
Sbjct  132   LGRLIATGLFSYDGDKWANHRRIINPAFHLEKIKNMVPAFHQTCSEVI-GEWDKLVSDKG  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
             + C+ DV P+L + T+DVISRTAFG SY EG ++F LQ E A+L    + + + P +  L
Sbjct  191   SSCEVDVWPWLMSMTADVISRTAFGSSYKEGQRIFELQAELAQLITLSVQTAFIPGYRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFSTD  801
              +KR+RR+     EI+ ++ G+I KR    E G               LG    +G ST+
Sbjct  251   PTKRNRRIKAAAREIQIILSGIINKRLRAREAGEAPSNDLLGILLESNLGQAKGNGMSTE  310

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             +V+EEC+ FYFAGQE+TS  LVW M+LLS HQ WQ RAR+EV+QVFG  +PD +GLN+LK
Sbjct  311   DVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDTEGLNQLK  370

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMI  EVLRLYPP     R +++E KLG++ LP  + + L  LLVQRD ++WG DA E
Sbjct  371   VMTMIFYEVLRLYPPVNQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGKDAAE  430

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             FKPERF EG++KATK++++F PFGWGPR CIG NFA++EAK+A+A IL RFS  LSPSY 
Sbjct  431   FKPERFQEGISKATKSQVSFFPFGWGPRICIGQNFALLEAKMAMALILHRFSLELSPSYV  490

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P  V T+ PQFGA L+LHK+
Sbjct  491   HAPYTVFTIHPQFGAHLILHKL  512



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   492 bits (1266),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 256/517 (50%), Positives = 344/517 (67%), Gaps = 16/517 (3%)
 Frame = -2

Query  1700  ILFLFISVPA-----VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMAT  1536
             IL L+  + A     V+ +  R++ W +++P++LEK LR+QGL GN+Y   YGD KEM  
Sbjct  4     ILILYKIIGACLAFVVLFYTWRILNWAYIRPKRLEKSLRKQGLIGNTYNFLYGDLKEMLN  63

Query  1535  LTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNN  1356
             +   AKS PINL DDI PRVL F H    KYGK  F+W GP P V+I+EPEL++EV    
Sbjct  64    MINHAKSHPINLDDDIKPRVLAFIHKTFLKYGKGSFIWLGPRPAVMITEPELIKEVMTKI  123

Query  1355  TLFKRPK-PHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
              L+++PK  +PL K L  G+  YE  +WA+HRKII+PAF+ +K+K M P+   SC+E ++
Sbjct  124   NLYQKPKNSNPLTKLLAQGVVAYEGDKWAKHRKIINPAFHFEKLKLMIPAFYLSCDE-VL  182

Query  1178  KKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIH  999
              KWE   S K   + DV PYL+  +SD ISRTAFG SY EG KVF LQ EQAE   +   
Sbjct  183   NKWEKSLSGKGSGEVDVWPYLQNLSSDAISRTAFGSSYKEGRKVFELQREQAEYIIKASQ  242

Query  998   SVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLK  819
             ++Y P W  + +K + RM EI+ E++  ++G+I KR + MK     +++    LL    K
Sbjct  243   TIYIPGWRFMPTKGNNRMKEIEKEVQSSIRGMINKRVKAMKAGEASNEDLLGLLLESNYK  302

Query  818   S---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQV  666
                       G + DEV+EEC+ FYFAGQE+TS  LVW ++LLS +  WQ +AR+EV Q 
Sbjct  303   EIEQYGNKSFGMTIDEVVEECKLFYFAGQETTSVLLVWALVLLSQYPEWQTKAREEVLQS  362

Query  665   FGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililssl  486
             FG+  P+FDGLN LKI+ MIL EVLRLYPP     R + EETKLG++ LP  + + L  +
Sbjct  363   FGNQIPEFDGLNHLKIVNMILYEVLRLYPPVVALGRIVSEETKLGKLTLPAGVQVSLPII  422

Query  485   LVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIA  306
              +  + ++WG DA EFKPERF+EGV+KA K +  F PFGWGPR C+G  FAM+EAK+A++
Sbjct  423   FLHHNREIWGDDAMEFKPERFSEGVSKAQKGQGIFFPFGWGPRICVGQTFAMLEAKVALS  482

Query  305   TILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
              ILQRFSF LSPSYAH+P  V+TL+PQ GA L+LHK+
Sbjct  483   MILQRFSFELSPSYAHAPHTVITLQPQHGAHLLLHKL  519



>ref|XP_009116734.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Brassica rapa]
Length=508

 Score =   491 bits (1265),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 245/490 (50%), Positives = 327/490 (67%), Gaps = 5/490 (1%)
 Frame = -2

Query  1652  RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVL  1473
             RVV WVWLKP+KLE++LR+QGL G  Y    GD K    +  +A+SKPI L+DDI PR+L
Sbjct  20    RVVNWVWLKPKKLERYLRRQGLPGTPYTPLVGDVKRNVNMLMEARSKPITLTDDITPRLL  79

Query  1472  PFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLAC  1293
             P        +G+  F+W GP P ++I+ PE ++EVF     F++    PLV+ LV GLA 
Sbjct  80    PLALKMFNSHGRTFFIWLGPVPTIMITNPEHIKEVFSKVYDFEKNASFPLVRLLVGGLAS  139

Query  1292  YEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW-CDFDVQPYL  1116
             Y+  +WARHR+II+PAF+ +KIK M P+    C E ++ KW+ L  +K   C+ DV P+L
Sbjct  140   YKGDKWARHRRIINPAFHLEKIKNMVPAFYHCCSE-VVGKWDKLVLDKGLSCEVDVCPWL  198

Query  1115  EAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEI  936
              + T+DVIS  AFG SY EG ++F LQ E + L  Q +   Y P      +K ++RM  I
Sbjct  199   VSMTADVISHAAFGSSYREGQRIFELQGELSSLIAQELKKPYIPGLSFFPTKNNKRMKAI  258

Query  935   DNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKSGFSTDEVIEECQHFYFAGQE  756
             D EI  +++G++ KRE G  E                  SG S +EV+ EC+ FYFAGQE
Sbjct  259   DKEIDIILRGMVSKREAGEAEHNDLLGILLASSSEESGGSGMSVEEVMRECKLFYFAGQE  318

Query  755   STSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN---KPDFDGLNRLKILTMILNEVLRL  585
             +TS  LVW MILLS HQ WQ+RAR+EV+Q+ G N   KPD D LN LK++TMI  EVLRL
Sbjct  319   TTSVLLVWTMILLSHHQDWQERAREEVRQILGDNINTKPDIDSLNNLKVMTMIFYEVLRL  378

Query  584   YPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAK  405
             YPP     RT+ +E KLGE+ LP  + + + + LV RDP++WG DAGEFKPERF +G++K
Sbjct  379   YPPVAELRRTVNKEMKLGEITLPAGVRVYIPTALVHRDPELWGEDAGEFKPERFKDGISK  438

Query  404   ATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQ  225
             ATKN++ +LPFGWG R CIG +F+++EAK+A+A ILQRFSF LSPSY HSP  V+T +PQ
Sbjct  439   ATKNQVCYLPFGWGLRICIGQSFSLLEAKMAMALILQRFSFELSPSYVHSPQIVMTTRPQ  498

Query  224   FGAPLVLHKI  195
             FGA L+LHK+
Sbjct  499   FGAHLILHKL  508



>gb|KHN47459.1| Secologanin synthase [Glycine soja]
Length=524

 Score =   492 bits (1266),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 248/516 (48%), Positives = 339/516 (66%), Gaps = 19/516 (4%)
 Frame = -2

Query  1694  FLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK-  1518
             FL I+ P VV+W  ++++WVWL+P++LE+ LR QGL GN Y +  GDTKEM T+  +A  
Sbjct  12    FLIIA-PLVVLWCWKLLKWVWLRPKRLERALRAQGLQGNPYSLLIGDTKEMYTVLMQAAR  70

Query  1517  -----SKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
                  S  ++  +D  P +  F H  V K+GKN F W G  P+V+I++PE ++EVF    
Sbjct  71    SQQSTSSFLSKDNDAAPHITTFNHHIVNKFGKNSFFWEGTKPKVVITDPEQIKEVFNKIQ  130

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++PK  P+VK L SGLA  E ++W  HRKII+PAF+ +K+K M P     C++M+  K
Sbjct  131   DFEKPKLSPIVKLLGSGLANLEGEKWRTHRKIINPAFHLEKLKVMLPIFLECCDDMV-SK  189

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE L S  +  + DV P+L+  T D+ISRTAFG SY +G ++F L  EQ  L  + + + 
Sbjct  190   WERLLSSNDKSEIDVWPFLQNLTCDIISRTAFGSSYEDGKRIFELLKEQTGLMMK-LQNA  248

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
             Y P WWLL +  ++RM +ID EIR L+KG+I KRE  MK     +++    LL       
Sbjct  249   YIPGWWLLPTTTNKRMKKIDTEIRALLKGVINKRENAMKAGEVLNNDLLGMLLESNRMEI  308

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                        +  EVIEEC  FY AGQE+TS  LVW M+LLS +  WQ+RAR+EV  VF
Sbjct  309   QDHGKNNIIAMTNLEVIEECNAFYIAGQETTSVLLVWTMVLLSRYPHWQERAREEVLHVF  368

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPD++GL+ LKI+TMIL EVLRLYPP  Y  R +  + KLG + LP  + + L  LL
Sbjct  369   GNQKPDYNGLSHLKIVTMILYEVLRLYPPLIYFARAIKNDVKLGNLSLPAGVQVSLPILL  428

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             + +D D+WG DA EF PERFAEGV KATK ++ F PFGWGPR C+G NFA++EAK+ ++ 
Sbjct  429   IHQDRDIWGDDATEFNPERFAEGVTKATKGQVVFFPFGWGPRVCLGQNFALLEAKLVLSL  488

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +LQRFSF LSP+YAH+P  V+TL P+FGA ++LHK+
Sbjct  489   LLQRFSFELSPTYAHAPVTVLTLNPKFGAHIILHKL  524



>emb|CDP15973.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   492 bits (1266),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 254/504 (50%), Positives = 347/504 (69%), Gaps = 12/504 (2%)
 Frame = -2

Query  1673  AVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSD  1494
             A+ ++A RV+  +WL+P+KLEK LR  GLNGNSYR+  GD K++A +  +A SKPINLSD
Sbjct  20    ALAVFAWRVLNCMWLRPKKLEKRLRNLGLNGNSYRLVCGDFKDIAVMLKEANSKPINLSD  79

Query  1493  DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKF  1314
             DI+PRV+PF+   + KYGKN FVW G  P V+I +P LM+E+ + N +FK+P+PHP+VK 
Sbjct  80    DIVPRVIPFFIEIIKKYGKNSFVWLGLNPSVVILDPVLMREILLKNYIFKKPRPHPIVKL  139

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDF  1134
             L  G+   E  +WA+HRKIIS AF+  K+K M P+  SS  EM + KWE   S +  C+ 
Sbjct  140   LAQGVIFSEGDKWAKHRKIISSAFHLQKLKHMLPAFYSSASEM-LSKWEERVSPEGSCEL  198

Query  1133  DVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRS  954
             DV PYL+   +D ISRTAFG +Y EG ++F LQ EQA+   +   SVY P    L ++R+
Sbjct  199   DVWPYLQTLGADSISRTAFGSNYEEGRRIFELQMEQAQYAVRATRSVYFPGLRFLPTRRN  258

Query  953   RRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------GFSTD  801
             +RM +I+ EI+  ++ +I KR + +K     +D+    +L    K          G +  
Sbjct  259   KRMKDIEKEIQAKIRDIINKRVKALKAGETSNDDLLGIMLESNFKEIDLHGDKSFGMTMQ  318

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             +VI+EC+ FYFAGQES+S  LVW ++LL  H+ WQ +AR EV QVFG NKP F+GLN LK
Sbjct  319   DVIDECKLFYFAGQESSSTLLVWTLVLLGRHREWQSKARDEVSQVFGRNKPHFEGLNHLK  378

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             I+TMILNEVLRLYPP+    R +++ETK+G++ LP  ++L L  +L+  D ++WG D  E
Sbjct  379   IVTMILNEVLRLYPPAVALNRRVHQETKVGKLSLPAGVMLWLPVILLHHDREIWGDDVKE  438

Query  440   FKPERFAEGVAKAT--KNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPS  267
             FKPERF+EGV+KA   +++  F PFGWGPR C+G NFAM+EAK+A++ ILQ FSF LSPS
Sbjct  439   FKPERFSEGVSKAANGQSQAPFFPFGWGPRICLGQNFAMLEAKLALSMILQHFSFQLSPS  498

Query  266   YAHSPCFVVTLKPQFGAPLVLHKI  195
             Y H+P  V TL+PQ GA LVLHK+
Sbjct  499   YVHAPYTVFTLQPQHGALLVLHKL  522



>ref|XP_006442298.1| hypothetical protein CICLE_v10019876mg [Citrus clementina]
 gb|ESR55538.1| hypothetical protein CICLE_v10019876mg [Citrus clementina]
Length=491

 Score =   491 bits (1263),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 231/492 (47%), Positives = 346/492 (70%), Gaps = 9/492 (2%)
 Frame = -2

Query  1649  VVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVLP  1470
             ++ WVWLKP+KLEK+LR+QG +GNSY+VF+GD KE+A  T +AKS+PI+LSDDI  R+LP
Sbjct  2     LLNWVWLKPKKLEKFLREQGFSGNSYKVFHGDMKELAQTTKEAKSRPISLSDDIARRILP  61

Query  1469  FYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLACY  1290
             F+H  +T +GKN F+W GP P + I++P++++E+F+ + +FK+ +  PL K L +G+  Y
Sbjct  62    FHHRIITNFGKNSFIWMGPRPNIHITDPKMIREIFLKHDIFKKLRS-PLAKLLATGMVGY  120

Query  1289  EDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLEA  1110
             + +QW + RKI +PAF+ DK+K M P++  SC +M ++KWE+  S+   C+ DV P+++ 
Sbjct  121   DGEQWFKVRKIATPAFHHDKLKNMLPTIHKSCNDM-LRKWEMSFSKDESCELDVWPHIQT  179

Query  1109  FTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEIDN  930
              T+DVISRTAFG ++ EG K+F + +EQ  L  Q     Y P W  + +K +R+++   N
Sbjct  180   LTADVISRTAFGSNFEEGRKIFEVLSEQINLVIQASLFAYIPGWRFVPNKLNRKLNSNHN  239

Query  929   EIRGLMKGLIGKRERGMK-------EKvgdddeenldllgvlLKSGFSTDEVIEECQHFY  771
             E+  L+KG++ KR+  +K       + +     E+        ++G S +EVIEEC+ FY
Sbjct  240   EMGELVKGIVNKRKEALKVGKASNNDDLLGILMESNHKEIQEKETGMSIEEVIEECKLFY  299

Query  770   FAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVL  591
              AGQE+T+  LVW  +LL IH  WQ+RAR+EV QVFG+ +P F+ LN+LK+++ IL EVL
Sbjct  300   LAGQETTASLLVWTTVLLCIHPEWQERAREEVCQVFGNREPKFEELNQLKVVSQILYEVL  359

Query  590   RLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGV  411
             RLY P+P   R   +E KLGE+ +P  ++L L  +LV  D + WG DA +F P+RF+EGV
Sbjct  360   RLYSPAPLLTRANVKEIKLGEIVIPSGVLLSLPIMLVHHDHEYWGDDAKKFNPDRFSEGV  419

Query  410   AKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLK  231
             +KA+KN+++F  FGWGPR C+G NFA++E+K+A+A ILQ+F+F LSP+Y H+P   VT+ 
Sbjct  420   SKASKNQVSFFSFGWGPRICLGQNFALLESKLALAMILQKFTFQLSPTYMHAPTRGVTVY  479

Query  230   PQFGAPLVLHKI  195
             PQ GA ++LHKI
Sbjct  480   PQHGANIILHKI  491



>ref|XP_008219216.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   491 bits (1265),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 254/520 (49%), Positives = 347/520 (67%), Gaps = 15/520 (3%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             + SWV++L + + V  V+ WA RV+ W+WL+P+KLE+ LR+QG  GNSYR+ +GDTK+ +
Sbjct  1     MASWVAVLSV-VWVSIVIAWAWRVLNWMWLRPKKLERCLREQGFTGNSYRLLFGDTKDSS  59

Query  1538  TLTAKAKSKPINLS--DDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVF  1365
              +  +A+SKP+ LS   DI PRV+PF H  V  YG+N FVW GP P++ I  PE ++E+F
Sbjct  60    MMLRQAQSKPMKLSTSHDIAPRVMPFVHQIVKTYGRNSFVWMGPMPKLNIMNPEDLKEIF  119

Query  1364  MNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEM  1185
                  F+RP  +PL+K LV GL   ED +WA+HRKII PAF+ +K+K M P+   SC +M
Sbjct  120   NKRQNFQRPSANPLIKLLVQGLLHIEDVKWAKHRKIIKPAFHLEKLKGMLPTFYQSCSDM  179

Query  1184  IMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQV  1005
             I  +W+ L S+   C+FDV P L+  ++DVI+R AFG SY EG K+F L  +Q +    V
Sbjct  180   I-NEWKGLVSKDGSCEFDVWPCLKNLSADVIARAAFGSSYQEGRKIFQLLQQQDKNFSLV  238

Query  1004  IHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl  825
             + SVY P W  L +K +RRM EI+ EI  L++G+I KRE  +K    + D+    L+   
Sbjct  239   VRSVYIPGWRFLPTKHNRRMKEINKEINVLLRGIINKREEEIKLGEDNKDDLLGILMESN  298

Query  824   LK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEV  675
             LK          +G S  +VIEEC+ FY AG ESTS  LVW MILL  +Q WQ RAR+EV
Sbjct  299   LKEIREHGNKTDTGMSIQDVIEECRLFYLAGSESTSTLLVWAMILLGQNQNWQARAREEV  358

Query  674   QQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilil  495
              Q F  N P F+ L++LK++TM+L EVLRLYP      RT  ++T+LG+  LP  +++ L
Sbjct  359   LQAFESNPPSFNALSQLKVVTMVLLEVLRLYPAGVELPRTTCKKTQLGKFLLPAGVLVSL  418

Query  494   sslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKI  315
               + V  D ++WG DA EFKPERF+EG++KATKN+ A+ PFG GPR CIG NFAM EAK+
Sbjct  419   HIMFVHHDKELWGEDADEFKPERFSEGISKATKNQFAYFPFGAGPRICIGQNFAMQEAKL  478

Query  314   AIATILQRFSFHLSPSYAHSPCFVVT-LKPQFGAPLVLHK  198
             A+A ILQ F+F LSPSYAH+P      L+PQ+GA ++L K
Sbjct  479   ALALILQHFTFELSPSYAHAPTTQGNLLQPQYGAHIILRK  518



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   491 bits (1264),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 243/515 (47%), Positives = 343/515 (67%), Gaps = 17/515 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             +S+   F+ +  ++ W  R + W+WL+P+ LEK L++ G  GNSY++ YGD KE+  +  
Sbjct  5     ISLAISFVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDE  64

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +AKSKPI  S DI+PR++PF H  +  YGKN F+W  P P ++I++PEL++E+   + +F
Sbjct  65    EAKSKPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIF  124

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSV-TSSCEEMIMKKW  1170
             ++P P    K LV G+  YE  +WA+HR+II+PAF+ DK+K M PS   S+CE  ++ +W
Sbjct  125   QKPPPTAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKHMIPSFHLSTCE--MLSEW  182

Query  1169  ELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVY  990
             E + S +   + DV PYL++ TSD ISRTAFG SY EG K+F LQ E A++  +V  S Y
Sbjct  183   EKVASAEG-SEVDVWPYLQSLTSDAISRTAFGSSYEEGRKIFELQQELAKIILKVTESSY  241

Query  989   SPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvg----------dddeenld  840
                   L +K +RRM +I  E+R L+ G+I KR   ++ +             D      
Sbjct  242   I---MFLPTKENRRMKQIYQEVRSLVLGIINKRMDAIEAREAFNNDDLLGILLDSNLKEI  298

Query  839   llgvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFG  660
                   K G S DEVIEEC+ FYFAGQE+TS  L W MI+LS H  WQ RAR+EV QVFG
Sbjct  299   KEHGNKKFGMSLDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSDWQARAREEVLQVFG  358

Query  659   HNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLV  480
             +N+PD+D LN+LK++TMI+ EVLRLYPP     R +++ETKLG + LP  + L+L ++++
Sbjct  359   NNRPDYDMLNQLKVVTMIIQEVLRLYPPLLLMGREVHKETKLGNLSLPGGVQLLLPTIML  418

Query  479   QRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATI  300
               D ++WG D  EF PERF+EGV KATK + A+ PF WGPR CIG +FAM++AK+A+A I
Sbjct  419   HHDQEIWGEDVKEFNPERFSEGVNKATKGKFAYFPFSWGPRICIGQHFAMLQAKMALAMI  478

Query  299   LQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LQ ++F +SPSYAH P  V+TL+PQ GA L+LHK+
Sbjct  479   LQHYAFDVSPSYAHVPYSVLTLQPQHGAQLILHKL  513



>emb|CDY32349.1| BnaC01g36680D [Brassica napus]
Length=508

 Score =   491 bits (1263),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 241/492 (49%), Positives = 339/492 (69%), Gaps = 6/492 (1%)
 Frame = -2

Query  1661  WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILP  1482
             W  R ++WVW KP+ LE +LR+QG+ G  Y    GD K+M+++  +A+SKPI L+DD+ P
Sbjct  20    WVWRTLKWVWFKPKMLESYLRRQGIPGTPYTPLVGDLKKMSSMLTEARSKPIKLTDDVTP  79

Query  1481  RVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH--PLVKFLV  1308
             RV+P+    +  +G   + W GP P + I +PE ++EVF  N ++  PKPH  PLV+F+ 
Sbjct  80    RVVPYPFHMLKTHGITYYTWFGPIPTITIMDPEQIKEVF--NNVYDFPKPHTFPLVRFIA  137

Query  1307  SGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNW-CDFD  1131
             +GLA Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++  KW+ L  +    C+ D
Sbjct  138   TGLASYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVV-GKWDKLVLDGGLSCEVD  196

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P+L + T+DVISRTAFG SY EG ++F LQ E +EL  Q     + P +  L +K +R
Sbjct  197   VWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELSELIIQDFRKAFIPGYSYLPTKDNR  256

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKSGFSTDEVIEECQHFY  771
             RM     EI  +++G++ KR    +             LG    +G ST++V+EEC+ F+
Sbjct  257   RMKAAAREILVILRGIVNKRLLAREASDDLLGILLESNLGQDEGNGMSTEDVMEECKLFF  316

Query  770   FAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVL  591
             FAGQE+TS  LVW M++LS HQ WQ RAR+EV+QVFG  KPD +GLN+LK++TMIL EVL
Sbjct  317   FAGQETTSVLLVWTMVMLSQHQDWQARAREEVKQVFGDKKPDAEGLNQLKVMTMILYEVL  376

Query  590   RLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGV  411
             RLYPP    IR +++E K+G++ LP  + + L  LLVQRD ++WG DAGEFKPERF +G+
Sbjct  377   RLYPPVAQLIRAVHKEMKVGDLTLPGGVQISLPILLVQRDTELWGQDAGEFKPERFKDGL  436

Query  410   AKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLK  231
             +KATKN++++ PF WGPR CIG +FA++EAK+A+A ILQRFSF LSPSY H+P  V+T+ 
Sbjct  437   SKATKNQVSYFPFSWGPRICIGQSFALLEAKMAMALILQRFSFELSPSYVHAPYTVMTIH  496

Query  230   PQFGAPLVLHKI  195
             PQFGA L LHK+
Sbjct  497   PQFGAHLTLHKL  508



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   491 bits (1263),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 252/522 (48%), Positives = 352/522 (67%), Gaps = 19/522 (4%)
 Frame = -2

Query  1727  MDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTK  1548
             M+ IQ  V+I    I++   ++W  +V+ WVW  P+KLE  LR+QGL GNSYR+ YGD K
Sbjct  1     METIQMIVTICCCAIAI--TLLW--KVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMK  56

Query  1547  EMATLTAKAKSKPINLSD-DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             ++  +  +A SKP+N+SD D+ PR++PF+   + KYGK CF W GP P+V+I +PEL++E
Sbjct  57    DVTRMIKEANSKPMNMSDHDLAPRMMPFFLETINKYGKKCFTWMGPKPQVLIMDPELIKE  116

Query  1370  VFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCE  1191
             V     L+++P  +PL    V GL  YE  +WA++RKII+PAF+ +K+K M P+   SC 
Sbjct  117   VLSKTYLYQKPGGNPLGSLFVQGLVSYEKDKWAKNRKIINPAFHLEKLKHMLPAFYLSCS  176

Query  1190  EMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTR  1011
             EM + KWE +       + DV P+L+  TSDVISRTAFG SY EG K+F LQNEQ     
Sbjct  177   EM-LSKWEDVEGSH---EIDVWPHLQQLTSDVISRTAFGSSYEEGRKIFELQNEQVPHFI  232

Query  1010  QVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllg  831
             + + SVY P W  L +KR+RRM EI  ++R L++G+I KR + M+    D+++    LL 
Sbjct  233   EAMRSVYIPGWRFLPTKRNRRMKEIKKDVRSLIRGIIDKRLKAMEAGDADNEDLLGILLE  292

Query  830   vlLKS----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQ  681
                K           G S DE+IEEC+ FYFAG E+TS +L+W ++LLS +Q WQ +AR+
Sbjct  293   SNFKEIEQQGGNKDFGMSIDEIIEECKLFYFAGSETTSVWLLWTLVLLSRYQDWQAQARE  352

Query  680   EVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiil  501
             EV QVFG  KPDF+GLNRLK++TMIL E LRLY P     R   E+  LGE+ LP  +++
Sbjct  353   EVLQVFGSRKPDFNGLNRLKVVTMILYESLRLYSPVTTLTRLAIEDITLGEVSLPAGVLV  412

Query  500   ilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEA  321
              L ++++  D ++WG DA +F PERF EG++ ATK ++ + PF WGPR CIG NFAM+EA
Sbjct  413   SLPTVILHHDKEIWGEDANKFNPERFREGISSATKGQVTYFPFSWGPRICIGQNFAMLEA  472

Query  320   KIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             K+A++ ILQ FSF LSPSY H+P + VT++PQ+GAPL+ HK+
Sbjct  473   KMALSMILQTFSFELSPSYTHAPQYSVTVQPQYGAPLIFHKL  514



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   491 bits (1264),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 243/519 (47%), Positives = 349/519 (67%), Gaps = 12/519 (2%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +++  +I+   ISV  ++++  +V+ W W +P+KLEK+LRQQGL GNSYR+ +GD KE +
Sbjct  1     METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  60

Query  1538  TLTAKAKSKPI-NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFM  1362
                 +A+SKPI NLS+DI PR++P++   ++KYGK CFVW GP P ++I E E ++E+F 
Sbjct  61    KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKYGKKCFVWFGPKPMILIMESEQIREIFA  120

Query  1361  NNTLFKRPK-PHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEM  1185
              N ++++P   +P+   L  G+A YE+ +WA+HRKI+ PAF+ +K+K M P+   SC EM
Sbjct  121   KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEM  180

Query  1184  IMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQV  1005
              +K+WE +  ++   + D+ P  +  TSD+ISRTAFG SY EG ++F LQ EQAE+  + 
Sbjct  181   -LKEWEKIVPDERSKELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEIIMKQ  239

Query  1004  IHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEK---------vgddde  852
              +S+Y P    L +K +++M E + E++  ++ LI  R +  +              +  
Sbjct  240   FNSIYIPGSRFLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESN  299

Query  851   enldllgvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQ  672
              N        + G + DEVI EC+ FYFAGQE+TS +LVW MILLS HQ WQ +AR+EV 
Sbjct  300   SNEIEEQGSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQDWQAKAREEVL  359

Query  671   QVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiilils  492
             Q FG ++P FD L+RLKI+TMIL E LRLYPP    IR   EET+LG + LP   ++ + 
Sbjct  360   QAFGSDQPAFDELSRLKIVTMILYESLRLYPPLATRIRRTNEETRLGNLYLPNGSLIFIP  419

Query  491   slLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIA  312
             ++L+  D ++WG DA EFKPERF EGV KATK ++ F PFG GPR CIG+NFAM+EAK+A
Sbjct  420   TILLHHDKEIWGEDAEEFKPERFKEGVLKATKGQMIFFPFGAGPRICIGHNFAMLEAKMA  479

Query  311   IATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +A ILQRF F LSPSY H P  +V L+P+FGAPL+L ++
Sbjct  480   VALILQRFVFELSPSYTHVPHCIVALQPKFGAPLLLQRL  518



>ref|XP_010683652.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=481

 Score =   489 bits (1260),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 238/480 (50%), Positives = 329/480 (69%), Gaps = 11/480 (2%)
 Frame = -2

Query  1604  LRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFV  1425
             LR+QG +GN YR+ YGD KE + +  +A S PI +SDDI+PRV PF H  V  +GKN FV
Sbjct  3     LRKQGFSGNRYRLLYGDMKESSKMAKEAISSPIEISDDIVPRVQPFTHQIVKNFGKNSFV  62

Query  1424  WSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPA  1245
             W GP P V I EP++++EV M    F++P  +P++K  V GL  YE Q+WA+HRKI++PA
Sbjct  63    WFGPVPCVNIMEPQMIKEVLMRYEEFQKPNINPILKMFVKGLVVYEGQKWAKHRKILNPA  122

Query  1244  FYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSY  1065
             F+ +K+K +      SC++MI  KWE + S    C+ DV P L+  +SDVISR AFG SY
Sbjct  123   FHMEKLKDLLGKFYVSCDDMI-SKWEEMVSTTGSCELDVWPCLDNLSSDVISRAAFGSSY  181

Query  1064  VEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRER  885
              EG K+F LQ EQ+ +  ++I  VY P    L +K ++RM+EI+ E+R LM  +I KRE 
Sbjct  182   EEGKKIFKLQKEQSTMAMKLIQQVYIPGLRFLPTKTNKRMNEINKEMRVLMNNIITKREN  241

Query  884   GMKEKvgdddeenldllgvlLK----------SGFSTDEVIEECQHFYFAGQESTSDFLV  735
              MK     +D+    LL   LK          +G + +E++EEC+ FY AG+++TS  LV
Sbjct  242   QMKMGETCNDDLLGILLESSLKEAQEQGYRKNAGLTIEEIVEECKLFYLAGRDTTSVLLV  301

Query  734   WIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRT  555
             W+M+ L  H  WQ RAR+EV +VFG NKPD++GLN LKI+TMI+NEVLRLYPP     R 
Sbjct  302   WLMVRLGKHLDWQARAREEVLRVFGQNKPDYNGLNNLKIVTMIINEVLRLYPPVILMYRM  361

Query  554   MYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLP  375
             +++ TK+G++ LPP + + + ++LV  DP +WG DA EF PERF+EG+AKAT +++ + P
Sbjct  362   IHKPTKIGDILLPPGVQISVPTMLVHNDPKLWGEDATEFNPERFSEGIAKATNSQVIYTP  421

Query  374   FGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             FGWGPR CIG NFAM+E K+A+A ILQR+SF LSPSY+H+P  V+ L+PQ G P++L KI
Sbjct  422   FGWGPRICIGQNFAMLEVKMALAMILQRYSFELSPSYSHAPFLVMNLQPQHGVPMILRKI  481



>ref|XP_006377693.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
 gb|ERP55490.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
Length=518

 Score =   491 bits (1263),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 248/516 (48%), Positives = 345/516 (67%), Gaps = 14/516 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             VS + + I   AV+ WA R++ WVW +P+K+E+ LRQQG  G  YR+ +GD KE + +  
Sbjct  5     VSSILVSIVYVAVLRWAWRLLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKESSDMLK  64

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A++KPI LSD +LPRV+PF H  V  YGKN F+W GP PRV I  P+ +++VFM    +
Sbjct  65    EARTKPIGLSDALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIKDVFMKINEY  124

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P  HPL+K +  GL  +E ++W+ HRKII+PAF+ +KIK M P+   SC  MI  KWE
Sbjct  125   QKPS-HPLLKAIACGLPSHEGEKWSNHRKIINPAFHQEKIKLMIPAFYESCSGMI-NKWE  182

Query  1166  LLTS-EKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVI-HSV  993
              L S ++  C+ DV P L+  T D ISRT+FG +Y EG ++F L  E  +LT  VI  ++
Sbjct  183   KLVSIDEGSCELDVWPDLQGLTCDAISRTSFGSNYEEGKRIFDLLKELTDLTVHVIIKAI  242

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
               P +  L    +RR+  ID EI+  +  LI KRE+ M       ++    LL    +  
Sbjct  243   VIPGYRFLPIPSNRRLKAIDKEIKASLNALINKREQAMSAGEDAKNDLLGLLLESNFREI  302

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S ++VI+EC+ FYFAGQE+T+  L W M+LL+ +  WQ RAR+EV QVF
Sbjct  303   QEHGNTKSVGMSIEDVIDECRIFYFAGQETTTVLLTWTMVLLAQYPNWQARAREEVVQVF  362

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPDFDGLN LK++TMI  EVLRLYPP     R ++EE KLG + LP  + + + ++L
Sbjct  363   GNKKPDFDGLNHLKVVTMIFYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQVSVPTIL  422

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             + +D ++WG DA EFKP RFAEGV+KATK++++FLPFGWGPR C+G NFA++EAK+A+A 
Sbjct  423   LHQDHELWGDDASEFKPGRFAEGVSKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAM  482

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQR SF LSPSY H+P  V+TL+PQ GAP++L K+
Sbjct  483   ILQRCSFELSPSYIHAPRTVITLQPQHGAPMILRKL  518



>ref|XP_004294188.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=521

 Score =   491 bits (1263),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 260/521 (50%), Positives = 355/521 (68%), Gaps = 19/521 (4%)
 Frame = -2

Query  1718  IQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             + SWV++  +F+S+  +V WA  V+ W+WLKP+KLE+ LR+QGL GNSYR+F+GD KE +
Sbjct  5     VASWVALSLVFVSI--IVRWAWSVLDWLWLKPKKLERCLREQGLQGNSYRIFHGDMKENS  62

Query  1538  TLTAKAKSKPINLSD--DILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVF  1365
              +  +AKSKP+ LS   DI  R +PF +  V  YG N FVW GP PRV I +PE +++VF
Sbjct  63    VMLTQAKSKPMILSSSHDIASRFIPFLNQTVKTYGTNSFVWMGPTPRVNIMDPEDVKDVF  122

Query  1364  MNNTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEM  1185
                  F+RP  +PL+K L++GLA YED++WA+HR+II+P F+ +K+K M P+   SC+EM
Sbjct  123   TKLEDFRRPS-NPLMKLLITGLASYEDEKWAKHRRIINPTFHVEKLKRMLPAFHQSCDEM  181

Query  1184  IMKKWELLTSEK-NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQ  1008
             I K+WE   S++ + C+ DV P L+  T+D ISRTAFG SY+EG K+F L  EQ   T +
Sbjct  182   I-KEWESCVSKQGSSCELDVWPSLQNLTADAISRTAFGSSYLEGRKIFKLIKEQTAHTIK  240

Query  1007  VIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgv  828
              + SVY P W  L +K + RM +ID E+ GL+KG+I KRE+ +       D+    L+  
Sbjct  241   SVQSVYIPGWRFLPTKMNNRMKQIDKELTGLLKGIINKREQAINAGEATKDDLLGALMES  300

Query  827   lLKS-----------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQ  681
              L+            G S ++VI EC+ FY+AGQESTS  LVW ++LL  +Q WQDRARQ
Sbjct  301   NLREIQEHGKNDKDVGMSIEDVIGECKLFYYAGQESTSVLLVWTVVLLGQNQIWQDRARQ  360

Query  680   EVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiil  501
             EV QVFG NKP+FDGL  LK++TMI  EVLRL+P      RT  +  +L +  LP  + +
Sbjct  361   EVLQVFGSNKPEFDGLTHLKVVTMIQLEVLRLFPALVVLSRTTNKTIQLKKFSLPAGVEV  420

Query  500   ilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEA  321
              LS+L + RD ++WG DA EFKPERF+EGV+KATK+  +++PFG GPR CIG NFA+ EA
Sbjct  421   GLSTLHIHRDKELWGNDANEFKPERFSEGVSKATKSPFSYIPFGGGPRICIGQNFALTEA  480

Query  320   KIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHK  198
             K+AIA ILQ F+F LSPSYAH+P     +KPQ+G P++L K
Sbjct  481   KLAIALILQHFTFELSPSYAHAPA-APMIKPQYGVPIILQK  520



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   490 bits (1262),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 241/507 (48%), Positives = 343/507 (68%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             I V  ++++  RV+ W W KP+KLEK+LR+ GL GN Y++FYGD  E+     +A+SKPI
Sbjct  12    ICVAILLVYTLRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEITNKLNEARSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR-PKPH  1329
             N SDDI  R++PF+  ++ K GK+ FVW GP P V+I++PE ++E+F  N ++++   P+
Sbjct  72    NFSDDIAQRLIPFFIDSINKNGKSSFVWQGPCPIVLITDPEHVKEIFTKNYVYQKDTHPN  131

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  KFL  G+   E+ +WA+HRKII+P F  +K+K M P+   SC EMI  KWE +  ++
Sbjct  132   PFSKFLAVGILKLEENKWAKHRKIINPVFQVEKLKHMLPAFYQSCSEMI-SKWEDIVPKE  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L+  T+++ISRTAFG S+ EG  VF LQ EQAE   ++  ++Y P    L
Sbjct  191   TSVELDVWPDLQLMTAEIISRTAFGSSFEEGRIVFELQKEQAEHVMEISRTIYIPGSRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR++RM EI+ +++  ++ +I KR R M+      ++    LL   +K          
Sbjct  251   PTKRNKRMLEIEKQVQTTIRHIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKDF  310

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +T EVI+EC+ FYFAGQE+T+  LVW MILL +H  WQ RAR+E  QVFG+ KP+ +G
Sbjct  311   GMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQVFGNEKPNLEG  370

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             L+RLKI+T+IL+E LRL+PP     R    E KLGE+ LP  ++L + ++L+  D ++WG
Sbjct  371   LSRLKIVTIILHETLRLFPPVATYRRRNKHEVKLGELSLPAGVLLFIPTVLIHYDKELWG  430

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+KATK   +F+PF  GPR CIG NFAMMEAK+AIA ILQ+FSF L
Sbjct  431   EDANEFKPERFSEGVSKATKGHFSFIPFSGGPRVCIGQNFAMMEAKLAIAMILQKFSFEL  490

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P   +T+ PQ+GAPL++ K+
Sbjct  491   SPSYTHAPSSTITIHPQYGAPLLMRKL  517



>ref|XP_008386384.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=511

 Score =   490 bits (1261),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 246/512 (48%), Positives = 337/512 (66%), Gaps = 14/512 (3%)
 Frame = -2

Query  1691  LFISVPAVVIWAC--RVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAK  1518
             + +S+  V + A   +VV W+WLKP+K E+ LRQQGL+GNSYR+  GD  + + +T  A 
Sbjct  1     MVVSIVCVGLIALGWKVVNWIWLKPKKFERHLRQQGLSGNSYRLLIGDLNDNSKMTKAAL  60

Query  1517  SKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRP  1338
             SKP+ LS DI+P VLP  H    KYG+  FVW GP P VI+ + ELM+E F    ++++P
Sbjct  61    SKPMELSHDIVPYVLPLLHDIFNKYGRKSFVWLGPMPSVILFDAELMREAFTKYRVYEKP  120

Query  1337  KPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLT  1158
               +PL+  L +GL  +E  +W +HR+II+PAF+ +K+K M P+  ++ E M + KWE+L 
Sbjct  121   HSNPLISLLATGLVGHEGDKWVKHRRIINPAFHVEKMKDMLPAFHAASENM-LSKWEMLF  179

Query  1157  SEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEW  978
             S K  C+ DV PYL AF  DVISR AFG ++ EG + F LQ EQA   R V+ SVY P +
Sbjct  180   SSKGTCEVDVWPYLCAFAGDVISRAAFGCNFEEGQRFFQLQKEQAAFIRIVLDSVYIPFF  239

Query  977   WLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS------  816
               L +K +RRM +I  E+  L++G+I KRE+ M+     +D+    LL            
Sbjct  240   RFLPTKMNRRMKQIAKEMDTLLRGIINKREKAMRAGEATEDDLLGILLKSNFNEIQEHAN  299

Query  815   ----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKP  648
                 G S +EVIEEC+ FY AG+E+T D + W ++LL  +Q WQ RAR+EV  +F +NKP
Sbjct  300   DKDVGMSIEEVIEECKLFYLAGEETTRDLINWTLVLLGKYQDWQMRAREEVVTIFKNNKP  359

Query  647   DFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDP  468
             D+ GL  LKI+ MIL EVLRLYP   +TIR + +ETKLG++ LPP   L +  L V  D 
Sbjct  360   DYAGLKCLKIVNMILYEVLRLYPSVSFTIREITKETKLGDISLPPGTQLAVPILFVHHDK  419

Query  467   DVWGADAGEFKPERFAEGVAKATKNRL-AFLPFGWGPRTCIGNNFAMMEAKIAIATILQR  291
             ++WG D  EFKPERF+EG++KATKN++ AF PF  GPRTCIG NFAM+E K  I  ILQR
Sbjct  420   EIWGDDVHEFKPERFSEGISKATKNQVAAFFPFSTGPRTCIGQNFAMIEVKTIITMILQR  479

Query  290   FSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             F+F LSP+Y HSP  ++TL+PQ+G P++  KI
Sbjct  480   FTFELSPAYRHSPSNILTLEPQYGTPIIFQKI  511



>emb|CAN72865.1| hypothetical protein VITISV_029731 [Vitis vinifera]
Length=502

 Score =   489 bits (1259),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 246/514 (48%), Positives = 349/514 (68%), Gaps = 30/514 (6%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V++ F FI++   +I+A R++ W+WL+P++LE+ L+QQGL GNSYR+ +GD KEM  +  
Sbjct  9     VALSFAFITI---LIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIK  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A S+PI++SDDI+ R+ PF++ ++ KYGK+ F+W GP PRV I EPEL+++V   +T+F
Sbjct  66    EATSRPISISDDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P+ H LVK LVSGL   + ++WA+HRKII+PAF  +K+K               K+  
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKVKRHD------------KQMG  173

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
             L++     C+ DV PYL+  T D ISRTAFG +Y +G  +F LQ EQA+L  Q   S + 
Sbjct  174   LVS-----CELDVWPYLQNLTGDAISRTAFGSNYEKGRMIFELQREQAQLLVQFSESAFI  228

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---  816
             P W    +K ++RM +I  E+  L+ G+I KR + MK     +D+    LL    K    
Sbjct  229   PGWRFXPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQE  288

Query  815   -------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGH  657
                    G S  +VIEEC+ FYFAG E+TS  L+W M+LLS H  WQ RAR+E+  VFG+
Sbjct  289   HENDKNVGMSIKDVIEECKLFYFAGXETTSALLLWTMVLLSKHPNWQARAREEILHVFGN  348

Query  656   NKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQ  477
             NKP+ DGLN LKI+ MIL+EVLRLYPP P+  R++YE+ ++G+M LP  + + L ++LV 
Sbjct  349   NKPEGDGLNHLKIVMMILHEVLRLYPPVPFLARSVYEDIQVGDMYLPAGVDVSLPTILVH  408

Query  476   RDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATIL  297
              D ++WG DA EF PERF++GV KA K+ ++F PFGWG ++CIG NFA++EAK+ +A IL
Sbjct  409   HDHEIWGEDAREFNPERFSQGVLKAMKSPVSFFPFGWGSQSCIGQNFAILEAKMVLAMIL  468

Query  296   QRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             QRFSF LSPSY+H+P  +VTL PQ+GA L LH I
Sbjct  469   QRFSFSLSPSYSHAPSSLVTLIPQYGAHLXLHGI  502



>ref|XP_010926817.1| PREDICTED: cytochrome P450 72A15-like isoform X3 [Elaeis guineensis]
Length=519

 Score =   490 bits (1261),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 244/523 (47%), Positives = 346/523 (66%), Gaps = 19/523 (4%)
 Frame = -2

Query  1730  TMDRIQSWVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDT  1551
             +++ + + V +LFL       ++WA R ++WVW +PR+LE  LR QGL+G  YR  YGD 
Sbjct  5     SLEMVGAVVGVLFL-------LVWAVRALEWVWWRPRRLEGLLRAQGLSGTRYRFLYGDL  57

Query  1550  KEMATLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQE  1371
             K+   L   A+SKP+ LS  I PRVLPF+H A+  +GK  F W GP P VI+ +PEL++E
Sbjct  58    KDNVRLQKAARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPTVILKDPELVRE  117

Query  1370  VFMNN-TLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSC  1194
             V  N    F++P  +PL K L  G+A YE ++WA+HR+II+PAF+ +K+K M P+  + C
Sbjct  118   VLSNKFGHFEKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFHLEKLKHMFPTFATCC  177

Query  1193  EEMIMKKWELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELT  1014
             +E+I  +W+     + +C+ DV P  + FT DVISR AFG S+ EG ++F LQ EQ EL 
Sbjct  178   DELI-NRWDNHVGSQAYCELDVWPEFQNFTGDVISRVAFGSSFKEGQRIFQLQEEQMELL  236

Query  1013  RQVIHSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldll  834
              Q   ++Y P +  L +K++ RM+EI  EIR L+  +I +RER M++    +D+    L+
Sbjct  237   VQAAQNIYIPGYRFLPTKKNNRMYEIYREIRALLSRMIEQRERAMRKSGATNDDLLGLLI  296

Query  833   gvlLK----------SGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRAR  684
                L+          +G + D+VIEEC+ FYFAG ++T   L W +++L +H +WQ RAR
Sbjct  297   ESNLRYSQEQGGSKNTGMTKDDVIEECKLFYFAGHKTTLVLLTWTVVILGMHPSWQARAR  356

Query  683   QEVQQVFGHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNii  504
             +EV QV+G NKPD+DGL++L+I+TM+L EVLRLYP   + +R  Y+E KLG+   PP + 
Sbjct  357   KEVLQVYGKNKPDYDGLSQLRIVTMVLYEVLRLYPAITFLVRRTYKEMKLGDFTFPPGVQ  416

Query  503   lilsslLVQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMME  324
             L+L  L +  DP  WG DA EF PERFA GV+KA+K +  F PFG GPR CIG NFAMME
Sbjct  417   LLLPLLFIHHDPQFWGDDATEFNPERFASGVSKASKIQGTFFPFGGGPRICIGQNFAMME  476

Query  323   AKIAIATILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             AK+A+A ILQ FS   S SYAH+P  V+TL PQ+GA ++LH++
Sbjct  477   AKMALARILQHFSLEPSSSYAHAPYTVITLHPQYGAQIMLHRL  519



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   490 bits (1261),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 250/512 (49%), Positives = 332/512 (65%), Gaps = 11/512 (2%)
 Frame = -2

Query  1700  ILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKA  1521
             I  LF++  A +  A  V+ WVW KP+K+EK L++QGL GN YR+ YGD KEM     KA
Sbjct  9     IWLLFVTGAAALYVAYEVLNWVWFKPKKIEKQLQEQGLKGNPYRLLYGDLKEMQKTLKKA  68

Query  1520  KSKPI-NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFK  1344
              S+P+   S    PRV+P Y   V KYGKN + W GP   VI+ +PE ++EV +   +F 
Sbjct  69    CSQPVKGFSHAFEPRVIPLYQDVVHKYGKNGYAWFGPEASVIVMDPESIKEVTLKYDVFN  128

Query  1343  RPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWEL  1164
             +P  +PL K L+ G+  YE  +W +HRKII+PAF+ DK+K M PS  +S  E +   W+ 
Sbjct  129   KPHSNPLSKLLLRGVVSYEGDKWVKHRKIINPAFHQDKLKHMLPSFHTSAMETV-SIWDA  187

Query  1163  LTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSP  984
             + +EK   + DV PYL+  TSD ISRTAFG +Y EG ++F LQ EQAEL    + S+Y P
Sbjct  188   MVAEKGSTEVDVLPYLQTLTSDAISRTAFGSNYEEGKRIFELQREQAELVVIALRSLYIP  247

Query  983   EWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS----  816
              W  L +K +RRM  I   +   +  ++ +R + M+  V  +D+    LL    K     
Sbjct  248   GWRFLPTKMNRRMKSISKVVNNSIGIIVSERIKAMEAGVACEDDLLGTLLESNFKEMDEH  307

Query  815   -----GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNK  651
                  G S  +VIEEC+ FYFAGQE+TS  LVW M+LLS +  WQ  AR+EV Q FG  K
Sbjct  308   GKKEVGLSIQDVIEECKLFYFAGQETTSTLLVWTMVLLSKYSHWQTLAREEVLQHFGTKK  367

Query  650   PDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRD  471
             PD+DGL+ LK ++MIL EVLRLYPP P   R   +E KLG+M LP   +L L  +L+ RD
Sbjct  368   PDYDGLHHLKTVSMILYEVLRLYPPVPVIARRSTQEIKLGKMTLPAGGLLSLPIMLLHRD  427

Query  470   PDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQR  291
              ++WG DA EFKPERFA+GV+ ATK ++ F PFGWGPR CI  NFA++EAK+A+A ILQR
Sbjct  428   TELWGEDALEFKPERFADGVSHATKGQVIFFPFGWGPRICIAQNFALLEAKMAMALILQR  487

Query  290   FSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             FSF LSPSY H+P  ++TL+PQ+GA L+LHKI
Sbjct  488   FSFELSPSYTHAPISIITLRPQYGAHLILHKI  519



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   489 bits (1260),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 345/507 (68%), Gaps = 11/507 (2%)
 Frame = -2

Query  1685  ISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPI  1506
             ISV  ++++  +V+ W W KP+KLEK+LR+ GL GN Y++ YGD KE+     +AKSKPI
Sbjct  12    ISVAILLVYTWKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELTNKLNEAKSKPI  71

Query  1505  NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKR-PKPH  1329
             + S D+  R++PF+  ++ K GK+ F+W GP P V+I++PE ++E+   N +++R   P+
Sbjct  72    HFSGDVPQRLIPFFCDSINKNGKSSFMWLGPYPVVLITDPEHVKEILTKNYVYQRQTHPN  131

Query  1328  PLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK  1149
             P  K L  GLA  E+ +WA+HRKII PAF  +K+K M P+   SC EMI  KWE +  ++
Sbjct  132   PFAKKLALGLAKLEEDKWAKHRKIIQPAFQLEKLKHMLPAFYQSCSEMI-SKWEEIIPKE  190

Query  1148  NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLL  969
                + DV P L+  T++VISRTAFG SY EG  VF LQ EQAE    +I SVY P    L
Sbjct  191   TSFELDVWPDLQLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVINIIRSVYIPGTRFL  250

Query  968   SSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS---------  816
              +KR++RM EI+ +++  ++ +I KR R M+      D+    LL   ++          
Sbjct  251   PTKRNKRMLEIEKQVQTTIRRIIDKRLRAMEAGETSKDDLLGILLESNMREIEQHRSKDF  310

Query  815   GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
             G +T E+IEEC+ FYFAGQE+ S  LVW MILLS+H  WQ RAR+EV QVFG+ KP+ +G
Sbjct  311   GITTIEMIEECKLFYFAGQETASVLLVWTMILLSLHPEWQARAREEVLQVFGNEKPNSEG  370

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             L+ LKI+TMIL+E LRL+P  P   R    E KLGE+ LP  ++LI+ ++L+  D ++WG
Sbjct  371   LSHLKIMTMILHETLRLFPSVPTYRRRNKHEVKLGELSLPAGVLLIIPTILIHYDKELWG  430

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EFKPERF+EGV+KATK +++F+PFG GPR CIG NFAMMEAK+AIA ILQ+FSF L
Sbjct  431   EDAKEFKPERFSEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKFSFEL  490

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY H+P   + + PQ+GAPL+L K+
Sbjct  491   SPSYTHAPLVTINIHPQYGAPLLLRKL  517



>gb|KEH38469.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=516

 Score =   489 bits (1259),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/516 (48%), Positives = 344/516 (67%), Gaps = 15/516 (3%)
 Frame = -2

Query  1709  WVSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLT  1530
             WVS + L I V   +IWA +V+  +WL+P+KLEK LR+QG  GNSYR+  GD K++  + 
Sbjct  3     WVSGIILII-VTLGLIWAWKVLSLLWLRPKKLEKLLREQGFQGNSYRILLGDIKDLFKME  61

Query  1529  AKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTL  1350
              +AKSK +NLSDDI PRV+P+   +V  +GKN ++W G  PRV ++EPE +++V   N +
Sbjct  62    KEAKSKSMNLSDDITPRVIPYIQHSVKIHGKNSYIWFGIKPRVTLTEPEQIKDVL--NKM  119

Query  1349  FKRPKP-HPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              + PKP + + K L + LA YE ++W++HRK+I+PAF+ +K+K M P+  +SC ++I  K
Sbjct  120   SEFPKPNYKIFKLLANALANYEGEKWSKHRKLINPAFHLEKLKIMTPAFFTSCNDLI-NK  178

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE + S    C+ D+ P L+   SD ISRTAFG SY EG ++F LQ EQAEL  +V+   
Sbjct  179   WEKMLSSDGSCEIDIWPSLQNLASDAISRTAFGSSYEEGKRIFQLQREQAELIVKVVTKS  238

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKS-  816
               P W  L +   R+M++ID EI   +K +I KRE+ +K      ++    LL    K  
Sbjct  239   IIPLWMFLPTIVHRKMNKIDKEITSSLKDMINKREKALKAGEPTRNDLLSILLESNRKEI  298

Query  815   ---------GFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVF  663
                      G S D+V+EEC+ F+FAGQE+TS  LVW MILLS +  WQ RAR+EV  VF
Sbjct  299   DENENNKDVGMSLDDVVEECKLFHFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLHVF  358

Query  662   GHNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslL  483
             G+ KPDFDGLN LKI+TMIL EVLRLYPP     R + ++ KLG + LP  + + L  LL
Sbjct  359   GNRKPDFDGLNNLKIVTMILYEVLRLYPPVIGLARNVEKDVKLGNLTLPAGVEIFLPILL  418

Query  482   VQRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIAT  303
             +  D ++WG DA  F PERF  G++KAT  R++F PFGWGPR CIG NF++MEAK+A+  
Sbjct  419   IHHDCELWGDDAKMFNPERFFGGISKATNGRVSFFPFGWGPRICIGQNFSLMEAKMAMTL  478

Query  302   ILQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             ILQ FSF LSP+YAH+P  ++TL+PQ+GA +++ K+
Sbjct  479   ILQHFSFELSPTYAHAPSSMITLQPQYGAHIIIRKL  514



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   489 bits (1258),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 252/502 (50%), Positives = 342/502 (68%), Gaps = 15/502 (3%)
 Frame = -2

Query  1670  VVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDD  1491
             V +W  +V+ WVW +P+KLEK LR+QGLNGNSYR+ YGD K+ + +  +A SKP+NLS+D
Sbjct  17    VCLW--KVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSKMIKEANSKPMNLSND  74

Query  1490  ILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHPLVKFL  1311
             I PR++PF+   + KYGK  F+W  P P+V+I +PEL++EVF  N  +++P  +P    L
Sbjct  75    ITPRLVPFFLETIKKYGKKSFIWLCPKPQVLIMDPELIKEVFSKNYFYQKPHGNPFAALL  134

Query  1310  VSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKNWCDFD  1131
             V GLA YE+ +WA+HRKII+PAF+ +K+K M P+   SC EM + KWE   + +  C+ D
Sbjct  135   VQGLAAYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCSEM-LSKWE--DAVEGSCEID  191

Query  1130  VQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKRSR  951
             V P+L+  T DVISRTAFG SY EG K+F LQ EQA+     + SV  P W  L +KR+R
Sbjct  192   VWPHLQQLTCDVISRTAFGSSYEEGRKIFELQREQAQHFIDTVRSVNIPRWRFLPTKRNR  251

Query  950   RMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvl----------LKSGFSTD  801
             RM EI NE+R  MKG+I KR + MK     D+E+ L +L                G S +
Sbjct  252   RMKEIKNEVRTSMKGIIDKRMKAMKAGHDADNEDLLGVLLESNFKEIEQHGNKDFGMSIE  311

Query  800   EVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLK  621
             EVIEEC+ FYFAGQE+ +  LVW ++LLS +Q WQ +AR+EV QVFG  KPDFDGLN LK
Sbjct  312   EVIEECKLFYFAGQETIAVLLVWTLVLLSRYQDWQTQAREEVLQVFGSRKPDFDGLNHLK  371

Query  620   ILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGE  441
             ++TMIL E LRLY P     R   E+T L E+ LP ++++ L ++++  D D+WG DA +
Sbjct  372   VVTMILYESLRLYSPLFTHNRQASEDTVLVELCLPADVLVSLPTIILHHDKDIWGEDANK  431

Query  440   FKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYA  261
             F PERF EG++ AT  ++ + PF WGPR CIG NFAM+EAK+ +  ILQ FSF LSPSY 
Sbjct  432   FNPERFREGISSATMGKVTYFPFSWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYT  491

Query  260   HSPCFVVTLKPQFGAPLVLHKI  195
             H+P  ++T+ PQ+GAPL+ HK+
Sbjct  492   HAPQPLLTIHPQYGAPLIFHKL  513



>ref|XP_010487267.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=547

 Score =   490 bits (1261),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 250/513 (49%), Positives = 343/513 (67%), Gaps = 12/513 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVV----IWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMA  1539
             +S+  + ISV  VV    +W  R +QWVW KP+ LE +LR+QGL G SY    GD K   
Sbjct  38    ISVASVTISVAVVVTSWLVW--RALQWVWFKPKMLESYLRRQGLPGTSYTPLVGDVKRNF  95

Query  1538  TLTAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMN  1359
             ++  +A+SKPINL+DDI PRV+P     +  +G+  F W GP P + I +PE ++EVF  
Sbjct  96    SMLTEARSKPINLTDDITPRVMPHPLQMLKTHGRTYFSWFGPVPIITIMDPEQIKEVFNK  155

Query  1358  NTLFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIM  1179
                F++P   PL   +  GLA Y+  +WA+HR+II+PAF+ +KIK M P+   SC E ++
Sbjct  156   VYDFQKPHTFPLATLIAKGLANYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSE-VL  214

Query  1178  KKWELLTSEK-NWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVI  1002
              +WE L S+K + C+ DV P L + T+DVISRTAFG SY EG ++F LQ E A+L  Q  
Sbjct  215   GEWEKLVSDKGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAF  274

Query  1001  HSVYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldll  834
                  P +  L +K +RRM     EI+ +++G++ KR    E G               L
Sbjct  275   RKAIIPGFSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNL  334

Query  833   gvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHN  654
             G    +G ST++++EEC+ FYFAGQE+TS  LVW M+LLS HQ WQ RAR+EV+QVFG  
Sbjct  335   GQTKGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  394

Query  653   KPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQR  474
             +PD +GLN+LK++TMIL EVLRLYPP     R +++E KLG++ LP  + + L  LLVQR
Sbjct  395   EPDAEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQR  454

Query  473   DPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQ  294
             D ++WG DAGEFKPERF +G++KATK++++F PF WGPR CIG NFAM+EAK+A+A ILQ
Sbjct  455   DTELWGKDAGEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  514

Query  293   RFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             +FSF LSPSY H+P  ++T+ PQFGA L+L K+
Sbjct  515   KFSFELSPSYLHAPYTIITIHPQFGAQLILQKL  547



>emb|CDY51036.1| BnaA06g02990D [Brassica napus]
Length=512

 Score =   488 bits (1257),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/498 (49%), Positives = 333/498 (67%), Gaps = 10/498 (2%)
 Frame = -2

Query  1667  VIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPINLSDDI  1488
             ++W  R ++WVW KP+ LE +LR+QG+ G  Y    GD +   +++ +A+SKPI L+DDI
Sbjct  18    LLWIWRTLKWVWFKPKMLESYLRRQGIAGTPYTPLVGDMRRDNSMSKEARSKPIKLTDDI  77

Query  1487  LPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPH--PLVKF  1314
             + RVLPF    +  YG   F W G  P + I++PE ++EVF  N ++  PKPH  PL   
Sbjct  78    ISRVLPFPSHMLKTYGMTFFTWRGTIPSITITDPEQIKEVF--NKVYDFPKPHTFPLTNL  135

Query  1313  LVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEK-NWCD  1137
             ++SGL  Y+  +WA+HR+II+PAF+ +KIK M P    SC E++  KW+ + S+K + C+
Sbjct  136   IISGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPVFHQSCNEVV-DKWDKMVSDKGSSCE  194

Query  1136  FDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLSSKR  957
              DV P L + T DVISRTAFG SY EG ++F LQ E A+L  Q     Y P +  L +K 
Sbjct  195   VDVWPGLMSITEDVISRTAFGSSYKEGQRIFELQTELAQLIIQAFRKSYIPGYRYLPTKD  254

Query  956   SRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgvlLKSGFSTDEVIE  789
             +RR+     E   +++GL+ KR    E G               LG    +G S D+VIE
Sbjct  255   NRRIKAAAKETHDILRGLVNKRLRAREAGEAPNEDLLGILLESNLGQAKGNGMSIDDVIE  314

Query  788   ECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLNRLKILTM  609
             EC+ FYFAGQE+TS  LVW MILLS HQ WQ RAR+EV+QVFG  +P+ +GLN LKI+TM
Sbjct  315   ECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPNTEGLNHLKIMTM  374

Query  608   ILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWGADAGEFKPE  429
             I+NEV+RLYPP     RT+++E KLG++ LP  + + L  +LVQRD  +WG DA EFKPE
Sbjct  375   IINEVIRLYPPVTQLSRTIHKEMKLGDLTLPGGVQINLPIMLVQRDTQLWGNDAAEFKPE  434

Query  428   RFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLSPSYAHSPC  249
             RF +GV+KATK++++F PF WGPR CIG NFA++EAK+A+A ILQRFSF LSP+Y H+P 
Sbjct  435   RFEDGVSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPTYVHAPY  494

Query  248   FVVTLKPQFGAPLVLHKI  195
              V TL PQ+GA L+LHK+
Sbjct  495   TVFTLHPQYGAHLILHKL  512



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   488 bits (1257),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 242/511 (47%), Positives = 341/511 (67%), Gaps = 8/511 (2%)
 Frame = -2

Query  1706  VSILFLFISVPAVVI--WACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATL  1533
             +S+  + ISV   V+  W  R +QWVW KP+ LE +LR+QGL G  Y    GD K   ++
Sbjct  3     ISVASVTISVAIAVVSWWIWRTLQWVWFKPKMLESYLRRQGLVGTPYTPLVGDLKRNFSM  62

Query  1532  TAKAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNT  1353
              A+A+SKPINL+DDI PR++P+       YG+  + W GP P + I +PE ++EVF    
Sbjct  63    LAEARSKPINLTDDITPRIVPYPLQMFKTYGRTFYTWLGPIPTITIMDPEQIKEVFNKVY  122

Query  1352  LFKRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
              F++    PL + + +GL  Y+  +WA+HR+II+PAF+ +KIK M P+   SC E++  +
Sbjct  123   DFQKSHTFPLARLIAAGLVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHRSCSEVV-GQ  181

Query  1172  WELLTSEKNW-CDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHS  996
             W+ L S+K   C+ D+ P L + T+DVISRTAFG SY EG ++F LQ E A+L  Q    
Sbjct  182   WDKLVSDKGLSCEVDIWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRK  241

Query  995   VYSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKR----ERGMKEKvgdddeenldllgv  828
              + P +  L +K +RRM     EI+ +++G++ KR    E G               L  
Sbjct  242   AFIPGFSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLRQ  301

Query  827   lLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKP  648
                +G ST++++EEC+ FYFAGQE+TS  LVW MILLS HQ WQ RAR+EV+QVFG  +P
Sbjct  302   TEGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEP  361

Query  647   DFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDP  468
             D +GLN+LK+++MIL EVLRLYPP     R +++E KLG++ LP  + + L  LLVQRD 
Sbjct  362   DAEGLNQLKVMSMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDT  421

Query  467   DVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRF  288
             ++WG DA EFKPERF +G++KATK++++F PF WGPR CIG NFA++EAK+A+A IL+RF
Sbjct  422   ELWGNDAAEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILKRF  481

Query  287   SFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SF LSPSY H+P  V+T+ PQFGA L++HK+
Sbjct  482   SFELSPSYVHAPYTVITIHPQFGAQLIMHKL  512



>ref|XP_006364093.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=536

 Score =   489 bits (1259),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 345/506 (68%), Gaps = 14/506 (3%)
 Frame = -2

Query  1682  SVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTAKAKSKPIN  1503
             ++  V+ W  R++ +VW KP+KLEK LRQQG  GNSY++ YGD KEM  +  +A SKPI+
Sbjct  35    AIIFVLRWTWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIEEATSKPID  94

Query  1502  LSDDIL-PRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLFKRPKPHP  1326
              S D++ PR+ PF H  +T YGKNCFVW GP P V+I+EP+L++EV   N ++ + +  P
Sbjct  95    FSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIREVLTKNYVYHKARGSP  154

Query  1325  LVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWELLTSEKN  1146
             L K ++SGLA +E  +WA HR+I++PAF+ DK+K M P+   +  EM +  W+ + S K+
Sbjct  155   LSKLVISGLAGHEKDKWATHRRILNPAFHLDKLKHMLPAFKLTVNEM-LNTWKKVVS-KD  212

Query  1145  WCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYSPEWWLLS  966
               + DV PYL+  TSD ISRTAFG +Y EG K F LQ EQ EL   +I+ +    +  + 
Sbjct  213   GTEIDVWPYLQTLTSDAISRTAFGSNYEEGKKNFELQKEQIELILTIINVIMIMNYRFVP  272

Query  965   SKRSRRMHEIDNEIRGLMKGLIGKRERGMKE--------KvgdddeenldllgvlLKSGF  810
             +K+++RM +I  E++ L+ G+I KR R ++          +               K G 
Sbjct  273   TKKNKRMMQIFYEVKALILGIINKRMRMIEAGESHDDLLSILLTSNLKEIQQHGNKKFGM  332

Query  809   STDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDGLN  630
             S DEVIEEC+ FYFAGQE+TS  LVW MILL  +  WQ+RAR+EV QVF  ++ D+D LN
Sbjct  333   SIDEVIEECKLFYFAGQETTSTLLVWTMILLCKYPIWQERAREEVLQVFASDELDYDKLN  392

Query  629   RLKILTMILNEVLRLYPPSPYTI-RTMYEETKLGEMKLPPNiililsslLVQRDPDVWGA  453
             +LK++TMILNEVLRLY  S YTI R +  ETKLG++ LP  + LIL+++LV  D ++WG 
Sbjct  393   QLKVVTMILNEVLRLYT-SAYTINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEIWGD  451

Query  452   DAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHLS  273
             DA EFKPERF+EG++KATK ++ F PF WGPR CIG NFAM+EAK+A+  IL+ ++F LS
Sbjct  452   DAMEFKPERFSEGISKATKGQVVFFPFSWGPRICIGQNFAMLEAKMAMVMILKYYAFELS  511

Query  272   PSYAHSPCFVVTLKPQFGAPLVLHKI  195
             PSYAH+P   + L+PQ+GA L++HK+
Sbjct  512   PSYAHAP-HPLLLQPQYGAQLIMHKL  536



>emb|CBI22131.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   487 bits (1253),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/507 (48%), Positives = 338/507 (67%), Gaps = 43/507 (8%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             V++ F FI++   +I+A R++ W+WL+P++LE+ L+QQGL GNSYR+ +GD KEM  +  
Sbjct  9     VALSFAFITI---LIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIK  65

Query  1526  KAKSKPINLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTLF  1347
             +A S+PI++SDDI+ R+ PF + ++ KYGK+ F+W GP PRV I EPEL+++V   +T+F
Sbjct  66    EASSRPISISDDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  1346  KRPKPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKKWE  1167
             ++P+ H LVK LVSGL   + ++WA+HRKII+PAF  +K+K M P+   SC +MI  KWE
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMI-SKWE  184

Query  1166  LLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSVYS  987
                S +  C+ DV PYL+  T D ISRTAFG +Y EG  +F LQ EQA+L  Q   S + 
Sbjct  185   GKLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFI  244

Query  986   PEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKEKvgdddeenldllgvlLKSGFS  807
             P W  L +K ++RM +I  E+  L+ G+I KR + MK                       
Sbjct  245   PGWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMK-----------------------  281

Query  806   TDEVIEECQHFYFAGQE---STSDFLVWIMILLSIHQTWQDRARQEVQQVFGHNKPDFDG  636
                          AG+         L+W M+LLS H  WQ RAR+EV  VFG+NKP+ DG
Sbjct  282   -------------AGETLNDDLLVLLLWTMVLLSKHPNWQARAREEVLHVFGNNKPEGDG  328

Query  635   LNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLVQRDPDVWG  456
             LN LKI+ MIL+EVLRLYPP P   RT+YE+ ++G+M LP  + + L ++LV  D ++WG
Sbjct  329   LNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHHDHEIWG  388

Query  455   ADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATILQRFSFHL  276
              DA EF PERF++GV KATK+ ++F PFGWG R CIG NFA++EAK+ +A ILQRFSF L
Sbjct  389   EDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAMILQRFSFSL  448

Query  275   SPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             SPSY+H+PC +VTLKPQ+GA L+LH I
Sbjct  449   SPSYSHAPCSLVTLKPQYGAHLILHGI  475



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   488 bits (1257),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 246/515 (48%), Positives = 343/515 (67%), Gaps = 14/515 (3%)
 Frame = -2

Query  1706  VSILFLFISVPAVVIWACRVVQWVWLKPRKLEKWLRQQGLNGNSYRVFYGDTKEMATLTA  1527
             + I  +F+++  V  W  +V+ W W +P+KLEK+ RQQGL GNSYR+ +GD KE +    
Sbjct  7     IIIATIFVTILLVHTW--KVLNWAWFRPKKLEKFFRQQGLCGNSYRLLHGDLKEFSKSIK  64

Query  1526  KAKSKPI-NLSDDILPRVLPFYHLAVTKYGKNCFVWSGPAPRVIISEPELMQEVFMNNTL  1350
             +A+SKPI NLS+DI PR++P++   ++KYGKNCFVW GP P ++I E E ++E+F  N +
Sbjct  65    EAQSKPINNLSNDIAPRIIPYFIQTISKYGKNCFVWFGPKPMILIMESEQIREIFAKNYV  124

Query  1349  FKRP-KPHPLVKFLVSGLACYEDQQWARHRKIISPAFYPDKIKCMAPSVTSSCEEMIMKK  1173
             +++P   +P+   L  G+A YE+ +WA+HRKI+ PAF+ +K+K M P+   SC EM +K+
Sbjct  125   YQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEM-LKE  183

Query  1172  WELLTSEKNWCDFDVQPYLEAFTSDVISRTAFGGSYVEGNKVFSLQNEQAELTRQVIHSV  993
             WE +   +   + D+ P  +  TSD+ISRTAFG SY EG ++F LQ EQAE+  +  +S+
Sbjct  184   WEQIIPYEGSKELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEIIMKQFNSI  243

Query  992   YSPEWWLLSSKRSRRMHEIDNEIRGLMKGLIGKRERGMKE---------Kvgdddeenld  840
             Y P    L +K +++M E + E++  ++ LI  R +  +              +   N  
Sbjct  244   YIPGSRFLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESNSNEI  303

Query  839   llgvlLKSGFSTDEVIEECQHFYFAGQESTSDFLVWIMILLSIHQTWQDRARQEVQQVFG  660
                   + G + DEVI EC+ FYFAGQE+TS +LVW MILLS HQ WQ +AR+EV Q FG
Sbjct  304   EEQGSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQNWQAKAREEVLQAFG  363

Query  659   HNKPDFDGLNRLKILTMILNEVLRLYPPSPYTIRTMYEETKLGEMKLPPNiililsslLV  480
              ++P FD L+RLKI+TMIL E LRLYPP    IR   EETKLG M LP   +L + ++L+
Sbjct  364   SDQPAFDELSRLKIVTMILYESLRLYPPLATRIRRTNEETKLGNMYLPNGSLLFIPTILL  423

Query  479   QRDPDVWGADAGEFKPERFAEGVAKATKNRLAFLPFGWGPRTCIGNNFAMMEAKIAIATI  300
               D ++WG DA EFKPERF+EGV  ATK ++ F PFG GPR CIG NFAM+EAK+AIA I
Sbjct  424   HHDKEIWGEDAEEFKPERFSEGVLNATKGQMTFFPFGAGPRICIGQNFAMLEAKMAIALI  483

Query  299   LQRFSFHLSPSYAHSPCFVVTLKPQFGAPLVLHKI  195
             LQRF F LSPSY H P  +V L+P++GAPL+L K+
Sbjct  484   LQRFEFELSPSYIHVPHCIVALQPKYGAPLLLQKL  518



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5191934777694