BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c64536_g1_i1 len=171 path=[149:0-170]

Length=171
                                                                      Score     E

dbj|BAF36312.1|  hypothetical protein                                 73.6    3e-15   Ipomoea trifida
dbj|BAE79384.1|  unnamed protein product                              78.2    8e-15   Ipomoea batatas [batate]
dbj|BAE79385.1|  unnamed protein product                              78.2    9e-15   Ipomoea batatas [batate]
dbj|BAE79382.1|  unnamed protein product                              78.2    9e-15   Ipomoea batatas [batate]
dbj|BAF36311.1|  hypothetical protein                                 60.8    1e-10   Ipomoea trifida
ref|XP_003620877.1|  hypothetical protein MTR_6g091740                49.3    4e-06   
ref|XP_003638645.1|  hypothetical protein MTR_138s0043                48.1    9e-06   
ref|XP_007224107.1|  hypothetical protein PRUPE_ppa015647mg           45.8    1e-04   
ref|XP_003606713.1|  hypothetical protein MTR_4g064720                45.1    2e-04   
ref|XP_003619056.1|  hypothetical protein MTR_6g036410                43.5    5e-04   
ref|XP_003607589.1|  hypothetical protein MTR_4g079970                43.5    6e-04   
gb|ABE80156.1|  Ribonuclease H                                        45.8    7e-04   Medicago truncatula
ref|XP_003621407.1|  hypothetical protein MTR_7g013000                43.1    8e-04   



>dbj|BAF36312.1| hypothetical protein [Ipomoea trifida]
Length=76

 Score = 73.6 bits (179),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  22   DTLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
            +TLI DC+ LM  F+  ++ H+LREGNQ ADFLANLGQN+ WGTTI D+P
Sbjct  6    NTLISDCRALMRDFRSIKITHILREGNQSADFLANLGQNSDWGTTILDDP  55



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  10    SPEADTLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
             +P+A  L+ DCK L+  FQE ++ H+LREGNQCADFLANLGQ+++WGTTI + P
Sbjct  1824  TPDASILVKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERP  1877



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  10    SPEADTLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
             +P+A  L+ DCK L+  FQE ++ H+LREGNQCADFLANLGQ+++WGTTI + P
Sbjct  1292  TPDASILVKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERP  1345



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  10    SPEADTLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
             +P+A  L+ DCK L+  FQE ++ H+LREGNQCADFLANLGQ+++WGTTI + P
Sbjct  1292  TPDASILVKDCKLLLDHFQEIKVTHILREGNQCADFLANLGQSSSWGTTILERP  1345



>dbj|BAF36311.1| hypothetical protein [Ipomoea trifida]
Length=54

 Score = 60.8 bits (146),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  52   MTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
            M  F+  ++ H+LREGNQ ADFLANLGQN+ WGTTI D+P
Sbjct  1    MRDFRSIKITHILREGNQSADFLANLGQNSDWGTTILDDP  40



>ref|XP_003620877.1| hypothetical protein MTR_6g091740 [Medicago truncatula]
 gb|AES77095.1| hypothetical protein MTR_6g091740 [Medicago truncatula]
Length=74

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  76   LNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
              HVLREGN CADFLA LG+N+T G T W  P
Sbjct  28   FKHVLREGNVCADFLARLGRNSTLGVTTWVTP  59



>ref|XP_003638645.1| hypothetical protein MTR_138s0043 [Medicago truncatula]
Length=55

 Score = 48.1 bits (113),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +1

Query  52   MTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
            M V  +    HVLREGN CADFL  LG+N T   TIW  P
Sbjct  1    MYVLPDLVFKHVLREGNVCADFLIRLGRNYTLEVTIWVIP  40



>ref|XP_007224107.1| hypothetical protein PRUPE_ppa015647mg, partial [Prunus persica]
 gb|EMJ25306.1| hypothetical protein PRUPE_ppa015647mg, partial [Prunus persica]
Length=140

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    SGSSPEADTLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
            +G++    ++I  CKDL+    EC + H+ RE N  AD +A+LGQN++ G  + D P
Sbjct  61   TGTNHPLSSIIHCCKDLLLRDWECTIYHIYREQNSAADHMAHLGQNSSLGFHVIDLP  117



>ref|XP_003606713.1| hypothetical protein MTR_4g064720 [Medicago truncatula]
 gb|AES88910.1| hypothetical protein MTR_4g064720 [Medicago truncatula]
Length=131

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = +1

Query  7    SSPEADTLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
            + P+   LI + KDLM+      L H  REGNQCADF+A LG +N    +I  +P
Sbjct  4    TPPKPAVLIQNIKDLMSSGTYSLL-HSFREGNQCADFMAKLGASNDVELSIHSSP  57



>ref|XP_003619056.1| hypothetical protein MTR_6g036410 [Medicago truncatula]
Length=75

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +1

Query  25   TLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
             LI D K+L+       +NH LREGNQCADF+A LG ++ +     ++P
Sbjct  8    VLIQDIKELLKQ-GNVTMNHTLREGNQCADFMAKLGASSNFEFLYHESP  55



>ref|XP_003607589.1| hypothetical protein MTR_4g079970 [Medicago truncatula]
Length=83

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +1

Query  25   TLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNN  141
             LI + KDL+ V +   L+H LREGNQC DF A LG N+
Sbjct  34   VLIQNIKDLLIV-RNISLHHTLREGNQCVDFFAKLGANS  71



>gb|ABE80156.1| Ribonuclease H [Medicago truncatula]
Length=438

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +1

Query  25   TLILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
             LI + KDL++V +   L+H LREGNQCADF A LG N+     +  +P
Sbjct  371  VLIQNIKDLLSV-RNITLHHTLREGNQCADFFAKLGANSDVHLVVHQSP  418



>ref|XP_003621407.1| hypothetical protein MTR_7g013000 [Medicago truncatula]
Length=96

 Score = 43.1 bits (100),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +1

Query  28   LILDCKDLMTVFQECRLNHVLREGNQCADFLANLGQNNTWGTTIWDNP  171
            LI D KD+++      ++H LREGNQCADF+A LG N+    T   +P
Sbjct  30   LIQDIKDILSS-TNFSIHHCLREGNQCADFMAKLGANSNTEFTRHTSP  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 526040204904