BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c64471_g1_i1 len=108 path=[1:0-107]

Length=108
                                                                      Score     E

gb|EYU33393.1|  hypothetical protein MIMGU_mgv1a023176mg              73.2    3e-15   
gb|KDO75421.1|  hypothetical protein CISIN_1g037432mg                 72.8    5e-15   
emb|CDP09532.1|  unnamed protein product                              73.2    6e-15   
ref|XP_006449013.1|  hypothetical protein CICLE_v10017760mg           73.2    6e-15   
ref|XP_009790572.1|  PREDICTED: glutaredoxin-C9-like                  72.8    7e-15   
gb|KDP38002.1|  hypothetical protein JCGZ_04645                       72.4    9e-15   
ref|XP_002519638.1|  glutaredoxin, grx, putative                      72.4    9e-15   Ricinus communis
ref|XP_009609332.1|  PREDICTED: glutaredoxin-C9-like                  71.6    1e-14   
ref|XP_004244929.1|  PREDICTED: glutaredoxin-C9-like                  72.0    1e-14   
ref|XP_011096607.1|  PREDICTED: glutaredoxin-C9-like                  72.4    1e-14   
ref|XP_006346834.1|  PREDICTED: glutaredoxin-C9-like                  71.2    2e-14   
ref|XP_007025024.1|  Glutaredoxin family protein                      71.2    3e-14   
ref|XP_010246107.1|  PREDICTED: glutaredoxin-C9-like                  70.5    6e-14   
emb|CBI30933.3|  unnamed protein product                              70.5    1e-13   
ref|XP_010655687.1|  PREDICTED: glutaredoxin-C1-like                  68.9    2e-13   
ref|XP_010538257.1|  PREDICTED: glutaredoxin-C9-like                  68.9    3e-13   
ref|XP_010540592.1|  PREDICTED: glutaredoxin-C9-like                  68.6    3e-13   
ref|XP_011085618.1|  PREDICTED: glutaredoxin-C9-like                  67.0    1e-12   
ref|XP_008371788.1|  PREDICTED: glutaredoxin-C9-like                  67.0    1e-12   
ref|XP_007212743.1|  hypothetical protein PRUPE_ppa019446mg           65.5    3e-12   
ref|XP_008225569.1|  PREDICTED: glutaredoxin-C9-like                  65.5    3e-12   
ref|XP_003547580.1|  PREDICTED: glutaredoxin-C9-like                  65.9    3e-12   
ref|XP_010054256.1|  PREDICTED: glutaredoxin-C9-like                  65.5    4e-12   
ref|XP_007138516.1|  hypothetical protein PHAVU_009G215800g           65.5    4e-12   
ref|XP_004488285.1|  PREDICTED: glutaredoxin-C9-like                  65.1    4e-12   
ref|XP_008784855.1|  PREDICTED: glutaredoxin-C9-like                  65.1    6e-12   
ref|XP_003535021.1|  PREDICTED: glutaredoxin-C9-like                  64.7    8e-12   
ref|XP_010942195.1|  PREDICTED: glutaredoxin-C9-like                  65.1    8e-12   
ref|XP_004958945.1|  PREDICTED: glutaredoxin-C9-like                  64.3    1e-11   
ref|XP_003524152.1|  PREDICTED: glutaredoxin-C9-like                  64.3    1e-11   
ref|XP_003561465.1|  PREDICTED: glutaredoxin-C9-like                  63.9    1e-11   
ref|XP_010691740.1|  PREDICTED: glutaredoxin-C9-like                  63.5    2e-11   
ref|XP_009408540.1|  PREDICTED: glutaredoxin-C9-like                  63.2    3e-11   
ref|XP_004134909.1|  PREDICTED: glutaredoxin-C9-like                  62.8    4e-11   
ref|XP_010054255.1|  PREDICTED: glutaredoxin-C9-like                  62.8    5e-11   
ref|XP_004305851.1|  PREDICTED: glutaredoxin-C9-like                  62.0    7e-11   
ref|XP_004488305.1|  PREDICTED: glutaredoxin-C9-like                  61.6    1e-10   
ref|XP_008652019.1|  PREDICTED: glutaredoxin-C9-like                  61.2    2e-10   
gb|AHM25912.1|  glutaredoxin 2                                        60.5    3e-10   
ref|XP_007161691.1|  hypothetical protein PHAVU_001G090300g           59.7    5e-10   
ref|XP_003548512.1|  PREDICTED: glutaredoxin-C5-like                  59.7    6e-10   
ref|XP_003553278.1|  PREDICTED: glutaredoxin-C3-like                  59.7    6e-10   
ref|XP_003622060.1|  N-hydroxycinnamoyl/benzoyltransferase            61.2    7e-10   
ref|XP_002272852.1|  PREDICTED: glutaredoxin-C1                       59.3    7e-10   Vitis vinifera
emb|CDX69609.1|  BnaA10g19580D                                        58.9    7e-10   
ref|XP_010522588.1|  PREDICTED: monothiol glutaredoxin-S13            59.3    9e-10   
gb|KDP26855.1|  hypothetical protein JCGZ_18013                       58.9    1e-09   
ref|XP_007043882.1|  Thioredoxin superfamily protein                  58.9    1e-09   
ref|XP_010087002.1|  hypothetical protein L484_005898                 59.3    1e-09   
ref|XP_004492160.1|  PREDICTED: glutaredoxin-C3-like                  58.9    1e-09   
gb|ADE77735.1|  unknown                                               58.5    1e-09   
ref|XP_004288932.1|  PREDICTED: glutaredoxin-C1-like                  58.5    1e-09   
ref|XP_009593680.1|  PREDICTED: glutaredoxin-C1-like                  58.5    1e-09   
gb|AFK35832.1|  unknown                                               58.5    1e-09   
gb|AES65786.2|  glutaredoxin-C1 protein                               58.5    1e-09   
ref|XP_002264542.2|  PREDICTED: glutaredoxin-C1-like                  58.5    1e-09   Vitis vinifera
ref|XP_010243568.1|  PREDICTED: monothiol glutaredoxin-S10-like       58.2    1e-09   
ref|XP_003595535.1|  Glutaredoxin-C7                                  58.2    2e-09   
gb|KCW61905.1|  hypothetical protein EUGRSUZ_H04601                   58.5    2e-09   
ref|XP_006438817.1|  hypothetical protein CICLE_v10033688mg           58.5    2e-09   
gb|KHN09956.1|  Glutaredoxin-C9                                       58.2    2e-09   
ref|XP_004310231.1|  PREDICTED: glutaredoxin-C1-like                  58.2    2e-09   
ref|XP_003541520.1|  PREDICTED: glutaredoxin-C9-like                  58.2    2e-09   
gb|KDO83116.1|  hypothetical protein CISIN_1g039295mg                 57.8    3e-09   
ref|XP_009613036.1|  PREDICTED: glutaredoxin-C7-like                  57.8    3e-09   
emb|CAN67225.1|  hypothetical protein VITISV_043905                   57.4    3e-09   Vitis vinifera
ref|XP_004239526.1|  PREDICTED: glutaredoxin-C1                       57.8    3e-09   
gb|KFK25638.1|  hypothetical protein AALP_AA8G140700                  57.8    3e-09   
ref|XP_002514866.1|  glutaredoxin, grx, putative                      57.4    3e-09   Ricinus communis
ref|XP_008459889.1|  PREDICTED: glutaredoxin-C1-like                  57.4    3e-09   
ref|XP_008347995.1|  PREDICTED: glutaredoxin-C5-like                  57.4    3e-09   
ref|XP_007216287.1|  hypothetical protein PRUPE_ppa020474mg           57.4    3e-09   
ref|NP_196911.1|  glutaredoxin ROXY2                                  57.8    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007031936.1|  Thioredoxin superfamily protein                  57.4    3e-09   
ref|XP_009801947.1|  PREDICTED: glutaredoxin-C5-like                  57.4    3e-09   
ref|XP_009592444.1|  PREDICTED: glutaredoxin-C5-like                  57.4    3e-09   
gb|AGX01499.1|  glutaredoxin                                          57.4    4e-09   
ref|XP_010249120.1|  PREDICTED: glutaredoxin-C1-like                  57.4    4e-09   
ref|XP_009346791.1|  PREDICTED: glutaredoxin-C1                       57.4    4e-09   
ref|XP_006483043.1|  PREDICTED: glutaredoxin-C5-like                  57.0    4e-09   
gb|AAM61544.1|  glutaredoxin-like protein                             57.0    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003593663.1|  Glutaredoxin-C9                                  57.4    4e-09   
ref|XP_010250605.1|  PREDICTED: glutaredoxin-C1-like                  57.4    4e-09   
ref|XP_008341254.1|  PREDICTED: glutaredoxin-C5-like                  57.0    5e-09   
ref|XP_009386578.1|  PREDICTED: glutaredoxin-C5-like                  57.0    5e-09   
ref|XP_006363780.1|  PREDICTED: glutaredoxin-C5-like                  57.0    5e-09   
ref|XP_006359084.1|  PREDICTED: glutaredoxin-C5-like                  57.0    5e-09   
gb|EYU31846.1|  hypothetical protein MIMGU_mgv1a026975mg              57.0    5e-09   
ref|XP_002303767.1|  hypothetical protein POPTR_0003s16540g           57.0    5e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004140545.1|  PREDICTED: glutaredoxin-C3-like                  57.0    5e-09   
ref|XP_009344217.1|  PREDICTED: glutaredoxin-C5-like                  57.0    5e-09   
ref|XP_011098924.1|  PREDICTED: glutaredoxin-C1                       57.0    5e-09   
ref|XP_006844586.1|  hypothetical protein AMTR_s00016p00206670        56.6    5e-09   
ref|XP_009758965.1|  PREDICTED: glutaredoxin-C1-like                  57.0    6e-09   
ref|XP_003621773.1|  Glutaredoxin                                     57.0    6e-09   
ref|XP_009349478.1|  PREDICTED: glutaredoxin-C1-like                  56.6    6e-09   
ref|XP_009421048.1|  PREDICTED: glutaredoxin-C5                       57.0    6e-09   
ref|XP_011045755.1|  PREDICTED: glutaredoxin-C1                       56.6    6e-09   
ref|XP_011036126.1|  PREDICTED: glutaredoxin-C1-like                  56.6    6e-09   
ref|XP_011020819.1|  PREDICTED: glutaredoxin-C1-like                  56.6    6e-09   
ref|XP_003579657.1|  PREDICTED: glutaredoxin-C5-like                  56.6    7e-09   
gb|KDO63867.1|  hypothetical protein CISIN_1g033109mg                 56.6    7e-09   
ref|XP_010024181.1|  PREDICTED: glutaredoxin-C1                       56.6    7e-09   
ref|XP_006399915.1|  hypothetical protein EUTSA_v10015899mg           56.6    7e-09   
ref|XP_008779419.1|  PREDICTED: glutaredoxin-C1-like                  56.6    7e-09   
ref|XP_008775588.1|  PREDICTED: glutaredoxin-C1-like                  56.6    7e-09   
ref|XP_004171791.1|  PREDICTED: glutaredoxin-C1-like                  56.2    7e-09   
gb|AGX01496.1|  glutaredoxin                                          56.2    7e-09   
ref|XP_004148005.1|  PREDICTED: glutaredoxin-C1-like                  56.6    8e-09   
ref|XP_008441305.1|  PREDICTED: glutaredoxin-C1-like                  56.6    8e-09   
ref|XP_003621763.1|  Glutaredoxin                                     56.6    8e-09   
ref|XP_004138799.1|  PREDICTED: glutaredoxin-C1-like                  56.2    8e-09   
emb|CDP13384.1|  unnamed protein product                              56.6    9e-09   
emb|CDX91084.1|  BnaC02g05130D                                        56.6    9e-09   
emb|CDX70540.1|  BnaC03g06240D                                        56.6    9e-09   
ref|XP_009125958.1|  PREDICTED: glutaredoxin-C8                       56.2    9e-09   
ref|XP_009792873.1|  PREDICTED: glutaredoxin-C9-like                  56.2    9e-09   
ref|XP_008450140.1|  PREDICTED: glutaredoxin-C1-like                  56.2    1e-08   
ref|XP_009131384.1|  PREDICTED: glutaredoxin-C8-like                  56.6    1e-08   
ref|NP_001150763.1|  Grx_C8 - glutaredoxin subgroup III               56.2    1e-08   Zea mays [maize]
ref|XP_006288869.1|  hypothetical protein CARUB_v10002222mg           56.2    1e-08   
ref|XP_006447012.1|  hypothetical protein CICLE_v10017534mg           56.2    1e-08   
ref|XP_009611400.1|  PREDICTED: glutaredoxin-C9-like                  56.2    1e-08   
ref|XP_009803758.1|  PREDICTED: glutaredoxin-C7-like                  55.8    1e-08   
ref|XP_009121702.1|  PREDICTED: glutaredoxin-C8-like                  55.8    1e-08   
ref|XP_004304538.1|  PREDICTED: glutaredoxin-C7-like                  55.8    1e-08   
gb|AFK35318.1|  unknown                                               56.2    1e-08   
ref|XP_003575027.1|  PREDICTED: glutaredoxin-C3-like                  55.8    1e-08   
ref|XP_009336451.1|  PREDICTED: glutaredoxin-C1-like                  55.8    1e-08   
ref|XP_003616226.1|  Glutaredoxin-C9                                  55.5    2e-08   
ref|XP_004296803.1|  PREDICTED: monothiol glutaredoxin-S10-like       55.5    2e-08   
ref|XP_010680093.1|  PREDICTED: glutaredoxin-C3                       55.5    2e-08   
ref|XP_007156490.1|  hypothetical protein PHAVU_003G290400g           55.8    2e-08   
ref|XP_010496441.1|  PREDICTED: glutaredoxin-C7                       55.5    2e-08   
ref|XP_002300130.1|  glutaredoxin family protein                      55.5    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010496424.1|  PREDICTED: glutaredoxin-C7                       55.8    2e-08   
ref|XP_010025281.1|  PREDICTED: glutaredoxin-C5-like                  55.8    2e-08   
ref|XP_008389917.1|  PREDICTED: glutaredoxin-C1-like                  55.5    2e-08   
ref|XP_002509419.1|  glutaredoxin, grx, putative                      55.8    2e-08   Ricinus communis
ref|XP_010492199.1|  PREDICTED: glutaredoxin-C8                       55.5    2e-08   
ref|XP_004228854.1|  PREDICTED: glutaredoxin-C1-like                  55.5    2e-08   
emb|CDX91918.1|  BnaC03g32200D                                        55.5    2e-08   
ref|XP_006408562.1|  hypothetical protein EUTSA_v10022308mg           55.5    2e-08   
ref|XP_010420029.1|  PREDICTED: glutaredoxin-C8-like                  55.5    2e-08   
ref|XP_004505534.1|  PREDICTED: glutaredoxin-C9-like                  55.5    2e-08   
ref|XP_010453518.1|  PREDICTED: glutaredoxin-C8-like                  55.5    2e-08   
ref|XP_002452160.1|  hypothetical protein SORBIDRAFT_04g020790        55.5    2e-08   Sorghum bicolor [broomcorn]
ref|NP_001147159.1|  Grx_C8 - glutaredoxin subgroup III               55.5    2e-08   Zea mays [maize]
ref|NP_001046942.1|  Os02g0512400                                     55.1    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004228431.1|  PREDICTED: glutaredoxin-C1-like                  55.1    2e-08   
ref|XP_008340253.1|  PREDICTED: glutaredoxin-C1-like                  55.1    2e-08   
ref|XP_007227610.1|  hypothetical protein PRUPE_ppa021177mg           55.1    2e-08   
gb|EYU34823.1|  hypothetical protein MIMGU_mgv1a026293mg              54.7    3e-08   
ref|XP_008222218.1|  PREDICTED: glutaredoxin-C1-like                  55.1    3e-08   
ref|XP_010524249.1|  PREDICTED: glutaredoxin-C8                       55.1    3e-08   
ref|XP_009631625.1|  PREDICTED: uncharacterized protein LOC104121354  56.6    3e-08   
ref|XP_002299331.2|  hypothetical protein POPTR_0001s13440g           55.1    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010682698.1|  PREDICTED: glutaredoxin-C3-like                  55.1    3e-08   
emb|CDX78558.1|  BnaA03g04700D                                        55.1    3e-08   
gb|AAL35982.1|AF104395_1  glutaredoxin-like protein                   53.5    3e-08   Cucumis sativus [cucumbers]
ref|XP_009398966.1|  PREDICTED: glutaredoxin-C9-like                  55.1    3e-08   
ref|XP_006363784.1|  PREDICTED: glutaredoxin-C5-like                  54.7    3e-08   
ref|XP_007025525.1|  Thioredoxin superfamily protein                  55.1    3e-08   
ref|XP_008791106.1|  PREDICTED: glutaredoxin-C1-like                  54.7    3e-08   
ref|NP_001147414.1|  Grx_I1 - glutaredoxin subgroup III               55.1    3e-08   Zea mays [maize]
ref|XP_011071245.1|  PREDICTED: glutaredoxin-C5-like                  54.7    3e-08   
ref|XP_007149799.1|  hypothetical protein PHAVU_005G099700g           55.1    3e-08   
ref|XP_002963851.1|  hypothetical protein SELMODRAFT_80143            54.3    3e-08   
gb|KDP41803.1|  hypothetical protein JCGZ_26821                       54.7    3e-08   
gb|EMT07309.1|  Glutaredoxin-C3                                       54.7    3e-08   
gb|ACG48030.1|  Grx_S2 - glutaredoxin subgroup III                    54.7    3e-08   Zea mays [maize]
ref|XP_011027761.1|  PREDICTED: glutaredoxin-C9                       54.7    4e-08   
ref|XP_006377423.1|  glutaredoxin-like family protein                 54.7    4e-08   
gb|EAZ30562.1|  hypothetical protein OsJ_14612                        54.7    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008225159.1|  PREDICTED: glutaredoxin-C9-like                  54.7    4e-08   
ref|XP_011001218.1|  PREDICTED: glutaredoxin-C9-like                  54.7    4e-08   
ref|XP_006836357.1|  hypothetical protein AMTR_s00092p00109090        54.3    4e-08   
ref|XP_011086843.1|  PREDICTED: glutaredoxin-C5-like                  54.7    4e-08   
ref|XP_003621774.1|  Glutaredoxin                                     54.3    5e-08   
ref|XP_008353233.1|  PREDICTED: monothiol glutaredoxin-S10-like       53.9    5e-08   
ref|XP_010090679.1|  hypothetical protein L484_017485                 54.3    5e-08   
ref|XP_011097396.1|  PREDICTED: glutaredoxin-C5                       53.9    5e-08   
ref|XP_007043710.1|  Glutaredoxin, putative                           54.3    5e-08   
ref|XP_002440249.1|  hypothetical protein SORBIDRAFT_09g028500        54.3    5e-08   Sorghum bicolor [broomcorn]
gb|EMT06809.1|  Monothiol glutaredoxin-S5                             54.3    5e-08   
ref|XP_004293899.1|  PREDICTED: glutaredoxin-C9-like                  54.3    6e-08   
ref|XP_011043607.1|  PREDICTED: glutaredoxin-C9-like                  54.3    6e-08   
ref|XP_009804127.1|  PREDICTED: glutaredoxin-C9-like                  54.3    6e-08   
ref|XP_008439802.1|  PREDICTED: glutaredoxin-C9                       54.3    6e-08   
ref|XP_002517842.1|  glutaredoxin, grx, putative                      54.3    6e-08   Ricinus communis
ref|XP_003607518.1|  Glutaredoxin-C9                                  54.3    6e-08   
ref|NP_001235378.1|  uncharacterized protein LOC100306716             54.3    6e-08   
gb|KFK39447.1|  hypothetical protein AALP_AA3G246300                  53.5    7e-08   
ref|XP_007148105.1|  hypothetical protein PHAVU_006G181300g           53.9    7e-08   
ref|XP_003543019.1|  PREDICTED: glutaredoxin-C9-like                  53.9    7e-08   
gb|KHN08482.1|  Glutaredoxin-C9                                       53.9    7e-08   
gb|KFK39456.1|  hypothetical protein AALP_AA3G247200                  53.5    7e-08   
ref|XP_004492067.1|  PREDICTED: glutaredoxin-C5-like                  53.9    8e-08   
ref|XP_006449418.1|  hypothetical protein CICLE_v10017106mg           53.9    8e-08   
ref|XP_009607405.1|  PREDICTED: monothiol glutaredoxin-S10            53.5    8e-08   
ref|XP_004229212.1|  PREDICTED: monothiol glutaredoxin-S10            53.5    8e-08   
ref|XP_006342768.1|  PREDICTED: monothiol glutaredoxin-S10-like       53.5    8e-08   
ref|XP_004492070.1|  PREDICTED: glutaredoxin-C5-like                  53.9    8e-08   
ref|XP_010052261.1|  PREDICTED: glutaredoxin-C9-like                  53.9    8e-08   
ref|NP_001043812.1|  Os01g0667900                                     53.9    8e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KDP21018.1|  hypothetical protein JCGZ_21489                       53.9    8e-08   
ref|XP_006467721.1|  PREDICTED: glutaredoxin-C9-like                  53.9    8e-08   
gb|KFK42729.1|  monothiol glutaredoxin-s13                            53.9    8e-08   
ref|NP_001274395.1|  glutaredoxin                                     53.5    9e-08   
ref|XP_006574874.1|  PREDICTED: glutaredoxin-C3-like                  53.5    1e-07   
ref|XP_003546009.1|  PREDICTED: glutaredoxin-C9-like                  53.5    1e-07   
ref|XP_004166934.1|  PREDICTED: glutaredoxin-C9-like                  53.5    1e-07   
ref|XP_003546093.1|  PREDICTED: monothiol glutaredoxin-S10-like       53.1    1e-07   
ref|XP_006594493.1|  PREDICTED: monothiol glutaredoxin-S10-like       53.1    1e-07   
ref|XP_007213996.1|  hypothetical protein PRUPE_ppa014139mg           52.8    1e-07   
gb|KHN07783.1|  Glutaredoxin-C9                                       53.5    1e-07   
ref|XP_002446324.1|  hypothetical protein SORBIDRAFT_06g014300        53.5    1e-07   Sorghum bicolor [broomcorn]
ref|XP_006603016.1|  PREDICTED: glutaredoxin-C5-like                  53.5    1e-07   
gb|EYU27873.1|  hypothetical protein MIMGU_mgv1a023197mg              53.1    1e-07   
emb|CDO98900.1|  unnamed protein product                              53.1    1e-07   
ref|NP_001235171.1|  uncharacterized protein LOC100527118             53.5    1e-07   
emb|CBI30620.3|  unnamed protein product                              52.4    1e-07   
ref|XP_010093967.1|  hypothetical protein L484_010533                 53.1    1e-07   
gb|KCW47268.1|  hypothetical protein EUGRSUZ_K01064                   53.5    1e-07   
ref|XP_003543318.1|  PREDICTED: glutaredoxin-C9-like                  53.5    1e-07   
gb|KFK37654.1|  hypothetical protein AALP_AA3G011200                  53.1    1e-07   
ref|XP_006299130.1|  hypothetical protein CARUB_v10015272mg           52.8    1e-07   
gb|AAB07873.1|  similar to glutaredoxin encoded by GenBank Access...  52.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009405878.1|  PREDICTED: glutaredoxin-C5-like                  53.1    1e-07   
ref|XP_008227351.1|  PREDICTED: glutaredoxin-C8-like                  52.4    1e-07   
ref|XP_002305107.2|  glutaredoxin-like family protein                 53.1    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006299844.1|  hypothetical protein CARUB_v10016047mg           53.1    1e-07   
ref|NP_001240908.1|  uncharacterized protein LOC100792704             53.1    1e-07   
ref|XP_006361069.1|  PREDICTED: glutaredoxin-C9-like                  53.1    1e-07   
ref|XP_010111166.1|  hypothetical protein L484_015048                 53.1    2e-07   
gb|AFK37553.1|  unknown                                               53.1    2e-07   
ref|XP_008371421.1|  PREDICTED: glutaredoxin-C9                       52.8    2e-07   
ref|XP_008383678.1|  PREDICTED: glutaredoxin-C9-like                  52.8    2e-07   
ref|XP_009344450.1|  PREDICTED: glutaredoxin-C9                       52.8    2e-07   
ref|XP_010475016.1|  PREDICTED: monothiol glutaredoxin-S13-like       52.8    2e-07   
ref|XP_009352842.1|  PREDICTED: glutaredoxin-C9-like                  52.8    2e-07   
gb|EPS67459.1|  hypothetical protein M569_07317                       52.4    2e-07   
ref|XP_010327035.1|  PREDICTED: glutaredoxin-C9-like isoform X1       52.8    2e-07   
ref|XP_010466387.1|  PREDICTED: monothiol glutaredoxin-S10-like       52.4    2e-07   
ref|XP_010911008.1|  PREDICTED: monothiol glutaredoxin-S9-like        52.8    2e-07   
ref|XP_010231027.1|  PREDICTED: monothiol glutaredoxin-S9-like        52.8    2e-07   
ref|XP_007226534.1|  hypothetical protein PRUPE_ppa025150mg           52.4    2e-07   
ref|XP_010435683.1|  PREDICTED: glutaredoxin-C7-like                  52.4    2e-07   
ref|XP_009134575.1|  PREDICTED: glutaredoxin-C7                       52.4    2e-07   
ref|XP_010327036.1|  PREDICTED: glutaredoxin-C9-like isoform X2       52.4    2e-07   
ref|XP_007147879.1|  hypothetical protein PHAVU_006G162600g           52.4    3e-07   
ref|XP_007154237.1|  hypothetical protein PHAVU_003G101900g           52.0    3e-07   
emb|CDY30815.1|  BnaC05g21910D                                        52.4    3e-07   
emb|CDM83146.1|  unnamed protein product                              52.4    3e-07   
dbj|BAK00692.1|  predicted protein                                    52.4    3e-07   
ref|XP_001763715.1|  predicted protein                                52.0    3e-07   
dbj|BAJ98449.1|  predicted protein                                    52.0    3e-07   
gb|KDP40012.1|  hypothetical protein JCGZ_02010                       52.0    3e-07   
ref|XP_009767693.1|  PREDICTED: glutaredoxin-C9-like                  52.4    3e-07   
ref|XP_010035805.1|  PREDICTED: monothiol glutaredoxin-S5-like        53.1    3e-07   
ref|XP_008390723.1|  PREDICTED: monothiol glutaredoxin-S10            52.0    3e-07   
ref|XP_001770429.1|  predicted protein                                52.0    3e-07   
ref|XP_002516882.1|  glutaredoxin, grx, putative                      52.0    3e-07   Ricinus communis
ref|XP_009607701.1|  PREDICTED: glutaredoxin-C9-like                  52.0    3e-07   
emb|CDX70828.1|  BnaC03g09120D                                        51.6    3e-07   
ref|XP_010457402.1|  PREDICTED: monothiol glutaredoxin-S13            52.0    3e-07   
ref|XP_006469072.1|  PREDICTED: glutaredoxin-C9-like                  52.0    3e-07   
ref|XP_010482655.1|  PREDICTED: monothiol glutaredoxin-S13-like       52.0    3e-07   
dbj|BAK00667.1|  predicted protein                                    52.0    3e-07   
gb|EMT17993.1|  Monothiol glutaredoxin-S5                             52.0    3e-07   
ref|XP_008232053.1|  PREDICTED: glutaredoxin-C9-like                  52.0    3e-07   
ref|XP_002991354.1|  CC type glutaredoxin                             52.0    4e-07   
ref|XP_009135750.1|  PREDICTED: monothiol glutaredoxin-S10            51.6    4e-07   
ref|XP_009594330.1|  PREDICTED: glutaredoxin-C9-like                  52.0    4e-07   
ref|XP_009113659.1|  PREDICTED: glutaredoxin-C9-like isoform X2       52.0    4e-07   
ref|XP_009131678.1|  PREDICTED: monothiol glutaredoxin-S2             51.6    4e-07   
ref|XP_002278515.1|  PREDICTED: glutaredoxin-C9                       52.0    4e-07   Vitis vinifera
ref|XP_007219160.1|  hypothetical protein PRUPE_ppa016347mg           52.0    4e-07   
emb|CDX89861.1|  BnaA10g02210D                                        52.0    4e-07   
ref|XP_007139286.1|  hypothetical protein PHAVU_008G016400g           52.0    4e-07   
ref|XP_002988222.1|  CC type glutaredoxin                             51.6    4e-07   
gb|KHN27916.1|  Glutaredoxin-C9                                       51.6    4e-07   
ref|NP_001274138.1|  glutaredoxin-C9-like                             51.6    4e-07   
emb|CDP15880.1|  unnamed protein product                              52.0    4e-07   
ref|XP_002310416.1|  hypothetical protein POPTR_0007s01400g           52.0    4e-07   
ref|XP_010919211.1|  PREDICTED: monothiol glutaredoxin-S9-like        52.0    4e-07   
ref|XP_006406267.1|  hypothetical protein EUTSA_v10021819mg           51.6    4e-07   
gb|KDP24071.1|  hypothetical protein JCGZ_25728                       51.6    4e-07   
gb|EAY99027.1|  hypothetical protein OsI_20984                        51.6    4e-07   
sp|P0C291.1|GRXS9_ORYSJ  RecName: Full=Monothiol glutaredoxin-S9      51.6    4e-07   
emb|CAN60168.1|  hypothetical protein VITISV_003664                   51.2    5e-07   
ref|XP_009119356.1|  PREDICTED: monothiol glutaredoxin-S13-like       51.6    5e-07   
ref|XP_010558476.1|  PREDICTED: monothiol glutaredoxin-S2             51.2    5e-07   
ref|XP_010538185.1|  PREDICTED: glutaredoxin-C9                       51.6    5e-07   
ref|XP_011047709.1|  PREDICTED: glutaredoxin-C9-like                  51.6    5e-07   
dbj|BAJ97010.1|  predicted protein                                    51.6    5e-07   
emb|CDY18190.1|  BnaC05g02130D                                        51.6    5e-07   
gb|KHN36670.1|  Glutaredoxin-C9                                       51.2    5e-07   
ref|XP_009111139.1|  PREDICTED: monothiol glutaredoxin-S13-like       51.6    5e-07   
ref|XP_002262673.1|  PREDICTED: glutaredoxin-C9                       51.6    5e-07   
ref|XP_008798206.1|  PREDICTED: monothiol glutaredoxin-S9-like        51.6    5e-07   
ref|XP_008455946.1|  PREDICTED: glutaredoxin-C9-like                  51.6    5e-07   
ref|XP_009120959.1|  PREDICTED: monothiol glutaredoxin-S2             51.2    5e-07   
ref|XP_006400409.1|  hypothetical protein EUTSA_v10015538mg           51.2    5e-07   
ref|NP_563691.1|  glutaredoxin ATGRXS13                               51.6    5e-07   
ref|XP_010492876.1|  PREDICTED: monothiol glutaredoxin-S2-like        51.2    5e-07   
gb|KFK26098.1|  hypothetical protein AALP_AA8G202600                  51.2    5e-07   
emb|CDY13904.1|  BnaC09g39220D                                        51.2    5e-07   
ref|XP_006288956.1|  hypothetical protein CARUB_v10002321mg           51.2    5e-07   
gb|EMT17990.1|  Monothiol glutaredoxin-S5                             51.2    5e-07   
ref|XP_006855457.1|  hypothetical protein AMTR_s00057p00179150        51.2    5e-07   
ref|XP_010323755.1|  PREDICTED: glutaredoxin-C9-like                  51.6    5e-07   
ref|XP_003529587.1|  PREDICTED: monothiol glutaredoxin-S10-like       51.2    6e-07   
ref|XP_002449930.1|  hypothetical protein SORBIDRAFT_05g025900        51.2    6e-07   
emb|CDO99478.1|  unnamed protein product                              51.6    6e-07   
ref|XP_009406261.1|  PREDICTED: monothiol glutaredoxin-S9-like        51.6    6e-07   
ref|XP_006305751.1|  hypothetical protein CARUB_v10010567mg           51.2    6e-07   
ref|XP_006852569.1|  hypothetical protein AMTR_s00021p00206280        51.2    6e-07   
emb|CDY02610.1|  BnaC02g08250D                                        51.2    6e-07   
ref|XP_002885441.1|  electron carrier/ protein disulfide oxidored...  51.2    6e-07   
ref|XP_004233840.1|  PREDICTED: monothiol glutaredoxin-S9-like        51.2    6e-07   
ref|XP_008798271.1|  PREDICTED: monothiol glutaredoxin-S9-like        51.2    6e-07   
ref|XP_002873906.1|  glutaredoxin family protein                      50.8    6e-07   
emb|CDY68328.1|  BnaAnng26900D                                        50.8    6e-07   
gb|EAY81716.1|  hypothetical protein OsI_36890                        51.2    6e-07   
ref|XP_003569532.1|  PREDICTED: monothiol glutaredoxin-S5-like        51.2    7e-07   
ref|NP_001078198.1|  monothiol glutaredoxin-S10                       50.8    7e-07   
ref|XP_010420636.1|  PREDICTED: monothiol glutaredoxin-S2             50.8    7e-07   
ref|XP_010024634.1|  PREDICTED: monothiol glutaredoxin-S10-like       50.8    7e-07   
ref|XP_006366300.1|  PREDICTED: glutaredoxin-C9-like                  51.2    7e-07   
ref|XP_006446718.1|  hypothetical protein CICLE_v10017057mg           51.2    7e-07   
gb|ABK28101.1|  unknown                                               50.8    8e-07   
gb|ABK96346.1|  unknown                                               51.2    8e-07   
gb|KHN27195.1|  Glutaredoxin-C1                                       50.8    8e-07   
ref|XP_008799336.1|  PREDICTED: glutaredoxin-C1-like                  50.8    8e-07   
ref|XP_009369117.1|  PREDICTED: monothiol glutaredoxin-S10-like       50.8    8e-07   
ref|XP_010649773.1|  PREDICTED: monothiol glutaredoxin-S10            50.8    8e-07   
ref|XP_006303410.1|  hypothetical protein CARUB_v10010616mg           50.8    8e-07   
ref|NP_001176689.1|  Os11g0656000                                     50.8    8e-07   
ref|XP_006372767.1|  hypothetical protein POPTR_0017s04860g           50.8    9e-07   
ref|XP_010241641.1|  PREDICTED: monothiol glutaredoxin-S10-like       50.4    9e-07   
ref|XP_009419009.1|  PREDICTED: putative glutaredoxin-C14             50.4    9e-07   
ref|XP_006663086.1|  PREDICTED: glutaredoxin-C13-like                 50.4    9e-07   
ref|XP_009126270.1|  PREDICTED: monothiol glutaredoxin-S2-like        50.4    9e-07   
ref|XP_010540469.1|  PREDICTED: glutaredoxin-C9-like                  50.8    9e-07   
ref|XP_010686392.1|  PREDICTED: glutaredoxin-C9-like                  50.8    9e-07   
ref|XP_004968749.1|  PREDICTED: glutaredoxin-C1-like                  50.4    1e-06   
ref|XP_004486045.1|  PREDICTED: monothiol glutaredoxin-S2-like        50.4    1e-06   
ref|XP_007132762.1|  hypothetical protein PHAVU_011G122900g           50.8    1e-06   
ref|XP_002455626.1|  hypothetical protein SORBIDRAFT_03g014800        50.4    1e-06   
ref|XP_006415650.1|  hypothetical protein EUTSA_v10009080mg           50.4    1e-06   
ref|XP_002455625.1|  hypothetical protein SORBIDRAFT_03g014790        50.4    1e-06   
ref|XP_002892183.1|  hypothetical protein ARALYDRAFT_470358           50.4    1e-06   
ref|XP_009409082.1|  PREDICTED: monothiol glutaredoxin-S3-like        50.4    1e-06   
ref|XP_002893532.1|  hypothetical protein ARALYDRAFT_473065           50.4    1e-06   
ref|XP_009414476.1|  PREDICTED: putative glutaredoxin-C14             50.4    1e-06   
ref|XP_008674047.1|  PREDICTED: glutaredoxin-C1                       50.4    1e-06   
ref|XP_003577277.1|  PREDICTED: glutaredoxin-C10                      50.4    1e-06   
ref|XP_008674046.1|  PREDICTED: glutaredoxin-C1-like                  50.4    1e-06   
ref|XP_008677913.1|  PREDICTED: glutaredoxin-C10-like                 50.4    1e-06   
ref|XP_006418197.1|  hypothetical protein EUTSA_v10008980mg           50.4    1e-06   
ref|XP_006419643.1|  hypothetical protein CICLE_v10006590mg           50.1    1e-06   
ref|XP_004492081.1|  PREDICTED: glutaredoxin-C5-like                  50.4    1e-06   
ref|XP_004962841.1|  PREDICTED: putative glutaredoxin-C14-like        50.1    1e-06   
ref|XP_010052341.1|  PREDICTED: glutaredoxin-C9-like                  50.4    1e-06   
ref|XP_003567688.1|  PREDICTED: glutaredoxin-C1                       50.1    1e-06   
gb|AFW60229.1|  hypothetical protein ZEAMMB73_920110                  50.1    1e-06   
gb|EPS67967.1|  hypothetical protein M569_06806                       50.4    1e-06   
ref|NP_001043047.1|  Os01g0368900                                     50.1    1e-06   
ref|XP_011071466.1|  PREDICTED: monothiol glutaredoxin-S5-like        50.1    1e-06   
ref|XP_002442254.1|  hypothetical protein SORBIDRAFT_08g017090        50.1    1e-06   
ref|XP_008674577.1|  PREDICTED: putative glutaredoxin-C2              50.1    1e-06   
ref|XP_010904787.1|  PREDICTED: putative glutaredoxin-C14             50.1    1e-06   
ref|XP_004486046.1|  PREDICTED: monothiol glutaredoxin-S10-like       50.1    2e-06   
gb|EAY81718.1|  hypothetical protein OsI_36892                        50.1    2e-06   
ref|XP_002456905.1|  hypothetical protein SORBIDRAFT_03g045210        50.1    2e-06   
ref|XP_006647266.1|  PREDICTED: glutaredoxin-C3-like                  50.1    2e-06   
ref|XP_006364326.1|  PREDICTED: monothiol glutaredoxin-S9-like        50.1    2e-06   
ref|XP_009109577.1|  PREDICTED: monothiol glutaredoxin-S10-like       49.7    2e-06   
ref|XP_008670904.1|  PREDICTED: putative glutaredoxin-C14             49.7    2e-06   
ref|XP_004979879.1|  PREDICTED: glutaredoxin-C10-like                 49.7    2e-06   
ref|XP_009386287.1|  PREDICTED: glutaredoxin-C1-like                  49.7    2e-06   
ref|XP_008799330.1|  PREDICTED: glutaredoxin-C1-like                  49.7    2e-06   
emb|CBI15005.3|  unnamed protein product                              49.7    2e-06   
gb|EYU37410.1|  hypothetical protein MIMGU_mgv1a023394mg              50.1    2e-06   
ref|XP_006406268.1|  hypothetical protein EUTSA_v10021818mg           49.7    2e-06   
ref|NP_186849.1|  glutaredoxin-C7                                     50.1    2e-06   
tpg|DAA42401.1|  TPA: hypothetical protein ZEAMMB73_785246            49.7    2e-06   
ref|XP_009392430.1|  PREDICTED: monothiol glutaredoxin-S9-like        50.1    2e-06   
ref|XP_006380203.1|  hypothetical protein POPTR_0008s22890g           49.7    2e-06   
ref|XP_002882152.1|  hypothetical protein ARALYDRAFT_477310           49.7    2e-06   
ref|XP_009388731.1|  PREDICTED: monothiol glutaredoxin-S9-like        49.7    2e-06   
ref|XP_004248179.2|  PREDICTED: glutaredoxin-C9-like                  49.7    2e-06   
ref|XP_004971194.1|  PREDICTED: putative glutaredoxin-C2-like         49.7    2e-06   
ref|XP_003575732.1|  PREDICTED: putative glutaredoxin-C14             49.7    2e-06   
ref|XP_003575739.1|  PREDICTED: putative glutaredoxin-C14             49.7    2e-06   
ref|XP_004961217.1|  PREDICTED: monothiol glutaredoxin-S9-like        49.7    2e-06   
ref|XP_009381029.1|  PREDICTED: monothiol glutaredoxin-S3             49.7    2e-06   
ref|XP_010549174.1|  PREDICTED: monothiol glutaredoxin-S4-like        49.3    2e-06   
ref|XP_009408234.1|  PREDICTED: putative glutaredoxin-C14             49.3    2e-06   
ref|XP_004968750.1|  PREDICTED: glutaredoxin-C1-like                  49.3    2e-06   
gb|KGN63206.1|  hypothetical protein Csa_2G412500                     49.7    2e-06   
ref|NP_197361.1|  monothiol glutaredoxin-S2                           49.3    2e-06   
ref|XP_009383750.1|  PREDICTED: putative glutaredoxin-C14             49.3    2e-06   
gb|ABK26004.1|  unknown                                               49.7    2e-06   
ref|XP_010454112.1|  PREDICTED: monothiol glutaredoxin-S2-like        49.3    3e-06   
ref|XP_004962838.1|  PREDICTED: glutaredoxin-C15-like                 49.3    3e-06   
ref|NP_001045325.2|  Os01g0936000                                     49.3    3e-06   
ref|XP_009381963.1|  PREDICTED: putative glutaredoxin-C14             49.3    3e-06   
gb|EAY81715.1|  hypothetical protein OsI_36889                        49.3    3e-06   
ref|XP_003565561.2|  PREDICTED: monothiol glutaredoxin-S3-like        49.3    3e-06   
ref|XP_002282196.1|  PREDICTED: glutaredoxin                          49.3    3e-06   
ref|XP_006664080.1|  PREDICTED: putative glutaredoxin-C14-like        49.3    3e-06   
ref|XP_004494336.1|  PREDICTED: monothiol glutaredoxin-S6-like        49.3    3e-06   
ref|XP_010098329.1|  Monothiol glutaredoxin-S10                       49.3    3e-06   
ref|XP_009791952.1|  PREDICTED: glutaredoxin-C9-like                  49.3    3e-06   
ref|XP_003625874.1|  Monothiol glutaredoxin-S6                        49.3    3e-06   
ref|XP_003521539.1|  PREDICTED: monothiol glutaredoxin-S6-like        48.9    3e-06   
ref|XP_006348835.1|  PREDICTED: glutaredoxin-C9-like                  49.3    3e-06   
ref|XP_004969481.1|  PREDICTED: monothiol glutaredoxin-S5-like        49.3    3e-06   
emb|CDY44992.1|  BnaCnng12220D                                        49.7    3e-06   
gb|KHN28226.1|  Monothiol glutaredoxin-S6                             48.9    3e-06   
ref|XP_010689814.1|  PREDICTED: glutaredoxin-C9-like                  49.3    3e-06   
dbj|BAJ86342.1|  predicted protein                                    48.9    3e-06   
gb|EMT19730.1|  Putative glutaredoxin-C14                             48.9    3e-06   
ref|XP_008804595.1|  PREDICTED: glutaredoxin-C1                       49.7    3e-06   
ref|XP_010245570.1|  PREDICTED: glutaredoxin-C9-like                  49.3    3e-06   
ref|XP_006439850.1|  hypothetical protein CICLE_v10022897mg           49.3    3e-06   
ref|XP_011016037.1|  PREDICTED: monothiol glutaredoxin-S10            48.9    3e-06   
dbj|BAD81621.1|  unknown protein                                      49.3    3e-06   
ref|XP_002442259.1|  hypothetical protein SORBIDRAFT_08g017160        48.9    4e-06   
ref|XP_002442257.1|  hypothetical protein SORBIDRAFT_08g017120        48.9    4e-06   
ref|XP_004952570.1|  PREDICTED: glutaredoxin-C3-like                  48.9    4e-06   
ref|XP_006476805.1|  PREDICTED: glutaredoxin-C1-like                  48.9    4e-06   
ref|XP_010904892.1|  PREDICTED: monothiol glutaredoxin-S3-like        49.3    4e-06   
gb|EMT31793.1|  Putative glutaredoxin-C14                             48.9    4e-06   
ref|NP_001042552.1|  Os01g0241400                                     48.9    4e-06   
gb|EMT15191.1|  Monothiol glutaredoxin-S3                             48.5    4e-06   
gb|EYU43367.1|  hypothetical protein MIMGU_mgv1a015804mg              48.9    4e-06   
ref|XP_009416533.1|  PREDICTED: monothiol glutaredoxin-S9-like        49.3    4e-06   
ref|NP_174170.1|  glutaredoxin-GRX480                                 48.9    4e-06   
ref|XP_004134195.1|  PREDICTED: monothiol glutaredoxin-S2-like        48.5    4e-06   
ref|XP_006645296.1|  PREDICTED: putative glutaredoxin-C2-like         48.5    4e-06   
ref|XP_004979878.1|  PREDICTED: glutaredoxin-C10-like                 48.5    4e-06   
ref|NP_001052649.2|  Os04g0393500                                     48.9    5e-06   
ref|NP_001176691.1|  Os11g0656801                                     48.5    5e-06   
gb|EAY77135.1|  hypothetical protein OsI_05100                        48.5    5e-06   
dbj|BAJ89491.1|  predicted protein                                    48.5    5e-06   
gb|EPS64180.1|  hypothetical protein M569_10600                       48.5    5e-06   
sp|Q2R073.1|GRC12_ORYSJ  RecName: Full=Putative glutaredoxin-C12      48.5    5e-06   
ref|XP_002459351.1|  hypothetical protein SORBIDRAFT_02g003040        48.9    5e-06   
ref|XP_010524509.1|  PREDICTED: monothiol glutaredoxin-S4             48.5    5e-06   
ref|XP_010449909.1|  PREDICTED: monothiol glutaredoxin-S3-like        48.5    5e-06   
ref|XP_010434931.1|  PREDICTED: monothiol glutaredoxin-S3             48.5    6e-06   
emb|CDX94626.1|  BnaC07g10320D                                        48.5    6e-06   
ref|XP_008777321.1|  PREDICTED: monothiol glutaredoxin-S3-like        48.5    6e-06   
ref|XP_010440263.1|  PREDICTED: monothiol glutaredoxin-S3-like        48.5    6e-06   
sp|Q7XIZ1.1|GRXC9_ORYSJ  RecName: Full=Glutaredoxin-C9                49.3    6e-06   
ref|XP_009118687.1|  PREDICTED: monothiol glutaredoxin-S13-like       48.5    6e-06   
ref|XP_006663084.1|  PREDICTED: glutaredoxin-C10-like                 48.5    6e-06   
ref|XP_008665182.1|  PREDICTED: putative glutaredoxin-C14             48.1    6e-06   
ref|XP_006286199.1|  hypothetical protein CARUB_v10007765mg           48.1    6e-06   
ref|XP_010260343.1|  PREDICTED: glutaredoxin-C9-like                  48.5    6e-06   
gb|EMS46251.1|  Putative glutaredoxin-C14                             48.1    6e-06   
ref|XP_010036905.1|  PREDICTED: monothiol glutaredoxin-S10-like       48.1    6e-06   
ref|XP_003593973.1|  Monothiol glutaredoxin-S4                        48.1    6e-06   
ref|XP_010931999.1|  PREDICTED: glutaredoxin-C1                       48.1    6e-06   
ref|XP_010449908.1|  PREDICTED: monothiol glutaredoxin-S3-like        48.1    6e-06   
ref|XP_006284817.1|  hypothetical protein CARUB_v10006105mg           48.1    6e-06   
ref|XP_002870219.1|  glutaredoxin family protein                      48.1    6e-06   
ref|NP_193305.1|  monothiol glutaredoxin-S3                           48.1    6e-06   
ref|XP_009102903.1|  PREDICTED: glutaredoxin-C9-like                  48.5    6e-06   
ref|XP_010434934.1|  PREDICTED: monothiol glutaredoxin-S4             48.1    6e-06   
ref|XP_010434933.1|  PREDICTED: monothiol glutaredoxin-S5-like        48.1    6e-06   
gb|KFK43355.1|  hypothetical protein AALP_AA1G115300                  48.1    6e-06   
ref|NP_193304.1|  monothiol glutaredoxin-S5                           48.1    6e-06   
ref|XP_006284821.1|  hypothetical protein CARUB_v10006100mg           48.1    6e-06   
ref|XP_002870218.1|  glutaredoxin family protein                      48.1    7e-06   
ref|XP_008796225.1|  PREDICTED: glutaredoxin-C1-like                  48.1    7e-06   
ref|XP_010548927.1|  PREDICTED: monothiol glutaredoxin-S5-like        48.1    7e-06   
ref|XP_003546092.1|  PREDICTED: monothiol glutaredoxin-S2-like        48.1    7e-06   
ref|XP_002449931.1|  hypothetical protein SORBIDRAFT_05g025910        48.1    7e-06   
gb|EAZ02789.1|  hypothetical protein OsI_24916                        48.9    7e-06   
ref|XP_009146815.1|  PREDICTED: monothiol glutaredoxin-S4             48.1    7e-06   
emb|CDY15662.1|  BnaA07g08330D                                        48.1    7e-06   
ref|XP_011071468.1|  PREDICTED: monothiol glutaredoxin-S10-like       48.1    7e-06   
ref|XP_008783123.1|  PREDICTED: monothiol glutaredoxin-S3-like        48.5    7e-06   
ref|XP_008802104.1|  PREDICTED: glutaredoxin-C1-like                  48.1    7e-06   
ref|XP_007225971.1|  hypothetical protein PRUPE_ppa013805mg           48.1    7e-06   
ref|XP_011013421.1|  PREDICTED: monothiol glutaredoxin-S2-like        48.1    8e-06   
gb|KHN33129.1|  Monothiol glutaredoxin-S4                             48.1    8e-06   
gb|KDO69594.1|  hypothetical protein CISIN_1g033336mg                 48.1    8e-06   
ref|NP_001068390.1|  Os11g0655900                                     48.1    8e-06   
ref|XP_002870221.1|  glutaredoxin family protein                      48.1    8e-06   
emb|CDY10096.1|  BnaC08g43550D                                        48.1    8e-06   
ref|XP_003609600.1|  Monothiol glutaredoxin-S2                        47.8    8e-06   
sp|P0C290.1|GRXS8_ORYSJ  RecName: Full=Monothiol glutaredoxin-S8      47.8    9e-06   
ref|XP_010070161.1|  PREDICTED: glutaredoxin-C9-like                  48.1    9e-06   
ref|XP_010434932.1|  PREDICTED: monothiol glutaredoxin-S3-like        47.8    9e-06   
gb|EMT20536.1|  Putative glutaredoxin-C14                             47.8    9e-06   



>gb|EYU33393.1| hypothetical protein MIMGU_mgv1a023176mg [Erythranthe guttata]
Length=112

 Score = 73.2 bits (178),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL
Sbjct  75   VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  110



>gb|KDO75421.1| hypothetical protein CISIN_1g037432mg [Citrus sinensis]
Length=111

 Score = 72.8 bits (177),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPA+FVGGKFLGGIET+MACHINGTLVPLLKDAGAL
Sbjct  74   VPAIFVGGKFLGGIETLMACHINGTLVPLLKDAGAL  109



>emb|CDP09532.1| unnamed protein product [Coffea canephora]
Length=133

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIETVMACHING+LVPLLKDAGAL
Sbjct  96   VPAVFVGGKFLGGIETVMACHINGSLVPLLKDAGAL  131



>ref|XP_006449013.1| hypothetical protein CICLE_v10017760mg [Citrus clementina]
 gb|ESR62253.1| hypothetical protein CICLE_v10017760mg [Citrus clementina]
Length=135

 Score = 73.2 bits (178),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPA+FVGGKFLGGIET+MACHINGTLVPLLKDAGAL
Sbjct  98   VPAIFVGGKFLGGIETLMACHINGTLVPLLKDAGAL  133



>ref|XP_009790572.1| PREDICTED: glutaredoxin-C9-like [Nicotiana sylvestris]
Length=130

 Score = 72.8 bits (177),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIETVMACHINGTLVPLLK+AGAL
Sbjct  93   VPAVFVGGKFLGGIETVMACHINGTLVPLLKEAGAL  128



>gb|KDP38002.1| hypothetical protein JCGZ_04645 [Jatropha curcas]
Length=131

 Score = 72.4 bits (176),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPA+FVGGKFLGGIET+MACHINGTLVPLLKDAGAL
Sbjct  94   VPAIFVGGKFLGGIETLMACHINGTLVPLLKDAGAL  129



>ref|XP_002519638.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF42611.1| glutaredoxin, grx, putative [Ricinus communis]
Length=127

 Score = 72.4 bits (176),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPA+FVGGKFLGGIET+MACHINGTLVPLLKDAGAL
Sbjct  90   VPAIFVGGKFLGGIETLMACHINGTLVPLLKDAGAL  125



>ref|XP_009609332.1| PREDICTED: glutaredoxin-C9-like [Nicotiana tomentosiformis]
Length=109

 Score = 71.6 bits (174),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIETVMACHINGTLVPLLK+AGAL
Sbjct  72   VPAVFVGGKFLGGIETVMACHINGTLVPLLKEAGAL  107



>ref|XP_004244929.1| PREDICTED: glutaredoxin-C9-like [Solanum lycopersicum]
Length=126

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIETVMACHINGTLVPLLK AGAL
Sbjct  89   VPAVFVGGKFLGGIETVMACHINGTLVPLLKQAGAL  124



>ref|XP_011096607.1| PREDICTED: glutaredoxin-C9-like [Sesamum indicum]
Length=146

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIE+VMACHINGTLVPLL+DAGAL
Sbjct  109  VPAVFVGGKFLGGIESVMACHINGTLVPLLRDAGAL  144



>ref|XP_006346834.1| PREDICTED: glutaredoxin-C9-like [Solanum tuberosum]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIETVMACHINGTLVPLLK AGAL
Sbjct  80   VPAVFVGGKFLGGIETVMACHINGTLVPLLKQAGAL  115



>ref|XP_007025024.1| Glutaredoxin family protein, partial [Theobroma cacao]
 gb|EOY27646.1| Glutaredoxin family protein, partial [Theobroma cacao]
Length=123

 Score = 71.2 bits (173),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIET+MACHINGTLVPLLK+AGAL
Sbjct  87   VPAVFVGGKFLGGIETLMACHINGTLVPLLKEAGAL  122



>ref|XP_010246107.1| PREDICTED: glutaredoxin-C9-like [Nelumbo nucifera]
Length=132

 Score = 70.5 bits (171),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVF+GGKFLGG+ETVM+CHINGTLVPLLKDAGAL
Sbjct  95   LPAVFIGGKFLGGLETVMSCHINGTLVPLLKDAGAL  130



>emb|CBI30933.3| unnamed protein product [Vitis vinifera]
Length=179

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIET+M+CHINGTLVPLLK AGAL
Sbjct  142  VPAVFVGGKFLGGIETLMSCHINGTLVPLLKAAGAL  177



>ref|XP_010655687.1| PREDICTED: glutaredoxin-C1-like [Vitis vinifera]
Length=129

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGGIET+M+CHINGTLVPLLK AGAL
Sbjct  92   VPAVFVGGKFLGGIETLMSCHINGTLVPLLKAAGAL  127



>ref|XP_010538257.1| PREDICTED: glutaredoxin-C9-like [Tarenaya hassleriana]
Length=143

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PA+FVGGKFLGG++T+MACHING+LVPLLKDAGAL
Sbjct  106  IPAIFVGGKFLGGVDTLMACHINGSLVPLLKDAGAL  141



>ref|XP_010540592.1| PREDICTED: glutaredoxin-C9-like [Tarenaya hassleriana]
Length=136

 Score = 68.6 bits (166),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PA+FVGGKFLGGI+T+MACHING+L+PLLKDAGAL
Sbjct  99   IPAIFVGGKFLGGIDTLMACHINGSLIPLLKDAGAL  134



>ref|XP_011085618.1| PREDICTED: glutaredoxin-C9-like [Sesamum indicum]
Length=134

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGG+FLGG ETV+ACHINGTLVPLLKD GAL
Sbjct  97   LPAVFVGGRFLGGTETVLACHINGTLVPLLKDVGAL  132



>ref|XP_008371788.1| PREDICTED: glutaredoxin-C9-like [Malus domestica]
 ref|XP_008346012.1| PREDICTED: glutaredoxin-C9-like [Malus domestica]
Length=140

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGKFLGG+ET+MA HINGTLVPLLKD+GAL
Sbjct  103  IPAVFVGGKFLGGVETLMAWHINGTLVPLLKDSGAL  138



>ref|XP_007212743.1| hypothetical protein PRUPE_ppa019446mg [Prunus persica]
 gb|EMJ13942.1| hypothetical protein PRUPE_ppa019446mg [Prunus persica]
Length=108

 Score = 65.5 bits (158),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGKFLGG++ +M CHINGTLVPLLKD+GAL
Sbjct  71   IPAVFVGGKFLGGVQALMGCHINGTLVPLLKDSGAL  106



>ref|XP_008225569.1| PREDICTED: glutaredoxin-C9-like [Prunus mume]
Length=111

 Score = 65.5 bits (158),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGKFLGG++ +M CHINGTLVPLLKD+GAL
Sbjct  74   IPAVFVGGKFLGGVQALMGCHINGTLVPLLKDSGAL  109



>ref|XP_003547580.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=132

 Score = 65.9 bits (159),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKFLGG++T+MA HINGTLVPLLK+AGAL
Sbjct  95   VPAVFIGGKFLGGVQTLMASHINGTLVPLLKEAGAL  130



>ref|XP_010054256.1| PREDICTED: glutaredoxin-C9-like [Eucalyptus grandis]
Length=131

 Score = 65.5 bits (158),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGKFLGG+ET+MA HINGTLVPLLKDAGAL
Sbjct  94   LPAVFVGGKFLGGLETLMARHINGTLVPLLKDAGAL  129



>ref|XP_007138516.1| hypothetical protein PHAVU_009G215800g [Phaseolus vulgaris]
 gb|ESW10510.1| hypothetical protein PHAVU_009G215800g [Phaseolus vulgaris]
Length=129

 Score = 65.5 bits (158),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKFLGG++T+MA HINGTLVPLLK+AGAL
Sbjct  92   VPAVFIGGKFLGGVQTLMASHINGTLVPLLKEAGAL  127



>ref|XP_004488285.1| PREDICTED: glutaredoxin-C9-like [Cicer arietinum]
Length=122

 Score = 65.1 bits (157),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKFLGG+ET+MA H+NGTLVPLLK+AGAL
Sbjct  85   VPAVFVGGKFLGGLETLMANHLNGTLVPLLKEAGAL  120



>ref|XP_008784855.1| PREDICTED: glutaredoxin-C9-like [Phoenix dactylifera]
Length=127

 Score = 65.1 bits (157),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGK LGG+E VM+CHING+LVPLLK AGAL
Sbjct  90   VPAVFVGGKLLGGVEKVMSCHINGSLVPLLKQAGAL  125



>ref|XP_003535021.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=136

 Score = 64.7 bits (156),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVF+GGKFLGG++T+MA HINGTLVPLLK+AGAL
Sbjct  99   IPAVFIGGKFLGGVQTLMASHINGTLVPLLKEAGAL  134



>ref|XP_010942195.1| PREDICTED: glutaredoxin-C9-like [Elaeis guineensis]
Length=181

 Score = 65.1 bits (157),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGK LGG+E VM+CHING+LVPLLK AGAL
Sbjct  144  VPAVFVGGKLLGGVEKVMSCHINGSLVPLLKQAGAL  179



>ref|XP_004958945.1| PREDICTED: glutaredoxin-C9-like, partial [Setaria italica]
Length=115

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VFVGG+ LGG+E VMACHINGTLVPLLK AGAL
Sbjct  78   VPVVFVGGRLLGGVEKVMACHINGTLVPLLKQAGAL  113



>ref|XP_003524152.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=120

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGKFLGG++T+MA HINGTLVPLLK AGAL
Sbjct  83   LPAVFVGGKFLGGVQTLMAAHINGTLVPLLKQAGAL  118



>ref|XP_003561465.1| PREDICTED: glutaredoxin-C9-like [Brachypodium distachyon]
Length=122

 Score = 63.9 bits (154),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VFVGG+ LGG++ VMACHING+LVPLLKDAGAL
Sbjct  85   VPVVFVGGRLLGGVDKVMACHINGSLVPLLKDAGAL  120



>ref|XP_010691740.1| PREDICTED: glutaredoxin-C9-like [Beta vulgaris subsp. vulgaris]
Length=136

 Score = 63.5 bits (153),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PA++VGGKFLGGIE++MA HING+LVPLLK+AGAL
Sbjct  99   LPAIYVGGKFLGGIESLMASHINGSLVPLLKEAGAL  134



>ref|XP_009408540.1| PREDICTED: glutaredoxin-C9-like [Musa acuminata subsp. malaccensis]
Length=121

 Score = 63.2 bits (152),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GG+ LGG+E VM+CHING+LVPLLK AGAL
Sbjct  84   VPAVFIGGQLLGGVEKVMSCHINGSLVPLLKQAGAL  119



>ref|XP_004134909.1| PREDICTED: glutaredoxin-C9-like [Cucumis sativus]
 ref|XP_004168781.1| PREDICTED: glutaredoxin-C9-like [Cucumis sativus]
 gb|KGN49415.1| hypothetical protein Csa_6G524040 [Cucumis sativus]
Length=116

 Score = 62.8 bits (151),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGKFLGG+ET+M+ HING+LVPLLK AGAL
Sbjct  79   IPAVFVGGKFLGGLETLMSSHINGSLVPLLKQAGAL  114



>ref|XP_010054255.1| PREDICTED: glutaredoxin-C9-like [Eucalyptus grandis]
Length=144

 Score = 62.8 bits (151),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGKFLGG++T+MACHING+LVPLLK+A AL
Sbjct  82   LPAVFVGGKFLGGLKTLMACHINGSLVPLLKNASAL  117



>ref|XP_004305851.1| PREDICTED: glutaredoxin-C9-like [Fragaria vesca subsp. vesca]
Length=124

 Score = 62.0 bits (149),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKF+GG+E +MACHING LVPLLK +GAL
Sbjct  87   VPAVFIGGKFVGGVEALMACHINGNLVPLLKHSGAL  122



>ref|XP_004488305.1| PREDICTED: glutaredoxin-C9-like [Cicer arietinum]
Length=134

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGKFLGG++T+M  HI+GTLVPLLK+AGAL
Sbjct  97   IPAVFVGGKFLGGVQTLMTNHIHGTLVPLLKEAGAL  132



>ref|XP_008652019.1| PREDICTED: glutaredoxin-C9-like [Zea mays]
 tpg|DAA59548.1| TPA: hypothetical protein ZEAMMB73_481275 [Zea mays]
Length=159

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  99   VFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VFVGG+ LGG+E VMACHINGTLVPLLK AGAL
Sbjct  125  VFVGGRLLGGVEKVMACHINGTLVPLLKQAGAL  157



>gb|AHM25912.1| glutaredoxin 2 [Salvia miltiorrhiza f. alba]
Length=123

 Score = 60.5 bits (145),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGK +G I+TV+A HING+LVPLLKDAGAL
Sbjct  86   VPAVFIGGKLVGAIDTVLASHINGSLVPLLKDAGAL  121



>ref|XP_007161691.1| hypothetical protein PHAVU_001G090300g [Phaseolus vulgaris]
 gb|ESW33685.1| hypothetical protein PHAVU_001G090300g [Phaseolus vulgaris]
Length=126

 Score = 59.7 bits (143),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMACHINGTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLVGTMDRVMACHINGTLVPLLKEAGAL  124



>ref|XP_003548512.1| PREDICTED: glutaredoxin-C5-like [Glycine max]
Length=134

 Score = 59.7 bits (143),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMACHINGTLVPLLK+AGAL
Sbjct  97   VPVVFIGGKLVGTMDRVMACHINGTLVPLLKEAGAL  132



>ref|XP_003553278.1| PREDICTED: glutaredoxin-C3-like [Glycine max]
Length=132

 Score = 59.7 bits (143),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMACHINGTLVPLLK+AGAL
Sbjct  95   VPVVFIGGKLVGTMDRVMACHINGTLVPLLKEAGAL  130



>ref|XP_003622060.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES78278.1| glutaredoxin-C3-like protein [Medicago truncatula]
Length=301

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMACHING+LVPLLK AGAL
Sbjct  87   VPVVFIGGKLIGTMDRVMACHINGSLVPLLKQAGAL  122



>ref|XP_002272852.1| PREDICTED: glutaredoxin-C1 [Vitis vinifera]
Length=123

 Score = 59.3 bits (142),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLKDAGAL
Sbjct  86   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKDAGAL  121



>emb|CDX69609.1| BnaA10g19580D [Brassica napus]
Length=101

 Score = 58.9 bits (141),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK LG +E VMA HING+LVPLLKDAGAL
Sbjct  64   LPVVFIGGKMLGSMERVMASHINGSLVPLLKDAGAL  99



>ref|XP_010522588.1| PREDICTED: monothiol glutaredoxin-S13 [Tarenaya hassleriana]
Length=154

 Score = 59.3 bits (142),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK  GG+ETVMA HING LVP+L+ AGAL
Sbjct  117  LPVVFIGGKLFGGLETVMAAHINGDLVPILRQAGAL  152



>gb|KDP26855.1| hypothetical protein JCGZ_18013 [Jatropha curcas]
Length=125

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G I+ VMA HINGTLVPLLK+AGAL
Sbjct  88   VPVVFIGGKLVGAIDRVMASHINGTLVPLLKEAGAL  123



>ref|XP_007043882.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOX99713.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=124

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLKDAGAL
Sbjct  87   VPVVFIGGKLIGAMDRVMASHINGTLVPLLKDAGAL  122



>ref|XP_010087002.1| hypothetical protein L484_005898 [Morus notabilis]
 gb|EXB25442.1| hypothetical protein L484_005898 [Morus notabilis]
Length=155

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -1

Query  90   GGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            GGK LGG+ET+MACHINGTLVPLLKDAGAL
Sbjct  124  GGKLLGGVETLMACHINGTLVPLLKDAGAL  153



>ref|XP_004492160.1| PREDICTED: glutaredoxin-C3-like [Cicer arietinum]
Length=133

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GG+ +G ++ VMACHINGTLVPLLK AGAL
Sbjct  96   VPVVFIGGQLIGTMDRVMACHINGTLVPLLKQAGAL  131



>gb|ADE77735.1| unknown [Picea sitchensis]
Length=132

 Score = 58.5 bits (140),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPA+FVGGK +GG++ VMA HING+LVPLLK+AGAL
Sbjct  95   VPAIFVGGKLVGGLDRVMASHINGSLVPLLKEAGAL  130



>ref|XP_004288932.1| PREDICTED: glutaredoxin-C1-like [Fragaria vesca subsp. vesca]
Length=129

 Score = 58.5 bits (140),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKFLG +E +MA HING LVPLLK +GAL
Sbjct  92   VPAVFIGGKFLGAVEALMAYHINGNLVPLLKHSGAL  127



>ref|XP_009593680.1| PREDICTED: glutaredoxin-C1-like [Nicotiana tomentosiformis]
Length=131

 Score = 58.5 bits (140),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VFVGGK +G ++ VMA HING+LVPLL+DAGAL
Sbjct  94   VPVVFVGGKLIGAMDRVMASHINGSLVPLLRDAGAL  129



>gb|AFK35832.1| unknown [Medicago truncatula]
Length=124

 Score = 58.5 bits (140),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMACHING+LVPLLK AGAL
Sbjct  87   VPVVFIGGKLIGTMDRVMACHINGSLVPLLKQAGAL  122



>gb|AES65786.2| glutaredoxin-C1 protein [Medicago truncatula]
Length=133

 Score = 58.5 bits (140),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKF+GG++T+M  H+NGTL+PLLK+ GAL
Sbjct  96   VPAVFIGGKFVGGVQTLMTNHLNGTLIPLLKEVGAL  131



>ref|XP_002264542.2| PREDICTED: glutaredoxin-C1-like [Vitis vinifera]
Length=131

 Score = 58.5 bits (140),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G +++VMA HINGTLVPLLK+AGAL
Sbjct  94   VPVVFIGGKLVGSMDSVMASHINGTLVPLLKEAGAL  129



>ref|XP_010243568.1| PREDICTED: monothiol glutaredoxin-S10-like [Nelumbo nucifera]
Length=102

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKF+G  + VMA HING+L+PLLK+AGA+
Sbjct  65   VPAVFIGGKFIGSTQKVMALHINGSLIPLLKEAGAI  100



>ref|XP_003595535.1| Glutaredoxin-C7 [Medicago truncatula]
Length=124

 Score = 58.2 bits (139),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKF+GG++T+M  H+NGTL+PLLK+ GAL
Sbjct  87   VPAVFIGGKFVGGVQTLMTNHLNGTLIPLLKEVGAL  122



>gb|KCW61905.1| hypothetical protein EUGRSUZ_H04601 [Eucalyptus grandis]
Length=186

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  149  VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  184



>ref|XP_006438817.1| hypothetical protein CICLE_v10033688mg [Citrus clementina]
 gb|ESR52057.1| hypothetical protein CICLE_v10033688mg [Citrus clementina]
Length=139

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  102  VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  137



>gb|KHN09956.1| Glutaredoxin-C9 [Glycine soja]
Length=134

 Score = 58.2 bits (139),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGGKF GG+E +MA HI+G LVP+LKDAGAL
Sbjct  98   PAVFVGGKFFGGLERLMATHISGELVPILKDAGAL  132



>ref|XP_004310231.1| PREDICTED: glutaredoxin-C1-like [Fragaria vesca subsp. vesca]
Length=130

 Score = 58.2 bits (139),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  93   VPVVFIGGKLIGAMDRVMASHINGSLVPLLKEAGAL  128



>ref|XP_003541520.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=136

 Score = 58.2 bits (139),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGGKF GG+E +MA HI+G LVP+LKDAGAL
Sbjct  100  PAVFVGGKFFGGLERLMATHISGELVPILKDAGAL  134



>gb|KDO83116.1| hypothetical protein CISIN_1g039295mg [Citrus sinensis]
Length=139

 Score = 57.8 bits (138),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  102  VPIVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  137



>ref|XP_009613036.1| PREDICTED: glutaredoxin-C7-like [Nicotiana tomentosiformis]
Length=123

 Score = 57.8 bits (138),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK +G +++VMA HINGTLVPLLK+AGAL
Sbjct  87   PVVFIGGKLVGAMDSVMAAHINGTLVPLLKEAGAL  121



>emb|CAN67225.1| hypothetical protein VITISV_043905 [Vitis vinifera]
 emb|CBI38163.3| unnamed protein product [Vitis vinifera]
Length=107

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G +++VMA HINGTLVPLLK+AGAL
Sbjct  70   VPVVFIGGKLVGSMDSVMASHINGTLVPLLKEAGAL  105



>ref|XP_004239526.1| PREDICTED: glutaredoxin-C1 [Solanum lycopersicum]
Length=131

 Score = 57.8 bits (138),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  94   VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  129



>gb|KFK25638.1| hypothetical protein AALP_AA8G140700 [Arabis alpina]
Length=139

 Score = 57.8 bits (138),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  102  LPVVFIGGKMVGAMERVMASHINGSLVPLLKDAGAL  137



>ref|XP_002514866.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF47420.1| glutaredoxin, grx, putative [Ricinus communis]
Length=128

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  91   VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  126



>ref|XP_008459889.1| PREDICTED: glutaredoxin-C1-like [Cucumis melo]
Length=128

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  91   VPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGAL  126



>ref|XP_008347995.1| PREDICTED: glutaredoxin-C5-like [Malus domestica]
Length=126

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  124



>ref|XP_007216287.1| hypothetical protein PRUPE_ppa020474mg [Prunus persica]
 ref|XP_008231071.1| PREDICTED: glutaredoxin-C5-like [Prunus mume]
 gb|EMJ17486.1| hypothetical protein PRUPE_ppa020474mg [Prunus persica]
Length=125

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  88   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  123



>ref|NP_196911.1| glutaredoxin ROXY2 [Arabidopsis thaliana]
 ref|XP_002871600.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 sp|Q8LF89.2|GRXC8_ARATH RecName: Full=Glutaredoxin-C8; Short=AtGrxC8; AltName: Full=Protein 
ROXY 2 [Arabidopsis thaliana]
 gb|AAK32815.1|AF361802_1 AT5g14070/MUA22_7 [Arabidopsis thaliana]
 dbj|BAB08286.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|AAL05901.1| AT5g14070/MUA22_7 [Arabidopsis thaliana]
 gb|ABY55157.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|EFH47859.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AED91984.1| glutaredoxin ROXY2 [Arabidopsis thaliana]
Length=140

 Score = 57.8 bits (138),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  103  LPVVFIGGKMVGAMERVMASHINGSLVPLLKDAGAL  138



>ref|XP_007031936.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOY02862.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=125

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  88   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  123



>ref|XP_009801947.1| PREDICTED: glutaredoxin-C5-like [Nicotiana sylvestris]
Length=132

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  95   VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  130



>ref|XP_009592444.1| PREDICTED: glutaredoxin-C5-like [Nicotiana tomentosiformis]
Length=132

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  95   VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  130



>gb|AGX01499.1| glutaredoxin [Cucumis sativus]
 gb|KGN46432.1| hypothetical protein Csa_6G092540 [Cucumis sativus]
Length=128

 Score = 57.4 bits (137),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  91   VPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGAL  126



>ref|XP_010249120.1| PREDICTED: glutaredoxin-C1-like [Nelumbo nucifera]
Length=123

 Score = 57.4 bits (137),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  86   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  121



>ref|XP_009346791.1| PREDICTED: glutaredoxin-C1 [Pyrus x bretschneideri]
Length=126

 Score = 57.4 bits (137),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  124



>ref|XP_006483043.1| PREDICTED: glutaredoxin-C5-like [Citrus sinensis]
Length=105

 Score = 57.0 bits (136),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  68   VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  103



>gb|AAM61544.1| glutaredoxin-like protein [Arabidopsis thaliana]
Length=104

 Score = 57.0 bits (136),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  67   LPVVFIGGKMVGAMERVMASHINGSLVPLLKDAGAL  102



>ref|XP_003593663.1| Glutaredoxin-C9 [Medicago truncatula]
 gb|ABN08731.1| Thioredoxin fold [Medicago truncatula]
 gb|AES63914.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=127

 Score = 57.4 bits (137),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGGK LGG+E VMA HI+G LVP+LKDAGAL
Sbjct  91   PAVFVGGKLLGGLERVMASHISGELVPILKDAGAL  125



>ref|XP_010250605.1| PREDICTED: glutaredoxin-C1-like [Nelumbo nucifera]
Length=123

 Score = 57.4 bits (137),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  86   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  121



>ref|XP_008341254.1| PREDICTED: glutaredoxin-C5-like [Malus domestica]
 ref|XP_009378005.1| PREDICTED: glutaredoxin-C5-like [Pyrus x bretschneideri]
 ref|XP_009350707.1| PREDICTED: glutaredoxin-C5-like [Pyrus x bretschneideri]
Length=126

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  124



>ref|XP_009386578.1| PREDICTED: glutaredoxin-C5-like [Musa acuminata subsp. malaccensis]
Length=107

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  70   VPVVFIGGKLVGAMDRVMAAHINGTLVPLLKEAGAL  105



>ref|XP_006363780.1| PREDICTED: glutaredoxin-C5-like [Solanum tuberosum]
Length=120

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GG+ +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  83   IPVVFIGGELIGSMDRVMASHINGTLVPLLKEAGAL  118



>ref|XP_006359084.1| PREDICTED: glutaredoxin-C5-like [Solanum tuberosum]
Length=134

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  97   VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  132



>gb|EYU31846.1| hypothetical protein MIMGU_mgv1a026975mg [Erythranthe guttata]
Length=140

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGK +G +++VMA HI+GTLVPLLK AGAL
Sbjct  103  VPAVFIGGKLVGSMDSVMASHISGTLVPLLKQAGAL  138



>ref|XP_002303767.1| hypothetical protein POPTR_0003s16540g [Populus trichocarpa]
 gb|EEE78746.1| hypothetical protein POPTR_0003s16540g [Populus trichocarpa]
Length=126

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G +E VMA HI+GTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLIGAMERVMASHISGTLVPLLKEAGAL  124



>ref|XP_004140545.1| PREDICTED: glutaredoxin-C3-like [Cucumis sativus]
 ref|XP_004170597.1| PREDICTED: glutaredoxin-C3-like [Cucumis sativus]
Length=115

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  78   VPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGAL  113



>ref|XP_009344217.1| PREDICTED: glutaredoxin-C5-like [Pyrus x bretschneideri]
Length=126

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  124



>ref|XP_011098924.1| PREDICTED: glutaredoxin-C1 [Sesamum indicum]
Length=129

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G +++VMA HI+GTLVPLLK+AGAL
Sbjct  92   VPLVFIGGKLVGAMDSVMASHISGTLVPLLKEAGAL  127



>ref|XP_006844586.1| hypothetical protein AMTR_s00016p00206670 [Amborella trichopoda]
 gb|ERN06261.1| hypothetical protein AMTR_s00016p00206670 [Amborella trichopoda]
Length=113

 Score = 56.6 bits (135),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  76   VPAVFIGGKLIGPMDRVMASHINGSLVPLLKEAGAL  111



>ref|XP_009758965.1| PREDICTED: glutaredoxin-C1-like [Nicotiana sylvestris]
Length=131

 Score = 57.0 bits (136),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VFVGGK +G ++ VMA HING+LVPLL++AGAL
Sbjct  94   VPVVFVGGKLIGAMDRVMASHINGSLVPLLREAGAL  129



>ref|XP_003621773.1| Glutaredoxin [Medicago truncatula]
 gb|AES77991.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=132

 Score = 57.0 bits (136),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ V+A HING+LVPLLKDAGAL
Sbjct  95   LPVVFIGGKLVGSMDRVLAFHINGSLVPLLKDAGAL  130



>ref|XP_009349478.1| PREDICTED: glutaredoxin-C1-like [Pyrus x bretschneideri]
Length=127

 Score = 56.6 bits (135),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK LG ++ VMA HING+LVPLLK+AGAL
Sbjct  90   VPVVFIGGKLLGAMDRVMASHINGSLVPLLKEAGAL  125



>ref|XP_009421048.1| PREDICTED: glutaredoxin-C5 [Musa acuminata subsp. malaccensis]
Length=135

 Score = 57.0 bits (136),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  98   VPVVFIGGKLVGAMDRVMAAHINGTLVPLLKEAGAL  133



>ref|XP_011045755.1| PREDICTED: glutaredoxin-C1 [Populus euphratica]
 ref|XP_011015327.1| PREDICTED: glutaredoxin-C1-like [Populus euphratica]
Length=123

 Score = 56.6 bits (135),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  86   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  121



>ref|XP_011036126.1| PREDICTED: glutaredoxin-C1-like [Populus euphratica]
Length=126

 Score = 56.6 bits (135),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G +E VMA HI+GTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLIGAMERVMASHISGTLVPLLKEAGAL  124



>ref|XP_011020819.1| PREDICTED: glutaredoxin-C1-like [Populus euphratica]
Length=126

 Score = 56.6 bits (135),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G +E VMA HI+GTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLIGAMERVMASHISGTLVPLLKEAGAL  124



>ref|XP_003579657.1| PREDICTED: glutaredoxin-C5-like [Brachypodium distachyon]
Length=137

 Score = 56.6 bits (135),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  100  VPVVFIGGKLVGAMDRVMAAHINGSLVPLLKDAGAL  135



>gb|KDO63867.1| hypothetical protein CISIN_1g033109mg [Citrus sinensis]
Length=127

 Score = 56.6 bits (135),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  90   VPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGAL  125



>ref|XP_010024181.1| PREDICTED: glutaredoxin-C1 [Eucalyptus grandis]
 gb|KCW60633.1| hypothetical protein EUGRSUZ_H03357 [Eucalyptus grandis]
Length=126

 Score = 56.6 bits (135),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  124



>ref|XP_006399915.1| hypothetical protein EUTSA_v10015899mg [Eutrema salsugineum]
 gb|ESQ41368.1| hypothetical protein EUTSA_v10015899mg [Eutrema salsugineum]
Length=139

 Score = 56.6 bits (135),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  102  LPVVFIGGKMVGSMERVMASHINGSLVPLLKDAGAL  137



>ref|XP_008779419.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
Length=126

 Score = 56.6 bits (135),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  124



>ref|XP_008775588.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
 ref|XP_010908168.1| PREDICTED: glutaredoxin-C1-like [Elaeis guineensis]
Length=126

 Score = 56.6 bits (135),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  124



>ref|XP_004171791.1| PREDICTED: glutaredoxin-C1-like [Cucumis sativus]
Length=112

 Score = 56.2 bits (134),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HI+GTLVPLLKDAGAL
Sbjct  75   VPVVFIGGKLVGAMDRVMASHISGTLVPLLKDAGAL  110



>gb|AGX01496.1| glutaredoxin [Cucumis sativus]
Length=112

 Score = 56.2 bits (134),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HI+GTLVPLLKDAGAL
Sbjct  75   VPVVFIGGKLVGAMDRVMASHISGTLVPLLKDAGAL  110



>ref|XP_004148005.1| PREDICTED: glutaredoxin-C1-like [Cucumis sativus]
 ref|XP_004161507.1| PREDICTED: glutaredoxin-C1-like [Cucumis sativus]
 gb|KGN58154.1| hypothetical protein Csa_3G563270 [Cucumis sativus]
Length=127

 Score = 56.6 bits (135),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGK +G ++ VMA HING+LVPLLK AGAL
Sbjct  90   VPAVFIGGKLIGSMDRVMASHINGSLVPLLKSAGAL  125



>ref|XP_008441305.1| PREDICTED: glutaredoxin-C1-like [Cucumis melo]
Length=124

 Score = 56.6 bits (135),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VFVGGK +G ++ VMA HI+GTLVPLLKDAGAL
Sbjct  87   VPVVFVGGKLVGAMDRVMASHISGTLVPLLKDAGAL  122



>ref|XP_003621763.1| Glutaredoxin [Medicago truncatula]
 gb|AES77981.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=132

 Score = 56.6 bits (135),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ V+A HING+LVPLLKDAGAL
Sbjct  95   LPVVFIGGKLVGSMDRVLAFHINGSLVPLLKDAGAL  130



>ref|XP_004138799.1| PREDICTED: glutaredoxin-C1-like [Cucumis sativus]
 gb|KGN63150.1| hypothetical protein Csa_2G405010 [Cucumis sativus]
Length=124

 Score = 56.2 bits (134),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HI+GTLVPLLKDAGAL
Sbjct  87   VPVVFIGGKLVGAMDRVMASHISGTLVPLLKDAGAL  122



>emb|CDP13384.1| unnamed protein product [Coffea canephora]
Length=138

 Score = 56.6 bits (135),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  101  VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  136



>emb|CDX91084.1| BnaC02g05130D [Brassica napus]
Length=137

 Score = 56.6 bits (135),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  100  LPVVFIGGKMVGAMERVMASHINGSLVPLLKDAGAL  135



>emb|CDX70540.1| BnaC03g06240D [Brassica napus]
Length=137

 Score = 56.6 bits (135),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  100  LPVVFIGGKMVGSMERVMASHINGSLVPLLKDAGAL  135



>ref|XP_009125958.1| PREDICTED: glutaredoxin-C8 [Brassica rapa]
 emb|CDX85614.1| BnaA02g01990D [Brassica napus]
Length=137

 Score = 56.2 bits (134),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  100  LPVVFIGGKMVGAMERVMASHINGSLVPLLKDAGAL  135



>ref|XP_009792873.1| PREDICTED: glutaredoxin-C9-like [Nicotiana sylvestris]
Length=145

 Score = 56.2 bits (134),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGK LGG+E VM  HI+G LVPLLK AGAL
Sbjct  108  LPAVFVGGKLLGGVEKVMETHISGELVPLLKQAGAL  143



>ref|XP_008450140.1| PREDICTED: glutaredoxin-C1-like [Cucumis melo]
Length=127

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGK +G ++ VMA HING+LVPLLK AGAL
Sbjct  90   VPAVFIGGKLIGSMDRVMASHINGSLVPLLKSAGAL  125



>ref|XP_009131384.1| PREDICTED: glutaredoxin-C8-like [Brassica rapa]
Length=161

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  124  LPVVFIGGKMVGSMERVMASHINGSLVPLLKDAGAL  159



>ref|NP_001150763.1| Grx_C8 - glutaredoxin subgroup III [Zea mays]
 gb|ACG40285.1| Grx_C8 - glutaredoxin subgroup III [Zea mays]
 tpg|DAA38111.1| TPA: grx_C8-glutaredoxin subgroup III [Zea mays]
Length=137

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GG+ +G ++ VMA HINGTLVPLLKDAGAL
Sbjct  100  VPVVFIGGRLVGAMDRVMAAHINGTLVPLLKDAGAL  135



>ref|XP_006288869.1| hypothetical protein CARUB_v10002222mg [Capsella rubella]
 gb|EOA21767.1| hypothetical protein CARUB_v10002222mg [Capsella rubella]
Length=140

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  103  LPVVFIGGKMVGAMERVMASHINGSLVPLLKDAGAL  138



>ref|XP_006447012.1| hypothetical protein CICLE_v10017534mg [Citrus clementina]
 ref|XP_006468831.1| PREDICTED: glutaredoxin-C3-like [Citrus sinensis]
 gb|ESR60252.1| hypothetical protein CICLE_v10017534mg [Citrus clementina]
Length=127

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  90   VPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGAL  125



>ref|XP_009611400.1| PREDICTED: glutaredoxin-C9-like [Nicotiana tomentosiformis]
Length=129

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGK LGG+E VM  HI+G LVPLLK AGAL
Sbjct  92   LPAVFVGGKLLGGVERVMETHISGELVPLLKKAGAL  127



>ref|XP_009803758.1| PREDICTED: glutaredoxin-C7-like [Nicotiana sylvestris]
Length=123

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK +G +++VMA HINGTLVPLLK+AGAL
Sbjct  87   PVVFIGGKLVGAMDSVMAAHINGTLVPLLKEAGAL  121



>ref|XP_009121702.1| PREDICTED: glutaredoxin-C8-like [Brassica rapa]
Length=134

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  97   LPVVFIGGKMVGSMERVMASHINGSLVPLLKDAGAL  132



>ref|XP_004304538.1| PREDICTED: glutaredoxin-C7-like [Fragaria vesca subsp. vesca]
Length=125

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK AGAL
Sbjct  88   VPVVFIGGKLVGTMDRVMASHINGSLVPLLKQAGAL  123



>gb|AFK35318.1| unknown [Lotus japonicus]
Length=165

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK  GG+E +MA HI+G LVPLLK AGAL
Sbjct  129  PVVFIGGKLFGGLERLMATHISGELVPLLKQAGAL  163



>ref|XP_003575027.1| PREDICTED: glutaredoxin-C3-like [Brachypodium distachyon]
Length=135

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GG+ +G ++ VMA HING+LVPLLKDAGAL
Sbjct  98   VPVVFIGGRLVGAMDRVMAAHINGSLVPLLKDAGAL  133



>ref|XP_009336451.1| PREDICTED: glutaredoxin-C1-like [Pyrus x bretschneideri]
Length=127

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  90   VPVVFIGGKLIGAMDRVMASHINGSLVPLLKEAGAL  125



>ref|XP_003616226.1| Glutaredoxin-C9 [Medicago truncatula]
 gb|AES99184.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=123

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFV GKFLGG+E ++A HING L+PLLK+AGAL
Sbjct  86   LPAVFVCGKFLGGVEILLAKHINGALIPLLKEAGAL  121



>ref|XP_004296803.1| PREDICTED: monothiol glutaredoxin-S10-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKF+G   TVM  H+NGTL  LLKDAGAL
Sbjct  65   VPAVFIGGKFVGSANTVMTLHLNGTLKKLLKDAGAL  100



>ref|XP_010680093.1| PREDICTED: glutaredoxin-C3 [Beta vulgaris subsp. vulgaris]
Length=109

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VFVGG+ LG ++ VMA HING+LVPLLK AGAL
Sbjct  72   VPVVFVGGQLLGAMDRVMASHINGSLVPLLKQAGAL  107



>ref|XP_007156490.1| hypothetical protein PHAVU_003G290400g [Phaseolus vulgaris]
 gb|ESW28484.1| hypothetical protein PHAVU_003G290400g [Phaseolus vulgaris]
Length=147

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFV GK+ GG+E VMA HI+G LVP+LKDAGAL
Sbjct  111  PAVFVSGKYFGGLERVMAKHISGELVPILKDAGAL  145



>ref|XP_010496441.1| PREDICTED: glutaredoxin-C7, partial [Camelina sativa]
Length=105

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  68   LPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  103



>ref|XP_002300130.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE84935.1| glutaredoxin family protein [Populus trichocarpa]
Length=123

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  86   VPVVFIGGKLVGAMDRVMASHINGSLVPLLKEAGAL  121



>ref|XP_010496424.1| PREDICTED: glutaredoxin-C7 [Camelina sativa]
Length=137

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  100  LPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  135



>ref|XP_010025281.1| PREDICTED: glutaredoxin-C5-like [Eucalyptus grandis]
Length=141

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  104  VPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGAL  139



>ref|XP_008389917.1| PREDICTED: glutaredoxin-C1-like [Malus domestica]
Length=127

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  90   VPVVFIGGKLIGAMDRVMASHINGSLVPLLKEAGAL  125



>ref|XP_002509419.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF50806.1| glutaredoxin, grx, putative [Ricinus communis]
Length=146

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI+G LVP+LKDAGAL
Sbjct  110  PVVFVGGKLFGGLERVMATHISGELVPILKDAGAL  144



>ref|XP_010492199.1| PREDICTED: glutaredoxin-C8 [Camelina sativa]
Length=139

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLK+AGAL
Sbjct  102  LPVVFIGGKMVGSMERVMASHINGSLVPLLKNAGAL  137



>ref|XP_004228854.1| PREDICTED: glutaredoxin-C1-like [Solanum lycopersicum]
Length=120

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GG+ +G ++ VMA HINGTLVP LK+AGAL
Sbjct  83   VPVVFIGGELIGSMDRVMASHINGTLVPRLKEAGAL  118



>emb|CDX91918.1| BnaC03g32200D [Brassica napus]
Length=134

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  97   LPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  132



>ref|XP_006408562.1| hypothetical protein EUTSA_v10022308mg [Eutrema salsugineum]
 gb|ESQ50015.1| hypothetical protein EUTSA_v10022308mg [Eutrema salsugineum]
Length=137

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  100  LPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  135



>ref|XP_010420029.1| PREDICTED: glutaredoxin-C8-like [Camelina sativa]
Length=139

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLK+AGAL
Sbjct  102  LPVVFIGGKMVGSMERVMASHINGSLVPLLKNAGAL  137



>ref|XP_004505534.1| PREDICTED: glutaredoxin-C9-like [Cicer arietinum]
Length=151

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GGK  GG++ +MA HI+G LVP+LK AGAL
Sbjct  115  PAVFIGGKLFGGLDRIMATHISGELVPILKQAGAL  149



>ref|XP_010453518.1| PREDICTED: glutaredoxin-C8-like [Camelina sativa]
Length=139

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLK+AGAL
Sbjct  102  LPVVFIGGKMVGSMERVMASHINGSLVPLLKNAGAL  137



>ref|XP_002452160.1| hypothetical protein SORBIDRAFT_04g020790 [Sorghum bicolor]
 gb|EES05136.1| hypothetical protein SORBIDRAFT_04g020790 [Sorghum bicolor]
Length=129

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  92   VPVVFIGGKLVGAMDRVMAAHINGSLVPLLKEAGAL  127



>ref|NP_001147159.1| Grx_C8 - glutaredoxin subgroup III [Zea mays]
 gb|ACG25746.1| Grx_C8 - glutaredoxin subgroup III [Zea mays]
 gb|ACG41465.1| Grx_C8 - glutaredoxin subgroup III [Zea mays]
 gb|AFW71567.1| grx_C8-glutaredoxin subgroup III [Zea mays]
Length=130

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  93   VPVVFIGGKLVGAMDRVMAAHINGSLVPLLKEAGAL  128



>ref|NP_001046942.1| Os02g0512400 [Oryza sativa Japonica Group]
 sp|Q6K609.1|GRXC3_ORYSJ RecName: Full=Glutaredoxin-C3; AltName: Full=Protein ROXY 2 [Oryza 
sativa Japonica Group]
 dbj|BAD23238.1| glutaredoxin-like [Oryza sativa Japonica Group]
 dbj|BAF08856.1| Os02g0512400 [Oryza sativa Japonica Group]
 gb|EAY86020.1| hypothetical protein OsI_07381 [Oryza sativa Indica Group]
 gb|EAZ23199.1| hypothetical protein OsJ_06884 [Oryza sativa Japonica Group]
 dbj|BAG93464.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACL68663.1| ROXY2 [Oryza sativa Japonica Group]
Length=135

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  98   VPVVFIGGKLVGAMDRVMAAHINGSLVPLLKEAGAL  133



>ref|XP_004228431.1| PREDICTED: glutaredoxin-C1-like [Solanum lycopersicum]
Length=120

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GG  +G ++TVMA HINGTLVPLLK+AGAL
Sbjct  83   IPVVFIGGDLIGSMDTVMASHINGTLVPLLKEAGAL  118



>ref|XP_008340253.1| PREDICTED: glutaredoxin-C1-like [Malus domestica]
Length=127

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  90   VPVVFIGGKLVGAMDRVMASHINGSLVPLLKEAGAL  125



>ref|XP_007227610.1| hypothetical protein PRUPE_ppa021177mg [Prunus persica]
 gb|EMJ28809.1| hypothetical protein PRUPE_ppa021177mg [Prunus persica]
Length=126

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  89   VPVVFIGGKLIGTMDRVMASHINGSLVPLLKEAGAL  124



>gb|EYU34823.1| hypothetical protein MIMGU_mgv1a026293mg, partial [Erythranthe 
guttata]
Length=103

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GG  +GGI+ V+A HINGTLVPLL+ AGAL
Sbjct  66   VPVVFIGGNLVGGIDAVLASHINGTLVPLLRQAGAL  101



>ref|XP_008222218.1| PREDICTED: glutaredoxin-C1-like [Prunus mume]
Length=127

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  90   VPVVFIGGKLIGTMDRVMASHINGSLVPLLKEAGAL  125



>ref|XP_010524249.1| PREDICTED: glutaredoxin-C8 [Tarenaya hassleriana]
Length=131

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VFVGGK LG ++ VMA HING+LVPLLK AGAL
Sbjct  94   LPVVFVGGKLLGAMDAVMASHINGSLVPLLKQAGAL  129



>ref|XP_009631625.1| PREDICTED: uncharacterized protein LOC104121354 [Nicotiana tomentosiformis]
Length=271

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGG+  GGIE VM+ HI+G LVP+LK+AGAL
Sbjct  235  PVVFVGGRLFGGIERVMSTHISGELVPILKEAGAL  269



>ref|XP_002299331.2| hypothetical protein POPTR_0001s13440g [Populus trichocarpa]
 gb|EEE84136.2| hypothetical protein POPTR_0001s13440g [Populus trichocarpa]
Length=126

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HI+GTLVPLLK+AGAL
Sbjct  89   VPVVFIGGKLIGAMDRVMASHISGTLVPLLKEAGAL  124



>ref|XP_010682698.1| PREDICTED: glutaredoxin-C3-like [Beta vulgaris subsp. vulgaris]
Length=123

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  86   VPVVFIGGKLVGAMDRVMASHINGSLVPLLKEAGAL  121



>emb|CDX78558.1| BnaA03g04700D [Brassica napus]
Length=137

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G +E VMA HING+LVPLLKDAGAL
Sbjct  100  LPVVFIGGKMVGSMERVMASHINGSLVPLLKDAGAL  135



>gb|AAL35982.1|AF104395_1 glutaredoxin-like protein [Cucumis sativus]
Length=37

 Score = 53.5 bits (127),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK  GG+E VMA HI+G LVP LKDAGAL
Sbjct  1    PMVFIGGKMFGGLEKVMAAHISGELVPALKDAGAL  35



>ref|XP_009398966.1| PREDICTED: glutaredoxin-C9-like [Musa acuminata subsp. malaccensis]
Length=137

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  99   VFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VFVGGK LGG+E VM+CHING+LVPLLK AGAL
Sbjct  103  VFVGGKLLGGVEKVMSCHINGSLVPLLKQAGAL  135



>ref|XP_006363784.1| PREDICTED: glutaredoxin-C5-like [Solanum tuberosum]
Length=120

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GG+ +G ++ VM  HINGTLVP LKDAGAL
Sbjct  83   IPVVFIGGELIGPMDRVMTSHINGTLVPRLKDAGAL  118



>ref|XP_007025525.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOY28147.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=181

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGGK  GG++ VM+ HI+G LVP+LKDAGAL
Sbjct  145  PAVFVGGKLFGGLDRVMSTHISGELVPILKDAGAL  179



>ref|XP_008791106.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
 ref|XP_010929596.1| PREDICTED: glutaredoxin-C1-like [Elaeis guineensis]
Length=128

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  91   VPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGAL  126



>ref|NP_001147414.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
 gb|ACG27432.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
 gb|ACN27791.1| unknown [Zea mays]
 gb|AFW81126.1| grx_I1-glutaredoxin subgroup III [Zea mays]
Length=153

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGG+ LGG++ +MA HI+G LVP+LKDAGAL
Sbjct  116  LPAVFVGGRLLGGLDRLMAVHISGDLVPILKDAGAL  151



>ref|XP_011071245.1| PREDICTED: glutaredoxin-C5-like [Sesamum indicum]
Length=127

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GG+ +G ++ VMA HINGTLVPLLK+AGAL
Sbjct  90   VPVVFIGGRLVGAMDRVMASHINGTLVPLLKEAGAL  125



>ref|XP_007149799.1| hypothetical protein PHAVU_005G099700g [Phaseolus vulgaris]
 gb|ESW21793.1| hypothetical protein PHAVU_005G099700g [Phaseolus vulgaris]
Length=157

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GGK  GG++ +MA HI+G LVPLLK AGAL
Sbjct  121  PAVFIGGKLFGGLDRIMATHISGELVPLLKQAGAL  155



>ref|XP_002963851.1| hypothetical protein SELMODRAFT_80143 [Selaginella moellendorffii]
 ref|XP_002971801.1| CC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ27550.1| CC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ35722.1| hypothetical protein SELMODRAFT_80143 [Selaginella moellendorffii]
Length=103

 Score = 54.3 bits (129),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +GG++ VMA HI+G+LVP LK+AGAL
Sbjct  66   VPTVFIGGKLIGGLDQVMAAHISGSLVPQLKEAGAL  101



>gb|KDP41803.1| hypothetical protein JCGZ_26821 [Jatropha curcas]
Length=127

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK AGAL
Sbjct  90   VPVVFIGGKLVGAMDRVMASHINGSLVPLLKQAGAL  125



>gb|EMT07309.1| Glutaredoxin-C3 [Aegilops tauschii]
Length=134

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  97   VPVVFIGGKLVGAMDRVMAAHINGSLVPLLKEAGAL  132



>gb|ACG48030.1| Grx_S2 - glutaredoxin subgroup III [Zea mays]
Length=140

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGG+ LGG++ +MA HI+G LVP+LKDAGAL
Sbjct  103  LPAVFVGGRLLGGLDRLMAVHISGDLVPILKDAGAL  138



>ref|XP_011027761.1| PREDICTED: glutaredoxin-C9 [Populus euphratica]
Length=156

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E +MA HI G LVP+LKDAGAL
Sbjct  120  PVVFVGGKLFGGLERIMASHITGELVPILKDAGAL  154



>ref|XP_006377423.1| glutaredoxin-like family protein [Populus trichocarpa]
 gb|ERP55220.1| glutaredoxin-like family protein [Populus trichocarpa]
Length=152

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI G LVP+LKDAGAL
Sbjct  116  PVVFVGGKLFGGLERVMATHITGELVPILKDAGAL  150



>gb|EAZ30562.1| hypothetical protein OsJ_14612 [Oryza sativa Japonica Group]
Length=135

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  98   VPVVFIGGKLVGAMDRVMAAHINGSLVPLLKEAGAL  133



>ref|XP_008225159.1| PREDICTED: glutaredoxin-C9-like [Prunus mume]
Length=142

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGGK  GG+E VMA HI+G LVP+LK AGAL
Sbjct  106  PAVFVGGKLFGGLERVMATHISGELVPVLKQAGAL  140



>ref|XP_011001218.1| PREDICTED: glutaredoxin-C9-like [Populus euphratica]
Length=152

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI G LVP+LKDAGAL
Sbjct  116  PVVFVGGKLFGGLERVMATHITGELVPILKDAGAL  150



>ref|XP_006836357.1| hypothetical protein AMTR_s00092p00109090 [Amborella trichopoda]
 gb|ERM99210.1| hypothetical protein AMTR_s00092p00109090 [Amborella trichopoda]
Length=122

 Score = 54.3 bits (129),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGG+ +GG+E V+ACHI+G LVPLLK+AGAL
Sbjct  85   LPAVFVGGRLVGGLERVVACHISGGLVPLLKEAGAL  120



>ref|XP_011086843.1| PREDICTED: glutaredoxin-C5-like [Sesamum indicum]
Length=125

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HI+GTLVPLLK+AGAL
Sbjct  88   VPVVFIGGKLIGAMDRVMASHISGTLVPLLKEAGAL  123



>ref|XP_003621774.1| Glutaredoxin [Medicago truncatula]
 gb|AES77992.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=132

 Score = 54.3 bits (129),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ V+A HIN +L+PLLKDAGAL
Sbjct  95   LPVVFIGGKLVGSMDRVLAFHINSSLIPLLKDAGAL  130



>ref|XP_008353233.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
 ref|XP_008361968.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
Length=102

 Score = 53.9 bits (128),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKF+G   TVM  H+NG+L  LLKDAGAL
Sbjct  65   VPAVFIGGKFVGSANTVMTLHLNGSLKKLLKDAGAL  100



>ref|XP_010090679.1| hypothetical protein L484_017485 [Morus notabilis]
 gb|EXB40343.1| hypothetical protein L484_017485 [Morus notabilis]
Length=127

 Score = 54.3 bits (129),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ VMA HING+LVPLLK+AGAL
Sbjct  90   VPVVFIGGKLVGAMDHVMASHINGSLVPLLKEAGAL  125



>ref|XP_011097396.1| PREDICTED: glutaredoxin-C5 [Sesamum indicum]
Length=100

 Score = 53.9 bits (128),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +GG++ VM  HI+GTLVPLLK+AGAL
Sbjct  63   VPVVFIGGKLVGGMDRVMGSHISGTLVPLLKEAGAL  98



>ref|XP_007043710.1| Glutaredoxin, putative [Theobroma cacao]
 gb|EOX99541.1| Glutaredoxin, putative [Theobroma cacao]
Length=145

 Score = 54.3 bits (129),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVF+GG+  GG++ VMA HI+G LVP+LKDAGAL
Sbjct  108  LPAVFIGGRLFGGLDKVMATHISGELVPVLKDAGAL  143



>ref|XP_002440249.1| hypothetical protein SORBIDRAFT_09g028500 [Sorghum bicolor]
 gb|EES18679.1| hypothetical protein SORBIDRAFT_09g028500 [Sorghum bicolor]
Length=149

 Score = 54.3 bits (129),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGG+ LGG++  MA HI+G LVP+LKDAGAL
Sbjct  112  LPAVFVGGRLLGGLDRFMAVHISGDLVPILKDAGAL  147



>gb|EMT06809.1| Monothiol glutaredoxin-S5 [Aegilops tauschii]
Length=138

 Score = 54.3 bits (129),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGK LGG++ +MA HI+G LVP+LK AGAL
Sbjct  101  LPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGAL  136



>ref|XP_004293899.1| PREDICTED: glutaredoxin-C9-like [Fragaria vesca subsp. vesca]
Length=143

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI+G LVP+LK+AGAL
Sbjct  107  PVVFVGGKLFGGLEKVMATHISGELVPVLKEAGAL  141



>ref|XP_011043607.1| PREDICTED: glutaredoxin-C9-like [Populus euphratica]
Length=155

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PA+F+GGK  GG++T+MA HI+G LVP+LK+AGAL
Sbjct  119  PALFIGGKLFGGLDTLMATHISGELVPILKEAGAL  153



>ref|XP_009804127.1| PREDICTED: glutaredoxin-C9-like [Nicotiana sylvestris]
Length=167

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VM+ HI+G L+P+LK+AGAL
Sbjct  131  PVVFVGGKLFGGLERVMSTHISGELIPILKEAGAL  165



>ref|XP_008439802.1| PREDICTED: glutaredoxin-C9 [Cucumis melo]
Length=159

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK  GG+E VMA HI+G LVP LKDAGAL
Sbjct  123  PVVFIGGKMFGGLEKVMAAHISGELVPALKDAGAL  157



>ref|XP_002517842.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF44360.1| glutaredoxin, grx, putative [Ricinus communis]
Length=149

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVF+GG+  GG++ +MA HI+G LVP+LKDAGAL
Sbjct  112  LPAVFIGGRLFGGLDRLMATHISGELVPILKDAGAL  147



>ref|XP_003607518.1| Glutaredoxin-C9 [Medicago truncatula]
 gb|AES89715.1| glutaredoxin-C1 protein [Medicago truncatula]
 gb|AFK38565.1| unknown [Medicago truncatula]
Length=155

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GG   GG++ +MA HI+G LVP+LK AGAL
Sbjct  119  PAVFIGGNLFGGLDRIMATHISGELVPILKQAGAL  153



>ref|NP_001235378.1| uncharacterized protein LOC100306716 [Glycine max]
 gb|ACU15023.1| unknown [Glycine max]
 gb|KHM99714.1| Glutaredoxin-C9 [Glycine soja]
Length=173

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GGK  GG++ VMA HI+G LVP+LK+AGAL
Sbjct  137  PAVFIGGKLFGGLDKVMATHISGELVPILKEAGAL  171



>gb|KFK39447.1| hypothetical protein AALP_AA3G246300 [Arabis alpina]
Length=102

 Score = 53.5 bits (127),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKF+G   TVM  H+NG+L  LLKDAGAL
Sbjct  65   VPAVFVGGKFVGTANTVMTLHLNGSLKKLLKDAGAL  100



>ref|XP_007148105.1| hypothetical protein PHAVU_006G181300g [Phaseolus vulgaris]
 gb|ESW20099.1| hypothetical protein PHAVU_006G181300g [Phaseolus vulgaris]
Length=134

 Score = 53.9 bits (128),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+ GK  GG+E VMA HI+G LVP+LKDAGAL
Sbjct  98   PAVFLAGKLFGGLERVMATHISGELVPILKDAGAL  132



>ref|XP_003543019.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=133

 Score = 53.9 bits (128),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+ GK  GG+E VMA HI+G LVP+LKDAGAL
Sbjct  97   PAVFLAGKLFGGLERVMATHISGELVPILKDAGAL  131



>gb|KHN08482.1| Glutaredoxin-C9 [Glycine soja]
Length=134

 Score = 53.9 bits (128),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+ GK  GG+E VMA HI+G LVP+LKDAGAL
Sbjct  98   PAVFLAGKLFGGLERVMATHISGELVPILKDAGAL  132



>gb|KFK39456.1| hypothetical protein AALP_AA3G247200 [Arabis alpina]
Length=102

 Score = 53.5 bits (127),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKF+G   TVM  H+NG+L  LLKDAGAL
Sbjct  65   VPAVFVGGKFVGTANTVMTLHLNGSLKKLLKDAGAL  100



>ref|XP_004492067.1| PREDICTED: glutaredoxin-C5-like [Cicer arietinum]
 ref|XP_004492069.1| PREDICTED: glutaredoxin-C5-like [Cicer arietinum]
 ref|XP_004492071.1| PREDICTED: glutaredoxin-C5-like [Cicer arietinum]
Length=135

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++T++A H+NG+LVPLLK AGAL
Sbjct  98   LPVVFIGGKLVGSMDTLLAFHVNGSLVPLLKQAGAL  133



>ref|XP_006449418.1| hypothetical protein CICLE_v10017106mg [Citrus clementina]
 gb|ESR62658.1| hypothetical protein CICLE_v10017106mg [Citrus clementina]
Length=142

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGGK  GG++ VMA HI+G LVP+LK+AGAL
Sbjct  106  PAVFVGGKLFGGLDRVMATHISGDLVPILKEAGAL  140



>ref|XP_009607405.1| PREDICTED: monothiol glutaredoxin-S10 [Nicotiana tomentosiformis]
 ref|XP_009782550.1| PREDICTED: monothiol glutaredoxin-S10 [Nicotiana sylvestris]
Length=102

 Score = 53.5 bits (127),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GG+F+G   TVM  HING+L  +LKDAGAL
Sbjct  65   VPAVFIGGRFVGSANTVMTLHINGSLKKMLKDAGAL  100



>ref|XP_004229212.1| PREDICTED: monothiol glutaredoxin-S10 [Solanum lycopersicum]
Length=102

 Score = 53.5 bits (127),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GG+F+G   TVM  HING+L  +LKDAGAL
Sbjct  65   VPAVFIGGRFVGSANTVMTLHINGSLKKMLKDAGAL  100



>ref|XP_006342768.1| PREDICTED: monothiol glutaredoxin-S10-like [Solanum tuberosum]
Length=102

 Score = 53.5 bits (127),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GG+F+G   TVM  HING+L  +LKDAGAL
Sbjct  65   VPAVFIGGRFVGSANTVMTLHINGSLKKMLKDAGAL  100



>ref|XP_004492070.1| PREDICTED: glutaredoxin-C5-like [Cicer arietinum]
Length=135

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++T++A H+NG+LVPLLK AGAL
Sbjct  98   LPVVFIGGKLVGSMDTLLAFHVNGSLVPLLKQAGAL  133



>ref|XP_010052261.1| PREDICTED: glutaredoxin-C9-like [Eucalyptus grandis]
 gb|KCW76201.1| hypothetical protein EUGRSUZ_D00589 [Eucalyptus grandis]
Length=155

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGG+  GG+E VMA HI+G LVP+L++AGAL
Sbjct  119  PAVFVGGRLFGGLEKVMATHISGELVPILREAGAL  153



>ref|NP_001043812.1| Os01g0667900 [Oryza sativa Japonica Group]
 sp|Q5QLR2.1|GRXS5_ORYSJ RecName: Full=Monothiol glutaredoxin-S5 [Oryza sativa Japonica 
Group]
 dbj|BAD73655.1| glutaredoxin-like [Oryza sativa Japonica Group]
 dbj|BAD73683.1| glutaredoxin-like [Oryza sativa Japonica Group]
 dbj|BAF05726.1| Os01g0667900 [Oryza sativa Japonica Group]
 gb|EAY75307.1| hypothetical protein OsI_03198 [Oryza sativa Indica Group]
 dbj|BAG97196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=147

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +PAVFVGGK LGG++ +MA HI+G LVP+LK AGAL
Sbjct  110  LPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGAL  145



>gb|KDP21018.1| hypothetical protein JCGZ_21489 [Jatropha curcas]
Length=150

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI+G LVP+LK+AGAL
Sbjct  114  PVVFVGGKLFGGLERVMATHISGELVPILKEAGAL  148



>ref|XP_006467721.1| PREDICTED: glutaredoxin-C9-like [Citrus sinensis]
 gb|KDO77717.1| hypothetical protein CISIN_1g032368mg [Citrus sinensis]
Length=142

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGGK  GG++ VMA HI+G LVP+LK+AGAL
Sbjct  106  PAVFVGGKLFGGLDRVMATHISGDLVPILKEAGAL  140



>gb|KFK42729.1| monothiol glutaredoxin-s13 [Arabis alpina]
Length=172

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P +F+GGK  GG+E +MA HING LVP L+ AGAL
Sbjct  135  LPVMFIGGKLFGGLENLMAAHINGDLVPTLRQAGAL  170



>ref|NP_001274395.1| glutaredoxin [Cucumis sativus]
 gb|AGX01493.1| glutaredoxin [Cucumis sativus]
 gb|KGN49264.1| Glutaredoxin, grx [Cucumis sativus]
Length=131

 Score = 53.5 bits (127),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK  GG+E VMA HI+G LVP LKDAGAL
Sbjct  95   PVVFIGGKMFGGLEKVMAAHISGELVPALKDAGAL  129



>ref|XP_006574874.1| PREDICTED: glutaredoxin-C3-like [Glycine max]
Length=139

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ V+A HI+GTLVPLLK AGAL
Sbjct  102  VPVVFIGGKLVGPMDRVLAFHISGTLVPLLKQAGAL  137



>ref|XP_003546009.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=133

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+ GK  GG+E VMA HI+G L+P+LKDAGAL
Sbjct  97   PAVFLAGKLFGGLERVMATHISGELIPILKDAGAL  131



>ref|XP_004166934.1| PREDICTED: glutaredoxin-C9-like [Cucumis sativus]
Length=131

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK  GG+E VMA HI+G LVP LKDAGAL
Sbjct  95   PMVFIGGKMFGGLERVMAAHISGELVPALKDAGAL  129



>ref|XP_003546093.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max]
 gb|KHN33128.1| Monothiol glutaredoxin-S10 [Glycine soja]
Length=102

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKF+G   TVM  H+NG+L  +L+DAGAL
Sbjct  65   VPAVFVGGKFVGSANTVMTLHLNGSLKKMLRDAGAL  100



>ref|XP_006594493.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max]
 gb|KHN47301.1| Monothiol glutaredoxin-S10 [Glycine soja]
Length=102

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKF+G   TVM  H+NG+L  +L+DAGAL
Sbjct  65   VPAVFVGGKFVGSANTVMTLHLNGSLKKMLRDAGAL  100



>ref|XP_007213996.1| hypothetical protein PRUPE_ppa014139mg [Prunus persica]
 gb|EMJ15195.1| hypothetical protein PRUPE_ppa014139mg [Prunus persica]
Length=84

 Score = 52.8 bits (125),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI+G LVP+LK AGAL
Sbjct  48   PVVFVGGKLFGGLERVMATHISGELVPVLKQAGAL  82



>gb|KHN07783.1| Glutaredoxin-C9 [Glycine soja]
Length=176

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GGK  GG++ VMA HI+G L+P+LK+AGAL
Sbjct  140  PAVFIGGKLFGGLDRVMATHISGELIPILKEAGAL  174



>ref|XP_002446324.1| hypothetical protein SORBIDRAFT_06g014300 [Sorghum bicolor]
 gb|EES10652.1| hypothetical protein SORBIDRAFT_06g014300 [Sorghum bicolor]
Length=137

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GG+ +G ++ VMA HING+LVPLLK+AGAL
Sbjct  100  VPVVFIGGRLVGAMDRVMAAHINGSLVPLLKEAGAL  135



>ref|XP_006603016.1| PREDICTED: glutaredoxin-C5-like [Glycine max]
 gb|KHN13856.1| Glutaredoxin-C1 [Glycine soja]
Length=142

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GGK +G ++ V+A HI+GTLVPLLK AGAL
Sbjct  105  VPVVFIGGKLVGSMDRVLAFHISGTLVPLLKQAGAL  140



>gb|EYU27873.1| hypothetical protein MIMGU_mgv1a023197mg, partial [Erythranthe 
guttata]
Length=118

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VP VF+GG  +GGI+ V+A HINGTL PLLK AGA+
Sbjct  81   VPVVFIGGNLVGGIDAVLASHINGTLTPLLKQAGAI  116



>emb|CDO98900.1| unnamed protein product [Coffea canephora]
Length=102

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKF+G   TVM  H+NG+L  +LKDAGA+
Sbjct  65   VPAVFIGGKFVGSANTVMTLHVNGSLKKMLKDAGAM  100



>ref|NP_001235171.1| uncharacterized protein LOC100527118 [Glycine max]
 gb|ACU16165.1| unknown [Glycine max]
Length=172

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GGK  GG++ VMA HI+G L+P+LK+AGAL
Sbjct  136  PAVFIGGKLFGGLDRVMATHISGELIPILKEAGAL  170



>emb|CBI30620.3| unnamed protein product [Vitis vinifera]
Length=62

 Score = 52.4 bits (124),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GG+  GG+E VMA HI+G LVP+LK AGAL
Sbjct  26   PAVFMGGQLFGGLERVMATHISGELVPILKKAGAL  60



>ref|XP_010093967.1| hypothetical protein L484_010533 [Morus notabilis]
 gb|EXB54954.1| hypothetical protein L484_010533 [Morus notabilis]
Length=150

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GG+  GG++ VMA HI+G LVPLLK AGAL
Sbjct  114  PAVFIGGRLFGGLDRVMAAHISGELVPLLKQAGAL  148



>gb|KCW47268.1| hypothetical protein EUGRSUZ_K01064 [Eucalyptus grandis]
Length=173

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGGK  GG++ VM  HI G LVP LKDAGAL
Sbjct  137  PAVFVGGKLFGGLDRVMTAHITGELVPALKDAGAL  171



>ref|XP_003543318.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=174

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK  GG++ +MA HI+G LVP+LK AGAL
Sbjct  138  PTVFIGGKLFGGLDRIMATHISGELVPILKKAGAL  172



>gb|KFK37654.1| hypothetical protein AALP_AA3G011200 [Arabis alpina]
Length=138

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  101  LPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  136



>ref|XP_006299130.1| hypothetical protein CARUB_v10015272mg [Capsella rubella]
 ref|XP_010510226.1| PREDICTED: monothiol glutaredoxin-S10 [Camelina sativa]
 gb|EOA32028.1| hypothetical protein CARUB_v10015272mg [Capsella rubella]
Length=102

 Score = 52.8 bits (125),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKF+G   TVM  H+NG+L  LLKDAGAL
Sbjct  65   VPAVFVGGKFVGTANTVMTLHLNGSLKMLLKDAGAL  100



>gb|AAB07873.1| similar to glutaredoxin encoded by GenBank Accession Number Z49699; 
localized according to blastn similarity to EST sequences; 
therefore, the coding span corresponds only to an area 
of similarity since the initation codon and stop codon could 
not be precisely determined, partial [Arabidopsis thaliana]
Length=100

 Score = 52.8 bits (125),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  99  VFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
           VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  68  VFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  100



>ref|XP_009405878.1| PREDICTED: glutaredoxin-C5-like [Musa acuminata subsp. malaccensis]
Length=136

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  96   FVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            F+GGK +G ++ VMA HINGTLVPLLKDAGAL
Sbjct  103  FIGGKLVGAMDRVMAAHINGTLVPLLKDAGAL  134



>ref|XP_008227351.1| PREDICTED: glutaredoxin-C8-like [Prunus mume]
Length=76

 Score = 52.4 bits (124),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK +G ++ V+A HINGTLVPLLK+AGAL
Sbjct  40   PVVFIGGKLVGAMDRVVASHINGTLVPLLKEAGAL  74



>ref|XP_002305107.2| glutaredoxin-like family protein [Populus trichocarpa]
 gb|EEE85618.2| glutaredoxin-like family protein [Populus trichocarpa]
Length=153

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E ++A HI G LVP+LKDAGAL
Sbjct  117  PVVFVGGKLFGGLERIIASHITGELVPILKDAGAL  151



>ref|XP_006299844.1| hypothetical protein CARUB_v10016047mg [Capsella rubella]
 gb|EOA32742.1| hypothetical protein CARUB_v10016047mg [Capsella rubella]
Length=136

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  99   VFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  102  VFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  134



>ref|NP_001240908.1| uncharacterized protein LOC100792704 [Glycine max]
 gb|ACU23720.1| unknown [Glycine max]
Length=160

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GGK  GG++ +MA HI G LVP+LK AGAL
Sbjct  124  PAVFIGGKLFGGLDRIMATHIYGELVPILKKAGAL  158



>ref|XP_006361069.1| PREDICTED: glutaredoxin-C9-like [Solanum tuberosum]
Length=180

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGG   GG+E V++ HI+G LVP+LKD GAL
Sbjct  144  PAVFVGGNLFGGLERVISTHISGELVPILKDVGAL  178



>ref|XP_010111166.1| hypothetical protein L484_015048 [Morus notabilis]
 gb|EXC30557.1| hypothetical protein L484_015048 [Morus notabilis]
Length=153

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI+G LVP+LK+AGAL
Sbjct  117  PVVFVGGKVFGGLERVMATHISGELVPILKEAGAL  151



>gb|AFK37553.1| unknown [Medicago truncatula]
 gb|KEH39199.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=140

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VF+GGK  GG++ +MA HI+G LVPLLK AGAL
Sbjct  104  PMVFIGGKLFGGLDRLMATHISGELVPLLKQAGAL  138



>ref|XP_008371421.1| PREDICTED: glutaredoxin-C9 [Malus domestica]
 ref|XP_008345899.1| PREDICTED: glutaredoxin-C9-like [Malus domestica]
Length=140

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI G LVP+LK AGAL
Sbjct  104  PVVFVGGKLFGGLERVMATHITGELVPVLKQAGAL  138



>ref|XP_008383678.1| PREDICTED: glutaredoxin-C9-like [Malus domestica]
Length=139

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI G LVP+LK AGAL
Sbjct  103  PVVFVGGKLFGGLERVMATHITGELVPVLKQAGAL  137



>ref|XP_009344450.1| PREDICTED: glutaredoxin-C9 [Pyrus x bretschneideri]
Length=136

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI G LVP+LK AGAL
Sbjct  100  PVVFVGGKLFGGLERVMATHITGELVPVLKQAGAL  134



>ref|XP_010475016.1| PREDICTED: monothiol glutaredoxin-S13-like [Camelina sativa]
Length=152

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P +++GGK  GG+E +MA HING LVP L+ AGAL
Sbjct  115  LPVMYIGGKLFGGLENLMAAHINGDLVPSLRQAGAL  150



>ref|XP_009352842.1| PREDICTED: glutaredoxin-C9-like [Pyrus x bretschneideri]
Length=140

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            P VFVGGK  GG+E VMA HI G LVP+LK AGAL
Sbjct  104  PGVFVGGKLFGGLERVMATHITGELVPVLKQAGAL  138



>gb|EPS67459.1| hypothetical protein M569_07317, partial [Genlisea aurea]
Length=112

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GG+ +G ++ VMA HI+GTLVPLLK+AGAL
Sbjct  75   LPVVFIGGRLIGAMDKVMASHISGTLVPLLKEAGAL  110



>ref|XP_010327035.1| PREDICTED: glutaredoxin-C9-like isoform X1 [Solanum lycopersicum]
Length=171

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGG   GG+E V++ HI+G LVP+LKD GAL
Sbjct  135  PAVFVGGNLFGGLERVISTHISGELVPILKDVGAL  169



>ref|XP_010466387.1| PREDICTED: monothiol glutaredoxin-S10-like [Camelina sativa]
 ref|XP_010488159.1| PREDICTED: monothiol glutaredoxin-S10-like [Camelina sativa]
Length=102

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVFVGGKF+G   TVM  H+NG+L  LLKDAGAL
Sbjct  65   VPAVFVGGKFVGMANTVMTLHLNGSLKMLLKDAGAL  100



>ref|XP_010911008.1| PREDICTED: monothiol glutaredoxin-S9-like [Elaeis guineensis]
Length=159

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVF+GG+ +GGI+ +MA HI+G LVP+LK+AGAL
Sbjct  123  PAVFIGGRLVGGIDRLMAVHISGDLVPILKEAGAL  157



>ref|XP_010231027.1| PREDICTED: monothiol glutaredoxin-S9-like [Brachypodium distachyon]
Length=140

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGG+ LGG++ +MA HI+G LVP+LKDAGAL
Sbjct  104  PAVFVGGRLLGGLDRLMAVHISGELVPILKDAGAL  138



>ref|XP_007226534.1| hypothetical protein PRUPE_ppa025150mg [Prunus persica]
 ref|XP_008223117.1| PREDICTED: monothiol glutaredoxin-S10 [Prunus mume]
 gb|EMJ27733.1| hypothetical protein PRUPE_ppa025150mg [Prunus persica]
Length=102

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            VPAVF+GGKF+G    VM  H+NG+L  LLKDAGAL
Sbjct  65   VPAVFIGGKFVGSANAVMTLHLNGSLKKLLKDAGAL  100



>ref|XP_010435683.1| PREDICTED: glutaredoxin-C7-like [Camelina sativa]
 ref|XP_010497035.1| PREDICTED: glutaredoxin-C7-like [Camelina sativa]
Length=136

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  99   LPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  134



>ref|XP_009134575.1| PREDICTED: glutaredoxin-C7 [Brassica rapa]
 emb|CDX74327.1| BnaA03g27200D [Brassica napus]
Length=137

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  108  VPAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            +P VF+GGK +G ++ VMA HING+LVPLLKDAGAL
Sbjct  100  LPVVFIGGKLVGAMDRVMASHINGSLVPLLKDAGAL  135



>ref|XP_010327036.1| PREDICTED: glutaredoxin-C9-like isoform X2 [Solanum lycopersicum]
Length=166

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PAVFVGGKFLGGIETVMACHINGTLVPLLKDAGAL  1
            PAVFVGG   GG+E V++ HI+G LVP+LKD GAL
Sbjct  130  PAVFVGGNLFGGLERVISTHISGELVPILKDVGAL  164



Lambda      K        H        a         alpha
   0.304    0.127    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524198921584