BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6441_g1_i2 len=995 path=[973:0-276 1250:277-994]

Length=995
                                                                      Score     E

ref|XP_004234086.1|  PREDICTED: CBL-interacting protein kinase 5-...    384   3e-127   
emb|CDO96812.1|  unnamed protein product                                382   2e-126   
ref|XP_011085980.1|  PREDICTED: CBL-interacting serine/threonine-...    372   1e-122   
emb|CBI30698.3|  unnamed protein product                                369   2e-122   
ref|XP_009352757.1|  PREDICTED: CBL-interacting serine/threonine-...    368   5e-121   
ref|XP_009352756.1|  PREDICTED: CBL-interacting serine/threonine-...    368   8e-121   
ref|XP_008383619.1|  PREDICTED: CBL-interacting serine/threonine-...    366   3e-120   
ref|XP_008383618.1|  PREDICTED: CBL-interacting serine/threonine-...    366   3e-120   
ref|XP_009800912.1|  PREDICTED: CBL-interacting protein kinase 5        365   6e-120   
ref|XP_006358155.1|  PREDICTED: CBL-interacting protein kinase 5-...    365   6e-120   
ref|XP_009616687.1|  PREDICTED: CBL-interacting protein kinase 5        365   8e-120   
ref|XP_004233056.1|  PREDICTED: CBL-interacting serine/threonine-...    365   1e-119   
ref|NP_001267894.1|  CBL-interacting protein kinase 16                  363   5e-119   
ref|XP_008345915.1|  PREDICTED: CBL-interacting protein kinase 5-...    359   2e-117   
ref|XP_009350943.1|  PREDICTED: CBL-interacting protein kinase 5-...    358   3e-117   
ref|XP_010276975.1|  PREDICTED: CBL-interacting protein kinase 5-...    358   5e-117   
ref|XP_007211421.1|  hypothetical protein PRUPE_ppa005365mg             357   1e-116   
ref|XP_008443358.1|  PREDICTED: CBL-interacting serine/threonine-...    357   1e-116   
ref|XP_008371484.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    357   2e-116   
ref|XP_008225305.1|  PREDICTED: CBL-interacting protein kinase 5        355   4e-116   
ref|XP_009409392.1|  PREDICTED: CBL-interacting protein kinase 5-...    355   1e-115   
gb|EYU43341.1|  hypothetical protein MIMGU_mgv1a006048mg                354   1e-115   
ref|XP_008801610.1|  PREDICTED: CBL-interacting protein kinase 5 ...    353   5e-115   
gb|KDO77875.1|  hypothetical protein CISIN_1g037702mg                   352   5e-115   
ref|XP_006449516.1|  hypothetical protein CICLE_v10015231mg             352   5e-115   
ref|XP_008803093.1|  PREDICTED: CBL-interacting protein kinase 5 ...    349   8e-114   
ref|XP_006830261.1|  hypothetical protein AMTR_s00130p00110630          349   1e-113   
ref|XP_004161212.1|  PREDICTED: CBL-interacting protein kinase 5-...    347   3e-113   
ref|XP_006468199.1|  PREDICTED: CBL-interacting serine/threonine-...    348   3e-113   
ref|XP_004150214.1|  PREDICTED: CBL-interacting protein kinase 5-...    347   1e-112   
ref|XP_004295578.1|  PREDICTED: CBL-interacting protein kinase 5-...    345   8e-112   
ref|XP_007025354.1|  CBL-interacting protein kinase 20                  344   1e-111   
ref|XP_009381758.1|  PREDICTED: CBL-interacting protein kinase 5-...    343   3e-111   
ref|XP_002522223.1|  CBL-interacting serine/threonine-protein kin...    343   3e-111   Ricinus communis
gb|EPS61861.1|  hypothetical protein M569_12931                         340   4e-110   
ref|XP_011039423.1|  PREDICTED: CBL-interacting serine/threonine-...    340   4e-110   
gb|KCW74123.1|  hypothetical protein EUGRSUZ_E027581                    336   5e-110   
ref|XP_002317414.1|  CBL-interacting protein kinase 20                  339   8e-110   Populus trichocarpa [western balsam poplar]
ref|XP_008802343.1|  PREDICTED: CBL-interacting protein kinase 5 ...    338   1e-109   
ref|XP_010059022.1|  PREDICTED: CBL-interacting protein kinase 5-...    338   2e-109   
ref|XP_006643890.1|  PREDICTED: CBL-interacting protein kinase 5-...    338   3e-109   
ref|NP_001042345.1|  Os01g0206700                                       336   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454972.1|  hypothetical protein SORBIDRAFT_03g002340          331   2e-106   Sorghum bicolor [broomcorn]
ref|XP_009602782.1|  PREDICTED: CBL-interacting protein kinase 2-...    330   6e-106   
gb|EMT28985.1|  CBL-interacting protein kinase 5                        330   6e-106   
ref|XP_010686216.1|  PREDICTED: CBL-interacting protein kinase 5        329   1e-105   
emb|CDM82235.1|  unnamed protein product                                329   1e-105   
ref|XP_003565293.1|  PREDICTED: CBL-interacting protein kinase 5        329   1e-105   
dbj|BAK07613.1|  predicted protein                                      328   2e-105   
ref|NP_001105966.1|  putative protein kinase                            328   2e-105   Zea mays [maize]
gb|ACF78341.1|  unknown                                                 328   2e-105   Zea mays [maize]
ref|NP_001149741.1|  LOC100283368                                       328   2e-105   Zea mays [maize]
gb|KDP21108.1|  hypothetical protein JCGZ_21579                         327   5e-105   
ref|XP_010925625.1|  PREDICTED: CBL-interacting protein kinase 5-...    327   8e-105   
gb|EMS57676.1|  CBL-interacting protein kinase 5                        327   1e-104   
ref|XP_010253153.1|  PREDICTED: CBL-interacting protein kinase 18       326   1e-104   
ref|XP_009784196.1|  PREDICTED: CBL-interacting protein kinase 2-...    326   2e-104   
ref|XP_006843723.1|  hypothetical protein AMTR_s00007p00220190          325   2e-104   
ref|XP_010529202.1|  PREDICTED: CBL-interacting serine/threonine-...    325   3e-104   
ref|XP_010231608.1|  PREDICTED: CBL-interacting protein kinase 5-...    323   3e-103   
ref|XP_010494733.1|  PREDICTED: CBL-interacting serine/threonine-...    319   4e-102   
ref|NP_199394.1|  CBL-interacting serine/threonine-protein kinase 20    319   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009415683.1|  PREDICTED: uncharacterized protein LOC103996486    335   5e-102   
ref|XP_002863452.1|  cbl-interacting protein kinase 20                  318   7e-102   
ref|XP_009128822.1|  PREDICTED: CBL-interacting serine/threonine-...    318   9e-102   
gb|AIZ68214.1|  CBL-interacting protein kinase 18-like protein          319   9e-102   
emb|CDY26359.1|  BnaA02g24110D                                          318   1e-101   
ref|XP_011095114.1|  PREDICTED: CBL-interacting protein kinase 2        318   1e-101   
gb|KFK31507.1|  hypothetical protein AALP_AA6G121600                    317   1e-101   
ref|XP_010441665.1|  PREDICTED: CBL-interacting serine/threonine-...    317   2e-101   
ref|XP_002323059.2|  calcineurin B-like-interacting protein kinase      318   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_010481526.1|  PREDICTED: CBL-interacting serine/threonine-...    317   4e-101   
ref|NP_001268154.1|  CBL-interacting protein kinase 07                  317   5e-101   
ref|XP_006398267.1|  hypothetical protein EUTSA_v10000893mg             315   8e-101   
gb|ABY58264.1|  serine-threonine kinase                                 315   1e-100   Persea americana
ref|XP_003517006.1|  PREDICTED: CBL-interacting protein kinase 2-...    316   2e-100   
ref|XP_006279541.1|  hypothetical protein CARUB_v10028407mg             315   2e-100   
gb|ACA65275.1|  serine-threonine kinase                                 315   2e-100   Persea americana
emb|CDX87763.1|  BnaC02g31860D                                          313   2e-100   
gb|KEH29212.1|  CBL-interacting kinase                                  315   3e-100   
ref|XP_008792201.1|  PREDICTED: CBL-interacting protein kinase 18...    314   3e-100   
gb|ABY58272.1|  serine-threonine kinase                                 314   4e-100   Persea americana
ref|XP_010089697.1|  CBL-interacting protein kinase 5                   314   8e-100   
ref|XP_008789399.1|  PREDICTED: CBL-interacting protein kinase 5-...    316   1e-99    
gb|ABY58257.1|  serine-threonine kinase                                 313   1e-99    Persea americana
gb|ABY58262.1|  serine-threonine kinase                                 313   1e-99    Persea americana
gb|ABY58256.1|  serine-threonine kinase                                 313   1e-99    Persea americana
ref|XP_007134686.1|  hypothetical protein PHAVU_010G067600g             313   2e-99    
ref|XP_011003598.1|  PREDICTED: CBL-interacting protein kinase 2-...    313   2e-99    
ref|XP_011008766.1|  PREDICTED: CBL-interacting protein kinase 2-...    313   2e-99    
gb|ACN76472.1|  CBL-interacting protein kinase 22                       313   2e-99    Populus euphratica
gb|ABY58274.1|  serine-threonine kinase                                 312   3e-99    Persea americana
gb|ABY58275.1|  serine-threonine kinase                                 311   5e-99    Persea americana
ref|XP_010931340.1|  PREDICTED: CBL-interacting protein kinase 18...    311   5e-99    
ref|XP_010922709.1|  PREDICTED: CBL-interacting protein kinase 18...    311   6e-99    
ref|XP_010326216.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    311   7e-99    
ref|NP_001267860.1|  CBL-interacting protein kinase 13                  311   7e-99    
gb|ABY58284.1|  serine-threonine kinase                                 311   8e-99    Persea americana
ref|XP_010091068.1|  CBL-interacting protein kinase 2                   311   8e-99    
gb|ADE76223.1|  unknown                                                 310   8e-99    
gb|ABK24914.1|  unknown                                                 310   1e-98    Picea sitchensis
gb|AAL23677.1|  Serine/threonine Kinase                                 310   1e-98    Persea americana
gb|ACA65274.1|  serine-threonine kinase                                 310   2e-98    Persea americana
gb|KDP22784.1|  hypothetical protein JCGZ_00371                         310   2e-98    
gb|ACA65278.1|  serine-threonine kinase                                 310   2e-98    Persea americana
ref|XP_010252111.1|  PREDICTED: CBL-interacting protein kinase 18...    309   3e-98    
gb|ABY58263.1|  serine-threonine kinase                                 309   4e-98    Persea americana
gb|ABY58267.1|  serine-threonine kinase                                 309   5e-98    Persea americana
gb|EYU41998.1|  hypothetical protein MIMGU_mgv1a006238mg                308   6e-98    
ref|XP_006429548.1|  hypothetical protein CICLE_v10011650mg             309   8e-98    
ref|XP_003534649.1|  PREDICTED: CBL-interacting protein kinase 18...    308   1e-97    
gb|KHN29521.1|  CBL-interacting protein kinase 18                       308   1e-97    
gb|ABY58259.1|  serine-threonine kinase                                 307   2e-97    Persea americana
gb|KEH23254.1|  CBL-interacting kinase                                  307   2e-97    
ref|XP_007205114.1|  hypothetical protein PRUPE_ppa004815mg             308   3e-97    
ref|XP_003552306.1|  PREDICTED: CBL-interacting protein kinase 2-...    307   3e-97    
gb|ABY58261.1|  serine-threonine kinase                                 306   4e-97    Persea americana
gb|KDO49657.1|  hypothetical protein CISIN_1g012046mg                   306   1e-96    
gb|KHN40647.1|  CBL-interacting protein kinase 2                        305   1e-96    
gb|ABY58260.1|  serine-threonine kinase                                 305   2e-96    Persea americana
ref|XP_008810573.1|  PREDICTED: CBL-interacting protein kinase 18       305   2e-96    
ref|XP_004492544.1|  PREDICTED: CBL-interacting protein kinase 18...    305   3e-96    
ref|XP_006356761.1|  PREDICTED: CBL-interacting protein kinase 2-...    305   4e-96    
ref|XP_010921114.1|  PREDICTED: CBL-interacting protein kinase 18...    303   6e-96    
ref|XP_008370241.1|  PREDICTED: CBL-interacting protein kinase 2        303   1e-95    
ref|XP_004149923.1|  PREDICTED: CBL-interacting protein kinase 2-...    303   1e-95    
ref|XP_010920246.1|  PREDICTED: CBL-interacting protein kinase 5        303   2e-95    
ref|XP_010087068.1|  CBL-interacting protein kinase 2                   302   2e-95    
gb|ABJ91210.1|  CBL-interacting protein kinase 2                        302   3e-95    Populus trichocarpa [western balsam poplar]
ref|XP_009414263.1|  PREDICTED: CBL-interacting protein kinase 18       301   3e-95    
ref|XP_008388328.1|  PREDICTED: CBL-interacting protein kinase 2-...    302   6e-95    
ref|XP_004167774.1|  PREDICTED: CBL-interacting protein kinase 2-...    301   6e-95    
ref|XP_006658129.1|  PREDICTED: CBL-interacting protein kinase 2-...    300   7e-95    
ref|XP_002439570.1|  hypothetical protein SORBIDRAFT_09g013580          300   8e-95    Sorghum bicolor [broomcorn]
ref|XP_010520185.1|  PREDICTED: CBL-interacting serine/threonine-...    301   8e-95    
ref|XP_008782631.1|  PREDICTED: CBL-interacting protein kinase 18...    300   1e-94    
ref|XP_008245119.1|  PREDICTED: CBL-interacting protein kinase 2        302   1e-94    
ref|XP_008464264.1|  PREDICTED: CBL-interacting protein kinase 2        300   2e-94    
ref|XP_004962438.1|  PREDICTED: CBL-interacting protein kinase 18...    300   3e-94    
ref|XP_007011240.1|  CBL-interacting protein kinase 10                  299   3e-94    
ref|XP_008653467.1|  PREDICTED: CBL-interacting protein kinase 2        299   3e-94    
emb|CDP04063.1|  unnamed protein product                                300   4e-94    
ref|XP_011041811.1|  PREDICTED: CBL-interacting serine/threonine-...    299   4e-94    
gb|KDP45725.1|  hypothetical protein JCGZ_17332                         299   5e-94    
ref|XP_009373129.1|  PREDICTED: CBL-interacting protein kinase 2-...    300   6e-94    
ref|XP_006431989.1|  hypothetical protein CICLE_v10001000mg             299   7e-94    
ref|XP_006279537.1|  hypothetical protein CARUB_v10028322mg             299   7e-94    
gb|EYU20111.1|  hypothetical protein MIMGU_mgv1a006672mg                298   7e-94    
gb|KDO49766.1|  hypothetical protein CISIN_1g011694mg                   299   7e-94    
ref|NP_001265903.1|  CBL-interacting protein kinase                     298   8e-94    
ref|XP_007017047.1|  SOS3-interacting protein 1                         298   9e-94    
ref|XP_004302573.1|  PREDICTED: CBL-interacting protein kinase 2-...    298   1e-93    
ref|XP_002326078.2|  CBL-interacting protein kinase 2                   297   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_009371993.1|  PREDICTED: CBL-interacting protein kinase 2        297   4e-93    
ref|XP_006401087.1|  hypothetical protein EUTSA_v10013486mg             296   5e-93    
ref|XP_009122380.1|  PREDICTED: CBL-interacting serine/threonine-...    296   7e-93    
gb|AGW15605.1|  CBL-interacting protein kinase                          296   8e-93    
ref|XP_002520844.1|  CBL-interacting serine/threonine-protein kin...    295   8e-93    Ricinus communis
ref|XP_010937988.1|  PREDICTED: CBL-interacting protein kinase 18...    295   9e-93    
ref|XP_007033570.1|  SOS3-interacting protein 1 isoform 1               296   1e-92    
gb|AGT16994.1|  CBL-interacting protein kinase                          295   2e-92    
gb|KFK25099.1|  hypothetical protein AALP_AA8G066200                    294   3e-92    
ref|XP_010483437.1|  PREDICTED: CBL-interacting serine/threonine-...    295   3e-92    
emb|CDY70046.1|  BnaA10g29660D                                          293   5e-92    
gb|AGQ43462.1|  CBL-interacting protein kinase 2                        293   5e-92    
ref|XP_006365327.1|  PREDICTED: CBL-interacting protein kinase 18...    293   6e-92    
ref|XP_009120348.1|  PREDICTED: CBL-interacting serine/threonine-...    293   6e-92    
gb|AGA37199.1|  CBL-interacting protein kinase 10.1                     293   6e-92    
ref|XP_010032938.1|  PREDICTED: CBL-interacting serine/threonine-...    291   6e-92    
ref|XP_010443564.1|  PREDICTED: CBL-interacting serine/threonine-...    293   6e-92    
ref|XP_010650780.1|  PREDICTED: CBL-interacting protein kinase 11...    293   7e-92    
emb|CDY43857.1|  BnaC09g33860D                                          293   7e-92    
ref|XP_006289352.1|  hypothetical protein CARUB_v10002839mg             293   7e-92    
ref|XP_007218015.1|  hypothetical protein PRUPE_ppa005839mg             293   7e-92    
ref|XP_004958692.1|  PREDICTED: CBL-interacting protein kinase 2-...    293   7e-92    
ref|NP_001268196.1|  CBL-interacting protein kinase 11                  292   8e-92    
ref|XP_004485907.1|  PREDICTED: CBL-interacting serine/threonine-...    292   8e-92    
gb|EMS54742.1|  CBL-interacting protein kinase 2                        293   1e-91    
ref|XP_009608924.1|  PREDICTED: CBL-interacting protein kinase 2-...    293   1e-91    
ref|XP_004294743.1|  PREDICTED: CBL-interacting serine/threonine-...    293   1e-91    
ref|XP_009387685.1|  PREDICTED: CBL-interacting protein kinase 18...    292   1e-91    
ref|XP_010032933.1|  PREDICTED: CBL-interacting serine/threonine-...    292   1e-91    
gb|AGK91199.1|  CIPK2                                                   292   1e-91    
ref|NP_568878.1|  CBL-interacting serine/threonine-protein kinase 10    293   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562454.1|  PREDICTED: CBL-interacting protein kinase 2        292   1e-91    
ref|XP_002866260.1|  cbl-interacting protein kinase 10                  292   2e-91    
emb|CBI18060.3|  unnamed protein product                                290   2e-91    
gb|ABQ09285.1|  CBL-interacting protein kinase                          290   2e-91    Hordeum brevisubulatum
ref|NP_001060636.1|  Os07g0678600                                       291   2e-91    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA96929.1|  serine/threonine protein kinase                        292   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AET80728.1|  calcineurin B-like-interacting protein kinase           291   3e-91    
gb|EMT16422.1|  CBL-interacting protein kinase 2                        291   3e-91    
ref|XP_010685966.1|  PREDICTED: CBL-interacting protein kinase 2        292   3e-91    
ref|XP_008233852.1|  PREDICTED: CBL-interacting protein kinase 18...    291   4e-91    
gb|AHG06442.1|  CBL-interacting protein kinase 2                        291   4e-91    
ref|NP_001147901.1|  CBL-interacting serine/threonine-protein kin...    291   5e-91    Zea mays [maize]
ref|XP_002533719.1|  CBL-interacting serine/threonine-protein kin...    290   6e-91    Ricinus communis
emb|CDY02816.1|  BnaC02g10730D                                          290   6e-91    
ref|XP_009769612.1|  PREDICTED: CBL-interacting protein kinase 18...    290   6e-91    
gb|AFW98257.1|  calcineurin B-like-interacting protein kinase           290   1e-90    
ref|XP_007140104.1|  hypothetical protein PHAVU_008G084600g             290   1e-90    
ref|XP_006399186.1|  hypothetical protein EUTSA_v10013492mg             289   3e-90    
ref|XP_009771513.1|  PREDICTED: CBL-interacting protein kinase 2-...    289   5e-90    
ref|XP_006399191.1|  hypothetical protein EUTSA_v10013670mg             287   5e-90    
dbj|BAJ99952.1|  predicted protein                                      286   6e-90    
emb|CDY32704.1|  BnaA02g07660D                                          287   9e-90    
gb|ACQ83494.1|  CBL-interacting protein kinase 25                       287   9e-90    Sorghum bicolor [broomcorn]
gb|AEZ51505.1|  CBL-interacting protein kinase 14                       287   1e-89    
ref|XP_011079428.1|  PREDICTED: CBL-interacting serine/threonine-...    287   1e-89    
ref|XP_011015352.1|  PREDICTED: CBL-interacting protein kinase 18...    286   2e-89    
ref|XP_007146859.1|  hypothetical protein PHAVU_006G076200g             287   2e-89    
ref|XP_002319966.2|  calcineurin B-like-interacting protein kinase      286   2e-89    Populus trichocarpa [western balsam poplar]
ref|XP_010683541.1|  PREDICTED: CBL-interacting protein kinase 18...    286   2e-89    
ref|XP_009354341.1|  PREDICTED: CBL-interacting serine/threonine-...    286   2e-89    
ref|XP_002325810.1|  calcineurin B-like-interacting protein kinase      286   3e-89    Populus trichocarpa [western balsam poplar]
ref|XP_006654265.1|  PREDICTED: CBL-interacting protein kinase 18...    286   4e-89    
ref|XP_010108499.1|  CBL-interacting serine/threonine-protein kin...    287   4e-89    
gb|ABK96146.1|  unknown                                                 284   5e-89    Populus trichocarpa [western balsam poplar]
gb|ABK25045.1|  unknown                                                 285   5e-89    Picea sitchensis
ref|XP_009126755.1|  PREDICTED: CBL-interacting serine/threonine-...    285   6e-89    
ref|XP_002309336.2|  CBL-interacting protein kinase 6                   285   7e-89    Populus trichocarpa [western balsam poplar]
gb|ABJ91216.1|  CBL-interacting protein kinase 9                        285   7e-89    Populus trichocarpa [western balsam poplar]
ref|NP_001054905.1|  Os05g0208100                                       286   7e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002517716.1|  CBL-interacting serine/threonine-protein kin...    285   7e-89    Ricinus communis
ref|XP_003636793.1|  CBL-interacting protein kinase                     285   8e-89    
ref|XP_003616004.1|  CBL-interacting protein kinase                     286   9e-89    
gb|KHG11871.1|  CBL-interacting protein kinase 2                        285   1e-88    
gb|KDP21674.1|  hypothetical protein JCGZ_03345                         285   1e-88    
ref|XP_010423258.1|  PREDICTED: CBL-interacting serine/threonine-...    285   1e-88    
emb|CDP13925.1|  unnamed protein product                                285   1e-88    
ref|XP_004506437.1|  PREDICTED: CBL-interacting protein kinase 2-...    285   1e-88    
gb|AFW03555.1|  CBL interacting protein kinase 14                       284   1e-88    
ref|XP_006594550.1|  PREDICTED: CBL-interacting protein kinase 5-...    285   1e-88    
gb|AFK39318.1|  unknown                                                 284   1e-88    
ref|XP_004490705.1|  PREDICTED: CBL-interacting serine/threonine-...    284   2e-88    
ref|XP_010491305.1|  PREDICTED: CBL-interacting serine/threonine-...    284   2e-88    
ref|XP_009403856.1|  PREDICTED: CBL-interacting protein kinase 18...    284   2e-88    
gb|AHB60733.1|  CBL-interacting serine/threonine-protein kinase 6       282   2e-88    
ref|XP_003553229.1|  PREDICTED: CBL-interacting serine/threonine-...    284   2e-88    
ref|XP_011083993.1|  PREDICTED: CBL-interacting serine/threonine-...    283   3e-88    
ref|XP_010452654.1|  PREDICTED: CBL-interacting serine/threonine-...    284   3e-88    
gb|KEH34435.1|  CBL-interacting kinase                                  284   3e-88    
gb|KHN48398.1|  CBL-interacting serine/threonine-protein kinase 10      284   3e-88    
ref|XP_011084844.1|  PREDICTED: CBL-interacting protein kinase 18...    283   3e-88    
ref|XP_011033439.1|  PREDICTED: CBL-interacting serine/threonine-...    283   3e-88    
ref|XP_010238807.1|  PREDICTED: CBL-interacting protein kinase 15...    283   4e-88    
ref|XP_008808322.1|  PREDICTED: CBL-interacting protein kinase 18...    282   8e-88    
ref|XP_002873295.1|  cbl-interacting protein kinase 2                   283   9e-88    
ref|XP_011076604.1|  PREDICTED: CBL-interacting protein kinase 2-...    282   1e-87    
ref|NP_001055223.1|  Os05g0332300                                       282   1e-87    Oryza sativa Japonica Group [Japonica rice]
gb|EAY97566.1|  hypothetical protein OsI_19494                          282   1e-87    Oryza sativa Indica Group [Indian rice]
gb|AII99837.1|  CBL-interacting protein kinase                          281   2e-87    
ref|XP_007011954.1|  SOS3-interacting protein 3                         281   2e-87    
ref|XP_008243885.1|  PREDICTED: CBL-interacting serine/threonine-...    282   2e-87    
ref|XP_011021034.1|  PREDICTED: CBL-interacting serine/threonine-...    281   2e-87    
ref|XP_008352090.1|  PREDICTED: CBL-interacting serine/threonine-...    281   2e-87    
ref|XP_010047118.1|  PREDICTED: CBL-interacting serine/threonine-...    281   2e-87    
ref|XP_004240423.1|  PREDICTED: CBL-interacting protein kinase 2-...    282   2e-87    
emb|CDY14057.1|  BnaC02g01740D                                          281   2e-87    
gb|KCW78919.1|  hypothetical protein EUGRSUZ_C00357                     280   2e-87    
ref|XP_009630199.1|  PREDICTED: CBL-interacting protein kinase 2-...    281   3e-87    
gb|KDO59402.1|  hypothetical protein CISIN_1g013522mg                   280   3e-87    
ref|XP_006857201.1|  hypothetical protein AMTR_s00065p00197200          280   3e-87    
ref|XP_009125674.1|  PREDICTED: CBL-interacting serine/threonine-...    280   4e-87    
ref|XP_009629516.1|  PREDICTED: CBL-interacting protein kinase 2-...    281   4e-87    
ref|XP_004149375.1|  PREDICTED: CBL-interacting serine/threonine-...    281   4e-87    
gb|EYU31774.1|  hypothetical protein MIMGU_mgv1a006747mg                280   4e-87    
ref|XP_006435875.1|  hypothetical protein CICLE_v10031522mg             280   5e-87    
emb|CDY05014.1|  BnaAnng01960D                                          280   5e-87    
ref|NP_001268212.1|  uncharacterized protein LOC100241657               280   5e-87    
ref|XP_007207447.1|  hypothetical protein PRUPE_ppa005370mg             281   5e-87    
ref|XP_004287123.1|  PREDICTED: CBL-interacting serine/threonine-...    279   7e-87    
ref|XP_006473970.1|  PREDICTED: CBL-interacting serine/threonine-...    280   7e-87    
ref|XP_006453669.1|  hypothetical protein CICLE_v10008315mg             280   7e-87    
ref|XP_008361195.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    276   7e-87    
ref|XP_007142057.1|  hypothetical protein PHAVU_008G248900g             279   1e-86    
ref|XP_008354330.1|  PREDICTED: CBL-interacting serine/threonine-...    278   2e-86    
ref|XP_008362871.1|  PREDICTED: CBL-interacting serine/threonine-...    278   2e-86    
ref|XP_006575445.1|  PREDICTED: CBL-interacting serine/threonine-...    280   2e-86    
ref|XP_003552138.1|  PREDICTED: CBL-interacting protein kinase 2 ...    279   2e-86    
ref|XP_008374611.1|  PREDICTED: CBL-interacting protein kinase 2-...    279   2e-86    
ref|XP_007148034.1|  hypothetical protein PHAVU_006G174900g             278   2e-86    
ref|XP_010275776.1|  PREDICTED: CBL-interacting serine/threonine-...    278   2e-86    
gb|AGL07710.1|  CBL-interacting protein kinase                          278   2e-86    
ref|XP_006399185.1|  hypothetical protein EUTSA_v10015596mg             278   2e-86    
ref|NP_196324.1|  CBL-interacting protein kinase 2                      279   3e-86    
ref|XP_010525811.1|  PREDICTED: CBL-interacting serine/threonine-...    278   3e-86    
gb|AAF86506.1|AF286050_1  CBL-interacting protein kinase 2              279   3e-86    
ref|XP_009358459.1|  PREDICTED: CBL-interacting serine/threonine-...    278   3e-86    
ref|XP_004500345.1|  PREDICTED: CBL-interacting serine/threonine-...    279   3e-86    
dbj|BAG41961.1|  CBL-interacting protein kinase 1                       278   3e-86    
ref|XP_008465300.1|  PREDICTED: CBL-interacting serine/threonine-...    279   4e-86    
gb|KHN04808.1|  CBL-interacting protein kinase 2                        278   4e-86    
gb|AGH08169.1|  CBL-interacting protein kinase                          277   4e-86    
sp|Q2QYM3.1|CIPKE_ORYSJ  RecName: Full=CBL-interacting protein ki...    277   5e-86    
ref|XP_003538498.2|  PREDICTED: CBL-interacting protein kinase 2-...    278   6e-86    
emb|CDP10216.1|  unnamed protein product                                277   6e-86    
ref|XP_009610648.1|  PREDICTED: CBL-interacting protein kinase 18...    277   9e-86    
gb|EAY82084.1|  hypothetical protein OsI_37283                          277   1e-85    
ref|XP_008242969.1|  PREDICTED: CBL-interacting serine/threonine-...    276   1e-85    
ref|XP_004984447.1|  PREDICTED: CBL-interacting protein kinase 10...    277   1e-85    
ref|XP_009410525.1|  PREDICTED: CBL-interacting protein kinase 18...    276   1e-85    
ref|XP_010110371.1|  CBL-interacting serine/threonine-protein kin...    276   1e-85    
ref|XP_008354792.1|  PREDICTED: CBL-interacting serine/threonine-...    277   1e-85    
ref|XP_003557957.1|  PREDICTED: CBL-interacting protein kinase 10...    276   1e-85    
ref|XP_007138415.1|  hypothetical protein PHAVU_009G206900g             276   2e-85    
dbj|BAG06678.1|  protein kinase                                         276   2e-85    
ref|XP_011080736.1|  PREDICTED: CBL-interacting protein kinase 18       277   2e-85    
emb|CDX70005.1|  BnaA10g23540D                                          276   3e-85    
ref|NP_001235809.1|  SOS2-like protein kinase                           275   3e-85    
gb|AFW90518.1|  SOS2-like protein kinase                                275   3e-85    
ref|XP_006344078.1|  PREDICTED: CBL-interacting serine/threonine-...    276   4e-85    
ref|XP_004242581.1|  PREDICTED: CBL-interacting serine/threonine-...    275   4e-85    
gb|AFW90522.1|  CBL-interacting serine/threonine-protein kinase 6...    275   4e-85    
ref|XP_007204894.1|  hypothetical protein PRUPE_ppa006023mg             275   4e-85    
ref|NP_001065977.2|  Os12g0113500                                       276   4e-85    
gb|AFR90220.1|  CBL-interacting protein kinase 14                       275   5e-85    
gb|EPS71159.1|  hypothetical protein M569_03590                         274   6e-85    
ref|XP_010265622.1|  PREDICTED: CBL-interacting serine/threonine-...    275   6e-85    
ref|XP_009596060.1|  PREDICTED: CBL-interacting serine/threonine-...    274   8e-85    
ref|XP_009790292.1|  PREDICTED: CBL-interacting serine/threonine-...    274   1e-84    
gb|ADZ99349.1|  CBL interacting protein kinase 6                        274   1e-84    
gb|KHN40977.1|  CBL-interacting serine/threonine-protein kinase 10      275   1e-84    
ref|NP_001148053.1|  CBL-interacting serine/threonine-protein kin...    275   1e-84    
gb|KDP38667.1|  hypothetical protein JCGZ_04020                         274   1e-84    
ref|XP_003533886.1|  PREDICTED: CBL-interacting serine/threonine-...    273   2e-84    
ref|XP_009781174.1|  PREDICTED: CBL-interacting protein kinase 2-...    274   2e-84    
ref|XP_006343663.1|  PREDICTED: CBL-interacting serine/threonine-...    273   2e-84    
ref|XP_010695855.1|  PREDICTED: CBL-interacting protein kinase 18...    274   2e-84    
dbj|BAJ91060.1|  predicted protein                                      273   2e-84    
gb|EMS49809.1|  CBL-interacting protein kinase 14                       273   2e-84    
gb|AAB62693.1|  protein kinase                                          273   3e-84    
ref|XP_002533977.1|  CBL-interacting serine/threonine-protein kin...    273   3e-84    
ref|XP_010526294.1|  PREDICTED: CBL-interacting serine/threonine-...    273   3e-84    
gb|KHN34705.1|  CBL-interacting serine/threonine-protein kinase 10      271   5e-84    
gb|EMT09949.1|  hypothetical protein F775_44026                         272   6e-84    
ref|XP_009122382.1|  PREDICTED: CBL-interacting serine/threonine-...    272   7e-84    
ref|XP_008443868.1|  PREDICTED: CBL-interacting serine/threonine-...    272   7e-84    
gb|AEZ51510.1|  CBL-interacting protein kinase 30                       272   1e-83    
ref|NP_001265891.1|  CBL-interacting protein kinase 6                   271   1e-83    
dbj|BAK06230.1|  predicted protein                                      272   2e-83    
emb|CDX99010.1|  BnaC09g48250D                                          271   2e-83    
ref|XP_006285443.1|  hypothetical protein CARUB_v10006862mg             271   3e-83    
ref|NP_001065574.1|  Os11g0113700                                       270   4e-83    
ref|XP_003577849.1|  PREDICTED: CBL-interacting protein kinase 15...    270   4e-83    
ref|XP_009369548.1|  PREDICTED: CBL-interacting serine/threonine-...    271   4e-83    
ref|XP_004161871.1|  PREDICTED: CBL-interacting serine/threonine-...    270   5e-83    
gb|KHN46285.1|  CBL-interacting serine/threonine-protein kinase 10      270   5e-83    
ref|XP_003538331.1|  PREDICTED: CBL-interacting serine/threonine-...    270   5e-83    
ref|XP_004146689.1|  PREDICTED: CBL-interacting serine/threonine-...    269   6e-83    
ref|XP_010447637.1|  PREDICTED: CBL-interacting serine/threonine-...    270   7e-83    
gb|KHG27764.1|  CBL-interacting serine/threonine-protein kinase 10      270   1e-82    
gb|EMS59743.1|  CBL-interacting protein kinase 30                       270   1e-82    
gb|KHG28276.1|  CBL-interacting protein kinase 2                        268   1e-82    
ref|XP_007154893.1|  hypothetical protein PHAVU_003G156900g             268   1e-82    
ref|XP_008456483.1|  PREDICTED: CBL-interacting serine/threonine-...    268   1e-82    
ref|XP_002324548.1|  CBL-interacting protein kinase 6                   268   2e-82    
ref|XP_006350095.1|  PREDICTED: CBL-interacting serine/threonine-...    268   2e-82    
ref|XP_007159452.1|  hypothetical protein PHAVU_002G238800g             270   2e-82    
ref|XP_006662667.1|  PREDICTED: CBL-interacting protein kinase 14...    268   2e-82    
ref|XP_011018017.1|  PREDICTED: CBL-interacting serine/threonine-...    268   3e-82    
gb|EEC71517.1|  hypothetical protein OsI_03811                          269   3e-82    
ref|XP_006650055.1|  PREDICTED: CBL-interacting protein kinase 10...    268   3e-82    
dbj|BAB61199.1|  OsPK4-like protein                                     269   3e-82    
ref|NP_001044309.1|  Os01g0759200                                       269   3e-82    
gb|EMS48892.1|  CBL-interacting protein kinase 10                       268   4e-82    
ref|XP_009127378.1|  PREDICTED: CBL-interacting serine/threonine-...    268   4e-82    
gb|KHN06402.1|  CBL-interacting serine/threonine-protein kinase 12      270   4e-82    
ref|XP_010042572.1|  PREDICTED: CBL-interacting protein kinase 2-...    267   4e-82    
ref|XP_003524205.1|  PREDICTED: CBL-interacting serine/threonine-...    269   5e-82    
gb|KFK27027.1|  hypothetical protein AALP_AA8G324700                    267   5e-82    
ref|XP_006412646.1|  hypothetical protein EUTSA_v10025230mg             267   6e-82    
gb|AFK41470.1|  unknown                                                 269   6e-82    
ref|XP_010048823.1|  PREDICTED: CBL-interacting serine/threonine-...    266   9e-82    
ref|XP_006663738.1|  PREDICTED: CBL-interacting protein kinase 14...    267   1e-81    
ref|XP_009108957.1|  PREDICTED: CBL-interacting serine/threonine-...    266   1e-81    
ref|XP_010432919.1|  PREDICTED: CBL-interacting serine/threonine-...    266   1e-81    
gb|AFW03556.1|  CBL interacting protein kinase 15                       266   2e-81    
ref|XP_006600550.1|  PREDICTED: CBL-interacting serine/threonine-...    265   2e-81    
ref|XP_004139258.1|  PREDICTED: CBL-interacting serine/threonine-...    265   2e-81    
ref|XP_010529203.1|  PREDICTED: CBL-interacting serine/threonine-...    267   2e-81    
emb|CDM84317.1|  unnamed protein product                                266   3e-81    
ref|XP_003519143.1|  PREDICTED: CBL-interacting serine/threonine-...    264   7e-81    
ref|XP_009795102.1|  PREDICTED: CBL-interacting serine/threonine-...    264   7e-81    
ref|XP_002450136.1|  hypothetical protein SORBIDRAFT_05g001050          264   7e-81    
gb|AFD97324.1|  kinase CIPK6                                            264   9e-81    
gb|EYU25351.1|  hypothetical protein MIMGU_mgv1a007012mg                263   9e-81    
ref|NP_001044665.2|  Os01g0824600                                       264   1e-80    
ref|XP_004485906.1|  PREDICTED: CBL-interacting serine/threonine-...    265   1e-80    
gb|KHN18322.1|  CBL-interacting serine/threonine-protein kinase 6       263   1e-80    
gb|AAL37170.1|AF319169_1  CBL-interacting protein kinase                263   1e-80    
ref|XP_006414068.1|  hypothetical protein EUTSA_v10025024mg             265   1e-80    
sp|Q0JI49.1|CIPKB_ORYSJ  RecName: Full=CBL-interacting protein ki...    265   1e-80    
gb|KHN42812.1|  CBL-interacting serine/threonine-protein kinase 6       263   2e-80    
gb|AAT64036.1|  putative serine-threonine kinase                        265   2e-80    
dbj|BAD87085.1|  putative serine/threonine Kinase                       265   2e-80    
ref|NP_194825.1|  CBL-interacting serine/threonine-protein kinase 6     263   2e-80    
gb|EMT15390.1|  CBL-interacting protein kinase 10                       263   2e-80    
emb|CDX99438.1|  BnaC01g11140D                                          264   2e-80    
gb|ACN26527.1|  unknown                                                 261   3e-80    
ref|NP_001267737.1|  uncharacterized protein LOC101758744               263   4e-80    
ref|XP_010925623.1|  PREDICTED: CBL-interacting serine/threonine-...    263   4e-80    
ref|XP_010089695.1|  CBL-interacting serine/threonine-protein kin...    263   5e-80    
gb|KFK28542.1|  hypothetical protein AALP_AA7G010200                    264   5e-80    
gb|ACF86984.1|  unknown                                                 262   5e-80    
ref|NP_001108478.1|  CBL-interacting protein kinase                     262   6e-80    
ref|XP_004507724.1|  PREDICTED: CBL-interacting serine/threonine-...    262   7e-80    
gb|EPS69417.1|  serine-threonine kinase                                 262   9e-80    
gb|EPS61661.1|  hypothetical protein M569_13134                         262   1e-79    
ref|XP_008225307.1|  PREDICTED: CBL-interacting serine/threonine-...    263   1e-79    
ref|NP_199393.1|  SNF1-related protein kinase                           262   1e-79    
ref|XP_006285967.1|  hypothetical protein CARUB_v10007488mg             263   1e-79    
ref|XP_010438101.1|  PREDICTED: CBL-interacting serine/threonine-...    261   1e-79    
gb|ACD56654.1|  putative serine-threonine kinase                        262   2e-79    
ref|XP_002441815.1|  hypothetical protein SORBIDRAFT_08g002740          261   2e-79    
gb|EMT13477.1|  CBL-interacting protein kinase 14                       261   2e-79    
gb|ACQ83516.1|  CBL-interacting protein kinase 29                       262   2e-79    
gb|EYU45678.1|  hypothetical protein MIMGU_mgv1a006057mg                261   2e-79    
ref|XP_010274456.1|  PREDICTED: CBL-interacting serine/threonine-...    261   2e-79    
ref|XP_002865222.1|  CIPK19                                             261   2e-79    
ref|XP_006830258.1|  hypothetical protein AMTR_s00130p00109330          261   2e-79    
ref|XP_009406059.1|  PREDICTED: CBL-interacting protein kinase 18...    259   3e-79    
ref|XP_008384733.1|  PREDICTED: CBL-interacting serine/threonine-...    261   3e-79    
ref|XP_010449480.1|  PREDICTED: CBL-interacting serine/threonine-...    261   4e-79    
ref|XP_010441666.1|  PREDICTED: CBL-interacting serine/threonine-...    261   4e-79    
ref|XP_010434498.1|  PREDICTED: CBL-interacting serine/threonine-...    261   4e-79    
ref|XP_009137980.1|  PREDICTED: CBL-interacting serine/threonine-...    259   4e-79    
ref|XP_009351033.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    261   4e-79    
emb|CDO96813.1|  unnamed protein product                                261   4e-79    
ref|XP_010231264.1|  PREDICTED: CBL-interacting protein kinase 28...    260   5e-79    
gb|AGA37201.1|  CBL-interacting protein kinase 12.1                     261   5e-79    
ref|XP_010275072.1|  PREDICTED: CBL-interacting serine/threonine-...    259   5e-79    
ref|XP_010275070.1|  PREDICTED: CBL-interacting serine/threonine-...    259   6e-79    
ref|XP_008804961.1|  PREDICTED: CBL-interacting serine/threonine-...    260   7e-79    
ref|XP_006282326.1|  hypothetical protein CARUB_v10028618mg             260   7e-79    
ref|XP_008383616.1|  PREDICTED: CBL-interacting serine/threonine-...    261   7e-79    
ref|XP_007025352.1|  CBL-interacting protein kinase 12 isoform 1        260   8e-79    
ref|XP_007212023.1|  hypothetical protein PRUPE_ppa004907mg             260   9e-79    
ref|XP_007148033.1|  hypothetical protein PHAVU_006G174800g             260   1e-78    
ref|XP_009352754.1|  PREDICTED: CBL-interacting serine/threonine-...    260   1e-78    
ref|NP_193605.1|  CBL-interacting serine/threonine-protein kinase 12    260   1e-78    
ref|XP_002867980.1|  CIPK12                                             260   1e-78    
ref|XP_008345916.1|  PREDICTED: CBL-interacting serine/threonine-...    260   1e-78    
ref|XP_002453344.1|  hypothetical protein SORBIDRAFT_04g004230          259   1e-78    
emb|CAA74646.1|  putative serine/threonine protein kinase               259   2e-78    
gb|ACC96114.1|  CBL-interacting protein kinase 6                        258   2e-78    
ref|XP_009406231.1|  PREDICTED: CBL-interacting serine/threonine-...    259   2e-78    
ref|XP_010494732.1|  PREDICTED: CBL-interacting serine/threonine-...    259   2e-78    
ref|NP_001267932.1|  CBL-interacting protein kinase 01                  258   2e-78    
ref|XP_002458524.1|  hypothetical protein SORBIDRAFT_03g035160          259   2e-78    
ref|XP_010655436.1|  PREDICTED: CBL-interacting protein kinase 01...    259   2e-78    
gb|KHN47998.1|  CBL-interacting serine/threonine-protein kinase 12      260   2e-78    
ref|XP_010101039.1|  CBL-interacting serine/threonine-protein kin...    258   2e-78    
ref|XP_003610339.1|  CBL-interacting protein kinase                     258   2e-78    
ref|XP_002467894.1|  hypothetical protein SORBIDRAFT_01g036020          258   3e-78    
ref|XP_004293960.1|  PREDICTED: CBL-interacting serine/threonine-...    259   3e-78    
ref|NP_001269081.1|  uncharacterized protein LOC101766857               258   3e-78    
ref|XP_006585169.1|  PREDICTED: CBL-interacting serine/threonine-...    260   3e-78    
gb|KEH36608.1|  CBL-interacting kinase                                  259   3e-78    
ref|XP_010538566.1|  PREDICTED: CBL-interacting serine/threonine-...    259   3e-78    
ref|XP_009598784.1|  PREDICTED: CBL-interacting serine/threonine-...    257   4e-78    
ref|XP_009108380.1|  PREDICTED: CBL-interacting serine/threonine-...    258   4e-78    
ref|XP_010481527.1|  PREDICTED: CBL-interacting serine/threonine-...    258   4e-78    
ref|XP_009132122.1|  PREDICTED: CBL-interacting serine/threonine-...    259   4e-78    
ref|XP_010247984.1|  PREDICTED: CBL-interacting serine/threonine-...    257   5e-78    
ref|NP_001146886.1|  LOC100280494                                       257   5e-78    
ref|XP_010924598.1|  PREDICTED: CBL-interacting protein kinase 19...    258   5e-78    
ref|XP_004951849.1|  PREDICTED: CBL-interacting protein kinase 26...    257   6e-78    
gb|EEC71723.1|  hypothetical protein OsI_04261                          266   6e-78    
gb|KCW88301.1|  hypothetical protein EUGRSUZ_A00690                     257   7e-78    
emb|CDX78885.1|  BnaA01g09520D                                          257   8e-78    
ref|XP_010232357.1|  PREDICTED: CBL-interacting protein kinase 30...    257   1e-77    
ref|XP_009795417.1|  PREDICTED: CBL-interacting serine/threonine-...    256   1e-77    
gb|KDP21109.1|  hypothetical protein JCGZ_21580                         257   1e-77    
dbj|BAJ99246.1|  predicted protein                                      257   2e-77    
gb|EAY84575.1|  hypothetical protein OsI_05947                          257   2e-77    
ref|NP_001045974.1|  Os02g0161000                                       256   2e-77    
ref|XP_003547175.1|  PREDICTED: CBL-interacting serine/threonine-...    257   3e-77    
gb|EEE55601.1|  hypothetical protein OsJ_03914                          266   3e-77    
ref|XP_009411257.1|  PREDICTED: CBL-interacting protein kinase 6-...    254   3e-77    
ref|XP_004955457.1|  PREDICTED: CBL-interacting protein kinase 23...    255   3e-77    
ref|XP_007163608.1|  hypothetical protein PHAVU_001G248700g             254   5e-77    
gb|EMT10937.1|  CBL-interacting protein kinase 26                       256   5e-77    
ref|XP_008371628.1|  PREDICTED: CBL-interacting serine/threonine-...    255   6e-77    
gb|EEC75223.1|  hypothetical protein OsI_11492                          254   6e-77    
ref|XP_009360934.1|  PREDICTED: CBL-interacting serine/threonine-...    254   6e-77    
ref|XP_003542982.1|  PREDICTED: CBL-interacting serine/threonine-...    256   6e-77    
ref|XP_004970402.1|  PREDICTED: CBL-interacting protein kinase 11...    256   7e-77    
ref|XP_009360933.1|  PREDICTED: CBL-interacting serine/threonine-...    254   7e-77    
ref|XP_009360932.1|  PREDICTED: CBL-interacting serine/threonine-...    254   7e-77    
ref|XP_002515434.1|  CBL-interacting serine/threonine-protein kin...    254   7e-77    
ref|XP_009360931.1|  PREDICTED: CBL-interacting serine/threonine-...    254   8e-77    
ref|NP_001148041.1|  CBL-interacting serine/threonine-protein kin...    255   1e-76    
ref|XP_011085979.1|  PREDICTED: CBL-interacting serine/threonine-...    254   1e-76    
ref|NP_001050062.1|  Os03g0339900                                       253   1e-76    
ref|XP_006361312.1|  PREDICTED: CBL-interacting protein kinase 18...    253   1e-76    
gb|EYU28098.1|  hypothetical protein MIMGU_mgv1a005690mg                254   1e-76    
ref|XP_009615813.1|  PREDICTED: CBL-interacting serine/threonine-...    254   2e-76    
ref|XP_008225519.1|  PREDICTED: CBL-interacting serine/threonine-...    253   2e-76    
gb|EMS64809.1|  CBL-interacting protein kinase 11                       254   2e-76    



>ref|XP_004234086.1| PREDICTED: CBL-interacting protein kinase 5-like [Solanum lycopersicum]
Length=465

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 219/271 (81%), Gaps = 7/271 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDGEKADIWSCGVILFVLLAGYLP  D+NL+EMY+KI KG FKCP++F
Sbjct  184  AYVAPEVINKRGYDGEKADIWSCGVILFVLLAGYLPFHDTNLLEMYKKITKGIFKCPEYF  243

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EVKKLL +ILDPNPI RI+L+KLM+N+WF+K F Q+     +    +D+SPRSV D+ 
Sbjct  244  PYEVKKLLLRILDPNPISRITLAKLMDNNWFKKGFKQIDKPFILDQDHDDDSPRSVFDMV  303

Query  361  DD-------RSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
            DD       R   + + + MKPTCLNAFDIISLSP FDLS LF+ D + + ++RFTTQ+ 
Sbjct  304  DDSDAECSSRHKEESSSTIMKPTCLNAFDIISLSPGFDLSSLFEKDKSHRSDARFTTQKS  363

Query  520  ASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            ASTIVS+ EE+A    F+V+KKDG VK+QG+K+GRKGQLAIDAEIFE+TP+FHVV+V K 
Sbjct  364  ASTIVSRLEEVASMGSFKVKKKDGTVKMQGSKEGRKGQLAIDAEIFEITPAFHVVQVTKK  423

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            SGDT EYRNFC+Q L+PSLKDI+W W+G+EQ
Sbjct  424  SGDTAEYRNFCDQGLKPSLKDIVWTWQGNEQ  454



>emb|CDO96812.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/273 (69%), Positives = 217/273 (79%), Gaps = 14/273 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDGEKADIWSCGVILFVLLAGYLP  D+NLMEMY+KI +G+FKCP+WF
Sbjct  176  AYVAPEVINKKGYDGEKADIWSCGVILFVLLAGYLPFHDTNLMEMYKKISRGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPI--ADSQNDESPRSVL  351
            PPEVKKL+++ILDPNP  R+ LSK+MENSWF+K F Q+  PI  +  AD +  ESPR VL
Sbjct  236  PPEVKKLMSRILDPNPCTRMPLSKIMENSWFKKGFKQIAIPIPDLDGADWEEFESPRGVL  295

Query  352  DIFDDRSTSDPAG----------SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESR  501
            DI  D   SD  G           +MKPTCLNAFDIISLSP FDLSGLF  D N K E+R
Sbjct  296  DI-HDLCNSDSEGIHQHKEEVITRTMKPTCLNAFDIISLSPGFDLSGLFIKDVNCKSEAR  354

Query  502  FTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHV  681
            FTTQ P S +V+K EEIA  + F+V+KKDGMVKLQGNK GRKG LAIDAEIFEVTPSFH+
Sbjct  355  FTTQMPPSMVVAKLEEIAAIDSFKVKKKDGMVKLQGNKGGRKGLLAIDAEIFEVTPSFHM  414

Query  682  VEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWE  780
            VEVKK +GDTMEY+ FC+QELRPSLK I+W W+
Sbjct  415  VEVKKRAGDTMEYKKFCDQELRPSLKGIVWDWQ  447



>ref|XP_011085980.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Sesamum indicum]
 ref|XP_011085981.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Sesamum indicum]
Length=459

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/273 (67%), Positives = 222/273 (81%), Gaps = 15/273 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDGEKADIWSCGVILFVLLAGYLP  DSNLMEMYRKI KG+FKCP+WF
Sbjct  176  AYVAPEVINKRGYDGEKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISKGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEVKKLL++ILDPNP  RI++S++MENSWF+K F +++  TP  D  +++SPRS+L+I 
Sbjct  236  PPEVKKLLSRILDPNPSTRITVSRIMENSWFRKGFKRIE--TPDLD-LDEQSPRSILEI-  291

Query  361  DDRSTSDPAGS---------SMKPTCLNAFDIISLSPSFDLSGLFDVD--TNKKPESRFT  507
            DD  T   +G          + KP CLNAFDIISLSP FDLSGLF+ D   + K E+ FT
Sbjct  292  DDSDTESCSGKNKEDAQPAVAKKPNCLNAFDIISLSPGFDLSGLFEKDRSNSAKSEAWFT  351

Query  508  TQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVE  687
            TQ P S +VSK EE+A+ E F+++KKDG+VK+QG+K GRKGQLAIDAEIFEVTPSFH+VE
Sbjct  352  TQMPPSMVVSKLEELAVMESFKIKKKDGIVKMQGSKGGRKGQLAIDAEIFEVTPSFHMVE  411

Query  688  VKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGS  786
            VKK++GDTMEY  F +QEL+PSLKD++W WEGS
Sbjct  412  VKKTAGDTMEYVKFRDQELKPSLKDVVWSWEGS  444



>emb|CBI30698.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/262 (68%), Positives = 213/262 (81%), Gaps = 16/262 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGVILFVL+AG+LP  D NLMEMYRKI +G+FKCP+WF
Sbjct  109  AYVAPEVINKKGYDGAKADMWSCGVILFVLMAGFLPFHDPNLMEMYRKISRGEFKCPQWF  168

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EV+KLL+KILDP+P  RI+++KLM+N WF+K F   KPI     ++ND          
Sbjct  169  PLEVRKLLSKILDPSPSTRITVAKLMDNPWFKKGF---KPIVAPQPNRND----------  215

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
               S SD   SSMKPTCLNAFDIISLSP FDLSGLF+ DTN +P++RFTT+QPASTIVSK
Sbjct  216  ---SMSDETTSSMKPTCLNAFDIISLSPGFDLSGLFEKDTNHRPDARFTTKQPASTIVSK  272

Query  541  FEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTMEY  720
             EEIA  E F+V+KKDG VKLQG+K+GRKGQLAIDAEIFEVTPS  VVEVKK++GDT+EY
Sbjct  273  LEEIAEMERFKVKKKDGTVKLQGSKEGRKGQLAIDAEIFEVTPSLFVVEVKKTAGDTLEY  332

Query  721  RNFCEQELRPSLKDIIWKWEGS  786
            + FC Q+L+PSLKDI+W W+G+
Sbjct  333  KKFCNQDLKPSLKDIVWTWQGN  354



>ref|XP_009352757.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X2 [Pyrus x bretschneideri]
Length=461

 Score =   368 bits (945),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 216/276 (78%), Gaps = 17/276 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+LFVLLAG+LP  D+NLMEMYRKI +GDFK P+WF
Sbjct  175  AYVAPEVINKKGYDGAKADTWSCGVVLFVLLAGFLPFHDTNLMEMYRKISRGDFKSPQWF  234

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEV KLL++ILDPNP  RIS+ K+MENSWF+K F Q++ P+T   D     S R V + 
Sbjct  235  PPEVCKLLSRILDPNPSSRISVDKIMENSWFKKGFKQIEAPLTLPCDPST--SIRDVHEA  292

Query  358  FDDRSTSDPAG------------SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESR  501
            F   STS  AG            SSM+PTC NAFDIISLSP FDLSGLF+ D N +P++R
Sbjct  293  F--ASTSHSAGEGSNKNASGAGTSSMRPTCFNAFDIISLSPGFDLSGLFEKDMNHRPQAR  350

Query  502  FTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHV  681
            FT+ +PA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSFHV
Sbjct  351  FTSTKPAATIVSKFEAIAQTERFKCMKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSFHV  410

Query  682  VEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            VE+KK++GDT+EY  FC+ +L+PSLKDI+W W+G+E
Sbjct  411  VEMKKTAGDTLEYMEFCDHDLKPSLKDIVWTWQGTE  446



>ref|XP_009352756.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X1 [Pyrus x bretschneideri]
Length=473

 Score =   368 bits (944),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 216/276 (78%), Gaps = 17/276 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+LFVLLAG+LP  D+NLMEMYRKI +GDFK P+WF
Sbjct  187  AYVAPEVINKKGYDGAKADTWSCGVVLFVLLAGFLPFHDTNLMEMYRKISRGDFKSPQWF  246

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEV KLL++ILDPNP  RIS+ K+MENSWF+K F Q++ P+T   D     S R V + 
Sbjct  247  PPEVCKLLSRILDPNPSSRISVDKIMENSWFKKGFKQIEAPLTLPCDPST--SIRDVHEA  304

Query  358  FDDRSTSDPAG------------SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESR  501
            F   STS  AG            SSM+PTC NAFDIISLSP FDLSGLF+ D N +P++R
Sbjct  305  F--ASTSHSAGEGSNKNASGAGTSSMRPTCFNAFDIISLSPGFDLSGLFEKDMNHRPQAR  362

Query  502  FTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHV  681
            FT+ +PA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSFHV
Sbjct  363  FTSTKPAATIVSKFEAIAQTERFKCMKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSFHV  422

Query  682  VEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            VE+KK++GDT+EY  FC+ +L+PSLKDI+W W+G+E
Sbjct  423  VEMKKTAGDTLEYMEFCDHDLKPSLKDIVWTWQGTE  458



>ref|XP_008383619.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X2 [Malus domestica]
Length=458

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/273 (64%), Positives = 214/273 (78%), Gaps = 14/273 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+LFVLLAG+LP  D+NLMEMYRK  +GDFK P+WF
Sbjct  175  AYVAPEVINKKGYDGAKADTWSCGVVLFVLLAGFLPFHDTNLMEMYRKXSRGDFKSPQWF  234

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEV KLL++ILDPNP  RIS+ K+MENSWF+K F Q++ P+    D     S R V + 
Sbjct  235  PPEVSKLLSRILDPNPSSRISVDKIMENSWFKKGFKQIEAPLALPCDPST--SIRDVHEA  292

Query  358  FDDRSTSDPAG---------SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
            F   STS  AG         SSM+PTC NAFDIISLSP FDLSGLF+ D N +P++RFT+
Sbjct  293  F--ASTSHSAGEGNASGAGTSSMRPTCFNAFDIISLSPGFDLSGLFEKDMNHRPQARFTS  350

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
             +PA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSFHVVE+
Sbjct  351  TKPAATIVSKFEAIAQTERFKCMKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSFHVVEM  410

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            KK++GDT+EY  FC+ +L+PSLKDI+W W+G+E
Sbjct  411  KKTAGDTLEYMEFCDHDLKPSLKDIVWTWQGTE  443



>ref|XP_008383618.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X1 [Malus domestica]
Length=470

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/273 (64%), Positives = 214/273 (78%), Gaps = 14/273 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+LFVLLAG+LP  D+NLMEMYRK  +GDFK P+WF
Sbjct  187  AYVAPEVINKKGYDGAKADTWSCGVVLFVLLAGFLPFHDTNLMEMYRKXSRGDFKSPQWF  246

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEV KLL++ILDPNP  RIS+ K+MENSWF+K F Q++ P+    D     S R V + 
Sbjct  247  PPEVSKLLSRILDPNPSSRISVDKIMENSWFKKGFKQIEAPLALPCDPST--SIRDVHEA  304

Query  358  FDDRSTSDPAG---------SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
            F   STS  AG         SSM+PTC NAFDIISLSP FDLSGLF+ D N +P++RFT+
Sbjct  305  F--ASTSHSAGEGNASGAGTSSMRPTCFNAFDIISLSPGFDLSGLFEKDMNHRPQARFTS  362

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
             +PA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSFHVVE+
Sbjct  363  TKPAATIVSKFEAIAQTERFKCMKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSFHVVEM  422

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            KK++GDT+EY  FC+ +L+PSLKDI+W W+G+E
Sbjct  423  KKTAGDTLEYMEFCDHDLKPSLKDIVWTWQGTE  455



>ref|XP_009800912.1| PREDICTED: CBL-interacting protein kinase 5 [Nicotiana sylvestris]
Length=462

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 208/267 (78%), Gaps = 9/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDGEKADIWSCGV+LFVLLAGYLP  D NLMEMY+KI KG+FKCP+WF
Sbjct  180  AYVAPEVINKRGYDGEKADIWSCGVVLFVLLAGYLPFHDQNLMEMYKKISKGEFKCPQWF  239

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL++ILDPNP  RI+L+KLMEN WF+K F Q+   T     Q  ESPRSVLDI 
Sbjct  240  HPEVRKLLSRILDPNPSSRITLTKLMENYWFKKGFKQIDKTTNPGKEQL-ESPRSVLDIE  298

Query  361  DDRSTS--------DPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            D  S          D   ++MKPTCLNAFDIISLSP FDLSGLF+ +  +K ++RFT ++
Sbjct  299  DHISDGEGPSNPKKDQDSTTMKPTCLNAFDIISLSPGFDLSGLFEKEKERKSDTRFTAKK  358

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            PAS IVSK EE+A +E F V+KKDG V +Q  K+GRKGQLAIDAEIFE+TPSFHVVEV K
Sbjct  359  PASIIVSKLEEVASNESFNVKKKDGTVTMQSIKEGRKGQLAIDAEIFEITPSFHVVEVSK  418

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKW  777
             SGDTMEY+ F +Q L+ SLKDI+W W
Sbjct  419  KSGDTMEYKKFFDQGLKTSLKDIVWTW  445



>ref|XP_006358155.1| PREDICTED: CBL-interacting protein kinase 5-like [Solanum tuberosum]
Length=459

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 211/272 (78%), Gaps = 9/272 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDGEKADIWSCGV+LFVLLAGYLP  D NLMEMY+KI K +FKCP+WF
Sbjct  181  AYVAPEVINKRGYDGEKADIWSCGVVLFVLLAGYLPFHDQNLMEMYKKISKAEFKCPQWF  240

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL++ILDPNP  RI+L KLM+NSWF+K F Q+   TP       ESPRSV DI 
Sbjct  241  HPEVRKLLSRILDPNPGSRITLIKLMDNSWFKKGFKQIDK-TPNPGKDQRESPRSVFDIE  299

Query  361  DDRST----SDPA----GSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            D+ S     S+P      ++MKPTCLNAFDIISLSP FDLSGLF+ +  ++ E+RFT ++
Sbjct  300  DNNSDGEGPSNPQKNQDSTTMKPTCLNAFDIISLSPGFDLSGLFEKEKERRSEARFTAKK  359

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            PAS IVSK EE+A +E F + KKDG V +Q  K+GRKGQLAIDAEIFE+TPSFHVVEV K
Sbjct  360  PASIIVSKLEEVASNESFNIMKKDGTVTMQSIKEGRKGQLAIDAEIFEITPSFHVVEVSK  419

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
             SGDTMEY+ F +Q L+ SLKDI+W W+  EQ
Sbjct  420  KSGDTMEYKKFFDQGLKTSLKDIVWTWQDGEQ  451



>ref|XP_009616687.1| PREDICTED: CBL-interacting protein kinase 5 [Nicotiana tomentosiformis]
Length=462

 Score =   365 bits (937),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 208/267 (78%), Gaps = 9/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDGEKADIWSCGV+LFVLLAGYLP  D NLMEMY+KI KG+FKCP+WF
Sbjct  180  AYVAPEVINKRGYDGEKADIWSCGVVLFVLLAGYLPFHDQNLMEMYKKISKGEFKCPQWF  239

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL++ILDPNP  RI+L+KLM+N WF+K F Q+   T     Q  ESPRSVLDI 
Sbjct  240  HPEVRKLLSRILDPNPSSRITLTKLMDNYWFKKGFKQIDKTTNPGKEQL-ESPRSVLDIE  298

Query  361  DDRSTS--------DPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            D  S          D   ++MKPTCLNAFDIISLSP FDLSGLF+ +  +K ++RFT ++
Sbjct  299  DHNSDGEGPSNPKKDQDSTTMKPTCLNAFDIISLSPGFDLSGLFEKEKERKSDARFTAKK  358

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            PAS IVSK EE+A +E F V+KKDG V +Q  K+GRKGQLAIDAEIFE+TPSFHVVEV K
Sbjct  359  PASIIVSKLEEVASNESFNVKKKDGTVTMQSIKEGRKGQLAIDAEIFEITPSFHVVEVSK  418

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKW  777
             SGDTMEY+ F +Q L+ SLKDI+W W
Sbjct  419  KSGDTMEYKKFFDQGLKTSLKDIVWTW  445



>ref|XP_004233056.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Solanum lycopersicum]
Length=460

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 210/268 (78%), Gaps = 9/268 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDGEKADIWSCGV+LFVLLAGYLP  D NLMEMY+KI K +FKCP+WF
Sbjct  180  AYVAPEVINKRGYDGEKADIWSCGVVLFVLLAGYLPFHDQNLMEMYKKISKAEFKCPQWF  239

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL++ILDPNP  RI+L KLMEN WF+K F Q+   TP +     ESPRSV DI 
Sbjct  240  HPEVRKLLSRILDPNPGSRITLIKLMENYWFKKGFKQVDK-TPNSGKDQRESPRSVFDIE  298

Query  361  DDRSTSD-PAG-------SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            D+ S  + P+        ++MKPTCLNAFDIISLSP F+LSGLF+ +  ++ E+RFT ++
Sbjct  299  DNNSDGEGPSNRQKNQDSTTMKPTCLNAFDIISLSPGFNLSGLFEKEKERRSEARFTAKK  358

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            PAS IVSK EE+A +E F + KKDG V +Q NK+GRKGQLAIDAEIFE+TPSFHVVEV K
Sbjct  359  PASIIVSKLEEVASNESFNIMKKDGTVTMQSNKEGRKGQLAIDAEIFEITPSFHVVEVSK  418

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWE  780
             SGDTMEY+ F +Q L+ SLKDI+W W+
Sbjct  419  KSGDTMEYKKFFDQGLKTSLKDIVWTWQ  446



>ref|NP_001267894.1| CBL-interacting protein kinase 16 [Vitis vinifera]
 gb|ACQ83532.1| CBL-interacting protein kinase 16 [Vitis vinifera]
Length=450

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/268 (67%), Positives = 216/268 (81%), Gaps = 10/268 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGVILFVL+AG+LP  D NLMEMYRKI +G+FKCP+WF
Sbjct  176  AYVAPEVINKKGYDGAKADMWSCGVILFVLMAGFLPFHDPNLMEMYRKISRGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EV+KLL+KILDP+P  RI+++KLM+N WF+K F   KPI     ++ND S   V  +F
Sbjct  236  PLEVRKLLSKILDPSPSTRITVAKLMDNPWFKKGF---KPIVAPQPNRND-SMSDVRAVF  291

Query  361  DDR------STSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
                       ++   SSMKPTCLNAFDIISLSP FDLSGLF+ DTN +P++RFTT+QPA
Sbjct  292  ATHPEGTSEEEAEETTSSMKPTCLNAFDIISLSPGFDLSGLFEKDTNHRPDARFTTKQPA  351

Query  523  STIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            STIVSK EEIA  E F+V+KKDG VKLQG+K+GRKGQLAIDAEIFEVTPS  VVEVKK++
Sbjct  352  STIVSKLEEIAEMERFKVKKKDGTVKLQGSKEGRKGQLAIDAEIFEVTPSLFVVEVKKTA  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGS  786
            GDT+EY+ FC Q+L+PSLKDI+W W+GS
Sbjct  412  GDTLEYKKFCNQDLKPSLKDIVWTWQGS  439



>ref|XP_008345915.1| PREDICTED: CBL-interacting protein kinase 5-like [Malus domestica]
Length=463

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/275 (62%), Positives = 212/275 (77%), Gaps = 13/275 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+LFVLLA +LP  D+NLMEMYRKI +GDF  P+WF
Sbjct  177  AYVAPEVINKKGYDGAKADTWSCGVVLFVLLAAFLPFHDTNLMEMYRKISRGDFXSPQWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKP-ITPIADSQNDESPRSVLDI  357
            PPEV+KLL++ILDPNP  RIS+ K+MENSWF+K F Q++  + P  D   + S R V + 
Sbjct  237  PPEVRKLLSRILDPNPSSRISVDKIMENSWFKKGFKQIEASLAPPCDP--NTSIRDVHEA  294

Query  358  F----------DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFT  507
            F           ++++S    S M+PTC NAFDIISLSP FDLSGLF+ D N +P+ RF 
Sbjct  295  FASTNHSAEESSNKNSSGAGTSPMRPTCFNAFDIISLSPGFDLSGLFENDMNHRPQERFM  354

Query  508  TQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVE  687
            + QPA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSF+VVE
Sbjct  355  STQPAATIVSKFEAIAQTERFKCLKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSFYVVE  414

Query  688  VKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +KK++GDT+EY  FC+  L+PSLKDI+W W+G+EQ
Sbjct  415  MKKTAGDTLEYMEFCDNGLKPSLKDIVWTWQGTEQ  449



>ref|XP_009350943.1| PREDICTED: CBL-interacting protein kinase 5-like [Pyrus x bretschneideri]
Length=463

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+LFVLLA +LP  D+NLMEMYRKI +GDFK P+WF
Sbjct  177  AYVAPEVINKKGYDGAKADTWSCGVVLFVLLAAFLPFHDTNLMEMYRKISRGDFKSPQWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKP-ITPIADSQNDESPRSVLDI  357
            PPEV+KLL++ILDPNP  RIS+ K+MENSWF+K F Q++  + P  D   + S R V + 
Sbjct  237  PPEVRKLLSRILDPNPSSRISVDKIMENSWFKKGFKQIEASLAPPCDP--NTSIRDVHEA  294

Query  358  F----------DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFT  507
            F           ++++S    S M+PTC NAFDIISLSP FDLSGLF+ D N + + RFT
Sbjct  295  FASTNHSAEESSNKNSSGAGISPMRPTCFNAFDIISLSPGFDLSGLFENDMNHRLQERFT  354

Query  508  TQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVE  687
            + QPA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSF+VVE
Sbjct  355  STQPAATIVSKFEAIAQTERFKCLKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSFYVVE  414

Query  688  VKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +KK++GDT+EY  FC+  L+PSLKDI+W W+G+EQ
Sbjct  415  MKKTAGDTLEYMEFCDHGLKPSLKDIVWTWQGTEQ  449



>ref|XP_010276975.1| PREDICTED: CBL-interacting protein kinase 5-like [Nelumbo nucifera]
Length=469

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 213/267 (80%), Gaps = 4/267 (1%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+K+GYDG K+DIWSCGV+LFVLLAGYLP  DSNLMEMYRKI +GDF+CP+W 
Sbjct  201  AYVAPEVISKKGYDGAKSDIWSCGVVLFVLLAGYLPFHDSNLMEMYRKISRGDFRCPQWI  260

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFT--QLKPITPIADSQNDESPRSVLD  354
             PE +KLL+++LDPNP  RI+L+K+MENSWF+K F   Q  P+     + + +  ++   
Sbjct  261  SPEARKLLSRLLDPNPSTRITLAKVMENSWFRKGFRPFQAPPVEEDVPAIDRDIKKAFES  320

Query  355  IFDDRSTSDPAG-SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
              DD S     G SSMKPTC+NAFDIISLS  F+LSGLF   +  K E+RFTT +PAS I
Sbjct  321  NPDDCSKEKSEGTSSMKPTCMNAFDIISLSSGFNLSGLFQ-QSEHKQEARFTTTKPASAI  379

Query  532  VSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            VSKFEEIA  E F+V+KKDGMVKL+G+K+GRKG LAI+AEIFEVTPSF++VEVKK+SGDT
Sbjct  380  VSKFEEIAKMERFKVKKKDGMVKLEGSKEGRKGHLAINAEIFEVTPSFYMVEVKKASGDT  439

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +EY+ FC QELRPSLKDI+W W+G +Q
Sbjct  440  LEYQKFCNQELRPSLKDIVWTWQGVDQ  466



>ref|XP_007211421.1| hypothetical protein PRUPE_ppa005365mg [Prunus persica]
 gb|EMJ12620.1| hypothetical protein PRUPE_ppa005365mg [Prunus persica]
Length=464

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/279 (61%), Positives = 212/279 (76%), Gaps = 19/279 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+L+VLLAG+LP  D+NLMEMYRKI KGDFK P+WF
Sbjct  177  AYVAPEVINKKGYDGAKADTWSCGVVLYVLLAGFLPFHDTNLMEMYRKISKGDFKSPQWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITP--------------IA  315
            PPEV+KLL++ILDPNP  RIS+ K++ENSWF+K F  ++ P+ P               A
Sbjct  237  PPEVRKLLSRILDPNPNTRISVDKIVENSWFKKGFKLVEAPLPPPDPNASILRDVQAAFA  296

Query  316  DSQNDESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPE  495
             +  DES          + TS    S M+PTC NAFDIISLSP FDLSGLF+ D   +P+
Sbjct  297  STTTDESAEGS----SHKKTSTAGTSPMRPTCFNAFDIISLSPGFDLSGLFENDMQHRPQ  352

Query  496  SRFTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSF  675
            +RFT+ +PA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSF
Sbjct  353  ARFTSTKPAATIVSKFEAIAETERFKCMKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSF  412

Query  676  HVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +VVE+KK++GDT+EY  FC+ +L+PSL+DI+W W+GSEQ
Sbjct  413  YVVEMKKTAGDTLEYMEFCDHDLKPSLQDIVWTWQGSEQ  451



>ref|XP_008443358.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Cucumis melo]
Length=463

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/281 (63%), Positives = 213/281 (76%), Gaps = 20/281 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWS GV+LFVLLAGYLP  D NLMEMYRKI +G+FKCP+WF
Sbjct  176  AYVAPEVINKKGYDGAKADIWSSGVVLFVLLAGYLPFHDPNLMEMYRKISRGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV+KLL++ILDP+P  RI+++KLMENSWF+K F     +T     QN+E   SV D+ 
Sbjct  236  PPEVRKLLSRILDPSPHTRINMAKLMENSWFKKGFKA--NVTTPKQLQNNEDMSSVSDVH  293

Query  361  D---------DRSTSDPAGSSMKPTC---------LNAFDIISLSPSFDLSGLFDVDTNK  486
                        S S+   S   PT           NAFDIISLSP FDLSGLF+ D ++
Sbjct  294  SAFLDISSEGGSSVSNTNESGKPPTATRAPIRNNSFNAFDIISLSPGFDLSGLFESDVSE  353

Query  487  KPESRFTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVT  666
            +P+SRFTT++PAS IVSKFEEIA  E FQV KKDG+VKLQG+KQGRKGQLAIDAEIFEVT
Sbjct  354  RPQSRFTTKKPASAIVSKFEEIAEMERFQVLKKDGIVKLQGSKQGRKGQLAIDAEIFEVT  413

Query  667  PSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            PSF VVEVKK++GDT+EYR F ++++RP LKDI+W WEG+E
Sbjct  414  PSFFVVEVKKTAGDTLEYRQFYDKDMRPCLKDIVWTWEGNE  454



>ref|XP_008371484.1| PREDICTED: LOW QUALITY PROTEIN: CBL-interacting protein kinase 
5 [Malus domestica]
Length=463

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/275 (61%), Positives = 211/275 (77%), Gaps = 13/275 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEV  K+GYDG KAD WSCGV+LFVLLA +LP  D+NLMEMYRKI +GDF  P+WF
Sbjct  177  AYVAPEVXNKKGYDGAKADTWSCGVVLFVLLAAFLPFHDTNLMEMYRKISRGDFXSPQWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKP-ITPIADSQNDESPRSVLDI  357
            PPEV+KLL++ILDPNP  RIS+ K+MENSWF+K F Q++  + P  D   + S R V + 
Sbjct  237  PPEVRKLLSRILDPNPSSRISVDKIMENSWFKKGFKQIEASLAPPCDP--NTSIRDVHEA  294

Query  358  F----------DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFT  507
            F           ++++S    S M+PTC NAFDIISLSP FDLSGLF+ D N +P+ RF 
Sbjct  295  FASTNHSAEESSNKNSSGAGTSPMRPTCFNAFDIISLSPGFDLSGLFENDMNHRPQERFM  354

Query  508  TQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVE  687
            + QPA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSF+VVE
Sbjct  355  STQPAATIVSKFEAIAQTERFKCLKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSFYVVE  414

Query  688  VKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +KK++GDT+EY  FC+  L+PSLKDI+W W+G+EQ
Sbjct  415  MKKTAGDTLEYMEFCDNGLKPSLKDIVWTWQGTEQ  449



>ref|XP_008225305.1| PREDICTED: CBL-interacting protein kinase 5 [Prunus mume]
Length=464

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/276 (62%), Positives = 213/276 (77%), Gaps = 13/276 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+L+VLLAG+LP  D+NLMEMYRKI KGDFK P+WF
Sbjct  177  AYVAPEVINKKGYDGAKADTWSCGVVLYVLLAGFLPFHDTNLMEMYRKISKGDFKSPQWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV+KLL++ILDPNP  R+S+ K+ ENSWF+K F  ++   P  D  N    R V   F
Sbjct  237  PPEVRKLLSRILDPNPNTRVSVDKITENSWFKKGFKLVEAPLPPPDP-NASILRDVQAAF  295

Query  361  DDRST-----------SDPAGSS-MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRF  504
               +T           ++ AG+S M+PTC NAFDIISLSP FDLSGLF+ D   +P++RF
Sbjct  296  ASTTTDESAEGSSHKKTNTAGTSPMRPTCFNAFDIISLSPGFDLSGLFENDMQHRPQARF  355

Query  505  TTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVV  684
            T+ +PA+TIVSKFE IA +E F+  KKDG +KLQG+K+GRKGQL IDAEIFEVTPSF+VV
Sbjct  356  TSTKPAATIVSKFEAIAETERFKCMKKDGTLKLQGSKEGRKGQLGIDAEIFEVTPSFYVV  415

Query  685  EVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            E+KK++GDT+EY  FC+ +L+PSL+DI+W W+GSEQ
Sbjct  416  EMKKTAGDTLEYMEFCDHDLKPSLQDIVWTWQGSEQ  451



>ref|XP_009409392.1| PREDICTED: CBL-interacting protein kinase 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409394.1| PREDICTED: CBL-interacting protein kinase 5-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/270 (63%), Positives = 208/270 (77%), Gaps = 9/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCGVIL+VLLAGYLP  DSNL+EMYRKI KG+F+ P  F
Sbjct  176  AYVAPEIINKKGYDGAKADIWSCGVILYVLLAGYLPFHDSNLIEMYRKITKGEFRFPHRF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V+KLL ++LDPNP  RI++  L+EN WF+K F   KP      S++  + + V+  F
Sbjct  236  PSDVRKLLTRLLDPNPNTRITIEMLVENPWFRKGF---KPAVAPTPSESLSNLKDVISAF  292

Query  361  ------DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
                  DDR+        MKPT LNAFDII+LSP FDLSGLF+    +K E+RFTTQ+PA
Sbjct  293  SIGINNDDRTQKAEMSEPMKPTSLNAFDIIALSPGFDLSGLFETGNREKQEARFTTQKPA  352

Query  523  STIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            S IVSK EEIA  EHF+V+KKDG+VKL+G K GRKGQLAIDAEIFEVTP+F+VVEVKKSS
Sbjct  353  SAIVSKLEEIAEMEHFKVKKKDGLVKLEGRKDGRKGQLAIDAEIFEVTPAFYVVEVKKSS  412

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDTMEY+ FC Q+L+P LKDI+W W+G++Q
Sbjct  413  GDTMEYQKFCNQDLKPYLKDIVWAWQGADQ  442



>gb|EYU43341.1| hypothetical protein MIMGU_mgv1a006048mg [Erythranthe guttata]
Length=459

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/271 (63%), Positives = 216/271 (80%), Gaps = 10/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGY+GEKADIWSCGVILFVLLAGYLP +DSNLME+YRKI +G+F+CP+WF
Sbjct  176  AYVAPEVINKRGYEGEKADIWSCGVILFVLLAGYLPFQDSNLMELYRKISRGEFRCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPI--ADSQNDESPRSVLD  354
            PPEVKKLL++ILDPNP  RIS+S++MENSWF+K F ++ P   +    +  D+SPRS+ +
Sbjct  236  PPEVKKLLSRILDPNPSARISVSRIMENSWFRKGFKRVDPDPDLDTGGAMEDDSPRSIFE  295

Query  355  IFDDRSTSDPAGS-----SMKPTCLNAFDIISLSPSFDLSGLFDVD-TNKKPESRFTTQQ  516
            I D  S S+P        S KP  +NAFDIISLS  FDLSGLF+ D +N +  + FTTQ 
Sbjct  296  IVD--SDSEPCSRKKEDVSPKPHYMNAFDIISLSQGFDLSGLFEKDLSNSRAHAWFTTQV  353

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            P   +VS+ EE+A +E F+++ KDG+VK+QG++ GRKGQLAIDAEIFEVTPSFH+VEVKK
Sbjct  354  PPDVVVSRLEELADTESFKIKMKDGVVKMQGSRGGRKGQLAIDAEIFEVTPSFHMVEVKK  413

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            ++GDT+EY  FC+QEL+PSLKDI+W W+  E
Sbjct  414  TAGDTLEYVKFCDQELKPSLKDIVWSWQSYE  444



>ref|XP_008801610.1| PREDICTED: CBL-interacting protein kinase 5 isoform X1 [Phoenix 
dactylifera]
Length=458

 Score =   353 bits (905),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I+K+GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI +G+FKCP+WF
Sbjct  176  AYVAPEIISKKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISRGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVL--D  354
              +V++LL +ILDP+P  R+++ K++E+ WF+K F       P+  S N    R     +
Sbjct  236  SADVRRLLIRILDPSPSTRLTIEKVVEDPWFKKGFKPTVTYPPVDCSANLTDVREAFRTN  295

Query  355  IFDDRSTSDPAGS-SMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
              DD       GS +M+PT LNAFDIISLSP FDLSGLF+ +  +KPE+RFTTQ+P STI
Sbjct  296  CEDDEGDIRAEGSQTMRPTSLNAFDIISLSPGFDLSGLFERERRQKPETRFTTQKPTSTI  355

Query  532  VSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            VSK EEIA  E F+V+KKDG++KLQG+K+GRKGQLAID EIFEVTPSF+VVE+KK +GDT
Sbjct  356  VSKLEEIAEKERFKVKKKDGILKLQGSKEGRKGQLAIDVEIFEVTPSFYVVEMKKLAGDT  415

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +EY  FC Q+LRPSL+DIIW W+G +Q
Sbjct  416  LEYHKFCNQDLRPSLRDIIWTWQGGDQ  442



>gb|KDO77875.1| hypothetical protein CISIN_1g037702mg [Citrus sinensis]
Length=448

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 216/273 (79%), Gaps = 10/273 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDG KADIWSCGV+LFVLLAG LP  DSNLME+Y+KI + +FKCP WF
Sbjct  176  AYVAPEVINKRGYDGAKADIWSCGVVLFVLLAGNLPFYDSNLMELYKKITRAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEV+KLL++ILDPNP  R++++KLMEN WF+K + +++ P +P    +N +    +  +
Sbjct  236  PPEVRKLLSRILDPNPSTRVTMAKLMENYWFRKGYKKIETPESPRGQDRN-KLISDIHAV  294

Query  358  FDDRSTS----DPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQ  513
            F+  S+S    DP  +S    ++P+  NAFDIISLS  F+LSGLF+ D N K E+RFTT 
Sbjct  295  FECESSSSRDTDPPTNSCRSPVRPSSFNAFDIISLSKGFNLSGLFEGDANSKLEARFTTT  354

Query  514  QPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            +PAS IVSKFEEIA++E  +  KKDG VKLQ N+QGRKGQLA+DAEIFEVTP+FHVVE+K
Sbjct  355  KPASAIVSKFEEIAVTESCKFNKKDGTVKLQHNRQGRKGQLAVDAEIFEVTPAFHVVELK  414

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            K++GDTMEY++FC Q LRPSLKDI+W W+G+++
Sbjct  415  KAAGDTMEYKDFCNQGLRPSLKDIVWTWQGNDE  447



>ref|XP_006449516.1| hypothetical protein CICLE_v10015231mg [Citrus clementina]
 gb|ESR62756.1| hypothetical protein CICLE_v10015231mg [Citrus clementina]
Length=448

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 216/273 (79%), Gaps = 10/273 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDG KADIWSCGV+LFVLLAG LP  DSNLME+Y+KI + +FKCP WF
Sbjct  176  AYVAPEVINKRGYDGAKADIWSCGVVLFVLLAGNLPFYDSNLMELYKKITRAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEV+KLL++ILDPNP  R++++KLMEN WF+K + +++ P +P    +N +    +  +
Sbjct  236  PPEVRKLLSRILDPNPSTRVTMAKLMENYWFRKGYKKIETPESPRGQDRN-KLISDIHAV  294

Query  358  FDDRSTS----DPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQ  513
            F+  S+S    DP  +S    ++P+  NAFDIISLS  F+LSGLF+ D N K E+RFTT 
Sbjct  295  FECESSSSRDTDPPTNSCRSPVRPSSFNAFDIISLSKGFNLSGLFEGDANSKLEARFTTT  354

Query  514  QPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            +PAS IVSKFEEIA++E  +  KKDG VKLQ N+QGRKGQLA+DAEIFEVTP+FHVVE+K
Sbjct  355  KPASAIVSKFEEIAVTESCKFNKKDGTVKLQHNRQGRKGQLAVDAEIFEVTPAFHVVELK  414

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            K++GDTMEY++FC Q LRPSLKDI+W W+G+++
Sbjct  415  KAAGDTMEYKDFCNQGLRPSLKDIVWTWQGNDE  447



>ref|XP_008803093.1| PREDICTED: CBL-interacting protein kinase 5 isoform X3 [Phoenix 
dactylifera]
Length=440

 Score =   349 bits (895),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 205/264 (78%), Gaps = 15/264 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I+K+GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI +G+FKCP+WF
Sbjct  176  AYVAPEIISKKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISRGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V++LL +ILDP+P  R+++ K++E+ WF+K F       P+  S N           
Sbjct  236  SADVRRLLIRILDPSPSTRLTIEKVVEDPWFKKGFKPTVTYPPVDCSAN-----------  284

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
                 +D    +M+PT LNAFDIISLSP FDLSGLF+ +  +KPE+RFTTQ+P STIVSK
Sbjct  285  ----LTDVRSQTMRPTSLNAFDIISLSPGFDLSGLFERERRQKPETRFTTQKPTSTIVSK  340

Query  541  FEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTMEY  720
             EEIA  E F+V+KKDG++KLQG+K+GRKGQLAID EIFEVTPSF+VVE+KK +GDT+EY
Sbjct  341  LEEIAEKERFKVKKKDGILKLQGSKEGRKGQLAIDVEIFEVTPSFYVVEMKKLAGDTLEY  400

Query  721  RNFCEQELRPSLKDIIWKWEGSEQ  792
              FC Q+LRPSL+DIIW W+G +Q
Sbjct  401  HKFCNQDLRPSLRDIIWTWQGGDQ  424



>ref|XP_006830261.1| hypothetical protein AMTR_s00130p00110630 [Amborella trichopoda]
 gb|ERM97677.1| hypothetical protein AMTR_s00130p00110630 [Amborella trichopoda]
Length=454

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/268 (63%), Positives = 208/268 (78%), Gaps = 10/268 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYV PEVI+K+GYDG KADIWSCGV+LFVL+AGYLP  D NLMEMY+KI KG+FK P WF
Sbjct  176  AYVPPEVISKKGYDGAKADIWSCGVVLFVLMAGYLPFHDPNLMEMYKKISKGEFKFPPWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             P+ ++LL+K+LDPNP  RI+++ L+E+ WF+K F   KPI  +       S    +D+ 
Sbjct  236  SPDARRLLSKLLDPNPTSRITMAMLIESPWFKKGF---KPIESLQPPLVVNSEIGDVDLA  292

Query  361  DDRSTSDPAGSS-------MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
             D S  +  G         +KPTCLNAFDIISLSP FDLSGLF+ + N KPE+RFTTQQP
Sbjct  293  FDSSLENGEGEKKGVEKGPVKPTCLNAFDIISLSPGFDLSGLFEKENNPKPEARFTTQQP  352

Query  520  ASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
             S IVSK EEIA +E F+V+KKDG+VKLQG+K+GRKGQLAIDAEIFEVTP+F VVEVKKS
Sbjct  353  VSRIVSKLEEIAETERFKVKKKDGLVKLQGSKEGRKGQLAIDAEIFEVTPTFFVVEVKKS  412

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            +GDT+EY+ FC QEL+PSL+DI+W W+G
Sbjct  413  AGDTLEYQTFCNQELKPSLEDIVWAWQG  440



>ref|XP_004161212.1| PREDICTED: CBL-interacting protein kinase 5-like [Cucumis sativus]
Length=412

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/281 (63%), Positives = 211/281 (75%), Gaps = 20/281 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWS GV+LFVLLAGYLP  D NLMEMYRKI +G+FKCP+WF
Sbjct  125  AYVAPEVINKKGYDGAKADIWSSGVVLFVLLAGYLPFHDPNLMEMYRKISRGEFKCPQWF  184

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-------SP  339
            PPEV+KLL++ILDP+P  RIS++KLMENSWF+K F +   +T     QNDE         
Sbjct  185  PPEVRKLLSRILDPSPRTRISMAKLMENSWFKKGFKE--NVTTPKQLQNDEDMSSVSDVS  242

Query  340  RSVLDIFDD--RSTSDPAGSSMKPTC---------LNAFDIISLSPSFDLSGLFDVDTNK  486
             +  DI  +   S S+   S   PT           NAFD+ISLSP FDLSGLF+ D N+
Sbjct  243  SAFSDISSEGGSSVSNTNESGRPPTATRAPIRNNSFNAFDLISLSPGFDLSGLFESDVNE  302

Query  487  KPESRFTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVT  666
            + +SRFTT +PAS IVSK EEIA  E F+V KKDG+VKLQG+KQGRKGQLAIDAEIFEVT
Sbjct  303  RLQSRFTTTKPASAIVSKLEEIAEMERFKVMKKDGIVKLQGSKQGRKGQLAIDAEIFEVT  362

Query  667  PSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            PSF VVEVKK++GDT+EYR F ++++RP LKDI+W WEG+E
Sbjct  363  PSFSVVEVKKTAGDTLEYRQFYDKDMRPCLKDIVWTWEGNE  403



>ref|XP_006468199.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Citrus sinensis]
Length=451

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/269 (62%), Positives = 212/269 (79%), Gaps = 10/269 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDG KADIWSCGV+LFVLLAG LP  DSNLME+Y+KI + +FKCP WF
Sbjct  176  AYVAPEVINKRGYDGAKADIWSCGVVLFVLLAGNLPFYDSNLMELYKKITRAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEV+KLL++ILDPNP  R++++KLMEN WF+K + +++ P +P    +N +    +  +
Sbjct  236  PPEVRKLLSRILDPNPSTRVTMAKLMENYWFRKGYKKIETPESPRGQDRN-KLISDIHAV  294

Query  358  FDDRSTS----DPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQ  513
            F+  S+S    DP  +S    ++P+  NAFDIISLS  F+LSGLF+ D N K E+RFTT 
Sbjct  295  FECESSSSRDTDPPTNSCRSPVRPSSFNAFDIISLSKGFNLSGLFEGDANSKLEARFTTT  354

Query  514  QPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            +PAS IVSKFEEIA++E  +  KKDG VKLQ N+QGRKGQLA+DAEIFEVTP+FHVVE+K
Sbjct  355  KPASAIVSKFEEIAVTESCKFNKKDGTVKLQHNRQGRKGQLAVDAEIFEVTPAFHVVELK  414

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWE  780
            K++GDTMEY++FC Q LRPSLKDI+W W+
Sbjct  415  KAAGDTMEYKDFCNQGLRPSLKDIVWTWQ  443



>ref|XP_004150214.1| PREDICTED: CBL-interacting protein kinase 5-like [Cucumis sativus]
 gb|KGN65626.1| hypothetical protein Csa_1G470420 [Cucumis sativus]
Length=463

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/281 (62%), Positives = 211/281 (75%), Gaps = 20/281 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWS GV+LFVLLAGYLP  D NLMEMYRKI +G+FKCP+WF
Sbjct  176  AYVAPEVINKKGYDGAKADIWSSGVVLFVLLAGYLPFHDPNLMEMYRKISRGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-------SP  339
            PPEV+KLL++ILDP+P  RI+++KLMENSWF+K F +   +T     QNDE         
Sbjct  236  PPEVRKLLSRILDPSPRTRINMAKLMENSWFKKGFKE--NVTTPKQLQNDEDMSSVSDVS  293

Query  340  RSVLDIFDD--RSTSDPAGSSMKPTC---------LNAFDIISLSPSFDLSGLFDVDTNK  486
             +  DI  +   S S+   S   PT           NAFD+ISLSP FDLSGLF+ D N+
Sbjct  294  SAFSDISSEGGSSVSNTNESGRPPTATRAPIRNNSFNAFDLISLSPGFDLSGLFESDVNE  353

Query  487  KPESRFTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVT  666
            + +SRFTT +PAS IVSK EEIA  E F+V KKDG+VKLQG+KQGRKGQLAIDAEIFEVT
Sbjct  354  RLQSRFTTTKPASAIVSKLEEIAEMERFKVMKKDGIVKLQGSKQGRKGQLAIDAEIFEVT  413

Query  667  PSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            PSF VVEVKK++GDT+EYR F ++++RP LKDI+W WEG+E
Sbjct  414  PSFSVVEVKKTAGDTLEYRQFYDKDMRPCLKDIVWTWEGNE  454



>ref|XP_004295578.1| PREDICTED: CBL-interacting protein kinase 5-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   345 bits (884),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 209/273 (77%), Gaps = 10/273 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD WSCGV+L+VLLAG+LP  D+NLMEMYRKI +GDFK P+WF
Sbjct  177  AYVAPEVINKKGYDGAKADTWSCGVVLYVLLAGFLPFHDTNLMEMYRKISRGDFKSPQWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQL--------KPITPIADSQND-E  333
            PPEV+KLLA+ILDPN   RIS+ K+MENSWF+K F  +         P T I+D  +   
Sbjct  237  PPEVRKLLARILDPNATMRISVDKIMENSWFKKGFKHIDAPLPIPCDPSTSISDVHSAFG  296

Query  334  SPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDT-NKKPESRFTT  510
            SP S     + ++ +  A S M+PT  NAFDIISLSP FDLSGLF+ D  ++  +SRFTT
Sbjct  297  SPDSSEGSSNRKAETTNAASPMRPTNFNAFDIISLSPGFDLSGLFEGDHKHRSSQSRFTT  356

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
             +PASTIVSKFE+IA  E F+  +KDG VKLQG+++GRKGQL IDAEIFEVTPSF VVEV
Sbjct  357  TKPASTIVSKFEQIAQMERFRCMQKDGTVKLQGSREGRKGQLGIDAEIFEVTPSFFVVEV  416

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            KK++GDT+EY  F + +L+PSLKDI+W W+G++
Sbjct  417  KKTAGDTLEYIQFYDHDLKPSLKDIVWTWQGND  449



>ref|XP_007025354.1| CBL-interacting protein kinase 20 [Theobroma cacao]
 gb|EOY27976.1| CBL-interacting protein kinase 20 [Theobroma cacao]
Length=474

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 213/272 (78%), Gaps = 8/272 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWSCGVIL+VLLAG+LP  D NLMEMYRKI +G+F+CP+W 
Sbjct  200  AYVAPEVINKKGYDGAKADIWSCGVILYVLLAGFLPFHDQNLMEMYRKICRGEFRCPQWI  259

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQN-DESPRSVLDI  357
            PPEV+KLL++ILDPNP  RI+++KLMENSWF+K +  +    P   ++  D     V  +
Sbjct  260  PPEVRKLLSRILDPNPSPRITVAKLMENSWFKKGYKHIDSPPPSPHARRIDLLISDVHAV  319

Query  358  FD----DRSTSDPAG---SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            FD    + S+ + A    S ++P+  NAFDIISLS  FDLSGLF+ D +++  SRFTT++
Sbjct  320  FDSSGRENSSQNEAAVPTSPVRPSFFNAFDIISLSQGFDLSGLFEKDLDQRNYSRFTTRK  379

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            PA+ IVSKF++IA +E F ++ KDG VKLQG+K+GRKG LAIDAEIFEVTPSF+VVE+ K
Sbjct  380  PATDIVSKFQQIAQTESFSIKNKDGKVKLQGSKEGRKGLLAIDAEIFEVTPSFYVVELNK  439

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            ++GDT+EY+ FC QEL+PSLKDI+W W+G+EQ
Sbjct  440  TAGDTLEYKKFCNQELKPSLKDIVWTWQGNEQ  471



>ref|XP_009381758.1| PREDICTED: CBL-interacting protein kinase 5-like [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/269 (62%), Positives = 209/269 (78%), Gaps = 10/269 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCGVIL+VLLAG LP  +SNL++MY+KI KGDF+CP  F
Sbjct  176  AYVAPEIINKKGYDGAKADIWSCGVILYVLLAGCLPFHESNLIDMYKKITKGDFRCPHRF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQ------NDESPR  342
            P EV+KLLA++L+PNP  RI++  L+E+ WFQK F   KP+   A SQ      +  S  
Sbjct  236  PSEVRKLLARLLEPNPDARITIQLLVESPWFQKGF---KPVEARARSQSLPNLKDVTSAF  292

Query  343  SVLDIFDDRSTSDPAGSS-MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
            +V + FDD S      S  +KPT LNAFDII+LSP  DLSGLF+  + +K E+RFTTQ+P
Sbjct  293  NVENTFDDESDKKAEMSEPVKPTSLNAFDIIALSPGLDLSGLFERGSGEKQEARFTTQRP  352

Query  520  ASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            ASTIVSK EEIA  EHF+V+KK G+VKL+G+K+GRKGQLAI+A+IFEVTP+FHVVEVKKS
Sbjct  353  ASTIVSKLEEIAEMEHFKVKKKAGLVKLEGSKEGRKGQLAIEAQIFEVTPAFHVVEVKKS  412

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEGS  786
             GDTMEY+ FC+ +L+P LKDI+W W+G 
Sbjct  413  YGDTMEYQKFCDHDLKPYLKDIVWTWQGG  441



>ref|XP_002522223.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF40081.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=459

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/280 (59%), Positives = 214/280 (76%), Gaps = 17/280 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCGV+LFVLLAGYLP  DSNLME+Y+KII+G+F+CP WF
Sbjct  176  AYVAPEIINKKGYDGAKADIWSCGVVLFVLLAGYLPFCDSNLMELYKKIIRGEFRCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
             PE +KL+++ILDP+P  RI+++++M N WF+K + Q++ P +P   ++N    + V   
Sbjct  236  HPEARKLVSRILDPHPSTRITMARIMNNCWFKKGYKQIETPPSPQGKARNT-LLKDVHAA  294

Query  358  FDDRSTSDPA---------------GSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKP  492
            FD  S+ + +                S ++PT  NAFDIISLS  FDLSGLF+ D+N++ 
Sbjct  295  FDSSSSDNESINLQKEVASDDHTITRSPLRPTNYNAFDIISLSKGFDLSGLFEKDSNQRS  354

Query  493  ESRFTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPS  672
            E+RFT+ +PASTIVSKF+EIAM+E F   KKDG VKLQG K+GRKGQL IDAEIFEVTPS
Sbjct  355  EARFTSTKPASTIVSKFQEIAMTESFSFNKKDGKVKLQGYKEGRKGQLGIDAEIFEVTPS  414

Query  673  FHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            F VVE+KK+SGDT EY++F +QEL+PSLKDI+W W+GS +
Sbjct  415  FFVVEMKKTSGDTWEYKDFYDQELKPSLKDIVWAWQGSTE  454



>gb|EPS61861.1| hypothetical protein M569_12931, partial [Genlisea aurea]
Length=439

 Score =   340 bits (871),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/269 (61%), Positives = 204/269 (76%), Gaps = 16/269 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDGEKAD+WSCGVILFVLLAGYLP +DSNLME+YRKI KG+F+CP WF
Sbjct  179  AYVAPEVIHRKGYDGEKADVWSCGVILFVLLAGYLPFQDSNLMELYRKIRKGEFRCPHWF  238

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV+KLL+KIL+PNP  RI++S++MENSWFQK F Q + +        +ESPR V D  
Sbjct  239  PPEVRKLLSKILNPNPSARITISRIMENSWFQKGFRQTENL--------EESPRCVFDAI  290

Query  361  DDRS------TSDPAGSSMKPTCLNAFDIISLSPSFDLSGLF--DVDTNKKPESRFTTQQ  516
            D+ +         P    ++P   NAFD++SLSP F+LSGLF  D  T +   S FTTQ 
Sbjct  291  DEAAPPPPPHPPPPPPPPVQPHRFNAFDLLSLSPGFNLSGLFEKDAGTPRSANSWFTTQM  350

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            P + +V K EE+A++E FQ+ KKDG+VK+ G + GRKG+LAI+ EIFEVTPSFH+VEVKK
Sbjct  351  PPALVVEKLEELAVTECFQINKKDGVVKMHGWRGGRKGKLAIETEIFEVTPSFHMVEVKK  410

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            +SGDTMEY  FC+Q LRPSLKD+ W W+G
Sbjct  411  TSGDTMEYLKFCDQGLRPSLKDVAWSWQG  439



>ref|XP_011039423.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Populus euphratica]
Length=451

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/277 (60%), Positives = 210/277 (76%), Gaps = 15/277 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWSCGVILFVLLAG+LP  D NLME+YRKI KG+F+CP WF
Sbjct  176  AYVAPEVINKKGYDGPKADIWSCGVILFVLLAGFLPFHDQNLMELYRKITKGEFRCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
             PE KKLL++ILDP+P  R S+ K+ +N WF+K + Q++ P +P   ++++   + V   
Sbjct  236  HPEAKKLLSRILDPHPSSRTSIEKITKNCWFRKGYKQIETPPSPQGHARSN-LIKDVHSA  294

Query  358  FDDRSTSDPAGSS-----------MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRF  504
            FD  S SD   +S           ++PTC NAFDIISLS  FDLSGLF+ D N++ E+RF
Sbjct  295  FD--SASDNGSNSRENVMVAPRSPLRPTCYNAFDIISLSKGFDLSGLFEKDKNQRQEARF  352

Query  505  TTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVV  684
            TT + AS I+SKFE+IAM+E F  +KKDG + L+G+K+GRKG LAIDAEI EVTPSF+VV
Sbjct  353  TTTKSASMIMSKFEQIAMAESFSFKKKDGTLMLEGSKEGRKGLLAIDAEICEVTPSFYVV  412

Query  685  EVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            E+KK SGD+ EY+ FC+ EL+PSLKDI+W W+GSEQP
Sbjct  413  EMKKKSGDSFEYKEFCDHELKPSLKDIVWAWQGSEQP  449



>gb|KCW74123.1| hypothetical protein EUGRSUZ_E027581, partial [Eucalyptus grandis]
Length=338

 Score =   336 bits (861),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 207/274 (76%), Gaps = 11/274 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GY G KADIWSCGV+LFVL+AGYLP  D+NLMEMYRKI KGDFKCP+WF
Sbjct  60   AYVAPEVINKKGYVGAKADIWSCGVVLFVLMAGYLPFHDANLMEMYRKISKGDFKCPQWF  119

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EV+KLL+KILDPNP  RI + K+M+N+WF+K F + +P  PI+   +  + + +   F
Sbjct  120  PHEVRKLLSKILDPNPNSRIGIDKIMDNNWFKKGFKRFEP-PPISRINSSVTMKDIQAAF  178

Query  361  D----------DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
            +            + + P  S +KP   NAFDIISLS  FDLS LF+   N++P++RFT+
Sbjct  179  EPSEMYPEAEAASAAAKPPISPLKPASFNAFDIISLSKGFDLSNLFENHANQRPQARFTS  238

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
             +P + I+SKFEE+A +E F+V+  +G+VKLQGNK+GRKGQLAIDAE FEVTPSF  VEV
Sbjct  239  TKPVAAIMSKFEELASTEQFKVETNNGVVKLQGNKEGRKGQLAIDAEFFEVTPSFSFVEV  298

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            KK++GDT+EY+ FC+ +L+PSLKD++W W G+ Q
Sbjct  299  KKAAGDTLEYQEFCDHDLKPSLKDVVWVWHGNMQ  332



>ref|XP_002317414.1| CBL-interacting protein kinase 20 [Populus trichocarpa]
 gb|ABJ91218.1| CBL-interacting protein kinase 11 [Populus trichocarpa]
 gb|EEE98026.1| CBL-interacting protein kinase 20 [Populus trichocarpa]
Length=451

 Score =   339 bits (870),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/275 (59%), Positives = 209/275 (76%), Gaps = 11/275 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWSCGVILFVLLAG+LP  D NLME+YRKI KG+F+CP WF
Sbjct  176  AYVAPEVINKKGYDGPKADIWSCGVILFVLLAGFLPFHDQNLMELYRKITKGEFRCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
             PE KKLL++ILDP+P  R S+ K+ +N WF+K + Q++ P +P   ++++   + V   
Sbjct  236  HPEAKKLLSRILDPHPSSRTSIEKITKNCWFRKGYKQIETPPSPQGHARSN-LIKDVHSA  294

Query  358  FDDRSTSDPAG---------SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
            FD  S ++            S ++PTC NAFDIISLS  FDLSGLF+ D N++ E+RFTT
Sbjct  295  FDSASDNESNSRENVMVAPRSPLRPTCYNAFDIISLSKGFDLSGLFEKDKNRRQEARFTT  354

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
             + AS I+SKFE+IAM+E F  +KKDG + L+G+++GRKG LAIDAEI EVTPSF+VVE+
Sbjct  355  TKSASMIMSKFEQIAMAESFSFKKKDGTLMLEGSREGRKGLLAIDAEICEVTPSFYVVEM  414

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            KK SGD+ EY+ FC+ EL+PSLKDI+W W+GSEQP
Sbjct  415  KKKSGDSFEYKEFCDHELKPSLKDIVWAWQGSEQP  449



>ref|XP_008802343.1| PREDICTED: CBL-interacting protein kinase 5 isoform X2 [Phoenix 
dactylifera]
Length=443

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/258 (63%), Positives = 202/258 (78%), Gaps = 3/258 (1%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I+K+GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI +G+FKCP+WF
Sbjct  176  AYVAPEIISKKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISRGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVL--D  354
              +V++LL +ILDP+P  R+++ K++E+ WF+K F       P+  S N    R     +
Sbjct  236  SADVRRLLIRILDPSPSTRLTIEKVVEDPWFKKGFKPTVTYPPVDCSANLTDVREAFRTN  295

Query  355  IFDDRSTSDPAGS-SMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
              DD       GS +M+PT LNAFDIISLSP FDLSGLF+ +  +KPE+RFTTQ+P STI
Sbjct  296  CEDDEGDIRAEGSQTMRPTSLNAFDIISLSPGFDLSGLFERERRQKPETRFTTQKPTSTI  355

Query  532  VSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            VSK EEIA  E F+V+KKDG++KLQG+K+GRKGQLAID EIFEVTPSF+VVE+KK +GDT
Sbjct  356  VSKLEEIAEKERFKVKKKDGILKLQGSKEGRKGQLAIDVEIFEVTPSFYVVEMKKLAGDT  415

Query  712  MEYRNFCEQELRPSLKDI  765
            +EY  FC Q+LRPSL+DI
Sbjct  416  LEYHKFCNQDLRPSLRDI  433



>ref|XP_010059022.1| PREDICTED: CBL-interacting protein kinase 5-like [Eucalyptus 
grandis]
Length=435

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 207/274 (76%), Gaps = 11/274 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GY G KADIWSCGV+LFVL+AGYLP  D+NLMEMYRKI KGDFKCP+WF
Sbjct  157  AYVAPEVINKKGYVGAKADIWSCGVVLFVLMAGYLPFHDANLMEMYRKISKGDFKCPQWF  216

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EV+KLL+KILDPNP  RI + K+M+N+WF+K F + +P  PI+   +  + + +   F
Sbjct  217  PHEVRKLLSKILDPNPNSRIGIDKIMDNNWFKKGFKRFEP-PPISRINSSVTMKDIQAAF  275

Query  361  D----------DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
            +            + + P  S +KP   NAFDIISLS  FDLS LF+   N++P++RFT+
Sbjct  276  EPSEMYPEAEAASAAAKPPISPLKPASFNAFDIISLSKGFDLSNLFENHANQRPQARFTS  335

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
             +P + I+SKFEE+A +E F+V+  +G+VKLQGNK+GRKGQLAIDAE FEVTPSF  VEV
Sbjct  336  TKPVAAIMSKFEELASTEQFKVETNNGVVKLQGNKEGRKGQLAIDAEFFEVTPSFSFVEV  395

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            KK++GDT+EY+ FC+ +L+PSLKD++W W G+ Q
Sbjct  396  KKAAGDTLEYQEFCDHDLKPSLKDVVWVWHGNMQ  429



>ref|XP_006643890.1| PREDICTED: CBL-interacting protein kinase 5-like [Oryza brachyantha]
Length=461

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/270 (62%), Positives = 205/270 (76%), Gaps = 9/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCGVILFVLLAGYLP  D+NLMEMYRKI K D K P+WF
Sbjct  176  AYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLMEMYRKISKSDVKYPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V+KLL+++LDPNP  RI++ KL+E+ WF+K +   KP   +A  Q   S + V   F
Sbjct  236  NTDVRKLLSRLLDPNPNTRITIEKLVEHPWFRKGY---KPAVMLAQPQGSNSLKDVQTAF  292

Query  361  -----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 D+   +    SS+KP  LNAFDIISLS  FDLSGLF+ D  +K  SRF TQ+PAS
Sbjct  293  STDHKDNEGKAKEPASSLKPVSLNAFDIISLSKGFDLSGLFEEDKEQKANSRFMTQKPAS  352

Query  526  TIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
             IVSK E+IA +E F+V+K+DG+VKLQG+K+GRKGQLAIDAEIFEVTPSF+VVEVKKS+G
Sbjct  353  AIVSKLEQIAETESFKVKKQDGLVKLQGSKEGRKGQLAIDAEIFEVTPSFYVVEVKKSAG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            DT+EY  FC ++LRPSL+DI W    SE+P
Sbjct  413  DTLEYETFCNKDLRPSLRDICWNGP-SERP  441



>ref|NP_001042345.1| Os01g0206700 [Oryza sativa Japonica Group]
 sp|Q9LWM4.1|CIPK5_ORYSJ RecName: Full=CBL-interacting protein kinase 5; AltName: Full=OsCIPK05 
[Oryza sativa Japonica Group]
 dbj|BAA92972.1| putative CBL-interacting protein kinase 2 [Oryza sativa Japonica 
Group]
 dbj|BAB92151.1| putative CBL-interacting protein kinase 2 [Oryza sativa Japonica 
Group]
 dbj|BAF04259.1| Os01g0206700 [Oryza sativa Japonica Group]
 gb|EAY72961.1| hypothetical protein OsI_00833 [Oryza sativa Indica Group]
 gb|EAZ10972.1| hypothetical protein OsJ_00815 [Oryza sativa Japonica Group]
 gb|ACD76976.1| CBL-interacting protein kinase 5 [Oryza sativa Japonica Group]
 dbj|BAG89574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/270 (61%), Positives = 204/270 (76%), Gaps = 9/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I KRGYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI KGD K P+WF
Sbjct  176  AYVAPEIINKRGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISKGDVKFPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V++LL+++LDPNP  RI++ KL+E+ WF+K +   KP   ++      + + V   F
Sbjct  236  TTDVRRLLSRLLDPNPNIRITVEKLVEHPWFKKGY---KPAVMLSQPNESNNLKDVHTAF  292

Query  361  -----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 D+   +    SS+KP  LNAFDIISLS  FDLSGLF+ D  +K +SRF TQ+PAS
Sbjct  293  SADHKDNEGKAKEPASSLKPVSLNAFDIISLSKGFDLSGLFENDKEQKADSRFMTQKPAS  352

Query  526  TIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
             IVSK E+IA +E F+V+K+DG+VKLQG+K+GRKGQLAIDAEIFEVTPSF VVEVKKS+G
Sbjct  353  AIVSKLEQIAETESFKVKKQDGLVKLQGSKEGRKGQLAIDAEIFEVTPSFFVVEVKKSAG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            DT+EY  FC + LRPSL+DI W  + SE P
Sbjct  413  DTLEYEKFCNKGLRPSLRDICWDGQ-SEHP  441



>ref|XP_002454972.1| hypothetical protein SORBIDRAFT_03g002340 [Sorghum bicolor]
 gb|ACQ83496.1| CBL-interacting protein kinase 20 [Sorghum bicolor]
 gb|EES00092.1| hypothetical protein SORBIDRAFT_03g002340 [Sorghum bicolor]
Length=455

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/275 (61%), Positives = 206/275 (75%), Gaps = 17/275 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I+K+GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYR+I +GD K P+WF
Sbjct  176  AYVAPEIISKKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRRISRGDVKYPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              ++++ ++K+LDPNP  RI++ KL+E+ WF+K +   KP   +A      S + V   F
Sbjct  236  SSDLRRFMSKLLDPNPNTRITIEKLVEHPWFKKGY---KPAVMLAQPHGSNSLKDVQVAF  292

Query  361  DDRSTSD---------PAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKP-ESRFTT  510
               ST+D         PAGSS+KP+ LNAFDIIS S  FDLSGLF VD  +K   SRF T
Sbjct  293  ---STADNEGGSKVEQPAGSSVKPSSLNAFDIISHSKGFDLSGLFAVDQEQKASNSRFMT  349

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
            Q+PAS IVSK E+IA +E F V+K+DG+VKLQG+K+GRKGQLAIDAEIFEVTP+F+VVEV
Sbjct  350  QKPASAIVSKLEQIAETESFMVKKQDGLVKLQGSKEGRKGQLAIDAEIFEVTPAFYVVEV  409

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            KKS+GDT+EY  FC + LRPSL DI W  + SE P
Sbjct  410  KKSAGDTLEYERFCNKGLRPSLSDICWSSQ-SEAP  443



>ref|XP_009602782.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana tomentosiformis]
Length=473

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 162/270 (60%), Positives = 207/270 (77%), Gaps = 9/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP  DSNLMEMY+ I K +F+CP WF
Sbjct  177  AYVAPEVINRRGYDGAKADIWSCGVILYVLLAGYLPFHDSNLMEMYKMIGKAEFRCPNWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADS--QNDESPRSVLD  354
            PP+ ++L++KILDPNP  RIS+SK+MENSWF+K   QLKPI   ADS  ++ ES  + L+
Sbjct  237  PPDARRLISKILDPNPSTRISISKIMENSWFKKGL-QLKPIKDNADSMLKDAESKEAALE  295

Query  355  ----IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
                +F     ++P     KP  LNAFDIISLS  FDLSGLF+ + NKK E RFT++QPA
Sbjct  296  NDDAVFSVCENTEPKPEMAKPAHLNAFDIISLSTGFDLSGLFE-ERNKKREVRFTSRQPA  354

Query  523  STIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
             TI+SK E++A     +V KKD G++KL+G+K+GRKG L+ID EIF VTP+FH VEVKK+
Sbjct  355  KTIISKLEDVAKRLKLKVMKKDGGLLKLEGSKEGRKGVLSIDTEIFVVTPNFHFVEVKKN  414

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            SGDT+EY+   ++++RP+LKDI+W W+G E
Sbjct  415  SGDTIEYKKMMKKDIRPALKDIVWTWQGDE  444



>gb|EMT28985.1| CBL-interacting protein kinase 5 [Aegilops tauschii]
Length=464

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 206/276 (75%), Gaps = 21/276 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDGEKADIWSCGVILFVLLAGYLP +DSNLMEMYRKI KGD + P+WF
Sbjct  176  AYVAPEIINKKGYDGEKADIWSCGVILFVLLAGYLPFQDSNLMEMYRKISKGDVRHPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              + +K+L+++LDPNP  RI++ KL+E+ WF+K +   KP   +A      +PR+  D+ 
Sbjct  236  SSDARKILSRLLDPNPNTRITMDKLIEHPWFKKGY---KPAVTLA------TPRASKDLN  286

Query  361  DDRST------------SDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRF  504
            D ++             ++   S +KP  LNAFDIISLS  FDLSGLF+ D  +K  SRF
Sbjct  287  DVQAAFSTDQKDGKGNRAEQPNSPLKPASLNAFDIISLSKGFDLSGLFEKDQEQKSNSRF  346

Query  505  TTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVV  684
             TQ+PAS IVSK E+IA +E F+V+K+DG+V LQG+K+GRKGQLAIDAEIFEVTPSF+VV
Sbjct  347  MTQKPASAIVSKLEQIAETESFKVKKQDGLVTLQGSKEGRKGQLAIDAEIFEVTPSFYVV  406

Query  685  EVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            EVKKS+GDT+EY  FC++ LRPSLKDI W     E+
Sbjct  407  EVKKSAGDTLEYERFCKKGLRPSLKDICWNGPSEEK  442



>ref|XP_010686216.1| PREDICTED: CBL-interacting protein kinase 5 [Beta vulgaris subsp. 
vulgaris]
Length=464

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/283 (58%), Positives = 206/283 (73%), Gaps = 24/283 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI KRGYDG KADIWSCGV+L+VLLAGYLP  D+NLME+YRK+ KGDFKCP WF
Sbjct  176  AYVAPEVINKRGYDGAKADIWSCGVVLYVLLAGYLPFHDTNLMELYRKVNKGDFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-----SPRS  345
            P EV+KLL +ILDP+P  RI+++KLM++ WF K F   K +  I D  N+      +P+ 
Sbjct  236  PTEVRKLLCEILDPSPYSRITVAKLMDDPWFLKGF---KHVDQIKDHDNNLELPPITPKD  292

Query  346  VLDIFDDRSTSDPAGSS---------------MKPTCLNAFDIISLSPSFDLSGLFDVDT  480
            V  +F+D      + SS               +KPTCLNAFDIISLSP FDLSGLF+  T
Sbjct  293  VRAVFNDIDLEGSSTSSHKSESEEEGVDVVIPIKPTCLNAFDIISLSPGFDLSGLFESHT  352

Query  481  NKKPESRFTTQQPASTIVSKFEEIAMS-EHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIF  657
            ++ P +RFTT  P S IVSKFEEIA + + F++ K+DG++KLQ NK+GRKG L+IDA+IF
Sbjct  353  SRNPAARFTTSMPPSMIVSKFEEIAQTNKKFKILKEDGIMKLQSNKEGRKGLLSIDAQIF  412

Query  658  EVTPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGS  786
            EV P  HV+EVKKSSGDT EY +FC  +L+P+L+DI+W W+ S
Sbjct  413  EVAPMLHVLEVKKSSGDTFEYNDFCNHDLKPALRDIVWAWQES  455



>emb|CDM82235.1| unnamed protein product [Triticum aestivum]
Length=464

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/276 (60%), Positives = 206/276 (75%), Gaps = 21/276 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDGEKADIWSCGVILFVLLAGYLP +DSNLMEMYRKI KGD + P+WF
Sbjct  176  AYVAPEIINKKGYDGEKADIWSCGVILFVLLAGYLPFQDSNLMEMYRKISKGDVRYPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              + +K+L+++LDPNP  RI++ KL+E+ WF+K +   KP   +A      +PR+  D+ 
Sbjct  236  SSDARKILSRLLDPNPNTRITMDKLIEHPWFKKGY---KPAVTLA------TPRASKDLN  286

Query  361  D-------DR-----STSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRF  504
            D       DR     + +    S +KP  LNAFDIISLS  FDLSGLF+ D  +K  SRF
Sbjct  287  DVQAAFSTDRKDGEGNRAQQPNSPLKPASLNAFDIISLSKGFDLSGLFEKDQEQKSNSRF  346

Query  505  TTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVV  684
             TQ+PAS IVSK E+IA +E F+V+K+DG+V LQG+K+GRKGQLAIDAEIFEVTPSF+VV
Sbjct  347  MTQKPASAIVSKLEQIAETESFKVKKQDGLVTLQGSKEGRKGQLAIDAEIFEVTPSFYVV  406

Query  685  EVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            EVKKS+GDT+EY  FC++ LRPSLKDI W     E+
Sbjct  407  EVKKSAGDTLEYERFCKKGLRPSLKDICWNGPSEEK  442



>ref|XP_003565293.1| PREDICTED: CBL-interacting protein kinase 5 [Brachypodium distachyon]
Length=460

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 199/268 (74%), Gaps = 9/268 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCG+ILFVLLAGYLP +DSNL+EMYRKI KGD + P WF
Sbjct  176  AYVAPEIINKKGYDGAKADIWSCGIILFVLLAGYLPFQDSNLVEMYRKISKGDVRYPHWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V+KLL K+LDPNP  RI++ KL+E+ WF+K +   KP   +       S   V   F
Sbjct  236  TSDVRKLLCKLLDPNPNSRITIEKLVEHPWFKKGY---KPAVMLGQPHGSNSLTDVQAAF  292

Query  361  D----DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                 D     P  S +KP  LNAFDIISLS  FDLSGLFD D  +K  SRF TQ+PAS 
Sbjct  293  GTDQKDNKAEQPE-SPLKPVSLNAFDIISLSKGFDLSGLFD-DQEQKANSRFMTQKPASA  350

Query  529  IVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            IVSK E+IA +E F+V+K+DG+VKLQG+K+GRKGQLAIDAEIFEVTPSF+VVEVKKS+GD
Sbjct  351  IVSKLEQIAETESFKVKKQDGLVKLQGSKEGRKGQLAIDAEIFEVTPSFYVVEVKKSAGD  410

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            T+EY  FC+++LRPSL DI W  +  E+
Sbjct  411  TLEYERFCKKDLRPSLNDICWNGQSDEK  438



>dbj|BAK07613.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/276 (59%), Positives = 204/276 (74%), Gaps = 21/276 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDGEKADIWSCGVILFVLLAGYLP +DSNLMEMYRKI KGD + P+WF
Sbjct  176  AYVAPEIINKKGYDGEKADIWSCGVILFVLLAGYLPFQDSNLMEMYRKISKGDVRYPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              + +KLL ++LDPNP  RI++ KL+E+ WF+K +   KP   +       +PR+  D+ 
Sbjct  236  SSDARKLLCRLLDPNPNTRITMDKLIEHPWFKKGY---KPAVMLG------TPRASKDLN  286

Query  361  D------------DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRF  504
            D            + S ++   S +KP  LNAFDIISLS  FDLSGLF+ D  +K  SRF
Sbjct  287  DVQAAFSTDHKDGEGSRAEQPNSPLKPASLNAFDIISLSKGFDLSGLFEKDQEQKSNSRF  346

Query  505  TTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVV  684
             TQ+PAS IVSK E+IA +E F+V+K+DG+V LQG+K+GRKGQLAIDAEIFEVTPSF+VV
Sbjct  347  MTQKPASAIVSKLEQIAETESFKVKKQDGLVTLQGSKEGRKGQLAIDAEIFEVTPSFYVV  406

Query  685  EVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            EVKKS+GDT+EY  FC++ LRPSLKDI W     E+
Sbjct  407  EVKKSAGDTLEYERFCKKGLRPSLKDICWNGPSEEK  442



>ref|NP_001105966.1| putative protein kinase [Zea mays]
 gb|ABM21448.1| putative protein kinase [Zea mays]
Length=453

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 198/271 (73%), Gaps = 11/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCGVILFVLLAGYLP  D+NL+EMYRKI + D K P+WF
Sbjct  176  AYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE+++L+ K+L+PNP  RI++ KL+E+ WF+K +   +P   +A      S + V   F
Sbjct  236  SPELRRLMPKLLEPNPNNRITIEKLVEHPWFKKGY---RPAVMLAQPHGSSSLKDVQVAF  292

Query  361  DDRSTSD-------PAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKP-ESRFTTQQ  516
             +    D       PA SS+KP  LNAFDIIS S  FDLS LF+VD  +K   SRF TQ+
Sbjct  293  SNADHKDSSTKVEQPADSSLKPASLNAFDIISHSRGFDLSSLFEVDQEQKASNSRFMTQK  352

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            PAS IVSK E+IA +E F V+K+DG+VKLQG+KQGRKGQLAIDAEIFEVTP+FHVVEVKK
Sbjct  353  PASAIVSKLEQIAETERFMVKKQDGLVKLQGSKQGRKGQLAIDAEIFEVTPAFHVVEVKK  412

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            S+GDT+EY  FC + LRPSL DI W     E
Sbjct  413  SAGDTLEYEMFCSKGLRPSLSDICWSSRSEE  443



>gb|ACF78341.1| unknown [Zea mays]
 gb|ACL54079.1| unknown [Zea mays]
 gb|AFW80366.1| putative CBL-interacting protein kinase family protein [Zea mays]
Length=453

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 198/271 (73%), Gaps = 11/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCGVILFVLLAGYLP  D+NL+EMYRKI + D K P+WF
Sbjct  176  AYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE+++L+ K+L+PNP  RI++ KL+E+ WF+K +   +P   +A      S + V   F
Sbjct  236  SPELRRLMPKLLEPNPNNRITIEKLVEHPWFKKGY---RPAVMLAQPHGSSSLKDVQVAF  292

Query  361  DDRSTSD-------PAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKP-ESRFTTQQ  516
             +    D       PA SS+KP  LNAFDIIS S  FDLS LF+VD  +K   SRF TQ+
Sbjct  293  SNADHKDSSSKVEQPADSSLKPASLNAFDIISHSRGFDLSSLFEVDQEQKASNSRFMTQK  352

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            PAS IVSK E+IA +E F V+K+DG+VKLQG+KQGRKGQLAIDAEIFEVTP+FHVVEVKK
Sbjct  353  PASAIVSKLEQIAETERFMVKKQDGLVKLQGSKQGRKGQLAIDAEIFEVTPAFHVVEVKK  412

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            S+GDT+EY  FC + LRPSL DI W     E
Sbjct  413  SAGDTLEYEMFCSKGLRPSLSDICWSSRSEE  443



>ref|NP_001149741.1| LOC100283368 [Zea mays]
 gb|ACG36627.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
 gb|ACG39742.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
Length=459

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 198/271 (73%), Gaps = 11/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCGVILFVLLAGYLP  D+NL+EMYRKI + D K P+WF
Sbjct  176  AYVAPEIINKKGYDGAKADIWSCGVILFVLLAGYLPFHDANLVEMYRKISRADVKYPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE+++L+ K+L+PNP  RI++ KL+E+ WF+K +   +P   +A      S + V   F
Sbjct  236  SPELRRLMPKLLEPNPNNRITIEKLVEHPWFKKGY---RPAVMLAQPHGSSSLKDVQVAF  292

Query  361  DDRSTSD-------PAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKP-ESRFTTQQ  516
             +    D       PA SS+KP  LNAFDIIS S  FDLS LF+VD  +K   SRF TQ+
Sbjct  293  SNADHKDSSTKVEQPADSSLKPASLNAFDIISHSRGFDLSSLFEVDQEQKASNSRFMTQK  352

Query  517  PASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            PAS IVSK E+IA +E F V+K+DG+VKLQG+KQGRKGQLAIDAEIFEVTP+FHVVEVKK
Sbjct  353  PASAIVSKLEQIAETERFMVKKQDGLVKLQGSKQGRKGQLAIDAEIFEVTPAFHVVEVKK  412

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            S+GDT+EY  FC + LRPSL DI W     E
Sbjct  413  SAGDTLEYEMFCSKGLRPSLSDICWSSRSEE  443



>gb|KDP21108.1| hypothetical protein JCGZ_21579 [Jatropha curcas]
Length=445

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 207/266 (78%), Gaps = 3/266 (1%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K GYDG KADIWSCGV+LFVLLAGYLP    NLMEMY+KI++ +FK P W 
Sbjct  177  AYVAPEIINKGGYDGSKADIWSCGVVLFVLLAGYLPFNHPNLMEMYKKIVRAEFKFPSWV  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
             PE +KLL+ ILDP+P  RI+++K+M N+WF K + +++ P +P   +++ +  + V   
Sbjct  237  QPEARKLLSMILDPSPNSRITIAKIMSNAWFMKGYKRIEAPPSPQGKARS-KLLQDVHAA  295

Query  358  FDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
            FD  S S  + S ++PT  NAFDIISLS  FDLSGLF+ D+N++ ESRFT+ +PAS IVS
Sbjct  296  FDSSSDSKTSSSPVRPTNFNAFDIISLSKGFDLSGLFEQDSNQRLESRFTSTKPASAIVS  355

Query  538  KFEEIAMS-EHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            KFEEIAM+ E F   KKDG VKLQ  K+GRKGQL IDAEIFEVTP+F VVE+KKSSGDT+
Sbjct  356  KFEEIAMTNESFNFNKKDGTVKLQSCKEGRKGQLGIDAEIFEVTPAFFVVELKKSSGDTL  415

Query  715  EYRNFCEQELRPSLKDIIWKWEGSEQ  792
            EY+ FC++EL+PSLKDI+W W+G+EQ
Sbjct  416  EYKQFCDRELKPSLKDIVWTWQGTEQ  441



>ref|XP_010925625.1| PREDICTED: CBL-interacting protein kinase 5-like [Elaeis guineensis]
Length=461

 Score =   327 bits (837),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/273 (62%), Positives = 213/273 (78%), Gaps = 14/273 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I+K+GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI +G+FKCP+WF
Sbjct  176  AYVAPEIISKKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISRGEFKCPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPIT--PIADSQND-----ESP  339
              +V++L+ +ILDP+P  R+++ KL+EN WF K+F   KP+   P  D   +     E+ 
Sbjct  236  SADVRRLVTRILDPSPSTRLTIDKLVENPWFNKEF---KPVVTYPTVDCSANLADVHETF  292

Query  340  RSVLDIFDDRSTSDPAGS-SMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            R+  D  DD       GS +M+P+ LNAFDIISLSP FDLSGLF+ ++ +KPE+RFTTQ+
Sbjct  293  RT--DCEDDEGDIRTEGSETMRPSSLNAFDIISLSPGFDLSGLFERESRQKPETRFTTQK  350

Query  517  PASTIVSKFEEIAMSEHF-QVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PASTIVSK EEIA  E F   +KKDG++KLQG+K+GRKGQLA+D EIFEVTPSF+ VE+K
Sbjct  351  PASTIVSKLEEIAEMERFKVKKKKDGLLKLQGSKEGRKGQLAVDVEIFEVTPSFYFVEMK  410

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            KS+GDT+EY  FC Q++R SLKDIIW W+G +Q
Sbjct  411  KSAGDTLEYHKFCNQDMRRSLKDIIWTWQGVDQ  443



>gb|EMS57676.1| CBL-interacting protein kinase 5 [Triticum urartu]
Length=466

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 201/270 (74%), Gaps = 7/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDGEKADIWSCGVILFVLLAGYLP +DSNLMEMYRKI KGD + P+WF
Sbjct  176  AYVAPEIINKKGYDGEKADIWSCGVILFVLLAGYLPFQDSNLMEMYRKISKGDVRHPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF---TQLKPITPIADSQ-NDESPRSV  348
              + +K+L+++LDPNP  RI++ KL+E+ WF+K +     L   TP A    ND      
Sbjct  236  SSDARKILSRLLDPNPNTRITMDKLIEHPWFKKGYKPAVMLGTPTPRASKDLNDVQAAFS  295

Query  349  LDIFDD--RSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
             D  D   +    P G+ +KP  LNAFDIISLS  FDLSGLF+ D  +K  SRF TQ+PA
Sbjct  296  TDHKDGEGKRAEQPNGA-LKPASLNAFDIISLSKGFDLSGLFEKDQEQKSNSRFMTQKPA  354

Query  523  STIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            S IVSK E+IA +E F+V+K+DG+V LQG+K+GRKGQLAIDAEIFEVTPSF+VVEVKKS+
Sbjct  355  SAIVSKLEQIAETESFKVKKQDGLVTLQGSKEGRKGQLAIDAEIFEVTPSFYVVEVKKSA  414

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EY  FC+  LRPSLKDI W     E+
Sbjct  415  GDTLEYERFCKMGLRPSLKDICWNGPSEEK  444



>ref|XP_010253153.1| PREDICTED: CBL-interacting protein kinase 18 [Nelumbo nucifera]
 ref|XP_010253154.1| PREDICTED: CBL-interacting protein kinase 18 [Nelumbo nucifera]
 ref|XP_010253156.1| PREDICTED: CBL-interacting protein kinase 18 [Nelumbo nucifera]
Length=452

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 202/264 (77%), Gaps = 6/264 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKIGKGEFKCPTWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EV++LL+K+LDPNP  RIS++K+ ENSWF+K F     +  +     + +P  V  +F
Sbjct  236  PSEVRRLLSKMLDPNPNTRISIAKIKENSWFRKGFNSKSAL--VETESKEPAPLDVDTVF  293

Query  361  ---DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               +  + ++P   S K T LNAFDIISLS  FDLSGLF+ + + K E+RFT++QPAS I
Sbjct  294  GPENSGTATEPKQESAKLTHLNAFDIISLSAGFDLSGLFE-EPDHKSEARFTSRQPASVI  352

Query  532  VSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            +SK E +A     +++K  G++KL+G K+GRKG L+IDAEIFEVTP+FH+VEVKKSSGDT
Sbjct  353  ISKLEGVAKRLGLKLKKDGGLLKLEGLKEGRKGVLSIDAEIFEVTPTFHLVEVKKSSGDT  412

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            +EY+   +Q++RP+LKDI+W W+G
Sbjct  413  LEYQKILKQDMRPALKDIVWAWQG  436



>ref|XP_009784196.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana sylvestris]
Length=457

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 207/269 (77%), Gaps = 14/269 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP  DSNLMEMY+KI K +F+CP WF
Sbjct  177  AYVAPEVINRRGYDGAKADIWSCGVILYVLLAGYLPFHDSNLMEMYKKIGKAEFRCPNWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADS-----QNDESPRS  345
            PP+ ++L++KILDPNP  RIS+SK+MENSWF+K   QLK +   A+      +ND++  S
Sbjct  237  PPDARRLISKILDPNPSTRISISKIMENSWFKKGL-QLKSMLKDAEPKEAALENDDAVFS  295

Query  346  VLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            V +       ++P    +KP  LNAFDIISLS  FDLSGLF+ + NKK E RFT++QPA 
Sbjct  296  VCE------KTEPKPEMVKPAHLNAFDIISLSTGFDLSGLFE-ERNKKREVRFTSRQPAK  348

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E++A     +V KKD G++KL+G+K+GRKG L+ID EIFEVTP+FH VEVKK+S
Sbjct  349  TIISKLEDVAKRLKLKVTKKDGGLLKLEGSKEGRKGVLSIDTEIFEVTPNFHFVEVKKNS  408

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            GDT+EY+   ++++RP+LKDI+W W+G E
Sbjct  409  GDTIEYKKMMKKDIRPALKDIVWTWQGDE  437



>ref|XP_006843723.1| hypothetical protein AMTR_s00007p00220190 [Amborella trichopoda]
 gb|ERN05398.1| hypothetical protein AMTR_s00007p00220190 [Amborella trichopoda]
Length=461

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/273 (62%), Positives = 204/273 (75%), Gaps = 16/273 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWSCGVILFVLLAGYLP  D NLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVINKKGYDGAKADIWSCGVILFVLLAGYLPFHDPNLMEMYRKISKAEFKCPYWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPI----------TPIADSQND  330
            P EV+KLL+KILDPNP  RIS+SK+MEN WF+K F   KPI          T   D    
Sbjct  236  PSEVRKLLSKILDPNPNTRISISKIMENPWFRKGF---KPIEAPQEEEELNTKDIDLAFR  292

Query  331  ESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
             S  +  ++ + ++   PA   +KP  LNAFDIIS S  FDLSGLF+   N K E RFT+
Sbjct  293  SSENNSNNVIEKKTDLLPA---VKPAYLNAFDIISFSAGFDLSGLFNEGNNVKKEERFTS  349

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
            ++P S IVSK EEIA    F+V+KKD +V+LQG+K+GRKG L++DAEIFEVTPSF+VVEV
Sbjct  350  KKPFSAIVSKLEEIAKKVRFRVKKKDWVVRLQGSKEGRKGVLSVDAEIFEVTPSFYVVEV  409

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            KKSSGDT+EY+ FC++ELRP+LKDI+W W+G +
Sbjct  410  KKSSGDTLEYQTFCKKELRPALKDIVWTWQGDQ  442



>ref|XP_010529202.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Tarenaya hassleriana]
Length=466

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 210/285 (74%), Gaps = 23/285 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEV+ KRGYDG KAD+WSCGV+L+VLLAG+LP  +SNL+EMYRKI +G+F+CP WF
Sbjct  176  AYVAPEVLCKRGYDGTKADVWSCGVVLYVLLAGFLPFHESNLVEMYRKISRGEFRCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITP--------IADSQNDE  333
            PPEVKKLL++ILDP+PI RI+L K+M+NSWF+K F +++ P TP        I+D    E
Sbjct  236  PPEVKKLLSRILDPSPITRITLEKIMDNSWFKKGFKKIESPRTPRCHQIETFISDVHKPE  295

Query  334  SPRSVLDIF------------DDRSTSDPAGSSMKPTCLNAFDII-SLSPSFDLSGLFDV  474
                    +            D  S  +     ++PTC NAFDII SLSP FDLSGLF+ 
Sbjct  296  DDNFSDSSYSHSNSNGSSSEKDPPSEGNETSPVIQPTCYNAFDIISSLSPGFDLSGLFEK  355

Query  475  DTNKKPESRFTTQQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAE  651
            D ++K +SRFTT +PA  IVSKF+EIA SE F ++K   G VK++ +++GRKGQLAID E
Sbjct  356  DKSQKSKSRFTTTKPAKEIVSKFQEIAASERFSLKKSSMGAVKMEDSREGRKGQLAIDVE  415

Query  652  IFEVTPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGS  786
            IFEVT SF++VE+KKS+GDTMEY  F +QEL+PSLKDI+WKW+GS
Sbjct  416  IFEVTKSFYMVEMKKSAGDTMEYMQFYDQELKPSLKDIVWKWQGS  460



>ref|XP_010231608.1| PREDICTED: CBL-interacting protein kinase 5-like [Brachypodium 
distachyon]
Length=475

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 198/263 (75%), Gaps = 9/263 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            +YVAPE+I  +GYDG KAD+WSCG+ILFVLLAGYLP  DSN+MEMYRKI KG+FK P WF
Sbjct  203  SYVAPEIINNKGYDGVKADVWSCGIILFVLLAGYLPFHDSNIMEMYRKIGKGEFKSPHWF  262

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V++LLAK+LDPNP  RI++ KL+E+ WF K++   KP   +A     +S + V   F
Sbjct  263  SCDVRRLLAKLLDPNPDTRITIEKLVEHPWFMKEY---KPAVMLAQPHISKSLKDVQVAF  319

Query  361  --DDRST----SDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
              D  S     ++ + ++MKP  LNAFDIISLS  FDLSGL D++  +K    F TQ+PA
Sbjct  320  SADHESNKCEEAEQSANAMKPASLNAFDIISLSNGFDLSGLIDMEQKQKVHELFMTQKPA  379

Query  523  STIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            S IVSK EEIA +EHF V+K+DGMVKLQG+K+GRKGQL IDAEIFEV  S +VVEVKK++
Sbjct  380  SEIVSKLEEIAETEHFNVKKQDGMVKLQGSKEGRKGQLTIDAEIFEVASSCYVVEVKKAA  439

Query  703  GDTMEYRNFCEQELRPSLKDIIW  771
            GDT+EY+ FC ++LRPSLKDI W
Sbjct  440  GDTLEYQTFCNKDLRPSLKDICW  462



>ref|XP_010494733.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Camelina sativa]
Length=441

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 197/264 (75%), Gaps = 17/264 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGV+L+VLLAG+LP  + NL+EMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVIGKKGYDGAKADVWSCGVVLYVLLAGFLPFHEQNLVEMYRKITKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEVKKLL++ILDPNP  RI + K+MENSWFQK F ++            E+P+S     
Sbjct  236  PPEVKKLLSRILDPNPNSRIKIDKIMENSWFQKGFKKM------------ETPKSPDSHQ  283

Query  361  DDRSTSD-PAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D   SD  A  S++P C NAFD+I SLS  FDLSGLF+ +   + ES+FTT++ A  IV
Sbjct  284  IDSLISDVHAAFSVQPMCYNAFDLISSLSQGFDLSGLFEKEG--RSESKFTTKKEAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIA  SE F + K +  VK++  K+GRKGQLAID EIFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIATSSERFNLTKSNVGVKMEDKKEGRKGQLAIDVEIFEVTKSFHMVEFKKSGGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            MEY  FC++EL+PSLKDI+WKW+G
Sbjct  402  MEYNEFCDRELKPSLKDIVWKWQG  425



>ref|NP_199394.1| CBL-interacting serine/threonine-protein kinase 20 [Arabidopsis 
thaliana]
 sp|Q9FJ54.1|CIPKK_ARATH RecName: Full=CBL-interacting serine/threonine-protein kinase 
20; AltName: Full=SNF1-related kinase 3.6; AltName: Full=SOS2-like 
protein kinase PKS18 [Arabidopsis thaliana]
 dbj|BAB09310.1| serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAK61493.1| CBL-interacting protein kinase 20 [Arabidopsis thaliana]
 dbj|BAD94760.1| CBL-interacting protein kinase 20 [Arabidopsis thaliana]
 gb|ABI54345.1| At5g45820 [Arabidopsis thaliana]
 gb|AED95303.1| CBL-interacting serine/threonine-protein kinase 20 [Arabidopsis 
thaliana]
Length=439

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 196/264 (74%), Gaps = 17/264 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGV+L+VLLAG+LP  + NL+EMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVIGKKGYDGAKADVWSCGVVLYVLLAGFLPFHEQNLVEMYRKITKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEVKKLL++ILDPNP  RI + K+MENSWFQK F ++            E+P+S     
Sbjct  236  PPEVKKLLSRILDPNPNSRIKIEKIMENSWFQKGFKKI------------ETPKSPESHQ  283

Query  361  DDRSTSD-PAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D   SD  A  S+KP   NAFD+I SLS  FDLSGLF  +  ++ ES+FTT++ A  IV
Sbjct  284  IDSLISDVHAAFSVKPMSYNAFDLISSLSQGFDLSGLF--EKEERSESKFTTKKDAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIA  SE F + K D  VK++  ++GRKG LAID EIFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIATSSERFNLTKSDVGVKMEDKREGRKGHLAIDVEIFEVTNSFHMVEFKKSGGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            MEY+ FC++ELRPSLKDI+WKW+G
Sbjct  402  MEYKQFCDRELRPSLKDIVWKWQG  425



>ref|XP_009415683.1| PREDICTED: uncharacterized protein LOC103996486 [Musa acuminata 
subsp. malaccensis]
Length=1092

 Score =   335 bits (858),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/271 (59%), Positives = 211/271 (78%), Gaps = 10/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVITK+GYDG KADIWSCGVILFVLLAGYLP  DSN++EMYRK  +G+FKCP WF
Sbjct  176  AYVAPEVITKKGYDGSKADIWSCGVILFVLLAGYLPFHDSNIIEMYRKTSRGEFKCPYWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EVKKLLA++LDPNP  RI++ KL++N WF+K +   + +      + DES R V + F
Sbjct  236  PSEVKKLLARLLDPNPTTRITVCKLIDNPWFRKGY---RAVNHQLRMKRDESLRDVREAF  292

Query  361  -------DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
                   +++  +  + SS++P  LNAFDIIS S SFDLSGLF+ +  ++ E+RF TQ+P
Sbjct  293  ASDADEEEEKKQATSSSSSIRPASLNAFDIISRSSSFDLSGLFEEEKGRRAEARFATQKP  352

Query  520  ASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
               IVSK EEIA +E F+V+KKDG+VKL+G+ +GRKGQLA++AEIFEVTP+ +VVEVKKS
Sbjct  353  TEAIVSKLEEIARTERFRVEKKDGVVKLEGSHEGRKGQLAVEAEIFEVTPALYVVEVKKS  412

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +GDT+EY+ F +Q L+PSLKDI+W+W+ ++Q
Sbjct  413  AGDTLEYQRFYDQGLKPSLKDIVWEWQMADQ  443



>ref|XP_002863452.1| cbl-interacting protein kinase 20 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39711.1| cbl-interacting protein kinase 20 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   318 bits (815),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 198/264 (75%), Gaps = 17/264 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGV+L+VLLAG+LP  + NL+EMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVIGKKGYDGAKADVWSCGVVLYVLLAGFLPFHEQNLVEMYRKITKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEVKKLL++ILDPNP  RI + K+MENSWFQK F ++            E+P+S     
Sbjct  236  PPEVKKLLSRILDPNPNSRIKIDKIMENSWFQKGFKKI------------ETPKSPDSHQ  283

Query  361  DDRSTSD-PAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D   SD  A  S+KP   NAFD+I SLS  FDLSGLF  +  ++ ES+FTT++ A  IV
Sbjct  284  IDSLISDVHAAFSVKPMSYNAFDLISSLSQGFDLSGLF--EKEERSESKFTTKKEAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIA+ SE F + K +  VK++  ++GRKGQLAID EIFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIALSSERFNLTKSNVGVKMEDKREGRKGQLAIDVEIFEVTKSFHMVEFKKSGGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            MEY+ FC++EL+PSLKDI+WKW+G
Sbjct  402  MEYKQFCDRELKPSLKDIVWKWQG  425



>ref|XP_009128822.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Brassica rapa]
Length=435

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 205/267 (77%), Gaps = 17/267 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG+KAD+WSCGV+L+VLLAG+LP    NL+EMYRKI  G+FKCP WF
Sbjct  176  AYVAPEVICKKGYDGDKADVWSCGVVLYVLLAGFLPFHQQNLVEMYRKIKNGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEVKKLL++ILDPNP  RI ++K+MENSWFQK F +++ P +P  DS   ES  S  D+
Sbjct  236  PPEVKKLLSRILDPNPNSRIKINKIMENSWFQKGFKKIETPKSP--DSYQIESLIS--DV  291

Query  358  FDDRSTSDPAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
                     A  +++P C NAFD+I SLS  FDLSGLF+ +  ++ ES FTT++ A  IV
Sbjct  292  H--------AAFAVQPMCYNAFDLISSLSQGFDLSGLFEKE--ERSESMFTTKKEAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIAM SE F ++K +  VK++  ++GRKGQLAID EIFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIAMNSERFDLKKSNVGVKMEDRREGRKGQLAIDVEIFEVTKSFHMVEFKKSKGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            MEY+ FC+ EL+PSLKDI+WKW+G+++
Sbjct  402  MEYKQFCDGELKPSLKDIVWKWQGNKK  428



>gb|AIZ68214.1| CBL-interacting protein kinase 18-like protein [Galtonia saundersiae]
Length=473

 Score =   319 bits (818),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 203/272 (75%), Gaps = 19/272 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI K +FKCP WF
Sbjct  178  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKIGKAEFKCPGWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
            P +V+KLL++ILDPNP  RIS++K++EN W +K F         + K I P+  +    S
Sbjct  238  PSDVRKLLSRILDPNPATRISMAKILENPWVRKGFDDKLIKHEAETKAIVPVDVNAVFGS  297

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            P           T +     +KP+ LNAFDIISLS  FDLSGLF+ + ++K E+RFT+ +
Sbjct  298  P---------EITVEAKQEIVKPSNLNAFDIISLSAGFDLSGLFE-EKDRKREARFTSAK  347

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PA+TI+SK EEIA     +V+KKD G++K++G+K+GRKG +AIDAEIFEVTP+FH+VE+K
Sbjct  348  PATTIISKLEEIAKRLRLRVKKKDGGVLKMEGSKEGRKGAVAIDAEIFEVTPTFHLVEIK  407

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            K++GDT+EY+   +QE+RP+LKDI+W W G +
Sbjct  408  KTNGDTLEYQKMWKQEMRPALKDIVWAWHGDQ  439



>emb|CDY26359.1| BnaA02g24110D [Brassica napus]
Length=435

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 204/267 (76%), Gaps = 17/267 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG+KAD+WSCGV+L+VLLAG+LP    NL+EMYRKI  G+FKCP WF
Sbjct  176  AYVAPEVICKKGYDGDKADVWSCGVVLYVLLAGFLPFHQQNLVEMYRKIKNGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEVKKLL++ILDPNP  RI ++K+MENSWFQK F +++ P +P  DS   ES  S  D+
Sbjct  236  PPEVKKLLSRILDPNPNSRIKINKIMENSWFQKGFKKIETPNSP--DSYQIESLIS--DV  291

Query  358  FDDRSTSDPAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
                     A  +++P C NAFD+I SLS  FDLSGLF+ +  ++ ES FTT++ A  IV
Sbjct  292  H--------AAFAVQPMCYNAFDLISSLSQGFDLSGLFEKE--ERSESMFTTKKEAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIAM SE F ++K +  VK++  ++GRKGQLAID EIFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIAMNSERFDLKKSNVGVKMEDRREGRKGQLAIDVEIFEVTKSFHMVEFKKSKGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            MEY+ FC+ EL+PSLKDI+WKW+G+ +
Sbjct  402  MEYKQFCDGELKPSLKDIVWKWQGNNK  428



>ref|XP_011095114.1| PREDICTED: CBL-interacting protein kinase 2 [Sesamum indicum]
Length=471

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 201/273 (74%), Gaps = 12/273 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVILFVLLAG+LP  DSNLMEMYRKI K +FKCP W 
Sbjct  176  AYVAPEVINRRGYDGSKADIWSCGVILFVLLAGHLPFHDSNLMEMYRKIGKAEFKCPNWI  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDES--PRSVLD  354
            PP+ +KL++KILDPNP  RIS+SK+M+NSWF+K   Q +     AD  N  +    +++D
Sbjct  236  PPDARKLISKILDPNPNTRISISKIMQNSWFRKGL-QSRTTRTTADLVNGFTKFKEAIVD  294

Query  355  I-----FDDRSTS--DPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQ  513
                  F D S S  +      KP  LNAF+IISLS  FDLSGLF+ D +K+ E RFT+ 
Sbjct  295  ADATVDFTDNSNSMANMKAELAKPVNLNAFEIISLSAGFDLSGLFE-DNDKRKEYRFTSN  353

Query  514  QPASTIVSKFEEIAMSEHFQVQKKDGMV-KLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
            QPA TI+SK EE+A     +V KKDG + KL+G+K GRKG L+IDAEIFEV P+FH+VE+
Sbjct  354  QPAKTIISKLEELAKHLKLKVMKKDGGIFKLEGSKTGRKGTLSIDAEIFEVAPTFHLVEM  413

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            KKS+GDT+EY+   ++++RPSLKDI+W W+G E
Sbjct  414  KKSNGDTLEYQKLMKEDIRPSLKDIVWTWQGDE  446



>gb|KFK31507.1| hypothetical protein AALP_AA6G121600 [Arabis alpina]
Length=433

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 200/265 (75%), Gaps = 17/265 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGV+L+VLLAG+LP  + NL+EMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVICKKGYDGAKADVWSCGVVLYVLLAGFLPFHEQNLVEMYRKITKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEVKKLL++ILDPNP  RI + K+MENSWFQK F +++ P +P  DS   ES  S  D+
Sbjct  236  PPEVKKLLSRILDPNPNSRIKIEKIMENSWFQKGFKKIETPKSP--DSHQIESLIS--DV  291

Query  358  FDDRSTSDPAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
                     A  +++P C NAFD+I SLS  FDLSGLF  +  ++ ES FTT++ A  IV
Sbjct  292  H--------AAFNVQPMCYNAFDLISSLSQGFDLSGLF--EKEERSESMFTTKKEAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIA  SE F + K +  VK++  ++GRKGQLAID  IFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIATSSERFSLTKSNVGVKMEDRREGRKGQLAIDVGIFEVTKSFHMVEFKKSGGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEGS  786
            MEY+ FC++EL+PSLKDI+WKW+GS
Sbjct  402  MEYKQFCDRELKPSLKDIVWKWQGS  426



>ref|XP_010441665.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Camelina sativa]
Length=437

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 198/265 (75%), Gaps = 17/265 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+ YDG KAD+WSCGV+L+VLLAG+LP  + NL+EMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVIGKKAYDGAKADVWSCGVVLYVLLAGFLPFHEKNLVEMYRKITKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEVKKLL++ILDPNP  RI + K+MENSWFQK F ++            E+P+S     
Sbjct  236  PPEVKKLLSRILDPNPNSRIKIDKIMENSWFQKGFKKI------------ETPKSPDSHQ  283

Query  361  DDRSTSD-PAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D   SD  A  S++P C NAFDII SLS  FDLSGLF+ +  ++ +S+FTT++ A  IV
Sbjct  284  IDSLISDVHAAFSVQPMCYNAFDIISSLSQGFDLSGLFEKE--ERSQSKFTTKKEAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIA  SE F + K +  VK++  K+GRKGQLAID EIFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIATSSERFNLTKNNVGVKMEDKKEGRKGQLAIDVEIFEVTKSFHMVEFKKSGGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEGS  786
            MEY  FC++EL+PSLKDI+WKW+G+
Sbjct  402  MEYNEFCDRELKPSLKDIVWKWQGN  426



>ref|XP_002323059.2| calcineurin B-like-interacting protein kinase [Populus trichocarpa]
 gb|ABJ91228.1| CBL-interacting protein kinase 22 [Populus trichocarpa]
 gb|ABK95707.1| unknown [Populus trichocarpa]
 gb|EEF04820.2| calcineurin B-like-interacting protein kinase [Populus trichocarpa]
Length=470

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/266 (59%), Positives = 201/266 (76%), Gaps = 8/266 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP RD NLMEMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILYVLLAGYLPFRDPNLMEMYRKIAKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL+KILDPNP  RIS++K+MENSW +KD  Q +P    A+ + + +P     +F
Sbjct  236  APEVRKLLSKILDPNPNTRISMAKIMENSWVRKDL-QSRPCVLEAEVK-EPAPLDSEAVF  293

Query  361  DDRSTS----DPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                 S    +P     KP  LNAFDIIS S  FDLSGLF+ +  +K E RFT+ +PAST
Sbjct  294  GINEISCAAVEPKQEVAKPCNLNAFDIISFSAGFDLSGLFE-EKEQKKEVRFTSNKPAST  352

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E+IA     +++K D G++K++G+K+GRKG + IDAEIFE+TP FH+VE+KKSSG
Sbjct  353  IISKLEDIAKRLRLKIKKNDGGLLKIEGSKEGRKGVMGIDAEIFEITPFFHLVEMKKSSG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEG  783
            DT+EY+   +Q++RP+LKDI+W W+G
Sbjct  413  DTVEYQKVVKQDIRPALKDIVWSWQG  438



>ref|XP_010481526.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Camelina sativa]
Length=441

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 196/264 (74%), Gaps = 17/264 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI  +GYDG KAD+WSCGV+L+VLLAG+LP  + NL+EMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVIGMKGYDGAKADVWSCGVVLYVLLAGFLPFHEQNLVEMYRKITKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEVKKLL++ILDPNP  RI + K+MENSWFQK F ++            E+P+S     
Sbjct  236  PPEVKKLLSRILDPNPNSRIKIDKIMENSWFQKGFKKI------------EAPKSPDSHQ  283

Query  361  DDRSTSD-PAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D   SD  A  S++P C NAFD+I SLS  FDLSGLF+ +   + ES+FTT++ A  IV
Sbjct  284  IDSLISDVHAAFSVQPMCYNAFDLISSLSQGFDLSGLFEKEG--RSESKFTTKKEAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIA  SE F + K +  VK++  K+GRKGQLAID EIFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIATSSERFNLTKSNVGVKMEDKKEGRKGQLAIDVEIFEVTKSFHMVEFKKSGGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            MEY  FC++EL+PSLKDI+WKW+G
Sbjct  402  MEYNEFCDRELKPSLKDIVWKWQG  425



>ref|NP_001268154.1| CBL-interacting protein kinase 07 [Vitis vinifera]
 ref|XP_010653329.1| PREDICTED: CBL-interacting protein kinase 07 isoform X1 [Vitis 
vinifera]
 emb|CAN81218.1| hypothetical protein VITISV_040419 [Vitis vinifera]
 gb|ACQ83523.1| CBL-interacting protein kinase 07 [Vitis vinifera]
Length=462

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 199/262 (76%), Gaps = 4/262 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLME+YRKI K +++ P WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHDSNLMELYRKIGKAEYRFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQ-NDESPRSVLDI  357
            P EV++LL+KILDPNP  RIS++K+MENSWFQK    +  IT   + +  D    +V   
Sbjct  236  PSEVRRLLSKILDPNPKTRISITKIMENSWFQKGLDPVLRITETGEKEPADLEVEAVFGS  295

Query  358  FDDRSTSDPAGSSMKP-TCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             +  ST+  A   +   + LNAFDIIS S  FDLSGLF+ +  KK E RFT++QPAS I+
Sbjct  296  NESASTTAEAKQELATLSNLNAFDIISFSAGFDLSGLFEENKQKK-EVRFTSRQPASAII  354

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E+IA     +V+KKD G++K++G+K+GRKG L+IDAEIFEVTPSFH+VEVKKSSGDT
Sbjct  355  SKLEDIAKRLMLKVKKKDGGLLKMEGSKEGRKGVLSIDAEIFEVTPSFHLVEVKKSSGDT  414

Query  712  MEYRNFCEQELRPSLKDIIWKW  777
            +EY+   +QE+RP+LKDI+W W
Sbjct  415  LEYQKIVKQEIRPALKDIVWAW  436



>ref|XP_006398267.1| hypothetical protein EUTSA_v10000893mg [Eutrema salsugineum]
 gb|ESQ39720.1| hypothetical protein EUTSA_v10000893mg [Eutrema salsugineum]
Length=424

 Score =   315 bits (807),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/263 (60%), Positives = 200/263 (76%), Gaps = 17/263 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG +AD+WSCGV+L+VLLAG+LP  + NL+EMYRKI KG+F+CP WF
Sbjct  176  AYVAPEVICKKGYDGAQADVWSCGVVLYVLLAGFLPFHEQNLVEMYRKITKGEFRCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEVKKLL++ILDPNP  RI + K+MENSWFQK F +++ P +P  DS   ES  S  D+
Sbjct  236  PPEVKKLLSRILDPNPNSRIKIDKIMENSWFQKGFKKIETPKSP--DSHQIESLIS--DV  291

Query  358  FDDRSTSDPAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
                     A  ++KP C NAFD+I SLS  FDLSGLF  +  ++ ES FT+++ A  IV
Sbjct  292  H--------AAFAVKPMCYNAFDLISSLSQGFDLSGLF--EKEERSESMFTSKKEAKEIV  341

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIAM SE F ++K +  VK++  ++GRKGQLAID EIFEVT SFH+VE KKS GDT
Sbjct  342  SKFEEIAMSSERFDLKKSNVGVKMEDRREGRKGQLAIDVEIFEVTKSFHMVEFKKSGGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWE  780
            MEY+ FC+ EL+PSLKDI+WKW+
Sbjct  402  MEYKQFCDLELKPSLKDIVWKWQ  424



>gb|ABY58264.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/270 (58%), Positives = 204/270 (76%), Gaps = 12/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDAGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EY+    Q++RP+L DI+W W+G +Q
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQGDQQ  439



>ref|XP_003517006.1| PREDICTED: CBL-interacting protein kinase 2-like [Glycine max]
Length=467

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 205/272 (75%), Gaps = 15/272 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAG+LP RDSNLMEMYRKI +G+FK P WF
Sbjct  176  AYVAPEVINRRGYDGAKADIWSCGVILYVLLAGFLPFRDSNLMEMYRKIGRGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLD--  354
             P+V++LL+KILDPNP  RIS++K+ME+SWF+K     KP      +QN++   + LD  
Sbjct  236  APDVRRLLSKILDPNPKTRISMAKIMESSWFKKGLE--KPTI----TQNEDEELAPLDAD  289

Query  355  -IFDDRSTSD---PAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
             +F      D   PA +S     LNAFDIIS S  FDLSGLF+ +T++K E RFT+ +PA
Sbjct  290  GVFGACENGDPIEPAKNSKPCNNLNAFDIISYSSGFDLSGLFE-ETDRKKEERFTSDKPA  348

Query  523  STIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            S I+SK EEI      +V+KKD G+ KL+G+K+GRKG L IDAEIFE+TP FH+VE+KKS
Sbjct  349  SIIISKLEEICRRLRLKVKKKDGGLFKLEGSKEGRKGPLGIDAEIFEITPVFHLVELKKS  408

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            SGDT+EY+   +QE+RP+LKDI+W W+G EQP
Sbjct  409  SGDTLEYQKLLKQEVRPALKDIVWNWQG-EQP  439



>ref|XP_006279541.1| hypothetical protein CARUB_v10028407mg [Capsella rubella]
 gb|EOA12439.1| hypothetical protein CARUB_v10028407mg [Capsella rubella]
Length=436

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 201/264 (76%), Gaps = 17/264 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGV+L+VLLAG+LP  + NL++MYRKI KG+FKCP WF
Sbjct  176  AYVAPEVIGKKGYDGAKADVWSCGVVLYVLLAGFLPFHEQNLVDMYRKISKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEVKKLL++ILDPNP  RI + K+MENSWFQK + +++ P +P  DS   +S  S  D+
Sbjct  236  PPEVKKLLSRILDPNPNSRIKIDKIMENSWFQKGYKKIETPTSP--DSHQIDSLLS--DV  291

Query  358  FDDRSTSDPAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
                     A  S++P C NAFD+I SLS  FDLSGLF  +  ++ ES+FTT++ A  IV
Sbjct  292  H--------AAFSVQPMCYNAFDLISSLSQGFDLSGLF--EKEERSESKFTTKKEAKEIV  341

Query  535  SKFEEIA-MSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIA ++E F + K +  VK++  ++GRKGQLAID EI+EVT SFH+VE KKS GDT
Sbjct  342  SKFEEIATINERFNLTKSNVGVKMEDKREGRKGQLAIDVEIYEVTKSFHMVEFKKSRGDT  401

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            MEY+ FC+ EL+PSLKDI+WKW+G
Sbjct  402  MEYKQFCDSELKPSLKDIVWKWQG  425



>gb|ACA65275.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 203/267 (76%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      ++LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELALLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>emb|CDX87763.1| BnaC02g31860D [Brassica napus]
Length=394

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 201/264 (76%), Gaps = 17/264 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG+KAD+WSCGV+L+VLLAG+LP    NL+EMYRKI  G+FKCP WF
Sbjct  133  AYVAPEVICKKGYDGDKADVWSCGVVLYVLLAGFLPFHQQNLVEMYRKIKNGEFKCPNWF  192

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK-PITPIADSQNDESPRSVLDI  357
            PPEVKKLL++ILDPNP  RI ++K+MENSWFQK F +++ P +P  DS   ES  S  D+
Sbjct  193  PPEVKKLLSRILDPNPNSRIKINKIMENSWFQKGFKKIETPKSP--DSNQIESLIS--DV  248

Query  358  FDDRSTSDPAGSSMKPTCLNAFDII-SLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
                     A  +++P C NAFD+I SLS  FDLSGLF+ +  ++ ES FTT++ A  IV
Sbjct  249  H--------AAFAVQPMCYNAFDLISSLSQGFDLSGLFEKE--ERSESMFTTKKEAKEIV  298

Query  535  SKFEEIAM-SEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SKFEEIA  SE F ++K +  VK++  K+GRKGQLAI+ EIFEVT SFH+VE KKS GDT
Sbjct  299  SKFEEIATSSERFDLKKSNVGVKMEDRKEGRKGQLAINVEIFEVTKSFHMVEFKKSKGDT  358

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            MEY+ FC+ EL+PSLKDI+WKW+G
Sbjct  359  MEYKQFCDGELKPSLKDIVWKWQG  382



>gb|KEH29212.1| CBL-interacting kinase [Medicago truncatula]
Length=465

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 199/267 (75%), Gaps = 7/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAG+LP RD NL+EMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVILYVLLAGFLPFRDPNLIEMYRKIGKADFKYPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
              +V++LL+KILDPNP  RIS++K+ME+SWF+K     KPI P  D+ N E +P  V  +
Sbjct  236  ASDVRRLLSKILDPNPKTRISIAKIMESSWFKKGLE--KPIVP--DTNNKELAPLDVDGV  291

Query  358  FDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
            F      D    S     LNAFDIIS S  FDLSGLF+ +  +K E RFT+ +PAS I+S
Sbjct  292  FGACENGDHVDLSKPCNNLNAFDIISFSSGFDLSGLFEDNKERKTEMRFTSNKPASIIIS  351

Query  538  KFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            KFEEI      +V+KKD G+ K++G+K+GRKG+L IDAEIFE+TP FH+VE+KKS+GDT+
Sbjct  352  KFEEICNRLGLKVKKKDGGLFKIEGSKEGRKGRLGIDAEIFEITPVFHLVELKKSNGDTL  411

Query  715  EYRNFCEQELRPSLKDIIWKWEGSEQP  795
            EY+   ++ +RPSLKDI+W W+G EQP
Sbjct  412  EYQKLVKENVRPSLKDIVWNWQG-EQP  437



>ref|XP_008792201.1| PREDICTED: CBL-interacting protein kinase 18-like [Phoenix dactylifera]
Length=448

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 197/265 (74%), Gaps = 7/265 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AY+APEVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI KG+FKCP WF
Sbjct  176  AYIAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKIGKGEFKCPTWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V+KLL KILDPNPI RIS++K+MEN WF K F     +  I     +  P  V  +F
Sbjct  236  SSDVRKLLYKILDPNPITRISITKIMENFWFSKGFDG--KLMKIEAETKENIPADVAAVF  293

Query  361  DDRSTSDPA---GSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               + ++       ++K T LNAFDIISLS  FDLSGLF+ + +   E+RFT++ PA+ I
Sbjct  294  STSNCNNTVVGKQEALKVTNLNAFDIISLSAGFDLSGLFE-ERDHSKEARFTSRHPATAI  352

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK E++A    F+V+KK  G++K++G+K+GRKG LAIDAEIFEVTPSFH+VE+KKS GD
Sbjct  353  ISKLEDVARCLKFRVKKKHYGLLKMEGSKKGRKGILAIDAEIFEVTPSFHLVEIKKSDGD  412

Query  709  TMEYRNFCEQELRPSLKDIIWKWEG  783
            T+EY+   ++ +RP+LKDI+  W+G
Sbjct  413  TLEYQKLLKEGIRPALKDIVCAWQG  437



>gb|ABY58272.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 202/267 (76%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    QE+RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQEMRPALTDIVWAWQG  436



>ref|XP_010089697.1| CBL-interacting protein kinase 5 [Morus notabilis]
 gb|EXB38220.1| CBL-interacting protein kinase 5 [Morus notabilis]
Length=461

 Score =   314 bits (804),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/280 (54%), Positives = 203/280 (73%), Gaps = 21/280 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG +ADIWSCGVILFVL+AGYLP  +  LM++YRKI KG+F+ P+WF
Sbjct  176  AYVAPEVIHQKGYDGARADIWSCGVILFVLMAGYLPFSEQKLMDLYRKIFKGEFRSPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLD--  354
              EV+KLL++ILDPNP +RIS++K+MEN W +K F        +  + ND++  S +D  
Sbjct  236  ALEVRKLLSRILDPNPSKRISIAKIMENRWVKKGFKHFGQ-AQLPSNSNDKTSVSDVDTA  294

Query  355  ---------------IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKK  489
                           + ++ + +DP    +K +  NAFDIISLSP FDLSGLF+ D N  
Sbjct  295  FSIADCETPSKMNSGVVEEMTKADPPLPMIKTSYFNAFDIISLSPGFDLSGLFEKD-NLI  353

Query  490  PE--SRFTTQQPASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEV  663
            P   +RFT+ +PAS I+SKFEEIA +E F++++KDG VKL G ++GRKGQL IDA+IFEV
Sbjct  354  PRLPARFTSNKPASAIISKFEEIAATERFKLERKDGTVKLHGRREGRKGQLGIDADIFEV  413

Query  664  TPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            TPSFHVVE++K++GDT+EY  F +  L+PSLKDI+W W+G
Sbjct  414  TPSFHVVELRKTAGDTLEYMEFYDHGLKPSLKDIVWTWQG  453



>ref|XP_008789399.1| PREDICTED: CBL-interacting protein kinase 5-like [Phoenix dactylifera]
Length=543

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 204/283 (72%), Gaps = 22/283 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVL+AGYLP  D NL+ MY KI +G+F+CP WF
Sbjct  237  AYVAPEVINRKGYDGAKADIWSCGVILFVLMAGYLPFNDPNLITMYGKISRGEFRCPTWF  296

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +++KLL+++LDPNP  RI++SKLMENSWF+K F   KP+ P    +    PRS  D+ 
Sbjct  297  PSDIRKLLSRLLDPNPNTRITMSKLMENSWFRKGF---KPVPPTLQYRGSPCPRSDGDVH  353

Query  361  DD-RSTSDP-----------------AGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNK  486
                  + P                 A S ++P CLNAFDIIS S  FDLSGLF+ +   
Sbjct  354  GCMHGATFPSEDEEKDEAEEEIKKKLAMSPIRPCCLNAFDIISRSQVFDLSGLFEKEKGV  413

Query  487  KPESRFTTQQPASTIVSKFEEIAMSEHFQ-VQKKDGMVKLQGNKQGRKGQLAIDAEIFEV  663
            K E+RFT+++PA+ IVSK EEIA  E F+ +++KDG+VKL+G+K+GRKGQL I+AEIFEV
Sbjct  414  KAEARFTSKKPAAAIVSKLEEIAQMERFKMIKEKDGVVKLEGSKKGRKGQLEIEAEIFEV  473

Query  664  TPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +P+  +VE+KK SGDT+EY+ F  QELRPSLKDI+W W+  +Q
Sbjct  474  SPALFLVEMKKLSGDTLEYQKFYHQELRPSLKDIVWTWQVGDQ  516



>gb|ABY58257.1| serine-threonine kinase [Persea americana]
 gb|ACA65285.1| serine-threonine kinase [Persea americana]
 gb|ACA65292.1| serine-threonine kinase [Persea americana]
 gb|ACA65299.1| serine-threonine kinase [Persea americana]
 gb|ACA65307.1| serine-threonine kinase [Persea americana]
 gb|ACA65308.1| serine-threonine kinase [Persea americana]
 gb|ACA65311.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 202/267 (76%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDAGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|ABY58262.1| serine-threonine kinase [Persea americana]
 gb|ABY58268.1| serine-threonine kinase [Persea americana]
 gb|ACA65279.1| serine-threonine kinase [Persea americana]
 gb|ACA65301.1| serine-threonine kinase [Persea americana]
 gb|ACA65305.1| serine-threonine kinase [Persea americana]
 gb|ACA65316.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 202/267 (76%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|ABY58256.1| serine-threonine kinase [Persea americana]
 gb|ABY58258.1| serine-threonine kinase [Persea americana]
 gb|ABY58276.1| serine-threonine kinase [Persea americana]
 gb|ABY58277.1| serine-threonine kinase [Persea americana]
 gb|ABY58278.1| serine-threonine kinase [Persea americana]
 gb|ACA65281.1| serine-threonine kinase [Persea americana]
 gb|ACA65289.1| serine-threonine kinase [Persea americana]
 gb|ACA65291.1| serine-threonine kinase [Persea americana]
 gb|ACA65295.1| serine-threonine kinase [Persea americana]
 gb|ACA65297.1| serine-threonine kinase [Persea americana]
 gb|ACA65318.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 202/267 (76%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>ref|XP_007134686.1| hypothetical protein PHAVU_010G067600g [Phaseolus vulgaris]
 gb|ESW06680.1| hypothetical protein PHAVU_010G067600g [Phaseolus vulgaris]
Length=467

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/270 (59%), Positives = 199/270 (74%), Gaps = 11/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAG+LP RD NLMEMYRKI KG+FK P WF
Sbjct  176  AYVAPEVINRRGYDGAKADIWSCGVILYVLLAGFLPFRDPNLMEMYRKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE--SPRSVLD  354
             P+V++LL+KILDPNP  RIS++K+ME+SWF+K   +     P      DE  +P     
Sbjct  236  APDVRRLLSKILDPNPKTRISMAKIMESSWFKKGLQK-----PTITQNKDEELAPLDTDG  290

Query  355  IFDDRSTSDPA--GSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
            +F      DP       KP  LNAFDIIS S  FDLSGLF+  T++K E+RFT+ +PAS 
Sbjct  291  VFSFCQNGDPIEPAKDSKPCNLNAFDIISYSSGFDLSGLFEETTDRKKEARFTSDKPASI  350

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK EEI      +++KKD G+ KL+G+K+GRKG L IDAEIFE+TP FH VE+KKSSG
Sbjct  351  IISKLEEICKRLRLKLKKKDGGLFKLEGSKEGRKGPLGIDAEIFEITPVFHFVELKKSSG  410

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            DT+EY+N  +QE+RP+LKDI+W W+G EQP
Sbjct  411  DTLEYQNLLKQEVRPALKDIVWNWQG-EQP  439



>ref|XP_011003598.1| PREDICTED: CBL-interacting protein kinase 2-like [Populus euphratica]
Length=470

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 201/266 (76%), Gaps = 8/266 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP RD NLMEMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILYVLLAGYLPFRDPNLMEMYRKIAKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL+KILDPNP  RIS++K+MENSW +KD  Q +P    A+ + + +P     +F
Sbjct  236  APEVRKLLSKILDPNPNTRISIAKIMENSWVRKDL-QSRPCVLAAEVK-EPAPLDSEAVF  293

Query  361  DDRSTS----DPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                 S    +P     KP  LNAFDIIS S  FDLSGLF+ +  +K E RFT+ +PAST
Sbjct  294  GINEISCAAVEPKQEVAKPCNLNAFDIISFSAGFDLSGLFE-EKEQKKEVRFTSNKPAST  352

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E+IA     +++KKD G +K++G+K+GRKG + IDAEIFE+TP FH+VE+KKSSG
Sbjct  353  IISKLEDIAKRLRLKIKKKDGGFLKIEGSKEGRKGVMGIDAEIFEITPFFHLVEMKKSSG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEG  783
            DT+EY+   +Q++RP+LKDI+W W+G
Sbjct  413  DTVEYQKVVKQDIRPALKDIVWSWQG  438



>ref|XP_011008766.1| PREDICTED: CBL-interacting protein kinase 2-like [Populus euphratica]
Length=472

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 201/266 (76%), Gaps = 8/266 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP RD NLMEMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILYVLLAGYLPFRDPNLMEMYRKIAKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL+KILDPNP  RIS++K+MENSW +KD  Q +P    A+ + + +P     +F
Sbjct  236  APEVRKLLSKILDPNPNTRISIAKIMENSWVRKDL-QSRPCVLAAEVK-EPAPLDSEAVF  293

Query  361  DDRSTS----DPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                 S    +P     KP  LNAFDIIS S  FDLSGLF+ +  +K E RFT+ +PAST
Sbjct  294  GINEISCAAVEPKQEVAKPCNLNAFDIISFSAGFDLSGLFE-EKEQKKEVRFTSNKPAST  352

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E+IA     +++KKD G +K++G+K+GRKG + IDAEIFE+TP FH+VE+KKSSG
Sbjct  353  IISKLEDIAKRLRLKIKKKDGGFLKIEGSKEGRKGVMGIDAEIFEITPFFHLVEMKKSSG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEG  783
            DT+EY+   +Q++RP+LKDI+W W+G
Sbjct  413  DTVEYQKVVKQDIRPALKDIVWSWQG  438



>gb|ACN76472.1| CBL-interacting protein kinase 22 [Populus euphratica]
Length=470

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 200/266 (75%), Gaps = 8/266 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP RD NLMEMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILYVLLAGYLPFRDPNLMEMYRKIAKGEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL+KILDPNP  RIS++K+MENSW +KD  Q +P   +A    + +P     +F
Sbjct  236  APEVRKLLSKILDPNPNTRISIAKIMENSWVRKDL-QSRPCV-LAAEVKEPAPLDSEAVF  293

Query  361  DDRSTS----DPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                 S    +P     KP  LNAFDIIS S  FDLSGLF+ +  +K E RFT+ +PAST
Sbjct  294  GINEISCAAVEPKQEVAKPCNLNAFDIISFSAGFDLSGLFE-EKEQKKEVRFTSNKPAST  352

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E+IA     +++KKD G +K++G+K+GRKG + IDAEIFE+TP FH+VE+KKSSG
Sbjct  353  IISKLEDIAKRLRLKIKKKDGGFLKIEGSKEGRKGVMGIDAEIFEITPFFHLVEMKKSSG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEG  783
            DT+EY+   +Q++RP+LKDI+W W+G
Sbjct  413  DTVEYQKVVKQDIRPALKDIVWSWQG  438



>gb|ABY58274.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 202/267 (76%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKSAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|ABY58275.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 202/267 (76%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG ++IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVVSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>ref|XP_010931340.1| PREDICTED: CBL-interacting protein kinase 18-like [Elaeis guineensis]
 ref|XP_010931342.1| PREDICTED: CBL-interacting protein kinase 18-like [Elaeis guineensis]
Length=448

 Score =   311 bits (797),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 197/265 (74%), Gaps = 7/265 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVA EVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI KG+FKCP WF
Sbjct  176  AYVAFEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKIGKGEFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V+KLL KILDPNPI RIS++K+MEN WF+K F   +        +N   P  V  +F
Sbjct  236  SSDVRKLLYKILDPNPITRISITKIMENPWFRKGFDGKRMKNEAQTKEN--IPTDVGTVF  293

Query  361  ---DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               D+ +T      ++K T LNAFDIISLS  FDLSGLF+ + +   E+RFT++ PA+ I
Sbjct  294  SSSDNNNTVVGKQEAVKVTNLNAFDIISLSSGFDLSGLFE-ERDHSKEARFTSRHPATAI  352

Query  532  VSKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK E+ A     +V+KK DG+++++G+++GRKG L IDAEIFEVTPSFH+VE+KKS+GD
Sbjct  353  ISKLEDAARCLRLRVKKKHDGLLQMEGSQEGRKGVLGIDAEIFEVTPSFHLVEMKKSNGD  412

Query  709  TMEYRNFCEQELRPSLKDIIWKWEG  783
            T+EY    ++ +RP+LKDI+W W+G
Sbjct  413  TLEYHKLLKEGIRPALKDIVWAWQG  437



>ref|XP_010922709.1| PREDICTED: CBL-interacting protein kinase 18-like [Elaeis guineensis]
Length=447

 Score =   311 bits (797),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 197/267 (74%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI KG+FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKIGKGEFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P E +KLL KILDPNP  RIS++K+MEN WF+K F        I +++ +    + +D+ 
Sbjct  236  PFEARKLLFKILDPNPSTRISIAKIMENPWFRKGFDD-----KIMNNEEETKENATVDVA  290

Query  361  -----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                  + +T +    S++ T LNAFDIISLS  FDLSGLF+ + +   E+RF + QPAS
Sbjct  291  AVFGSSESNTVEGKQDSVRVTNLNAFDIISLSAGFDLSGLFE-EKDHMKEARFVSMQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E++A     +V KK DG++K++G+K+GRKG L IDAEIFEV P FH+VE+KKS+
Sbjct  350  AIISKLEDVARRLKLRVGKKHDGVLKMEGSKEGRKGVLGIDAEIFEVAPLFHLVELKKSN  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+   ++E+RP+L DI+W W+G
Sbjct  410  GDTLEYQKVLKEEMRPALTDIVWAWQG  436



>ref|XP_010326216.1| PREDICTED: LOW QUALITY PROTEIN: CBL-interacting protein kinase 
2-like [Solanum lycopersicum]
Length=473

 Score =   311 bits (798),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 203/267 (76%), Gaps = 6/267 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+KRGYDG KADIWSCGVIL+VLLAGYLP +DS L EMYRKI K +FKCP WF
Sbjct  180  AYVAPEVISKRGYDGAKADIWSCGVILYVLLAGYLPFQDSKLTEMYRKIGKAEFKCPNWF  239

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESP--RSVLD  354
            PP+ ++L++KIL+PNP  RIS+SK+MENSWF+K   QLKPI   ADS+ +E+    +V  
Sbjct  240  PPDARRLISKILNPNPSTRISISKIMENSWFKKGL-QLKPIIADADSKPEEAAIDDAVFG  298

Query  355  IFDDR-STSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
            I +   S ++P    +K   LNAFDIIS S  FDLS  F+ + +KK E  FT++QPA TI
Sbjct  299  IGESTDSITEPKPELVKXCTLNAFDIISFSTGFDLSAFFE-ERDKKREVIFTSKQPAKTI  357

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK E++A     +V KKD G++KL+G+K+GRKG L+IDAEIFEVTP+FH VE+KKS+GD
Sbjct  358  ISKLEDVARRLKLKVMKKDGGLLKLEGSKEGRKGVLSIDAEIFEVTPNFHFVEMKKSNGD  417

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSE  789
            T+EY+     ++RP+L+D +W W+G E
Sbjct  418  TIEYKKTMMTDVRPALEDTVWTWQGDE  444



>ref|NP_001267860.1| CBL-interacting protein kinase 13 [Vitis vinifera]
 ref|XP_010658133.1| PREDICTED: CBL-interacting protein kinase 13 isoform X1 [Vitis 
vinifera]
 ref|XP_010658134.1| PREDICTED: CBL-interacting protein kinase 13 isoform X1 [Vitis 
vinifera]
 gb|ACQ83529.1| CBL-interacting protein kinase 13 [Vitis vinifera]
Length=464

 Score =   311 bits (797),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 195/267 (73%), Gaps = 11/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI K D+KCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKIGKADYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EV++LL+KILDPNP  RIS++K+M N WF++ F   KP+    + + D  P     +F
Sbjct  236  PSEVRRLLSKILDPNPNTRISIAKIMVNPWFRRGFIP-KPLKTKTEVK-DLDPLGTDTVF  293

Query  361  DDRSTSDPAGSSMK-------PTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
                 +  A   MK       PT LNAFDIISLS  FDLSGLF  +  KK E +FT++QP
Sbjct  294  GPCENNSAAAGEMKELSKPTQPTNLNAFDIISLSTGFDLSGLFATNDQKK-EVQFTSRQP  352

Query  520  ASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            A+ I+SK EEIA     +++KKD G++KL+G+ +GRKG L+IDAEIFE T SFH+VE+KK
Sbjct  353  ATAIISKLEEIARRLRLKIKKKDGGLLKLEGSVEGRKGPLSIDAEIFEFTSSFHLVEMKK  412

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKW  777
            SSGDT+EY+    QE+RP+LKDI+W W
Sbjct  413  SSGDTLEYQKILRQEIRPALKDIVWAW  439



>gb|ABY58284.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   311 bits (796),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 201/267 (75%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F            +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFTKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>ref|XP_010091068.1| CBL-interacting protein kinase 2 [Morus notabilis]
 gb|EXB42358.1| CBL-interacting protein kinase 2 [Morus notabilis]
Length=461

 Score =   311 bits (797),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 199/269 (74%), Gaps = 13/269 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP RDSNLMEMYRKI KG+FK P WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFRDSNLMEMYRKIGKGEFKMPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPR-----S  345
             PEV+KL++K+LDPNP  RIS+ K+M NSWF+K         PI   + D  P      +
Sbjct  236  APEVRKLVSKMLDPNPRTRISMEKIMGNSWFRKGL----DTKPIIFEKEDAEPAPLDADA  291

Query  346  VLDIFDDRST-SDPAGSSMKPTC-LNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
            V    +D S+ +D      KP C LNAFDIIS S  FDLSGLF+ +T +K E RFT+ + 
Sbjct  292  VFGRLEDLSSMTDSKQELSKPCCNLNAFDIISYSAGFDLSGLFE-ETERKKEVRFTSNKS  350

Query  520  ASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            A TI+SK E+IA     +++K+D G++KL+G+K+GRKG + +DAEIFE+TP FH+VE+KK
Sbjct  351  AFTIISKLEDIAKRLRLKIKKRDGGLLKLEGSKEGRKGIVGVDAEIFEITPLFHMVEMKK  410

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            S+GDT+EY+   +Q++RP+LKDIIW WEG
Sbjct  411  SNGDTLEYQKLMKQDIRPALKDIIWTWEG  439



>gb|ADE76223.1| unknown [Picea sitchensis]
Length=431

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 196/266 (74%), Gaps = 16/266 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVITK+GYDG  ADIWSCGVILFVL+AGYLP +D+NLM MY+KI KGD+KCP WF
Sbjct  177  AYVAPEVITKKGYDGATADIWSCGVILFVLMAGYLPFQDANLMVMYKKIYKGDYKCPPWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              EV++L+ ++LDPNP  RI++ +LME  WF++ F +     P AD   +      + + 
Sbjct  237  SSEVRRLVLRLLDPNPRTRITVPQLMEVPWFRRGFKR-----PQADKDVN------VGVL  285

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKK-PESRFTTQQPASTIVS  537
            DD    D A    KP CLNAFDIISLSP F+LSGLF  D  K+  ESRFT+ QPAS+I+S
Sbjct  286  DD---VDSAFFVPKPACLNAFDIISLSPGFNLSGLFKDDVLKQEEESRFTSTQPASSIMS  342

Query  538  KFEEIAMSEHFQVQK-KDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            K EEIA    F  +K KD  +KLQG++QGRKG L+IDAEIFEVTPSF +VE++K+ GDT+
Sbjct  343  KLEEIASLFRFSFKKSKDFKMKLQGSEQGRKGHLSIDAEIFEVTPSFFMVELRKTGGDTL  402

Query  715  EYRNFCEQELRPSLKDIIWKWEGSEQ  792
            EY  FC Q+LRP LKDI+W W+G+ Q
Sbjct  403  EYSKFCSQDLRPGLKDIVWTWDGNRQ  428



>gb|ABK24914.1| unknown [Picea sitchensis]
Length=426

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 195/265 (74%), Gaps = 15/265 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYV+PEVITK+GYDG KADIWSCGVILFVL+AGYLP  D+NLM MY+KI KGDFKCP WF
Sbjct  176  AYVSPEVITKKGYDGAKADIWSCGVILFVLMAGYLPFLDANLMVMYKKIYKGDFKCPPWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              EV++L+ ++LDPNP  RI++ +LME  WF++ F +     P A    D      + + 
Sbjct  236  SSEVRRLVVRLLDPNPRTRITVPQLMEVPWFRRGFKR-----PQAGKDVD------VGLL  284

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
            +D    D A  + KP CLNAFDIISLSP F+LSGLF  D  K+ ESRFT+ QPAS+I+SK
Sbjct  285  ED---VDSAFCAPKPACLNAFDIISLSPGFNLSGLFKDDVVKQEESRFTSTQPASSIMSK  341

Query  541  FEEIAMSEHFQVQK-KDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             EEIA    F  +K KD  VKLQG++QGRKGQL+IDAEIFEVTPS  VVE++K+ GD++E
Sbjct  342  LEEIASLFRFSFKKSKDCKVKLQGSEQGRKGQLSIDAEIFEVTPSLFVVELRKTGGDSLE  401

Query  718  YRNFCEQELRPSLKDIIWKWEGSEQ  792
            Y  F  Q+L+P LKDI+W W+G+ Q
Sbjct  402  YSKFYSQDLKPGLKDIVWTWDGNSQ  426



>gb|AAL23677.1| Serine/threonine Kinase [Persea americana]
Length=453

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 201/267 (75%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQHLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  AIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|ACA65274.1| serine-threonine kinase [Persea americana]
 gb|ACA65276.1| serine-threonine kinase [Persea americana]
 gb|ACA65284.1| serine-threonine kinase [Persea americana]
 gb|ACA65294.1| serine-threonine kinase [Persea americana]
 gb|ACA65304.1| serine-threonine kinase [Persea americana]
 gb|ACA65310.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 201/267 (75%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILD NP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDQNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQNLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|KDP22784.1| hypothetical protein JCGZ_00371 [Jatropha curcas]
Length=465

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 198/265 (75%), Gaps = 10/265 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP  D+NLMEMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGYKADIWSCGVILYVLLAGYLPFHDANLMEMYRKIAKADFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLD-I  357
             PEV+KLL+K+LDPNP  RIS++K+MENSWF+K    L+P   I ++   ES     D I
Sbjct  236  APEVRKLLSKMLDPNPRTRISMAKIMENSWFRKG---LEPKPQIVETDMKESVNLDCDSI  292

Query  358  FDDR----STSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F+      S ++      KP  LNAFDIIS S  FDLSGLF+ +  K+ E RFT  +PAS
Sbjct  293  FNVNESGCSITESKQELAKPCNLNAFDIISYSAGFDLSGLFE-EKEKRKEVRFTANKPAS  351

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E+IA +   +++KKD G++KL+G+K+GRKG L IDAEIFE+TP FH++E+KKSS
Sbjct  352  FIISKLEDIAKNLRLKIKKKDGGLMKLEGSKEGRKGVLGIDAEIFEITPCFHLIEMKKSS  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKW  777
            GDT+EY+   +QE+RP+LKDI+W W
Sbjct  412  GDTLEYQKVLKQEIRPALKDIVWTW  436



>gb|ACA65278.1| serine-threonine kinase [Persea americana]
 gb|ACA65288.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 201/267 (75%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILD NP  RIS++K+ +NSWF++ F         A  +      + LD  
Sbjct  236  PPEVRRLLARILDQNPNTRISIAKIKDNSWFKRGFE-----AKFAKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQNLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  TIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>ref|XP_010252111.1| PREDICTED: CBL-interacting protein kinase 18-like [Nelumbo nucifera]
Length=444

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 200/263 (76%), Gaps = 6/263 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  D NLMEMYRKI +G+FKCP WF
Sbjct  176  AYVAPEVISRKGYDGPKADIWSCGVILFVLLAGYLPFHDPNLMEMYRKIGRGEFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V++LL+KILDPNP  RIS++K+ME+SWF+K        +  +   N ++P    D  
Sbjct  236  PSDVRRLLSKILDPNPNTRISITKIMESSWFRKGLNSKSTSSKESTPINADAP---CDSS  292

Query  361  DDRSTSDPAGSSM-KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
            +   T+  A   + K   LNAFDIISLS  FDLSGLF+ +++KK E+RFT+++PAS I+S
Sbjct  293  EKSGTAAEAKQELAKLNNLNAFDIISLSAGFDLSGLFE-ESDKKKEARFTSRKPASVIIS  351

Query  538  KFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            K E+IA     +V K D G++KL+G+++GRKG  +IDAEIFE+TP+ H+VEVKKSSGDT+
Sbjct  352  KLEDIAKHLKLKVMKNDGGLLKLEGSREGRKGAFSIDAEIFEITPTCHLVEVKKSSGDTL  411

Query  715  EYRNFCEQELRPSLKDIIWKWEG  783
            EY+    +++RP+LKDI+W W+G
Sbjct  412  EYQKILNEDIRPALKDIVWAWQG  434



>gb|ABY58263.1| serine-threonine kinase [Persea americana]
 gb|ABY58269.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 156/270 (58%), Positives = 201/270 (74%), Gaps = 18/270 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
            PPEV++LLA+ILD NP  RIS++K+ +NSWF++ F        T+ K + P+     D +
Sbjct  236  PPEVRRLLARILDQNPNTRISIAKIKDNSWFKRGFEAKFAKGETKFKELAPL---NTDAA  292

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S      D   +      +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++Q
Sbjct  293  FAS-----SDTGVAARKPELVKPQNLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQ  346

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PASTI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVK
Sbjct  347  PASTIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVK  406

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            KSSGDT+EY+    Q++RP+L DI+W W+G
Sbjct  407  KSSGDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|ABY58267.1| serine-threonine kinase [Persea americana]
 gb|ABY58271.1| serine-threonine kinase [Persea americana]
 gb|ABY58273.1| serine-threonine kinase [Persea americana]
 gb|ABY58280.1| serine-threonine kinase [Persea americana]
 gb|ABY58281.1| serine-threonine kinase [Persea americana]
 gb|ABY58283.1| serine-threonine kinase [Persea americana]
 gb|ACA65286.1| serine-threonine kinase [Persea americana]
 gb|ACA65306.1| serine-threonine kinase [Persea americana]
 gb|ACA65315.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 157/270 (58%), Positives = 201/270 (74%), Gaps = 18/270 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
            PPEV++LLA+ILDPNP  RIS+ K+ +NSWF++ F        T+ K + P+     D +
Sbjct  236  PPEVRRLLARILDPNPNTRISIVKIKDNSWFKRGFEAKFTKGETKSKELAPL---DTDAA  292

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S      D   +      +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++Q
Sbjct  293  FAST-----DTGVAARKPELVKPQNLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQ  346

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PASTI+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVK
Sbjct  347  PASTIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVK  406

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            KSSGDT+EY+    Q++RP+L DI+W W+G
Sbjct  407  KSSGDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|EYU41998.1| hypothetical protein MIMGU_mgv1a006238mg [Erythranthe guttata]
Length=451

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 195/264 (74%), Gaps = 11/264 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI  RGYDG KADIWSCGVILFVLL+GYLP RDSNLMEMY+KI K +FKCP W 
Sbjct  176  AYVAPEVINGRGYDGAKADIWSCGVILFVLLSGYLPFRDSNLMEMYKKIGKAEFKCPNWI  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             P+ ++L++KILDPNP  RIS+SK+M+NSWF++ F +         S+++     V ++ 
Sbjct  236  NPDARRLISKILDPNPNTRISISKIMQNSWFRRGFNK---------SRSNIECGKVKEVV  286

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
            D  +T D     ++P  LNAF+IISLS  FDLSGLF+   ++K E +F + Q A TIVSK
Sbjct  287  DADATVDLT-VEIEPVNLNAFEIISLSAGFDLSGLFEESDDRKKECKFMSNQSAKTIVSK  345

Query  541  FEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             EE+      +V KK+ G+VK +G KQGRKG + IDAEIFEV+P++H+VE+KKS+GDT+E
Sbjct  346  LEELGKRLKMKVAKKNGGLVKFEGTKQGRKGVVCIDAEIFEVSPNYHLVEMKKSNGDTLE  405

Query  718  YRNFCEQELRPSLKDIIWKWEGSE  789
            Y+   +QE+RPSLKDI+W W+G E
Sbjct  406  YQKLMKQEIRPSLKDIVWTWQGEE  429



>ref|XP_006429548.1| hypothetical protein CICLE_v10011650mg [Citrus clementina]
 ref|XP_006481165.1| PREDICTED: CBL-interacting protein kinase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481166.1| PREDICTED: CBL-interacting protein kinase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR42788.1| hypothetical protein CICLE_v10011650mg [Citrus clementina]
Length=472

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 159/272 (58%), Positives = 202/272 (74%), Gaps = 15/272 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP  DSNLMEMYRKI K +FK P WF
Sbjct  176  AYVAPEVINRRGYDGSKADIWSCGVILYVLLAGYLPFHDSNLMEMYRKIGKAEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLD--  354
             PEV++LL+KILDPNP  RIS++K+MENSWF+K    +KPI     S+ +E  R+ +D  
Sbjct  236  APEVRRLLSKILDPNPNTRISMTKIMENSWFRKGL--VKPII----SETEEKERAPVDAD  289

Query  355  -IFDDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
              F    +++    S     KP  LNAFDIIS S  FDLSGLF+ +  K+ E RFT+ +P
Sbjct  290  AAFSPSGSTNTVAESKNELAKPCNLNAFDIISFSAGFDLSGLFE-EREKRKEVRFTSNKP  348

Query  520  ASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
             STI+SK E IA     +V+KKD G++K++G+K+GRKG L +DAEIFE+TP FH+VEVKK
Sbjct  349  VSTIISKLEGIAKLLRLKVKKKDGGLLKIEGSKEGRKGVLGMDAEIFEITPFFHLVEVKK  408

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            SSGDT+EY+    QE+RP+LKDI+W W+G ++
Sbjct  409  SSGDTLEYQKVMNQEIRPALKDIVWTWQGEQR  440



>ref|XP_003534649.1| PREDICTED: CBL-interacting protein kinase 18-like isoform X1 
[Glycine max]
 ref|XP_006587935.1| PREDICTED: CBL-interacting protein kinase 18-like isoform X2 
[Glycine max]
 ref|XP_006587936.1| PREDICTED: CBL-interacting protein kinase 18-like isoform X3 
[Glycine max]
Length=460

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 206/271 (76%), Gaps = 12/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAG+LP +D+NLMEMYRKI +G+FK PKWF
Sbjct  176  AYVAPEVINRKGYDGIKADIWSCGVILYVLLAGHLPFQDTNLMEMYRKIGRGEFKFPKWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             P+V++ L++ILDPNP  RIS++K+ME+SWF+K     KP   I  ++N+E +P     I
Sbjct  236  APDVRRFLSRILDPNPKARISMAKIMESSWFKKGLE--KP--AITVTENEELAPLDADGI  291

Query  358  F----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F    +D   ++P     KP  LNAFDIIS S  FDLSGLF+ DT  K E+RF +++PAS
Sbjct  292  FEACENDGPIAEPKQEQAKPCNLNAFDIISFSTGFDLSGLFE-DTFLKKETRFMSKKPAS  350

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             IV K EEI      +V+KKD G++KL+G+K+GRKG L +DAEIFE+TP FH+VE++KS+
Sbjct  351  IIVLKLEEICKRLCLKVKKKDGGLLKLEGSKEGRKGTLGVDAEIFEITPHFHMVELRKSN  410

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            GDTMEY+   +Q++RP+LKDI+W W+G E+P
Sbjct  411  GDTMEYQKLFKQDIRPALKDIVWTWQG-EKP  440



>gb|KHN29521.1| CBL-interacting protein kinase 18 [Glycine soja]
Length=462

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 206/271 (76%), Gaps = 12/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAG+LP +D+NLMEMYRKI +G+FK PKWF
Sbjct  176  AYVAPEVINRKGYDGIKADIWSCGVILYVLLAGHLPFQDTNLMEMYRKIGRGEFKFPKWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             P+V++ L++ILDPNP  RIS++K+ME+SWF+K     KP   I  ++N+E +P     I
Sbjct  236  APDVRRFLSRILDPNPKARISMAKIMESSWFKKGLE--KP--AITVTENEELAPLDADGI  291

Query  358  F----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F    +D   ++P     KP  LNAFDIIS S  FDLSGLF+ DT  K E+RF +++PAS
Sbjct  292  FEACENDGPIAEPKQEQAKPCNLNAFDIISFSTGFDLSGLFE-DTFLKKETRFMSKKPAS  350

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             IV K EEI      +V+KKD G++KL+G+K+GRKG L +DAEIFE+TP FH+VE++KS+
Sbjct  351  IIVLKLEEICKQLCLKVKKKDRGLLKLEGSKEGRKGTLGVDAEIFEITPHFHMVELRKSN  410

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            GDTMEY+   +Q++RP+LKDI+W W+G E+P
Sbjct  411  GDTMEYQKLFKQDIRPALKDIVWTWQG-EKP  440



>gb|ABY58259.1| serine-threonine kinase [Persea americana]
 gb|ABY58265.1| serine-threonine kinase [Persea americana]
 gb|ABY58266.1| serine-threonine kinase [Persea americana]
 gb|ABY58270.1| serine-threonine kinase [Persea americana]
 gb|ABY58279.1| serine-threonine kinase [Persea americana]
 gb|ABY58282.1| serine-threonine kinase [Persea americana]
 gb|ACA65273.1| serine-threonine kinase [Persea americana]
 gb|ACA65277.1| serine-threonine kinase [Persea americana]
 gb|ACA65280.1| serine-threonine kinase [Persea americana]
 gb|ACA65282.1| serine-threonine kinase [Persea americana]
 gb|ACA65283.1| serine-threonine kinase [Persea americana]
 gb|ACA65287.1| serine-threonine kinase [Persea americana]
 gb|ACA65290.1| serine-threonine kinase [Persea americana]
 gb|ACA65293.1| serine-threonine kinase [Persea americana]
 gb|ACA65296.1| serine-threonine kinase [Persea americana]
 gb|ACA65298.1| serine-threonine kinase [Persea americana]
 gb|ACA65300.1| serine-threonine kinase [Persea americana]
 gb|ACA65302.1| serine-threonine kinase [Persea americana]
 gb|ACA65303.1| serine-threonine kinase [Persea americana]
 gb|ACA65309.1| serine-threonine kinase [Persea americana]
 gb|ACA65312.1| serine-threonine kinase [Persea americana]
 gb|ACA65313.1| serine-threonine kinase [Persea americana]
 gb|ACA65314.1| serine-threonine kinase [Persea americana]
 gb|ACA65317.1| serine-threonine kinase [Persea americana]
 gb|ACA65319.1| serine-threonine kinase [Persea americana]
 gb|ACA65320.1| serine-threonine kinase [Persea americana]
 gb|ACA65321.1| serine-threonine kinase [Persea americana]
 gb|ACA65322.1| serine-threonine kinase [Persea americana]
 gb|ACA65323.1| serine-threonine kinase [Persea americana]
 gb|ACA65324.1| serine-threonine kinase [Persea americana]
 gb|ACA65325.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 199/267 (75%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS+ K+ +NSWF++ F            +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIVKIKDNSWFKRGFE-----AKFTKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQNLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  AIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|KEH23254.1| CBL-interacting kinase [Medicago truncatula]
Length=462

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 200/267 (75%), Gaps = 13/267 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GY+G KADIWSCGVIL+VLLAGYLP  D NLMEMYRKI KG+FK PKWF
Sbjct  176  AYVAPEVINRKGYEGCKADIWSCGVILYVLLAGYLPFHDQNLMEMYRKIGKGEFKFPKWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE----SPRSV  348
             PEV++LL+KILDP+   RIS++K+MENSWF+K     KP+  + +++N+E        V
Sbjct  236  APEVRRLLSKILDPSLKTRISMAKIMENSWFKKGLE--KPV--VIETENNELTSLHAEGV  291

Query  349  LDIFDDRSTSDPAGSSMKPT-C--LNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
             ++ ++   S+     ++   C  LNAFDIIS S  FDLSGLF+ DT +K E RFT+ +P
Sbjct  292  FEVSENGGDSNTETKQLQAKPCNNLNAFDIISFSSGFDLSGLFE-DTIQKKEMRFTSNKP  350

Query  520  ASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            ASTI+SK EEI      +V+KKD G++KL+G+K+GRKG L IDAEIFE+TP FH+VE+KK
Sbjct  351  ASTIISKLEEICKCLQLKVKKKDGGLLKLEGSKEGRKGILNIDAEIFEITPHFHLVELKK  410

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKW  777
            S GDT+EY    +QE+RP+LKDI+W W
Sbjct  411  SDGDTVEYEKLLQQEIRPALKDIVWNW  437



>ref|XP_007205114.1| hypothetical protein PRUPE_ppa004815mg [Prunus persica]
 gb|EMJ06313.1| hypothetical protein PRUPE_ppa004815mg [Prunus persica]
Length=490

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 196/266 (74%), Gaps = 8/266 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP  DSNLMEMYRKI KGDFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVILYVLLAGYLPFHDSNLMEMYRKIGKGDFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL+KILDPNP  RIS++K+M+NSWF+K   Q   I  +     + +P  V  IF
Sbjct  236  SPEVRKLLSKILDPNPKTRISMAKIMQNSWFRKGLVQTPVIAEVP--VKEPAPLDVDAIF  293

Query  361  DDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                 S+ A  S     KP+ LNAFDIIS S  FDLSGLF+  T +K E RFT+ + A T
Sbjct  294  GPSEGSNSAVESKQELAKPSNLNAFDIISYSAGFDLSGLFE-QTEQKKEVRFTSNKTAPT  352

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E+IA     +++K+D G++K++G+ +GRKG L I+ EIFE+TP FH+VEVKK SG
Sbjct  353  IISKLEDIAKRLRLKIKKRDGGLLKMEGSTEGRKGVLGIETEIFEITPFFHLVEVKKCSG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEG  783
            DT+EY+   ++++RP+LKDI+W W+G
Sbjct  413  DTLEYQKVMKKDIRPALKDIVWTWQG  438



>ref|XP_003552306.1| PREDICTED: CBL-interacting protein kinase 2-like [Glycine max]
Length=462

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 201/271 (74%), Gaps = 12/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYV+PEVI ++GYDG KADIWSCGVIL+VLLAG+LP  DSNLMEMYRKI +G+FK PKW 
Sbjct  176  AYVSPEVINRKGYDGMKADIWSCGVILYVLLAGHLPFHDSNLMEMYRKIGRGEFKFPKWL  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             P+V++LL++ILDPNP  RIS++K+ME+SWF+K     KP   I  ++N+E  P     I
Sbjct  236  APDVRRLLSRILDPNPKARISMAKIMESSWFKKGLE--KP--AITVTENEELVPLDADGI  291

Query  358  FDDRSTSDPAG----SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F+      P         KP  LNAFDIIS S  FDLSGLF+ DT  + E+RF +++PAS
Sbjct  292  FEVSENGGPIAKPKQEQAKPCNLNAFDIISFSTGFDLSGLFE-DTVLRKETRFMSKKPAS  350

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK EE+      +V+KKD G++KL+G+K+GRKG L +DAEIFE+TP FH+VE++K +
Sbjct  351  IIISKLEEVCKQLRLKVKKKDGGLLKLEGSKEGRKGTLGVDAEIFEITPHFHMVELRKCN  410

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            GDTMEY+   +Q++RPSLKDI+W W+G EQP
Sbjct  411  GDTMEYQKLFKQDIRPSLKDIVWTWQG-EQP  440



>gb|ABY58261.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 199/267 (75%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS+ K+ +NSWF++ F            +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIVKIKDNSWFKRGFE-----AKFTKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPAS
Sbjct  291  AAFASSDTGVAARKPELVKPQNLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAE+F V PSFH+VEVKKSS
Sbjct  350  AIISKLEDIAKRLRLKVKKKDEGILKLKGSKEGRKGVLSIDAEVFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>gb|KDO49657.1| hypothetical protein CISIN_1g012046mg [Citrus sinensis]
 gb|KDO49658.1| hypothetical protein CISIN_1g012046mg [Citrus sinensis]
 gb|KDO49659.1| hypothetical protein CISIN_1g012046mg [Citrus sinensis]
Length=472

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/270 (58%), Positives = 201/270 (74%), Gaps = 11/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP  DSNLMEMYRKI K +FK P WF
Sbjct  176  AYVAPEVINRRGYDGSKADIWSCGVILYVLLAGYLPFHDSNLMEMYRKIGKAEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             PEV++LL+KILDPNP  RIS++K+MENSWF+K    +KP   I++++  E +P     +
Sbjct  236  APEVRRLLSKILDPNPNTRISMTKIMENSWFRKGL--VKP--SISETEEKEWAPVDADAV  291

Query  358  FDDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F    ++     S     KP  LNAFDIIS S  FDLSGLF+ +  K+ E RFT+ +P S
Sbjct  292  FSPSGSTSTVAESKNELAKPCNLNAFDIISFSAGFDLSGLFE-EREKRKEVRFTSNKPVS  350

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E IA     +V+KKD G++K++G+K+GRKG L +DAEIFE+TP FH+VEVKKSS
Sbjct  351  TIISKLEGIAKLLRLKVKKKDGGLLKIEGSKEGRKGVLGMDAEIFEITPFFHLVEVKKSS  410

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EY+    QE+RP+LKDI+W W+G ++
Sbjct  411  GDTLEYQKVMNQEIRPALKDIVWTWQGEQR  440



>gb|KHN40647.1| CBL-interacting protein kinase 2 [Glycine soja]
Length=462

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 200/271 (74%), Gaps = 12/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AY +PEVI ++GYDG KADIWSCGVIL+VLLAG+LP  DSNLMEMYRKI +G+FK PKW 
Sbjct  176  AYASPEVINRKGYDGMKADIWSCGVILYVLLAGHLPFHDSNLMEMYRKIGRGEFKFPKWL  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             P+V++LL++ILDPNP  RIS++K+ME+SWF+K     KP   I  ++N+E  P     I
Sbjct  236  APDVRRLLSRILDPNPKARISMAKIMESSWFKKGLE--KP--AITVTENEELVPLDADGI  291

Query  358  FDDRSTSDPAG----SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F+      P         KP  LNAFDIIS S  FDLSGLF+ DT  + E+RF +++PAS
Sbjct  292  FEVSENGGPIAKPKQEQAKPCNLNAFDIISFSTGFDLSGLFE-DTVLRKETRFMSKKPAS  350

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK EE+      +V+KKD G++KL+G+K+GRKG L +DAEIFE+TP FH+VE++K +
Sbjct  351  IIISKLEEVCKQLRLKVKKKDGGLLKLEGSKEGRKGTLGVDAEIFEITPHFHMVELRKCN  410

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            GDTMEY+   +Q++RPSLKDI+W W+G EQP
Sbjct  411  GDTMEYQKLFKQDIRPSLKDIVWTWQG-EQP  440



>gb|ABY58260.1| serine-threonine kinase [Persea americana]
 gb|ABY58285.1| serine-threonine kinase [Persea americana]
Length=453

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 198/267 (74%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRK+ K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKVGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LLA+ILDPNP  RIS+ K+ +NSWF++ F            +      + LD  
Sbjct  236  PPEVRRLLARILDPNPNTRISIVKIKDNSWFKRGFE-----AKFTKGETKSKELAPLDTD  290

Query  361  DDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               ++SD   ++     +KP  LNAFDIISLS  FDLSGLF+ DTN + E+RF ++QPA 
Sbjct  291  AAFASSDTGVAARKPELVKPQNLNAFDIISLSAGFDLSGLFE-DTNCRKEARFASKQPAL  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E+IA     +V+KKD G++KL+G+K+GRKG L+IDAEIF V PSFH+VEVKKSS
Sbjct  350  AIISKLEDIAKRLRLKVKKKDEGILKLEGSKEGRKGVLSIDAEIFVVNPSFHLVEVKKSS  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    Q++RP+L DI+W W+G
Sbjct  410  GDTLEYQKLWNQDMRPALTDIVWAWQG  436



>ref|XP_008810573.1| PREDICTED: CBL-interacting protein kinase 18 [Phoenix dactylifera]
Length=450

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 197/271 (73%), Gaps = 14/271 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI KG+FKC  WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKIGKGEFKCSSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P EV+KLL KILDPNP  RIS++K+MEN WF+K F        I +S+ +      +D+ 
Sbjct  236  PSEVRKLLYKILDPNPSTRISIAKIMENPWFRKGFDD-----KIINSEGETQESVTVDVA  290

Query  361  -----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                  + +T +    S++ T LNAFDIISLS  FDLSGLF+ + + + E+RF + QPAS
Sbjct  291  AAFGSSESNTVEGKQESVRVTNLNAFDIISLSAGFDLSGLFE-EGDHRKEARFISMQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E++A     +V+KK DG++K++G+  GR   L +DAEIFEV P FH+VE+KKS+
Sbjct  350  AIISKLEDVARRLKLRVKKKHDGVLKMEGSNGGR--VLGMDAEIFEVAPLFHLVELKKSN  407

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            GDT+EY+   ++++RP+LKDI+W W+G  +P
Sbjct  408  GDTLEYQKLLKEDMRPALKDIVWAWQGDREP  438



>ref|XP_004492544.1| PREDICTED: CBL-interacting protein kinase 18-like [Cicer arietinum]
Length=463

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 206/273 (75%), Gaps = 16/273 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYV+PEVI ++GYDG KADIWSCGVILFVLLAGYLP  D NLMEMYRKI +G+FK PKWF
Sbjct  176  AYVSPEVINRKGYDGSKADIWSCGVILFVLLAGYLPFHDQNLMEMYRKISRGEFKFPKWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLD--  354
             PEV++LL+KILDP P  RIS++K+MENSWF+K     KP+  + +++N+E P S+L   
Sbjct  236  APEVRRLLSKILDPYPKTRISMAKIMENSWFKKGLE--KPV--VIETENNE-PASLLHAD  290

Query  355  -IFD-----DRSTSDPAGSSMKP-TCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQ  513
             +F+     D S ++      KP   LNAFDIIS S  FDLSGLF+ D  ++ E RFT+ 
Sbjct  291  GVFEVSENGDGSIAETKQQQAKPCNNLNAFDIISFSSGFDLSGLFE-DKIQQKEMRFTSN  349

Query  514  QPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
            +PASTI+SK EEI      +V+KKD G+ KL+G+K+GRKG L IDAEIFE+TP FH+VE+
Sbjct  350  KPASTIISKLEEICKCLCLKVKKKDGGLFKLEGSKEGRKGTLNIDAEIFEITPIFHLVEL  409

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            KKS+GDTME++   ++++RP+LKDI+W W+G E
Sbjct  410  KKSNGDTMEFQKLLQEDIRPALKDIVWSWQGEE  442



>ref|XP_006356761.1| PREDICTED: CBL-interacting protein kinase 2-like [Solanum tuberosum]
Length=470

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/269 (57%), Positives = 202/269 (75%), Gaps = 10/269 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP +DSN MEMYRKI K +FK P WF
Sbjct  177  AYVAPEVINRRGYDGAKADIWSCGVILYVLLAGYLPFQDSNFMEMYRKIGKAEFKSPNWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDI-  357
            PP+  +L++KIL+PNP  R+S+SK+MENSWF+K   QLKPI   AD++      ++ D  
Sbjct  237  PPDAHRLISKILNPNPSTRMSISKIMENSWFKKGL-QLKPIN--ADTELKPEEAAIDDAG  293

Query  358  FDDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F    ++D    +    +KP  LNAFDIIS S   DLSGLF+ + +KK E  FT++QPA 
Sbjct  294  FGIGESTDSITEAKPELVKPAHLNAFDIISFSTGVDLSGLFE-ERDKKREVIFTSKQPAK  352

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E++A     +V KKD G++KL+G+K+GRKG L+IDAEIFEVTP+FH VE+KKS+
Sbjct  353  TIISKLEDVARRLTLKVMKKDGGLLKLEGSKEGRKGVLSIDAEIFEVTPNFHFVEMKKSN  412

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            GDT+EY+    +++RP+L+DI+W W+G E
Sbjct  413  GDTIEYKKTMIKDVRPALEDIVWTWQGDE  441



>ref|XP_010921114.1| PREDICTED: CBL-interacting protein kinase 18-like [Elaeis guineensis]
Length=448

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 203/274 (74%), Gaps = 19/274 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG K+DIWSCGVILFVL+AGYLP +D NLMEMYRKI K DFKCP WF
Sbjct  178  AYVAPEVINRKGYDGAKSDIWSCGVILFVLMAGYLPFQDPNLMEMYRKIGKADFKCPSWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF---------TQLKPITPIADSQNDE  333
            P +V++LL +ILDPNP  RIS++K+MEN WF+K           T+ K I P+ D     
Sbjct  238  PSDVRRLLLRILDPNPSTRISIAKIMENPWFRKGLDHDRLLKNETETKEIVPV-DVHAAF  296

Query  334  SPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQ  513
            +P        D ST +      K   LNAFDIISLS  FDLSGLF+ +T+ + E+RFT+ 
Sbjct  297  NP-------SDNSTVEGKQEMGKLANLNAFDIISLSAGFDLSGLFE-ETDHRREARFTSS  348

Query  514  QPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
            +PASTI+SK E++A     +++KKD G++K++G++ GRKG LAIDAEIFE+TPSFH+VE+
Sbjct  349  KPASTIISKLEDMAKRLRLKIKKKDHGVLKMEGSRAGRKGVLAIDAEIFEITPSFHLVEI  408

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            KK++G+T+EY+   ++++RP+LKDI+W W+G ++
Sbjct  409  KKTNGNTLEYQKLLKEDIRPALKDIVWAWQGDKE  442



>ref|XP_008370241.1| PREDICTED: CBL-interacting protein kinase 2 [Malus domestica]
Length=466

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 202/267 (76%), Gaps = 8/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+L+VLLAGYLP  DSNLMEMY+KI KG+FK P WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVVLYVLLAGYLPFHDSNLMEMYKKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV++LL++I+DPNP  R+S++K+M++SWF+K   Q   I  +     + SP  V  IF
Sbjct  236  SPEVRRLLSQIMDPNPNTRVSIAKIMQSSWFRKGLVQKXEIAEVP--MKEPSPLDVDAIF  293

Query  361  ----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                D  S+ +      KP+ LNAFDIIS S  FDLSGLF+  T++K E RFT+ + AST
Sbjct  294  GPNEDSNSSVESXQELSKPSNLNAFDIISYSEGFDLSGLFE-QTDQKKEVRFTSNKTAST  352

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E+IA     +++K+D G++K++G+ +GRKG L+ID EIFE+TP+FH+VEVKKSSG
Sbjct  353  IISKLEDIAKRLKLKIKKRDGGLLKMEGSTEGRKGVLSIDTEIFEITPTFHLVEVKKSSG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEGS  786
            DT+EY+   ++++RP+LKDI+W W+G+
Sbjct  413  DTLEYQKVIKKDIRPALKDIVWTWQGA  439



>ref|XP_004149923.1| PREDICTED: CBL-interacting protein kinase 2-like [Cucumis sativus]
 gb|KGN54440.1| hypothetical protein Csa_4G331090 [Cucumis sativus]
Length=470

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 198/270 (73%), Gaps = 8/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP  D NLMEMY+KI KG+FK P WF
Sbjct  176  AYVAPEVINRRGYDGCKADIWSCGVILYVLLAGYLPFHDPNLMEMYKKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL+KILDPNP  RIS++K+M +SW +++   +KP    A+  N+  P  +  +F
Sbjct  236  APEVRKLLSKILDPNPNTRISIAKIMGSSWLRRELN-VKPQVNTAEEVNEGDPLDLDAVF  294

Query  361  -----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 D  S  D      KP  LNAFDIISLS  FDLSGLF+ + + K E RFT+ +PAS
Sbjct  295  VSTAEDRNSVKDQKPEMEKPLNLNAFDIISLSSGFDLSGLFE-EADLKKEVRFTSNKPAS  353

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK ++IA     +++KKD G++K++G K+GRKG + IDAEIFEVTPSFH+VE+KKS+
Sbjct  354  VIISKLQDIAKCLKLKIKKKDRGLLKIEGCKEGRKGAVCIDAEIFEVTPSFHIVEMKKSN  413

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EYR   +  +RP+LKD++W W+G  +
Sbjct  414  GDTLEYRKIMKDNIRPALKDVVWTWQGEHE  443



>ref|XP_010920246.1| PREDICTED: CBL-interacting protein kinase 5 [Elaeis guineensis]
Length=478

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 200/281 (71%), Gaps = 21/281 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVL+AGYLP  D NL+ MY KI +G+F+CP WF
Sbjct  176  AYVAPEVIHRKGYDGAKADIWSCGVILFVLMAGYLPFNDPNLIIMYGKISRGEFRCPTWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V+KLL+++LDPNP  RI++SKLMENSWF+K F   KP+ P+   +    P S +D+ 
Sbjct  236  PSDVRKLLSRLLDPNPNTRIAMSKLMENSWFRKGF---KPVRPMLQLRGSPYPTSDVDVH  292

Query  361  DDRSTSDPAG----------------SSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKP  492
                 S                    S ++P  LNAFDIIS S  FDLSGLF+ +   K 
Sbjct  293  GCMHGSAFTSDDEEKDEAEEKKKLVMSPLRPCSLNAFDIISRSQGFDLSGLFE-EKVVKA  351

Query  493  ESRFTTQQPASTIVSKFEEIAMSEHFQ-VQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTP  669
            E+RF +Q+PA+ I+SK EEIA  E F+ ++KKDG+VKL+G+K+GRKGQL I+AEIFE++P
Sbjct  352  EARFMSQKPAAVIMSKLEEIAQMERFKMIKKKDGVVKLEGSKKGRKGQLEIEAEIFELSP  411

Query  670  SFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +   VE++K SGDT+EY+ F  QE+RPSLKDI+W W+  +Q
Sbjct  412  ALFWVEMRKLSGDTLEYQKFYHQEMRPSLKDIVWTWQVGDQ  452



>ref|XP_010087068.1| CBL-interacting protein kinase 2 [Morus notabilis]
 gb|EXB25886.1| CBL-interacting protein kinase 2 [Morus notabilis]
Length=448

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 191/268 (71%), Gaps = 10/268 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AY APEV+ ++GYDG KADIWSCGVILFVLLAGYLP  DSNLMEMY+KI K D+KCP WF
Sbjct  176  AYAAPEVLCRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYKKIGKADYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              E +KLL++IL+PNP +RI ++++MEN WF+K F      +    S+      +  D F
Sbjct  236  SHEARKLLSRILNPNPNKRILIARIMENPWFRKVFN-----SQATRSKTGTQELASFDTF  290

Query  361  DDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
             +   SD          KPT LNAF IISLS  FDLSGLF  + ++K   +FT+ +PAS+
Sbjct  291  GNCENSDATLEETQELTKPTNLNAFGIISLSSGFDLSGLF-TENDEKKAVQFTSTRPASS  349

Query  529  IVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            IVSK EE+A +   +V+K  G +K++G+K+GRKG ++I AEI+E TPSFH+VEVKKSSGD
Sbjct  350  IVSKLEEVARNLRLKVKKDKGCLKMEGSKEGRKGTISIQAEIYEFTPSFHLVEVKKSSGD  409

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            T+EY+   E ++RP+LKDI+W W+G + 
Sbjct  410  TLEYKRIMENDIRPALKDIVWAWQGEQN  437



>gb|ABJ91210.1| CBL-interacting protein kinase 2 [Populus trichocarpa]
Length=464

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 193/270 (71%), Gaps = 12/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  D+NLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVIKRKGYDGAKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIDKAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF-----TQLKPITPIADSQNDESPRS  345
            P + +KLL KILDPNP  RIS++++ E+SWF+K       T+       A  +N   P  
Sbjct  236  PTDARKLLRKILDPNPNTRISIAEIKESSWFRKGLPRQSKTETVGREAAALGRNGSGPSE  295

Query  346  VLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 +     +    S KP  LNAFDIISLS  FDLSGLFD D     E+RFT+ QPAS
Sbjct  296  -----NSSVACEAKQESAKPPYLNAFDIISLSAGFDLSGLFD-DKYPNREARFTSAQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             ++SK E+I+     +V KKD G++K++G K+GRKG LAIDAEIFE+TP+FH+VE+KK++
Sbjct  350  VVISKLEDISKCLKLKVMKKDAGLLKMEGMKEGRKGLLAIDAEIFELTPNFHLVELKKTN  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EY+    +++RP+LKDI+W W+GS+ 
Sbjct  410  GDTLEYQKMLNEDIRPALKDIVWLWQGSKN  439



>ref|XP_009414263.1| PREDICTED: CBL-interacting protein kinase 18 [Musa acuminata 
subsp. malaccensis]
Length=444

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 196/263 (75%), Gaps = 5/263 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVL+AGYLP  DSNLMEMYRKI K +FKCP WF
Sbjct  178  AYVAPEVISRKGYDGAKADIWSCGVILFVLMAGYLPFHDSNLMEMYRKIAKAEFKCPCWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V++LL++ILDPNP  RIS++K+MEN WF K   +   I     +Q  + P  + ++F
Sbjct  238  PSDVRRLLSRILDPNPTTRISIAKIMENPWFGKGLDK-GVIRNGEGTQEIDQP-DMNEVF  295

Query  361  DDRSTSDPAGSSM-KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
                T       M K T LNAFDIISLS  FDLSGLF+ +T++K E+RF + + A+TI+S
Sbjct  296  SSPDTDMTEERQMRKLTNLNAFDIISLSAGFDLSGLFE-ETDQKREARFISGKSAATIIS  354

Query  538  KFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            K E++A     +V+K D G++ ++G K GRKG LAIDAEIFEVTPSFH+VE+KK++GDT+
Sbjct  355  KLEDVARFLKLKVKKNDHGVLIMEGTKLGRKGVLAIDAEIFEVTPSFHLVEIKKTNGDTL  414

Query  715  EYRNFCEQELRPSLKDIIWKWEG  783
            EY+    Q +RP+LKDI+W W+G
Sbjct  415  EYQKLWNQGIRPALKDIVWAWQG  437



>ref|XP_008388328.1| PREDICTED: CBL-interacting protein kinase 2-like [Malus domestica]
 ref|XP_008359819.1| PREDICTED: CBL-interacting protein kinase 2-like [Malus domestica]
Length=483

 Score =   302 bits (773),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 200/265 (75%), Gaps = 10/265 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+L+VLLAGYLP  DSNLMEMYRKI KG+FK P WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVVLYVLLAGYLPFHDSNLMEMYRKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             PEV++LL+KI+DPNP  RIS++K+M++SW +K   Q KP+  IA+    E +P  V  I
Sbjct  236  SPEVRRLLSKIMDPNPNTRISIAKIMQSSWCRKGLVQ-KPV--IAEVPMKEPAPLDVDAI  292

Query  358  F----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F    D  S+ +      KP+ LNAFDIIS S  FDLSGLF+  T++K E RFT+ + AS
Sbjct  293  FGANEDSNSSVESKQELSKPSNLNAFDIISYSAGFDLSGLFE-QTDQKKEVRFTSNKTAS  351

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +++K D G++K++G+ +GRKG L I+ EIFE+TPSFH+VEVKKSS
Sbjct  352  TIISKLEDIAKRLKLKIKKWDGGLLKMEGSTEGRKGVLGIETEIFEITPSFHLVEVKKSS  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKW  777
            GDT+EYR   ++++RP+LKDI+W W
Sbjct  412  GDTLEYRKAMKKDIRPALKDIVWTW  436



>ref|XP_004167774.1| PREDICTED: CBL-interacting protein kinase 2-like [Cucumis sativus]
Length=470

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 198/270 (73%), Gaps = 8/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP  D NLMEMY+KI KG+FK P WF
Sbjct  176  AYVAPEVINRRGYDGCKADIWSCGVILYVLLAGYLPFHDPNLMEMYKKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL+KILDPNP  RIS++K+M +SW +++   +KP    A+  N+  P  +  +F
Sbjct  236  APEVRKLLSKILDPNPNTRISIAKIMGSSWLRRELN-VKPQVNTAEEVNEGDPLDLDAVF  294

Query  361  -----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 D  S  D      KP  LNAFDIISLS  FDLSGLF+ + + K E RFT+ +PAS
Sbjct  295  VSTAEDRNSVKDQKPEMEKPLNLNAFDIISLSSGFDLSGLFE-EADLKKEVRFTSNKPAS  353

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK ++IA     +++KKD G++K++G K+GRKG + IDAEIFEVTPSFH+VE+KKS+
Sbjct  354  VIISKLQDIAKCLKLKIKKKDRGLLKIEGCKEGRKGAVCIDAEIFEVTPSFHIVEMKKSN  413

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EYR   +  ++P+LKD++W W+G  +
Sbjct  414  GDTLEYRKIMKDNIKPALKDVVWTWQGEHE  443



>ref|XP_006658129.1| PREDICTED: CBL-interacting protein kinase 2-like [Oryza brachyantha]
Length=444

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 192/268 (72%), Gaps = 22/268 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  D NLM+MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
              +V++LL +ILDPNP  RIS+ K+MEN WF+K           Q K   PIAD   D  
Sbjct  237  TTDVRRLLLRILDPNPSTRISMEKIMENPWFRKGLDAKLLRYNQQAKDAIPIADMNTD--  294

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
                   FD  S+S       KP+ LNAFDIISLS   DLSG+F+ ++N+K ES+FT+  
Sbjct  295  -------FDSLSSSPTL--EKKPSNLNAFDIISLSTGLDLSGMFE-ESNQK-ESKFTSTS  343

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTI+SK E+IA     ++ KKD G++K++G+K GRKG + IDAEIFEVTP+FH+VE+K
Sbjct  344  TASTIISKIEDIAKGLRLKLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEVTPNFHLVELK  403

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKW  777
            K++GDT+EYR    QE+RP+LKDI+W W
Sbjct  404  KTNGDTLEYRKLLNQEMRPALKDIVWAW  431



>ref|XP_002439570.1| hypothetical protein SORBIDRAFT_09g013580 [Sorghum bicolor]
 gb|ACQ83509.1| CBL-interacting protein kinase 15 [Sorghum bicolor]
 gb|EES18000.1| hypothetical protein SORBIDRAFT_09g013580 [Sorghum bicolor]
Length=431

 Score =   300 bits (768),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 197/266 (74%), Gaps = 16/266 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG K D WSCGVILFVL+AGYLP +DSNLMEMYRKI K DFKCP WF
Sbjct  179  AYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWF  238

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V+KL+++ILDPNP  R+ ++K++E  WF+K               +++  R  ++I 
Sbjct  239  PSDVRKLVSRILDPNPRTRMPITKIVECFWFKKGI-------------DNKLIRKNMEIK  285

Query  361  DDRST-SDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
               S  ++      K T LNAFDIISLS  F+LSGLFD D+ K+ E+RFT+ QPASTI+S
Sbjct  286  GKVSALTNVKQDVTKVTNLNAFDIISLSEGFNLSGLFD-DSEKRKETRFTSSQPASTIIS  344

Query  538  KFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            K E++A      V+KK+ G++K++G  +GRKG L+IDAEIFEVTPSFH+VE+KK++GDT+
Sbjct  345  KLEDVATCSKLTVKKKEGGVLKMKGENEGRKGVLSIDAEIFEVTPSFHLVEIKKNNGDTI  404

Query  715  EYRNFCEQELRPSLKDIIWKWEGSEQ  792
            EY N  +QE++P+LKDI+W W+G  +
Sbjct  405  EYENLFKQEMKPALKDIVWAWQGERR  430



>ref|XP_010520185.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
[Tarenaya hassleriana]
Length=483

 Score =   301 bits (772),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 197/264 (75%), Gaps = 5/264 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKAEFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQK--DFTQLKPITPIADSQNDESPRSVLD  354
             PEV++LL K+LDPN   RI+++K+ E+SWF+K   F Q K    + +  + E+  S   
Sbjct  236  APEVRRLLCKMLDPNSETRITIAKIKESSWFRKGLHFKQKKMEKQVKEMSSTEAGASGPS  295

Query  355  IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
                R T +    +++P+ +NAFDIISLS  FDLSGLF+ D   K E+RFT+++PAS I+
Sbjct  296  ENGGRETEENH-EAVQPSNMNAFDIISLSAGFDLSGLFE-DVYNKQEARFTSREPASVII  353

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK EE A     +++K+D G+ KL+  K+GRKG L+IDAEIF+VTP+FH VEVKKS+GDT
Sbjct  354  SKLEEAAKRLKLKIRKRDAGLFKLERLKEGRKGILSIDAEIFQVTPTFHFVEVKKSNGDT  413

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            +EY+   +++LRP+L DI+W W+G
Sbjct  414  LEYQKLVKEDLRPALADIVWVWQG  437



>ref|XP_008782631.1| PREDICTED: CBL-interacting protein kinase 18-like [Phoenix dactylifera]
Length=445

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 201/273 (74%), Gaps = 18/273 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG K+DIWSCGVILFVL+AGYLP  D NLMEMYRKI K +FK P WF
Sbjct  178  AYVAPEVINRKGYDGAKSDIWSCGVILFVLMAGYLPFHDPNLMEMYRKIGKAEFKFPNWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
            P +V++LL +ILDPNP  RIS++K+MEN WF+K          T+ K I P+ D      
Sbjct  238  PSDVRRLLLRILDPNPSTRISIAKIMENPWFRKGLDKRPLKNETETKEIVPV-DGNAVSK  296

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            P        + +T +      K   LNAFDIISL+  FDLSGLF+ DT+ + E+RF++ +
Sbjct  297  P-------SEDNTVEGKQEMGKLANLNAFDIISLAAGFDLSGLFE-DTDHRREARFSSSK  348

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PASTI+SK E+IA     +V+KKD G++K++G+K+GRKG LAIDAEIFE+TPSFH+VE+K
Sbjct  349  PASTIISKLEDIAKRLRLKVKKKDGGVLKMEGSKEGRKGVLAIDAEIFEITPSFHLVEIK  408

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            K++GDT+EY+   +Q++RP+LKDI+W W+G +Q
Sbjct  409  KTNGDTLEYQKLLKQDIRPALKDIVWAWQGDKQ  441



>ref|XP_008245119.1| PREDICTED: CBL-interacting protein kinase 2 [Prunus mume]
Length=508

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 196/265 (74%), Gaps = 10/265 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP  DSNLMEMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVILYVLLAGYLPFHDSNLMEMYRKIGKADFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLD-I  357
             PEV+KLL+KILDPNP  RIS++K+M+NSWF+K   Q KP+  IA+    E     +D I
Sbjct  236  SPEVRKLLSKILDPNPKTRISMAKIMQNSWFRKGLVQ-KPV--IAEVPVKEPAHLDVDAI  292

Query  358  FDDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F     S+ A  S     KP+ LNAFDIIS S  FDLSGLF+  T +K E RFT+ + A 
Sbjct  293  FGPSEGSNSAVESKQELAKPSNLNAFDIISYSAGFDLSGLFE-QTEQKKEVRFTSNKTAP  351

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +++K+D G++K++G+ +GRKG L I+ EIFE+TP FH+VEVKK S
Sbjct  352  TIISKLEDIAKRLRLKIKKRDGGLLKMEGSTEGRKGVLGIETEIFEITPFFHLVEVKKCS  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKW  777
            GDT+EY+   ++++RP+LKDI+W W
Sbjct  412  GDTLEYQKVMKKDIRPALKDIVWTW  436



>ref|XP_008464264.1| PREDICTED: CBL-interacting protein kinase 2 [Cucumis melo]
Length=468

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/270 (57%), Positives = 198/270 (73%), Gaps = 8/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP  D NLMEMY+KI KG+FK P WF
Sbjct  176  AYVAPEVINRRGYDGCKADIWSCGVILYVLLAGYLPFHDPNLMEMYKKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+KLL+KILDPNP  RIS++K+M +SW +++F  +K     A+   +  P  V  +F
Sbjct  236  APEVRKLLSKILDPNPNTRISIAKIMGSSWLRREFN-VKAQVNAAEEVKEGDPLDVDAVF  294

Query  361  ----DDR-STSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                DDR S  D      KP  LNAFDIISLS  FDLSGLF+ + + K E RFT+ +PAS
Sbjct  295  VSAADDRDSVKDQKPEMEKPLNLNAFDIISLSSGFDLSGLFE-EADLKKEVRFTSNKPAS  353

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK ++IA     +++KKD G++K++G  +GRKG + IDAEIFEVTPSFH+VE+KKS+
Sbjct  354  MIISKLQDIAKCLKLKIKKKDRGLLKIEGCNEGRKGAVCIDAEIFEVTPSFHIVEMKKSN  413

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EYR   +  +RP+LKD++W W+G  +
Sbjct  414  GDTLEYRKIMKDNIRPALKDVVWTWQGEHE  443



>ref|XP_004962438.1| PREDICTED: CBL-interacting protein kinase 18-like isoform X1 
[Setaria italica]
Length=459

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 198/273 (73%), Gaps = 11/273 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG K D WSCGVILFVL+AGYLP +DSNLMEMYRKI K DFKCP WF
Sbjct  179  AYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWF  238

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V+KL+++ILDPNP  R+ ++K++E  WF+K     K I    + +   S  + +D+ 
Sbjct  239  PSDVRKLVSRILDPNPRTRMPITKIVECFWFKKGLDS-KLIRKNIEMKGKVSALTHVDVV  297

Query  361  DDRSTSDPAGSSM--------KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
               + S    + M        K T LNAFDIISLS  F+LS LF+ +T K+ E+RFT+ Q
Sbjct  298  FASTGSSSGNNKMVDEKQDAAKVTNLNAFDIISLSEGFNLSALFE-ETEKRKEARFTSSQ  356

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTI+SK E++A      V+KK+ G++K++G  +GRKG L+IDAEIFEVTPSFH+VE+K
Sbjct  357  SASTIISKLEDVATCSKLTVKKKEGGVLKMEGESEGRKGVLSIDAEIFEVTPSFHLVEIK  416

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            K++GDT+EY N  +Q+++P+LKDI+W W+G  Q
Sbjct  417  KNNGDTLEYENLFKQDMKPALKDIVWAWQGERQ  449



>ref|XP_007011240.1| CBL-interacting protein kinase 10 [Theobroma cacao]
 gb|EOY20050.1| CBL-interacting protein kinase 10 [Theobroma cacao]
Length=450

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 187/265 (71%), Gaps = 9/265 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP  DSNL+ MYRKI K D+K P WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILYVLLAGYLPFHDSNLIAMYRKISKADYKFPGWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV KLL++IL+PNP  RIS++K+M N WF+K F       P+      E     +D  
Sbjct  236  SPEVTKLLSRILNPNPKARISIAKIMSNPWFKKGFNS----KPVQRKAEKELAHVDIDAV  291

Query  361  DDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                T+  A  +     K T LNAFDIISLS  FDLSGLF  + +KK + +FT+   AST
Sbjct  292  FGSETNHIAFEAKKDMAKLTNLNAFDIISLSSGFDLSGLF-AENDKKKDVQFTSMHTAST  350

Query  529  IVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            I SK E+IA     +V+K  G++KL+G+  GRKG LAIDAEIFE TPSFH+VE++KSSGD
Sbjct  351  ITSKLEDIAQHLKLKVKKDGGLLKLEGSNGGRKGALAIDAEIFEFTPSFHLVELRKSSGD  410

Query  709  TMEYRNFCEQELRPSLKDIIWKWEG  783
            T+E+R   +Q++RP+LKDI+W W+G
Sbjct  411  TLEFRKTLQQDVRPALKDIVWAWQG  435



>ref|XP_008653467.1| PREDICTED: CBL-interacting protein kinase 2 [Zea mays]
 tpg|DAA64116.1| TPA: putative CBL-interacting protein kinase family protein isoform 
1 [Zea mays]
 tpg|DAA64117.1| TPA: putative CBL-interacting protein kinase family protein isoform 
2 [Zea mays]
Length=451

 Score =   299 bits (765),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 192/267 (72%), Gaps = 10/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  D NLM+MY+KI K DFKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIEKADFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDI-  357
              +V++LL +ILDPNP RRIS+ K+MEN WF+K    L       D QN  +P    +  
Sbjct  237  STDVRRLLQRILDPNPSRRISMEKIMENPWFRKG---LGAKLLRYDLQNKNAPHVDKNAD  293

Query  358  FDDRS----TSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            FD  S    T        KP  +NAFDIISLS   DLSGLF+ ++NKK ES+FT+   +S
Sbjct  294  FDSLSANITTESKQHEEKKPINMNAFDIISLSTGLDLSGLFE-ESNKKRESKFTSTNTSS  352

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA +    + KKD G++K++ +K GRKG + IDAE+FEV+P+FH+VE+KK++
Sbjct  353  TIISKIEDIAKNLRLNLTKKDGGLLKMEASKPGRKGVMGIDAEVFEVSPNFHLVEIKKTN  412

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    QE+RP+LK+I+W W+G
Sbjct  413  GDTLEYQKVLNQEMRPALKEIVWAWQG  439



>emb|CDP04063.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   300 bits (768),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 193/268 (72%), Gaps = 12/268 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KAD+WSCGVILFVLL+GYLP  DSNLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADVWSCGVILFVLLSGYLPFHDSNLMEMYRKIGKAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITP------IADSQNDESPR  342
            PPEV++LL +ILDPNP  RIS++K+ ++ WF+      K + P      +A S  D   R
Sbjct  236  PPEVRRLLLRILDPNPSTRISIAKIKDHPWFKGGLNS-KLVKPNIENKEVASSSTDAGTR  294

Query  343  SVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
            S+ +    R+T D     +  T LNAFDIIS S  FDLS LF+ ++++K E+RFT+ QPA
Sbjct  295  SLEN--SSRAT-DGTQDLLALTNLNAFDIISFSAGFDLSRLFE-ESSRKKEARFTSWQPA  350

Query  523  STIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            + I+SK EE+A     +  K+D G+ KL+G K+GRKG L+IDAEIFEVTP FH+VE+KKS
Sbjct  351  AVIISKLEEVAKRLKLKTTKRDRGLFKLEGKKEGRKGILSIDAEIFEVTPEFHLVEMKKS  410

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            SGDT+EY    +  LRP L+DI+W W+G
Sbjct  411  SGDTLEYLKILDDGLRPGLQDIVWVWQG  438



>ref|XP_011041811.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
[Populus euphratica]
Length=455

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 192/267 (72%), Gaps = 12/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  D+NLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVIKRKGYDGAKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIDKAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF-----TQLKPITPIADSQNDESPRS  345
            P + +KLL KILDPNP  RIS++++ME+SWF+K       T+ +     +  +N   P  
Sbjct  236  PTDARKLLRKILDPNPNTRISIAEIMESSWFRKGLPRQSKTETEGREAASLGRNGSGPSE  295

Query  346  VLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 +     +    S KP  LNAFDIISLS  FDLSGLFD D     E+RFT+ Q AS
Sbjct  296  -----NSSVACEAKQESAKPPYLNAFDIISLSAGFDLSGLFD-DKYPNREARFTSAQLAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             ++SK E+I+     +V KKD G++K++G K+GRKG LAIDAEIFE+TP+FH+VE+KK++
Sbjct  350  VVISKLEDISKCLKLKVMKKDAGLLKMEGMKEGRKGLLAIDAEIFELTPNFHLVELKKTN  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+    +++RP+LKDI+W W+G
Sbjct  410  GDTLEYQKILNEDIRPALKDIVWLWQG  436



>gb|KDP45725.1| hypothetical protein JCGZ_17332 [Jatropha curcas]
Length=458

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 192/262 (73%), Gaps = 4/262 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDGEKADIWSCGV+L+VLLAGYLP  DSNLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVIGRKGYDGEKADIWSCGVVLYVLLAGYLPFHDSNLMEMYRKIGKAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFT--QLKPITPIADSQNDESPRSVLD  354
            PPE ++LL K+LDPNP  RIS++K+ E++WF+K     Q K      D  + E   S   
Sbjct  236  PPEARRLLFKMLDPNPDSRISMAKIKESAWFKKGLNSKQKKTEAESRDVNHLERSGSGPS  295

Query  355  IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
               + S+      S+KP  LNAFDIISLS  FDLSGLF+ + ++  E+RFT+ QPAS I+
Sbjct  296  RTSNVSSEAKQEESVKPPILNAFDIISLSAGFDLSGLFE-EKSRLKEARFTSVQPASVII  354

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E++A     ++ KKD G++K+ G K+GRKG L+IDAEIFEVTP+FH+VEVK+S GDT
Sbjct  355  SKLEDVAKHLSLKITKKDAGLLKMVGLKEGRKGPLSIDAEIFEVTPNFHLVEVKQSGGDT  414

Query  712  MEYRNFCEQELRPSLKDIIWKW  777
            +EY    +++++P+L DI+W W
Sbjct  415  LEYHKILKEDIKPALDDIVWIW  436



>ref|XP_009373129.1| PREDICTED: CBL-interacting protein kinase 2-like [Pyrus x bretschneideri]
Length=491

 Score =   300 bits (767),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 199/264 (75%), Gaps = 8/264 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+L+VLLAGYLP  DSNLMEMY+KI KG+FK P WF
Sbjct  176  AYVAPEVIDRKGYDGAKADIWSCGVVLYVLLAGYLPFHDSNLMEMYKKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV+ LL+KI+DPNP  RIS++K+M++SWF+K   Q   I  +     + SP  V  IF
Sbjct  236  SPEVRSLLSKIMDPNPNTRISIAKIMQSSWFRKGLVQKPEIAEVP--MKEPSPLDVDAIF  293

Query  361  ----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
                D  S+ +      KP+ LNAFDIIS S  FDLSGLF+  T++K E RFT+ + AST
Sbjct  294  GPNEDSNSSVESKQELSKPSNLNAFDIISYSAGFDLSGLFE-QTDQKKEVRFTSNKMAST  352

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E+IA     +++K+D G++K++G+ +GRKG L+IDAEIFE+TP+FH+VEVKKSSG
Sbjct  353  IISKLEDIAKRLKLKIKKRDGGLLKMEGSTEGRKGVLSIDAEIFEITPTFHLVEVKKSSG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKW  777
            DT+EY+   ++++RP+LKDI+W W
Sbjct  413  DTLEYQKVIKKDIRPALKDIVWTW  436



>ref|XP_006431989.1| hypothetical protein CICLE_v10001000mg [Citrus clementina]
 ref|XP_006431990.1| hypothetical protein CICLE_v10001000mg [Citrus clementina]
 ref|XP_006468164.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
isoform X1 [Citrus sinensis]
 ref|XP_006468165.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
isoform X2 [Citrus sinensis]
 gb|ESR45229.1| hypothetical protein CICLE_v10001000mg [Citrus clementina]
 gb|ESR45230.1| hypothetical protein CICLE_v10001000mg [Citrus clementina]
Length=479

 Score =   299 bits (766),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 195/270 (72%), Gaps = 21/270 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDGEK DIWSCGV+LFVLLAGYLP  DSNL+EMYRKI K +FKCP WF
Sbjct  180  AYVAPEVINRKGYDGEKVDIWSCGVVLFVLLAGYLPFHDSNLIEMYRKIGKAEFKCPNWF  239

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV+KLL KILDPNP  RIS++K+ E+SWF+K   Q K    + +S++  S        
Sbjct  240  PPEVRKLLCKILDPNPSTRISMAKIRESSWFRKGMNQ-KQKQKVTESKDAAS--------  290

Query  361  DDRSTSDPAGSSMKPT----------CLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
             D   S P GSS               LNAFDIISLS  FDLSG FD +   + E+RFT+
Sbjct  291  QDAGASAPQGSSSIAAEIKQELGQLPNLNAFDIISLSAGFDLSGFFDENPLIR-EARFTS  349

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVE  687
            ++PAS I+SK EEIA S   ++ KKD G++K +G K+GRKG +++DAEIF++TP+FH+VE
Sbjct  350  KRPASVIISKLEEIAKSLRLKMMKKDGGLLKFEGLKEGRKGIVSMDAEIFQITPNFHLVE  409

Query  688  VKKSSGDTMEYRNFCEQELRPSLKDIIWKW  777
            +KKS+GDT+EY+   + ++RP+L+DI+W W
Sbjct  410  MKKSNGDTLEYKKLLKDDIRPALQDIVWVW  439



>ref|XP_006279537.1| hypothetical protein CARUB_v10028322mg [Capsella rubella]
 gb|EOA12435.1| hypothetical protein CARUB_v10028322mg [Capsella rubella]
Length=472

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/282 (53%), Positives = 197/282 (70%), Gaps = 28/282 (10%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPI--------  312
             PEV++LL K+LDPNP  RI+++++ E+SWF+K           ++K +  +        
Sbjct  236  APEVRRLLCKMLDPNPETRITIARIRESSWFRKGLHMKQKKMEKRIKEMNSVEAGVAGPS  295

Query  313  ----ADSQNDESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDT  480
                  S+N E PR   D   + + +D      +PT LNAFDII+LS  FDL+GLF  D 
Sbjct  296  ENGAGPSENGEGPRENGDRVTEENDTD------EPTNLNAFDIIALSAGFDLAGLFG-DV  348

Query  481  NKKPESRFTTQQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIF  657
              K ESRFT+Q+PAS I+SK EE+A      ++K++ G+ KL+  K+GRKG L++DAEIF
Sbjct  349  YNKRESRFTSQKPASVIISKLEEVAQRLKLSIRKREAGLFKLERLKEGRKGILSMDAEIF  408

Query  658  EVTPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            +VTP+FH+VEVKKS+GDT+EY+    ++LRP+L DI+W W+G
Sbjct  409  QVTPTFHLVEVKKSNGDTLEYQKLVAEDLRPALSDIVWVWQG  450



>gb|EYU20111.1| hypothetical protein MIMGU_mgv1a006672mg [Erythranthe guttata]
Length=435

 Score =   298 bits (762),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 194/265 (73%), Gaps = 9/265 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI++RGYDG KADIWSCGVILFVLLAGYLP  DSNLMEMYRKI +G++KCP WF
Sbjct  176  AYVAPEVISRRGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISRGEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEVK+LL++ILDPNP  RIS++++MEN WF+K     K +  + D +    P  V+++ 
Sbjct  236  PPEVKRLLSRILDPNPKSRISIARIMENPWFRKGLNTSKKVG-VLDVEKLPEPSEVVNVV  294

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
            + +          KP+ LNAFDIISLS  FDLSGLF V  ++K E +FT+ +   TI+SK
Sbjct  295  ETKM------ELAKPSNLNAFDIISLSAGFDLSGLF-VSNDEKDEFQFTSVKSPCTILSK  347

Query  541  FEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
            FEEI  +   ++ KKD G ++L+G+ +G+ G L+ID EIFE+ P FH+VEVKK SGD+++
Sbjct  348  FEEIGANVGLKMTKKDRGSLRLEGSNEGKNGNLSIDIEIFEIGPVFHLVEVKKCSGDSID  407

Query  718  YRNFCEQELRPSLKDIIWKWEGSEQ  792
            YR    ++++P + +I+W W+G +Q
Sbjct  408  YRCLMRRDIKPKIGEIVWAWQGEQQ  432



>gb|KDO49766.1| hypothetical protein CISIN_1g011694mg [Citrus sinensis]
Length=479

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 195/270 (72%), Gaps = 21/270 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDGEK DIWSCGV+LFVLLAGYLP  DSNL+EMYRKI K +FKCP WF
Sbjct  180  AYVAPEVINRKGYDGEKVDIWSCGVVLFVLLAGYLPFHDSNLIEMYRKIGKAEFKCPNWF  239

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV+KLL KILDPNP  RIS++K+ E+SWF+K   Q K    + +S++  S        
Sbjct  240  PPEVRKLLCKILDPNPSTRISMAKIRESSWFRKGMNQ-KQKQKVTESKDAAS--------  290

Query  361  DDRSTSDPAGSSMKPT----------CLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
             D   S P GSS               LNAFDIISLS  FDLSG FD +   + E+RFT+
Sbjct  291  QDAGASAPQGSSSIAAEIKQELGQLPNLNAFDIISLSAGFDLSGFFDENPLIR-EARFTS  349

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVE  687
            ++PAS I+SK EEIA S   ++ KKD G++K +G K+GRKG +++DAEIF++TP+FH+VE
Sbjct  350  KRPASVIISKLEEIAKSLRLKMMKKDGGLLKFEGLKEGRKGIVSMDAEIFQITPNFHLVE  409

Query  688  VKKSSGDTMEYRNFCEQELRPSLKDIIWKW  777
            +KKS+GDT+EY+   + ++RP+L+DI+W W
Sbjct  410  MKKSNGDTLEYKKLLKDDIRPALQDIVWVW  439



>ref|NP_001265903.1| CBL-interacting protein kinase [Solanum lycopersicum]
 ref|XP_010321289.1| PREDICTED: CBL-interacting protein kinase isoform X1 [Solanum 
lycopersicum]
 dbj|BAL03610.1| CBL-interacting protein kinase [Solanum lycopersicum]
Length=440

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 200/269 (74%), Gaps = 11/269 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP +DSNLME+YRKI + +FKCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFQDSNLMEIYRKIKQAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LL+KILDPNP  RIS++K+ E+SWF+K F     +T +     +E  +  LD  
Sbjct  236  PPEVRRLLSKILDPNPRTRISIAKIKESSWFKKGFESRNTVTKV-----EEKEKFSLDAN  290

Query  361  DDRSTSDPAGSS---MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               ++  P+ S    +KPT LNAFDIISLS  FDLSGLF +  ++K + +F + +P S+I
Sbjct  291  ATHNSISPSVSKLELLKPTNLNAFDIISLSSGFDLSGLF-ITKDQKEDLQFISAKPTSSI  349

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK EE+  +   +V KK+ G ++L+G+ +GR   L+IDAEI E+TPSFH+VE+KKS GD
Sbjct  350  MSKLEEVGRNLKLEVMKKEAGFMRLEGSSEGRYETLSIDAEISEITPSFHLVELKKSYGD  409

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
             +EY+   +Q +RP+L++I+W W+G EQP
Sbjct  410  KVEYQKLLKQVIRPALEEIVWAWQG-EQP  437



>ref|XP_007017047.1| SOS3-interacting protein 1 [Theobroma cacao]
 gb|EOY34666.1| SOS3-interacting protein 1 [Theobroma cacao]
Length=473

 Score =   298 bits (764),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 198/272 (73%), Gaps = 22/272 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG  ADIWSCGV+L+VLL GYLP  DSNLMEMYRKI + +F+ P WF
Sbjct  176  AYVAPEVINRKGYDGAAADIWSCGVVLYVLLTGYLPFHDSNLMEMYRKIGRAEFRYPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPE ++L++K+LDPNP  RIS+SK+  +SWF+K           A+ +  E+    + + 
Sbjct  236  PPEARRLVSKMLDPNPTTRISMSKIRGSSWFKKGLN--------AEQKKPETENGQVSV-  286

Query  361  DDRSTSDPAGS----------SMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
             D   S P G+          S++P  +NAFDIISLS  FDLSGLF+   ++K E+RFT+
Sbjct  287  -DMGASGPCGTSNVDAETKQESVQPPNINAFDIISLSAGFDLSGLFE-GMSQKRETRFTS  344

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVE  687
            +QPAS I+SK EE A     +V+KKD G++K++G K+GRKG L++DAEIF+VTP+FH+VE
Sbjct  345  RQPASVIISKLEEAARRLRLKVKKKDAGLLKMEGLKEGRKGILSVDAEIFQVTPTFHLVE  404

Query  688  VKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            +KKS+GDT+EY+   ++E+RP+L+DI+W W+G
Sbjct  405  IKKSNGDTLEYQKILKEEMRPALQDIVWVWQG  436



>ref|XP_004302573.1| PREDICTED: CBL-interacting protein kinase 2-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 198/267 (74%), Gaps = 9/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  D+NLME+YRKI KG+FK P WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHDANLMELYRKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV++LL+KI DPNP  RISLSK+M++SWF+K   Q   I  +     + +P     IF
Sbjct  236  TPEVRRLLSKIFDPNPNTRISLSKVMQSSWFRKGLVQKPAIVELP--VKELAPLDADSIF  293

Query  361  ---DDRSTSDPAGSSM--KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
               +D ++   A   +  KP+ LNAFDIIS S  FDLSGLF+ +  +K E RFT+ + AS
Sbjct  294  GPGEDNNSVTEAKQELVQKPSNLNAFDIISYSAGFDLSGLFE-EAEQKKEVRFTSNKTAS  352

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +++KKD G+++++G+ +GRKG L I+ EIFE+TPSFH+VEVKKSS
Sbjct  353  TIISKLEDIAKRLKLKIKKKDGGLLRMEGSTEGRKGVLGIETEIFEITPSFHLVEVKKSS  412

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY+   ++E+RP LKDIIW W+G
Sbjct  413  GDTLEYQKVMKKEVRPGLKDIIWTWQG  439



>ref|XP_002326078.2| CBL-interacting protein kinase 2 [Populus trichocarpa]
 gb|EEF00460.2| CBL-interacting protein kinase 2 [Populus trichocarpa]
Length=456

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 189/265 (71%), Gaps = 12/265 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  D+NLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVIKRKGYDGAKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIDKAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF-----TQLKPITPIADSQNDESPRS  345
            P + +KLL KILDPNP  RIS++++ E+SWF+K       T+       A  +N   P  
Sbjct  236  PTDARKLLRKILDPNPNTRISIAEIKESSWFRKGLPRQSKTETVGREAAALGRNGSGPSE  295

Query  346  VLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 +     +    S KP  LNAFDIISLS  FDLSGLFD D     E+RFT+ QPAS
Sbjct  296  -----NSSVACEAKQESAKPPYLNAFDIISLSAGFDLSGLFD-DKYPNREARFTSAQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             ++SK E+I+     +V KKD G++K++G K+GRKG LAIDAEIFE+TP+FH+VE+KK++
Sbjct  350  VVISKLEDISKCLKLKVMKKDAGLLKMEGMKEGRKGLLAIDAEIFELTPNFHLVELKKTN  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKW  777
            GDT+EY+    +++RP+LKDI+W W
Sbjct  410  GDTLEYQKMLNEDIRPALKDIVWLW  434



>ref|XP_009371993.1| PREDICTED: CBL-interacting protein kinase 2 [Pyrus x bretschneideri]
Length=483

 Score =   297 bits (761),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 200/267 (75%), Gaps = 10/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KAD+WSCGV+L+VLLAGYLP  DSNLMEMYRKI KG+FK P WF
Sbjct  176  AYVAPEVINRKGYDGAKADVWSCGVVLYVLLAGYLPFHDSNLMEMYRKIGKGEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             PEV++LL+KI+DPNP  RIS++K+M++SW +K   Q KP+  IA+    E +P  V  I
Sbjct  236  SPEVRRLLSKIMDPNPNTRISIAKIMQSSWCRKGLVQ-KPV--IAEVPMKEPAPLDVDAI  292

Query  358  F----DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F    D  S+ +      KP+ LNAFDIIS S  FDLSGLF+  T++K E RFT+ +  S
Sbjct  293  FGANEDSNSSVESKQQLSKPSNLNAFDIISYSAGFDLSGLFE-QTDQKKEVRFTSNKTVS  351

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E+IA     +++K+D G++K++G+ +GRKG L I+ EIFE+TPSFH+VEVKKSS
Sbjct  352  TIISKLEDIAKRLKLKIKKRDGGLLKMEGSTEGRKGVLGIETEIFEITPSFHLVEVKKSS  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY    +++ RP+LKDI+W W+G
Sbjct  412  GDTLEYHKAMKKDFRPALKDIVWTWQG  438



>ref|XP_006401087.1| hypothetical protein EUTSA_v10013486mg [Eutrema salsugineum]
 ref|XP_006401088.1| hypothetical protein EUTSA_v10013486mg [Eutrema salsugineum]
 ref|XP_006401089.1| hypothetical protein EUTSA_v10013486mg [Eutrema salsugineum]
 gb|ESQ42540.1| hypothetical protein EUTSA_v10013486mg [Eutrema salsugineum]
 gb|ESQ42541.1| hypothetical protein EUTSA_v10013486mg [Eutrema salsugineum]
 gb|ESQ42542.1| hypothetical protein EUTSA_v10013486mg [Eutrema salsugineum]
Length=458

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/263 (56%), Positives = 195/263 (74%), Gaps = 6/263 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI + +FK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGRAEFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFT--QLKPITPIADSQNDESPRSVLD  354
            PPEV++LL K+LDPNP  RI+++K+ E+SWF+K     Q K    + ++ + E+  +   
Sbjct  236  PPEVRRLLCKMLDPNPETRIAIAKIRESSWFRKGLHMKQKKMEKRVNETNSVEAGAAGPS  295

Query  355  IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
               DR T +    + +PT LNAFDII+LS  FDL+GLF  D   K ESRFT+Q+PAS I+
Sbjct  296  ENGDRVTEE--NHTDQPTNLNAFDIIALSAGFDLAGLFG-DLYDKRESRFTSQKPASVII  352

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK EE+A      ++K++ G+ KL+  K+GRKG L++DAEIF+VTP+FH+VEVKKS+GDT
Sbjct  353  SKLEEVAQRLKLSIRKREAGLFKLESLKEGRKGILSMDAEIFQVTPTFHMVEVKKSNGDT  412

Query  712  MEYRNFCEQELRPSLKDIIWKWE  780
            +EY+    ++LRP+L DI+W W+
Sbjct  413  LEYQKLVAEDLRPALADIVWVWQ  435



>ref|XP_009122380.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 2 
[Brassica rapa]
 ref|XP_009122381.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 2 
[Brassica rapa]
 emb|CDX70006.1| BnaA10g23550D [Brassica napus]
Length=465

 Score =   296 bits (758),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 194/273 (71%), Gaps = 14/273 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFT--------QLKPITPIADSQNDES  336
             PE K+LL K+LDPN   RIS++++ E+SWF+K           QL+  T I   +  ES
Sbjct  236  APEAKRLLCKMLDPNHESRISIARIRESSWFRKGLHLKQKKMDKQLRETTVIPTVEVGES  295

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S  +  D      PA    +   LNAFDIISLS  FDL GLF  D N K ESRF +++
Sbjct  296  SGSSSENGDSLHEEAPA----QLAYLNAFDIISLSAGFDLGGLFG-DANDKRESRFASRK  350

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PA+ I+SK EE+A   + +++K+D G+ KL+G+K+GRKG L++DAEIF+VT +FH+VEVK
Sbjct  351  PAAEIISKLEEVARGLNLKIRKQDAGLFKLEGSKEGRKGALSMDAEIFQVTQTFHLVEVK  410

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            K  GDT+EY+   E++LRP+L D++W W+G ++
Sbjct  411  KCDGDTVEYQRLVEEDLRPALGDVVWVWQGDKE  443



>gb|AGW15605.1| CBL-interacting protein kinase [Populus tomentosa]
Length=464

 Score =   296 bits (757),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 190/265 (72%), Gaps = 12/265 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  D+NLMEMY+KI K +FKCP WF
Sbjct  176  AYVAPEVIKRKGYDGAKADIWSCGVVLFVLLAGYLPFHDTNLMEMYKKIDKAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF-----TQLKPITPIADSQNDESPRS  345
            P + +KLL KILDPNP  RIS++++ E+SWF+K       T+ +     +  +N   P  
Sbjct  236  PTDARKLLRKILDPNPNTRISIAEIKESSWFRKGLPRQSKTETEGREAASLGRNGSGPSE  295

Query  346  VLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 +     +    S KP  LNAFDIISLS  FDLSGLFD D     E+RFT+ QPAS
Sbjct  296  -----NSNVACEAKQESAKPPYLNAFDIISLSAGFDLSGLFD-DKYPNREARFTSAQPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             ++SK E+I+     +V KKD G++K++G K+GRKG LAIDAEIFE+TP+FH+VE+KK++
Sbjct  350  VVISKLEDISKCLKLKVMKKDAGLLKMEGMKEGRKGLLAIDAEIFELTPNFHLVELKKTN  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKW  777
            GDT+EY+    +++RP+LKDI+W W
Sbjct  410  GDTLEYQKILNKDIRPALKDIVWLW  434



>ref|XP_002520844.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF41553.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=457

 Score =   295 bits (756),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 194/264 (73%), Gaps = 7/264 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVIL+VLLAG+LP  D+NL+ +YRKI K ++K P WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILYVLLAGFLPFHDANLILLYRKISKAEYKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDES---PRSVL  351
             PEV+KLL+KILDPNP  RIS++K+MENSWF+K FT  K      D Q  +S     + L
Sbjct  236  SPEVRKLLSKILDPNPTTRISIAKIMENSWFRKGFTA-KVFPARNDVQKFDSLVTDTTFL  294

Query  352  DIFDDRSTSDPAGSSM-KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
              +++ +T+      + KPT LNAFDIISLS  F+LSG F  +  +K E+ FT+   A+T
Sbjct  295  VPYENHTTTAENKKELGKPTSLNAFDIISLSSGFNLSGFFSRNYQEK-ETTFTSVHSATT  353

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E+ A     +V+KK  G++KL+G+K GRKG L+IDAEIFE TPSFH+VEVKKS G
Sbjct  354  IISKIEDTARDLRLEVKKKHGGLLKLEGSKGGRKGALSIDAEIFEFTPSFHLVEVKKSGG  413

Query  706  DTMEYRNFCEQELRPSLKDIIWKW  777
            DT+EY +  E+ LRP+LKDI+W W
Sbjct  414  DTLEYLHILEEGLRPALKDIVWVW  437



>ref|XP_010937988.1| PREDICTED: CBL-interacting protein kinase 18-like [Elaeis guineensis]
Length=446

 Score =   295 bits (755),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 193/270 (71%), Gaps = 18/270 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVL+AGYLP  D NLMEMYRKI K +FKCP WF
Sbjct  178  AYVAPEVIGRKGYDGAKADIWSCGVILFVLMAGYLPFHDPNLMEMYRKIGKAEFKCPNWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
            P +V++LL +ILDPNP  RIS++K+ EN WF++           + K I P AD     +
Sbjct  238  PSDVRRLLLRILDPNPSTRISIAKIKENPWFRRGLDRRLLEGDVETKEIVP-ADVNAAFN  296

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
            P          +T +      K + LNAFDIISLS  FDLSGLF+ +T+ + E+RF + Q
Sbjct  297  PSG-------DNTVEGKQEMGKLSNLNAFDIISLSAGFDLSGLFE-ETDHRREARFISSQ  348

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PASTI SK E+ A     +V+KKD G++K++G++ GRKG L IDAEIFEVTP FH+VE+K
Sbjct  349  PASTIFSKLEDTANRLRLKVKKKDSGVLKMEGSRAGRKGVLEIDAEIFEVTPFFHLVEIK  408

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            +++GDT+EY+   +Q++RP+LKDI+W W+G
Sbjct  409  RANGDTLEYQKMLKQDIRPALKDIVWAWQG  438



>ref|XP_007033570.1| SOS3-interacting protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007033571.1| SOS3-interacting protein 1 isoform 1 [Theobroma cacao]
 gb|EOY04496.1| SOS3-interacting protein 1 isoform 1 [Theobroma cacao]
 gb|EOY04497.1| SOS3-interacting protein 1 isoform 1 [Theobroma cacao]
Length=469

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 199/270 (74%), Gaps = 10/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGY P  DSNLMEMYRKI KG+FK PKWF
Sbjct  176  AYVAPEVINRRGYDGCKADIWSCGVILYVLLAGYPPFHDSNLMEMYRKIGKGEFKYPKWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             PEV K L+KILDPNP  RIS++K+M+N WF+K    L P   + D++  E +P +V  +
Sbjct  236  SPEVCKFLSKILDPNPSTRISMAKIMDNPWFRKG---LGPKPELLDAEVKEPAPLNVDTV  292

Query  358  FD-DRSTSDPAGSSM---KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            F+ + S +   G      KP  LNAFDIIS S  FDLS LF+     K E RFT+ + AS
Sbjct  293  FNLNESNATVVGEKQELRKPCNLNAFDIISFSAGFDLSSLFEEKETMK-EVRFTSNKAAS  351

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI++K E+IA     +++KKD G++K++G ++GRKG L IDAEIFE+TP FH+VEVKKSS
Sbjct  352  TIITKLEDIAKRLKLKIKKKDGGLLKIEGFREGRKGVLGIDAEIFEITPFFHLVEVKKSS  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EY+N  +Q++RP+L DI+W W+G +Q
Sbjct  412  GDTLEYQNVIKQDIRPALSDIVWTWQGEQQ  441



>gb|AGT16994.1| CBL-interacting protein kinase [Saccharum hybrid cultivar R570]
Length=449

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 196/268 (73%), Gaps = 8/268 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  D NLM+MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIGKAEFKCPCWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V++LL +ILDPNP  RIS+ K+MEN WF+K     K +     ++N        D F
Sbjct  237  STDVRRLLLRILDPNPSTRISMEKIMENPWFRKGLDA-KLLRYNLQTKNAPQVDKNAD-F  294

Query  361  DDRSTSDPAGSSM----KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
            D  ST+  + S      KPT +NAFD+ISLS   DLSGLF+ +++KK ES+FT+   +ST
Sbjct  295  DSLSTNITSESKQQEEKKPTNMNAFDLISLSTGLDLSGLFE-ESDKKRESKFTSINTSST  353

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E++A +   +V KKD G++K++ +K GRKG + IDAEIFEV+P+FH+VE+KK++G
Sbjct  354  IISKIEDVAKNLRLKVAKKDGGLLKMEASKPGRKGVMGIDAEIFEVSPNFHLVEIKKTNG  413

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            DT+EY+    QE+RP+LKDI+W W+G +
Sbjct  414  DTLEYQKVLNQEMRPALKDIVWAWQGEQ  441



>gb|KFK25099.1| hypothetical protein AALP_AA8G066200 [Arabis alpina]
Length=451

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 195/267 (73%), Gaps = 16/267 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEVK+LL K+LDPN   RI++SK+ E+SWF+K   QLK        + ++  R      
Sbjct  236  APEVKRLLCKMLDPNHESRITISKIKESSWFRKGL-QLK------QKRMEKEIREA----  284

Query  361  DDRSTSDPAGSSMKPTC--LNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             + + S P+ +   P    LNAFDII LS  FDL+GLF  + N K ESRF +++PAS I+
Sbjct  285  -NSADSGPSENYEAPQLANLNAFDIIGLSAGFDLAGLFR-NGNDKRESRFGSRKPASEII  342

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK EE++ S   +++K+D G+ KL+G+ +GRKG L+IDAEIF+VT SFH+VEVKK +GDT
Sbjct  343  SKLEEVSKSLKLKIRKQDAGLFKLEGSNEGRKGVLSIDAEIFQVTQSFHLVEVKKCNGDT  402

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +EY+   E++LRP+L DI+W W+G ++
Sbjct  403  IEYQKLVEEDLRPALADIVWVWQGEKE  429



>ref|XP_010483437.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
[Camelina sativa]
Length=488

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 195/282 (69%), Gaps = 28/282 (10%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPI--------  312
             PEVK+LL K+LDPNP  RI+++K+ E+SWF+K           ++K +  +        
Sbjct  236  APEVKRLLCKMLDPNPETRITIAKIRESSWFRKGLHMKQKRMEKRVKEMNSVEAGVAGPS  295

Query  313  ----ADSQNDESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDT  480
                  S+N   P    D   + + +D      +PT LNAFDII+LS  FDL+GLF  D 
Sbjct  296  ESGAGPSENGAGPSENGDRVTEENHTD------EPTNLNAFDIIALSAGFDLAGLFG-DV  348

Query  481  NKKPESRFTTQQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIF  657
            + K ESRFT+Q+PAS I+S  EE+A      ++K++ G+ KL+  K+GRKG L++DAEIF
Sbjct  349  HNKRESRFTSQKPASVIISTLEEVAQRLKLSIRKREAGLFKLERLKEGRKGILSMDAEIF  408

Query  658  EVTPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            +VTP+FH+VEVKKS+GDT+EY+    ++LRP+L DI+W W+G
Sbjct  409  QVTPTFHLVEVKKSNGDTLEYQKLVAEDLRPALSDIVWVWQG  450



>emb|CDY70046.1| BnaA10g29660D [Brassica napus]
Length=461

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 195/269 (72%), Gaps = 18/269 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI KGDFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKGDFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
             PEV++LL K+LDPNP  RI+++K+ E+SWF+K           +++   P+  S    S
Sbjct  236  APEVRRLLCKMLDPNPETRITIAKIRESSWFRKGLHMKQKKMEKRVRETNPLEASAAGPS  295

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
                      R T +   ++ +PT +NAFDII+ S  FDL+GLF  D   K ESRFT+Q+
Sbjct  296  ENG------GRVTEE--NNTDQPTSINAFDIIASSSGFDLTGLFG-DVYDKRESRFTSQK  346

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PAS I+SK EE+A      ++K++ G+ KL+ +K+GRKG+L++DAEIF+VTP+FH+VE+K
Sbjct  347  PASVIISKLEEVAQRLKLSIRKREAGLFKLETSKEGRKGKLSMDAEIFQVTPTFHMVEMK  406

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWE  780
            KS+GDT+EY+   +++LRP+L DI+W W+
Sbjct  407  KSNGDTLEYQKLVKEDLRPALADIVWVWQ  435



>gb|AGQ43462.1| CBL-interacting protein kinase 2 [Nitraria tangutorum]
Length=447

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 199/267 (75%), Gaps = 7/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I  +GYDG ++DIWSCGVIL+VLLAGYLPL DSNLM MYRKI KGD+  P WF
Sbjct  177  AYVAPEIIRGKGYDGAESDIWSCGVILYVLLAGYLPLHDSNLMAMYRKISKGDYAIPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPI---TPIADSQNDESPRSVL  351
              +V+KLL +ILDPNP  R+SL+K+M+N WF+K     KPI   T + +S   +  ++++
Sbjct  237  STDVRKLLTRILDPNPKTRVSLAKIMDNPWFKKRLNS-KPIEAKTEVNESLPLDGDKALV  295

Query  352  DIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               +D + ++P    +KP  +NAFDIISLS  FDLSGLF V+ N+K E++FTT  PAS I
Sbjct  296  PPKND-AINEPKRELIKPAKMNAFDIISLSTGFDLSGLF-VENNQKGEAKFTTTLPASNI  353

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK E+IA      V KK+ GM+KL+  ++GRKG L+IDA+I+E++ SFH+VE+KK++GD
Sbjct  354  ISKLEDIARELRLHVTKKERGMLKLERLEEGRKGGLSIDADIYELSSSFHLVEMKKAAGD  413

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSE  789
            T+EY    +Q++RP+L+DI+W W+G E
Sbjct  414  TLEYHIMLKQDIRPALEDIVWAWQGEE  440



>ref|XP_006365327.1| PREDICTED: CBL-interacting protein kinase 18-like [Solanum tuberosum]
Length=445

 Score =   293 bits (750),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 200/269 (74%), Gaps = 6/269 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP +DSNLME+YRKI + +FKCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFQDSNLMEIYRKIKQAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQ--NDESPRSVLD  354
            PPEV+KLL+KILDPNP  RIS++K+ E+SWF+K       +T + + +  + ++  ++ D
Sbjct  236  PPEVRKLLSKILDPNPRTRISIAKIKESSWFKKGLESRNAVTKVEEKEKFSLDANATIQD  295

Query  355  IFDDR-STSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               +  S S      +KP+ LNAFDIISLS  FDLSGLF +  ++K + +F + +PAS+I
Sbjct  296  CTHNSISPSVSKLELLKPSNLNAFDIISLSSGFDLSGLF-ITKDQKEDLQFISAKPASSI  354

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK EE+      +V KK+ G ++L+G+ +GR G L+ID EI E+TPSFH+VE+KKS GD
Sbjct  355  ISKLEEVGRYLKLEVMKKEAGSMRLEGSGEGRYGTLSIDTEISEITPSFHLVELKKSYGD  414

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
             +EY+   +Q +RP+L++I+W W+G EQP
Sbjct  415  KVEYQKMLKQVIRPALEEIVWTWQG-EQP  442



>ref|XP_009120348.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
[Brassica rapa]
Length=462

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 195/269 (72%), Gaps = 18/269 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI KGDFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKGDFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
             PEV++LL K+LDPNP  RI+++K+ E+SWF+K           +++   P+  S    S
Sbjct  236  APEVRRLLCKMLDPNPETRITIAKIKESSWFRKGLHMKQKKMEKRVRETNPLEASAAGPS  295

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
                      R T +   ++ +PT +NAFDII+ S  FDL+GLF  D   K ESRFT+Q+
Sbjct  296  ENG------GRVTEE--NNTDQPTSINAFDIIASSSGFDLTGLFG-DVYDKRESRFTSQK  346

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PAS I+SK EE+A      ++K++ G+ KL+ +K+GRKG+L++DAEIF+VTP+FH+VE+K
Sbjct  347  PASVIISKLEEVAQRLKLSIRKREAGLFKLETSKEGRKGKLSMDAEIFQVTPTFHMVEMK  406

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWE  780
            KS+GDT+EY+   +++LRP+L DI+W W+
Sbjct  407  KSNGDTLEYQKLVKEDLRPALADIVWVWQ  435



>gb|AGA37199.1| CBL-interacting protein kinase 10.1 [Brassica napus]
Length=462

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 195/269 (72%), Gaps = 18/269 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI KGDFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKGDFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
             PEV++LL K+LDPNP  RI+++K+ E+SWF+K           +++   P+  S    S
Sbjct  236  APEVRRLLCKMLDPNPETRITIAKIKESSWFRKGLHMKQKKMEKRVRETNPLEASAAGPS  295

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
                      R T +   ++ +PT +NAFDII+ S  FDL+GLF  D   K ESRFT+Q+
Sbjct  296  ENG------GRVTEE--NNTDQPTSINAFDIIASSSGFDLTGLFG-DVYDKRESRFTSQK  346

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PAS I+SK EE+A      ++K++ G+ KL+ +K+GRKG+L++DAEIF+VTP+FH+VE+K
Sbjct  347  PASVIISKLEEVAQRLKLSIRKREAGLFKLETSKEGRKGKLSMDAEIFQVTPTFHMVEMK  406

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWE  780
            KS+GDT+EY+   +++LRP+L DI+W W+
Sbjct  407  KSNGDTLEYQKLVKEDLRPALADIVWVWQ  435



>ref|XP_010032938.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 2 
isoform X2 [Eucalyptus grandis]
Length=392

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 192/269 (71%), Gaps = 6/269 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI   DFKCP WF
Sbjct  123  AYVAPEVIGQKGYDGAKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGSADFKCPSWF  182

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++L+ KILDPNP  RIS++K+ E+SWF+K     K I    +++ D+         
Sbjct  183  PPEVRRLIRKILDPNPSMRISIAKIKESSWFRKGLISDKQIMRKMENR-DKGVVQSSSSS  241

Query  361  DDRSTSDPAGSSM---KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               S+  P  S     KP  LNAFDIIS S  FDLS LF+ + + + E RFT++QPAS I
Sbjct  242  SSESSGIPNKSKAEHEKPPYLNAFDIISFSAGFDLSRLFE-EFSPQREERFTSRQPASVI  300

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK  EIA     +V KK+ G++KL+  K+GRKG L IDAEIFE+T SFH++E+KK+SGD
Sbjct  301  LSKLHEIANCFRLKVMKKEMGLLKLEWTKEGRKGILGIDAEIFEITRSFHLIELKKASGD  360

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            TMEY+   + ++RP+L+DI+W W+G + P
Sbjct  361  TMEYKKAIKDDIRPALEDIVWVWQGEQHP  389



>ref|XP_010443564.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
[Camelina sativa]
 ref|XP_010443565.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
[Camelina sativa]
Length=467

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/282 (52%), Positives = 195/282 (69%), Gaps = 28/282 (10%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPI--------  312
             PEVK+LL K+LDPNP  RI+++K+ E+SWF+K           ++K +  +        
Sbjct  236  APEVKRLLCKMLDPNPETRITIAKIRESSWFRKGLHMKQKRMEKRVKEMNSVEAGVAGPS  295

Query  313  ----ADSQNDESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDT  480
                  S+N   P    +   + + +D      +PT LNAFDII+LS  FDL+GLF  D 
Sbjct  296  ENGAGPSENGAGPSENGERVTEENHTD------EPTNLNAFDIIALSAGFDLAGLFG-DV  348

Query  481  NKKPESRFTTQQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIF  657
            + K ESRFT+Q+PAS I+S  EE+A      ++K++ G+ KL+  K+GRKG L++DAEIF
Sbjct  349  HNKRESRFTSQKPASVIISTLEEVAQRLKLSIRKREAGLFKLERLKEGRKGILSMDAEIF  408

Query  658  EVTPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            +VTP+FH+VEVKKS+GDT+EY+    ++LRP+L DI+W W+G
Sbjct  409  QVTPTFHLVEVKKSNGDTLEYQKLVAEDLRPALSDIVWVWQG  450



>ref|XP_010650780.1| PREDICTED: CBL-interacting protein kinase 11 isoform X1 [Vitis 
vinifera]
 ref|XP_010650781.1| PREDICTED: CBL-interacting protein kinase 11 isoform X1 [Vitis 
vinifera]
 ref|XP_010650782.1| PREDICTED: CBL-interacting protein kinase 11 isoform X1 [Vitis 
vinifera]
 ref|XP_010650783.1| PREDICTED: CBL-interacting protein kinase 11 isoform X1 [Vitis 
vinifera]
Length=448

 Score =   293 bits (750),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 191/261 (73%), Gaps = 4/261 (2%)
 Frame = +1

Query  4    YVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWFP  183
            YVAPEVI K+GYDG KADIWSCGV+LFVLLAGYLP  DSNL+EMYRKI K +FKCP WF 
Sbjct  177  YVAPEVINKKGYDGAKADIWSCGVVLFVLLAGYLPFHDSNLIEMYRKISKAEFKCPNWFS  236

Query  184  PEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--TQLKPITPIADSQNDESPRSVLDI  357
            P+V++LL KILDPNP  RIS++K+ E+SWF++     Q+K  T   D    ++  +    
Sbjct  237  PDVRRLLQKILDPNPNTRISIAKIKESSWFRRGLKSKQIKSETGSKDMAPLDTDAASGPC  296

Query  358  FDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
              +   S+      KPT LNAFDIIS+S  FDLSGLF+    KK ++ FT ++PA+ I+S
Sbjct  297  KSNGMASEAKQELAKPTNLNAFDIISISAGFDLSGLFEEPCQKK-KAIFTFRKPAAVIIS  355

Query  538  KFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            + EEIA     +V KKD G +K +G K+G+KG L+IDAEIFEVTPSFH+VEVKKS+GDT+
Sbjct  356  RLEEIAKHLRLKVMKKDAGFMKFEGLKEGKKGILSIDAEIFEVTPSFHLVEVKKSNGDTL  415

Query  715  EYRNFCEQELRPSLKDIIWKW  777
            EY+   ++++RP+L+DI+W W
Sbjct  416  EYQKLLKEDIRPALQDIVWTW  436



>emb|CDY43857.1| BnaC09g33860D [Brassica napus]
Length=461

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 191/261 (73%), Gaps = 2/261 (1%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI KGDFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKGDFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV++LL K+LDPNP  RI+++K+ E++WF+K     +        + +    S     
Sbjct  236  APEVRRLLCKMLDPNPETRITIAKIRESTWFRKGLHMKQKKMEKRVRETNPLEASAAGPS  295

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
            ++        ++ +PT +NAFDII+ S  FDL+GLF  D   K ESRFT+Q+PAS I+SK
Sbjct  296  ENGGRVTEGNNTDQPTSINAFDIIASSAGFDLTGLFG-DVYDKRESRFTSQKPASVIISK  354

Query  541  FEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             EE+A      ++K++ G+ KL+ +K+GRKG+L++DAEIF+VTP+FH+VE+KKS+GDT+E
Sbjct  355  LEEVAQRLKLSIRKREAGLFKLETSKEGRKGKLSMDAEIFQVTPTFHMVEMKKSNGDTLE  414

Query  718  YRNFCEQELRPSLKDIIWKWE  780
            Y+   +++LRP+L DI+W W+
Sbjct  415  YQKLVKEDLRPALADIVWVWQ  435



>ref|XP_006289352.1| hypothetical protein CARUB_v10002839mg [Capsella rubella]
 gb|EOA22250.1| hypothetical protein CARUB_v10002839mg [Capsella rubella]
Length=455

 Score =   293 bits (750),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/272 (55%), Positives = 196/272 (72%), Gaps = 16/272 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEVK+LL K+LDPN   RI+++K+ E+SWF+K   QLK        + ++  R V ++ 
Sbjct  236  APEVKRLLCKMLDPNHETRITIAKIKESSWFRKGL-QLK------QKKMEKMERQVREVA  288

Query  361  D----DRSTSDPAGSSMKP---TCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
            +    + S  +  G S +P     LNAFDII+LS  FDL GLF  D   K ESRF +++P
Sbjct  289  NPMEAEGSGRNENGESHEPPQLASLNAFDIIALSTGFDLVGLFG-DLYDKRESRFASRKP  347

Query  520  ASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            AS I+SK EE+A     +++K+D G+ KL+  K+GRKG L +DAEIF+VTP+FH+VEVKK
Sbjct  348  ASEIISKLEEVAKCLKLKIRKQDAGLFKLERLKEGRKGILRMDAEIFQVTPTFHLVEVKK  407

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
             +GDT+EY+   E++LRP+L DI+W W+G ++
Sbjct  408  CNGDTLEYQKLVEEDLRPALADIVWVWQGEKE  439



>ref|XP_007218015.1| hypothetical protein PRUPE_ppa005839mg [Prunus persica]
 gb|EMJ19214.1| hypothetical protein PRUPE_ppa005839mg [Prunus persica]
Length=441

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 202/271 (75%), Gaps = 13/271 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEV+ ++ YDGEKADIWSCGVIL+VLLAG LP  D+NL++MY+KI K ++KCP WF
Sbjct  176  AYVAPEVVGRKAYDGEKADIWSCGVILYVLLAGCLPFHDTNLIQMYKKIGKAEYKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDI-  357
              EV+KLL++IL+PNP +RI +S +ME+ WF+K F+  K IT I + +     R+++D+ 
Sbjct  236  SVEVRKLLSRILNPNPNKRILISNVMESPWFRKGFSS-KSITTITEVE----KRALVDVD  290

Query  358  --FDDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
              FD+  +SD    +     +PT LNAFDIISLS  FDLSGLF +  + K E++FT+ Q 
Sbjct  291  AAFDNCDSSDHNTEAKQELARPTNLNAFDIISLSSGFDLSGLF-MGKDTKKEAQFTSVQS  349

Query  520  ASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            AS+I+SK E+IA     +V K  G++KL+ +K GRKG L+I+ EIFE TPSF++VE+KKS
Sbjct  350  ASSIISKLEDIAQQLRLKVNKDGGLLKLEKSKDGRKGALSIETEIFEFTPSFYLVEMKKS  409

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +GDT+E++   ++++RP+LKDI+W W+G E+
Sbjct  410  NGDTLEFKKILKEDIRPALKDIVWAWQGEEK  440



>ref|XP_004958692.1| PREDICTED: CBL-interacting protein kinase 2-like isoform X1 [Setaria 
italica]
Length=450

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 190/264 (72%), Gaps = 8/264 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  D NLM+MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V++LL +ILDPNP  RIS+ K+MEN WF+K       +        D  P  +   F
Sbjct  237  STDVRRLLQRILDPNPSTRISMEKIMENPWFRKGLNA--KLLRYNLQTKDAPPLDMNADF  294

Query  361  DDRSTSDPAGS----SMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
            D  ST     S    + KP  +NAFDIISLS   DLSG+F+ +++KK ES+FT+   +ST
Sbjct  295  DSVSTIANTESKQQEAKKPINMNAFDIISLSTGLDLSGMFE-ESDKKRESKFTSTNTSST  353

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I+SK E++A S   ++ KKD G++K++G+K GRKG + IDAEIFEV+P+FH+VE+KK++G
Sbjct  354  IISKIEDVAKSLRLKLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEVSPNFHLVEIKKANG  413

Query  706  DTMEYRNFCEQELRPSLKDIIWKW  777
            DT+EY+    QE+RP+LKDI+W W
Sbjct  414  DTLEYQKVLNQEMRPALKDIVWAW  437



>ref|NP_001268196.1| CBL-interacting protein kinase 11 [Vitis vinifera]
 gb|ACQ83527.1| CBL-interacting protein kinase 11 [Vitis vinifera]
Length=437

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 189/261 (72%), Gaps = 15/261 (6%)
 Frame = +1

Query  4    YVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWFP  183
            YVAPEVI K+GYDG KADIWSCGV+LFVLLAGYLP  DSNL+EMYRKI K +FKCP WF 
Sbjct  177  YVAPEVINKKGYDGAKADIWSCGVVLFVLLAGYLPFHDSNLIEMYRKISKAEFKCPNWFS  236

Query  184  PEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--TQLKPITPIADSQNDESPRSVLDI  357
            P+V++LL KILDPNP  RIS++K+ E+SWF++     Q+K  T       D +P      
Sbjct  237  PDVRRLLQKILDPNPNTRISIAKIKESSWFRRGLKSKQIKSET----GSKDMAPL-----  287

Query  358  FDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
              D   +       KPT LNAFDIIS+S  FDLSGLF+    KK ++ FT ++PA+ I+S
Sbjct  288  --DTDAASAKQELAKPTNLNAFDIISISAGFDLSGLFEEPCQKK-KAIFTFRKPAAVIIS  344

Query  538  KFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            + EEIA     +V KKD G +K +G K+G+KG L+IDAEIFEVTPSFH+VEVKKS+GDT+
Sbjct  345  RLEEIAKHLRLKVMKKDAGFMKFEGLKEGKKGILSIDAEIFEVTPSFHLVEVKKSNGDTL  404

Query  715  EYRNFCEQELRPSLKDIIWKW  777
            EY+   ++++RP+L+DI+W W
Sbjct  405  EYQKLLKEDIRPALQDIVWTW  425



>ref|XP_004485907.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Cicer arietinum]
Length=426

 Score =   292 bits (747),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/264 (53%), Positives = 193/264 (73%), Gaps = 16/264 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG+KADIWSCGV+L+VLLAG+LP  + NLMEMY+KI K DFK P+WF
Sbjct  176  AYVAPEVIRKKGYDGDKADIWSCGVVLYVLLAGFLPFNEKNLMEMYKKITKADFKFPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKP--ITPIADSQNDESPRSVLD  354
              +VK+LL +ILDPNP  RIS+ K+M+NSWF K + Q++   + P++ ++         D
Sbjct  236  RSDVKRLLYRILDPNPRTRISIDKIMQNSWFLKGYNQIEAPKLPPLSPTRG--------D  287

Query  355  IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
            I+D  +  +     MKP C NAFD+ISLS  F+LSGLF+ D N++  +RF T++P S +V
Sbjct  288  IWDVHNVFN-----MKPYCFNAFDLISLSSGFNLSGLFEKDMNERENARFATKRPPSIVV  342

Query  535  SKFEEIA-MSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK EEIA +   F+V KK+G+++L+G + G   QL+ID EIFEVT SF++VE+ K +G+T
Sbjct  343  SKLEEIAQIDGRFKVMKKNGIIRLEGTETGLNDQLSIDTEIFEVTSSFYIVEINKIAGET  402

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            +EYR F +  L+PSL +I+W W+G
Sbjct  403  LEYRKFWDHYLKPSLNEIVWVWQG  426



>gb|EMS54742.1| CBL-interacting protein kinase 2 [Triticum urartu]
Length=452

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 187/270 (69%), Gaps = 14/270 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP +D NLM MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFQDKNLMNMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
              ++++LL +ILDPNP  RIS+ ++ME+ WF+K           Q K   P AD      
Sbjct  237  SSDIRRLLLRILDPNPSTRISIERIMEHPWFRKGLDAKLLRYNLQAKDAVPAADMTATSD  296

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S      + +T      + K   LNAFDIISLS   DLSG+F+ D +KK ES+FT+  
Sbjct  297  SLSC----SNSATEGKEQEAKKLANLNAFDIISLSTGLDLSGMFE-DNDKKRESKFTSTN  351

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTIVSK E+IA     ++ KKD GM++++  K GRKG ++IDAEIFEVTP FH+VE+K
Sbjct  352  SASTIVSKIEDIAKCMRLKLVKKDGGMLRMESFKAGRKGVMSIDAEIFEVTPDFHLVELK  411

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            K++GDT+EY+    QE+RP+LKDI+W W+G
Sbjct  412  KTNGDTLEYQKVLNQEMRPALKDIVWAWQG  441



>ref|XP_009608924.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana tomentosiformis]
 ref|XP_009608931.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana tomentosiformis]
Length=483

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 192/261 (74%), Gaps = 7/261 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP  DSNLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILYVLLAGYLPFHDSNLMEMYRKIGKSEFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LL ++LDPNP  RIS++K+ E+SWF++     K I    + ++  S  + L   
Sbjct  236  PPEVRRLLVRMLDPNPHTRISIAKIKESSWFKRGIAS-KSIKADTERKDLASACTELAAG  294

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
               +  D A    + + LNAFDIISLS  FDLS LF+ DT  K E+RFT+ +PAS I+SK
Sbjct  295  SSENKQDMA----RLSNLNAFDIISLSTGFDLSRLFE-DTPLKKEARFTSCKPASVIISK  349

Query  541  FEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             E++A     +V K+D G+++ +G+K+GRKG L+ID EIFEVTP+F++VEVKKS+GDT+E
Sbjct  350  LEDVAKRLKLKVSKRDAGLLRFEGSKEGRKGILSIDTEIFEVTPTFYLVEVKKSNGDTLE  409

Query  718  YRNFCEQELRPSLKDIIWKWE  780
            Y+    + LRP L+DI+W W+
Sbjct  410  YQKILNEGLRPGLQDIVWAWQ  430



>ref|XP_004294743.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
[Fragaria vesca subsp. vesca]
Length=468

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 198/266 (74%), Gaps = 10/266 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KAD+WSCGV+L+VLLAGYLP  DSNLMEMYRKI K +F+CP WF
Sbjct  182  AYVAPEVINRKGYDGVKADVWSCGVVLYVLLAGYLPFHDSNLMEMYRKIGKAEFRCPNWF  241

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKD-FTQLKPITPIADSQNDESPRSVLDI  357
             PE ++LL K+LDPNP  RI+L+K+ E+SWF++   ++ K + P A   +  S       
Sbjct  242  SPEARRLLCKMLDPNPNTRITLAKVRESSWFRRGPKSKEKEVAPAATEASSPSEN-----  296

Query  358  FDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
             ++    +    S +P+ LNAFDIISLS  FDLSGLF+ ++  + E+RFT+++PA+ I+S
Sbjct  297  -ENNLAVEANQESGRPSNLNAFDIISLSDGFDLSGLFEKNSLSR-EARFTSRKPATVIIS  354

Query  538  KFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            K EE+A     +V KKD G++K+   ++GRKG L+IDAEIFE+TP+FH+VEVKKS+GDTM
Sbjct  355  KLEEMAKYLKLKVNKKDHGLLKMDRLQEGRKGFLSIDAEIFEITPNFHLVEVKKSNGDTM  414

Query  715  EYRNFCEQELRPSLKDIIWKWEGSEQ  792
            EY+   E ++RP+L+DI+W W+G ++
Sbjct  415  EYQQMLE-DIRPALRDIVWVWQGEQE  439



>ref|XP_009387685.1| PREDICTED: CBL-interacting protein kinase 18-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 197/270 (73%), Gaps = 12/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEV+ ++GYDG KADIWSCGVILFVL+AGYLP  D NL+EMYRKI K +F+CP WF
Sbjct  178  AYVAPEVLCRKGYDGAKADIWSCGVILFVLMAGYLPFHDPNLIEMYRKIGKAEFRCPNWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V+KLL++ILDPNP  RIS++K+M N WF+K              + D+S     D  
Sbjct  238  PLDVRKLLSRILDPNPTSRISIAKIMGNPWFRKGLDGGLIRNGKGTQEIDQS-----DTN  292

Query  361  DDRST-----SDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            DD S+     S+      K   LNAFDIISLS  F+LSGLF+ +T+ K E+RF + QPAS
Sbjct  293  DDISSPGTNVSEERREMGKLANLNAFDIISLSAGFNLSGLFE-ETDHKREARFISCQPAS  351

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK E++A     +V+KKD G++K++G  QGRKG LAIDAEIFEVTP+FH+VE+KK++
Sbjct  352  TIISKLEDVAKFLKLKVKKKDHGVLKMEGTTQGRKGVLAIDAEIFEVTPAFHMVEIKKTN  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EY+   ++++RP+LKDI+W W G +Q
Sbjct  412  GDTLEYQKTWKRDIRPALKDIVWAWHGEQQ  441



>ref|XP_010032933.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
isoform X1 [Eucalyptus grandis]
 ref|XP_010032934.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
isoform X1 [Eucalyptus grandis]
 ref|XP_010032935.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
isoform X1 [Eucalyptus grandis]
 ref|XP_010032936.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
isoform X1 [Eucalyptus grandis]
 ref|XP_010032937.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
isoform X1 [Eucalyptus grandis]
 gb|KCW52439.1| hypothetical protein EUGRSUZ_J01840 [Eucalyptus grandis]
Length=445

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 192/269 (71%), Gaps = 6/269 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI   DFKCP WF
Sbjct  176  AYVAPEVIGQKGYDGAKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGSADFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++L+ KILDPNP  RIS++K+ E+SWF+K     K I    +++ D+         
Sbjct  236  PPEVRRLIRKILDPNPSMRISIAKIKESSWFRKGLISDKQIMRKMENR-DKGVVQSSSSS  294

Query  361  DDRSTSDPAGSSM---KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               S+  P  S     KP  LNAFDIIS S  FDLS LF+ + + + E RFT++QPAS I
Sbjct  295  SSESSGIPNKSKAEHEKPPYLNAFDIISFSAGFDLSRLFE-EFSPQREERFTSRQPASVI  353

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK  EIA     +V KK+ G++KL+  K+GRKG L IDAEIFE+T SFH++E+KK+SGD
Sbjct  354  LSKLHEIANCFRLKVMKKEMGLLKLEWTKEGRKGILGIDAEIFEITRSFHLIELKKASGD  413

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            TMEY+   + ++RP+L+DI+W W+G + P
Sbjct  414  TMEYKKAIKDDIRPALEDIVWVWQGEQHP  442



>gb|AGK91199.1| CIPK2 [Brachypodium distachyon]
Length=446

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 191/270 (71%), Gaps = 21/270 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAG LP  D NLM MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGQLPFHDKNLMNMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
              ++++LL +ILDPNP  RIS+ K+MEN WF+K           Q K   P+  S   E+
Sbjct  237  STDIRRLLLRILDPNPSTRISIEKIMENPWFRKGLDAKLLRYNLQAKDAVPVDMSLASEA  296

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
                  + + +   +      KPT LNAFDIISLS   DLSGLF+ + +KK ES+FT+  
Sbjct  297  ------MMEGKLQEEK-----KPTNLNAFDIISLSTGLDLSGLFE-EPDKKSESKFTSTS  344

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTI+SK E+ A S   ++ KKD G++K++G+K GRKG ++IDAEIFEVTPSFH+VE+K
Sbjct  345  TASTILSKIEDTAKSLRLKLTKKDGGLLKMEGSKPGRKGVMSIDAEIFEVTPSFHLVELK  404

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            K++GDT+EY+    QE+RP+LKDI+W W+G
Sbjct  405  KANGDTLEYQKVLNQEMRPALKDIVWAWQG  434



>ref|NP_568878.1| CBL-interacting serine/threonine-protein kinase 10 [Arabidopsis 
thaliana]
 sp|Q9C562.1|CIPKA_ARATH RecName: Full=CBL-interacting serine/threonine-protein kinase 
10; AltName: Full=SNF1-related kinase 3.8; AltName: Full=SOS2-like 
protein kinase PKS2; AltName: Full=SOS3-interacting 
protein 1 [Arabidopsis thaliana]
 gb|AAK16685.1|AF295665_1 CBL-interacting protein kinase 10 [Arabidopsis thaliana]
 gb|AAK26841.1|AF339143_1 SOS2-like protein kinase PKS2 [Arabidopsis thaliana]
 gb|AAM19789.1| AT5g07070/T28J14_10 [Arabidopsis thaliana]
 gb|AAM74510.1| AT5g07070/T28J14_10 [Arabidopsis thaliana]
 gb|AAM78040.1| AT5g07070/T28J14_10 [Arabidopsis thaliana]
 dbj|BAE99008.1| SOS2-like protein kinase PKS2 [Arabidopsis thaliana]
 gb|AED97046.1| CBL-interacting serine/threonine-protein kinase 10 [Arabidopsis 
thaliana]
Length=479

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 197/282 (70%), Gaps = 29/282 (10%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPI--------  312
             PEV++LL K+LDPNP  RI+++++ E+SWF+K           ++K I  +        
Sbjct  236  APEVRRLLCKMLDPNPETRITIARIRESSWFRKGLHMKQKKMEKRVKEINSVEAGTAGTN  295

Query  313  ----ADSQNDESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDT  480
                  S+N   P    D   + + +D      +PT LNAFD+I+LS  FDL+GLF  D 
Sbjct  296  ENGAGPSENGAGPSENGDRVTEENHTD------EPTNLNAFDLIALSAGFDLAGLFG-DD  348

Query  481  NKKPESRFTTQQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIF  657
            NK+ ESRFT+Q+PAS I+SK EE+A      ++K++ G+ KL+  K+GRKG L++DAEIF
Sbjct  349  NKR-ESRFTSQKPASVIISKLEEVAQRLKLSIRKREAGLFKLERLKEGRKGILSMDAEIF  407

Query  658  EVTPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            +VTP+FH+VEVKKS+GDT+EY+    ++LRP+L DI+W W+G
Sbjct  408  QVTPNFHLVEVKKSNGDTLEYQKLVAEDLRPALSDIVWVWQG  449



>ref|XP_003562454.1| PREDICTED: CBL-interacting protein kinase 2 [Brachypodium distachyon]
Length=446

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 191/270 (71%), Gaps = 21/270 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAG LP  D NLM MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGQLPFHDKNLMNMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
              ++++LL +ILDPNP  RIS+ K+MEN WF+K           Q K   P+  S   E+
Sbjct  237  STDIRRLLLRILDPNPSTRISIEKIMENPWFRKGLDAKLLRYNLQAKDAVPVDMSLASEA  296

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
                  + + +   +      KPT LNAFDIISLS   DLSGLF+ + +KK ES+FT+  
Sbjct  297  ------MMEGKLQEEK-----KPTNLNAFDIISLSTGLDLSGLFE-EPDKKSESKFTSTS  344

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTI+SK E+ A S   ++ KKD G++K++G+K GRKG ++IDAEIFEVTPSFH+VE+K
Sbjct  345  TASTILSKIEDTAKSLRLKLTKKDGGLLKMEGSKPGRKGVMSIDAEIFEVTPSFHLVELK  404

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            K++GDT+EY+    QE+RP+LKDI+W W+G
Sbjct  405  KANGDTLEYQKVLNQEMRPALKDIVWAWQG  434



>ref|XP_002866260.1| cbl-interacting protein kinase 10 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42519.1| cbl-interacting protein kinase 10 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 195/276 (71%), Gaps = 22/276 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPI------AD  318
             PEV++LL K+LDPNP  RI+++++ E+SWF+K           ++K +  +        
Sbjct  236  APEVRRLLCKMLDPNPETRITIARIRESSWFRKGLHMKQKKMEKRVKEMNSVEAGVAGGP  295

Query  319  SQNDESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPES  498
            ++N   P    D   + + +D      +PT LNAFD+I+LS  FDL+GLF  D   K ES
Sbjct  296  NENGAGPSENGDRVIEENQTD------EPTNLNAFDLIALSAGFDLAGLFG-DVFNKRES  348

Query  499  RFTTQQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSF  675
            RFT+Q+PAS I+SK EE+A      ++K++ G+ KL+  K+GRKG L++DAEIF+VTP+F
Sbjct  349  RFTSQKPASVIISKLEEVAQRLKLSIRKREAGLFKLERLKEGRKGILSMDAEIFQVTPTF  408

Query  676  HVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            H+VEVKKS+GDT+EY+    ++LRP+L DI+W W+G
Sbjct  409  HLVEVKKSNGDTLEYQKLVAEDLRPALSDIVWVWQG  444



>emb|CBI18060.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/250 (58%), Positives = 185/250 (74%), Gaps = 18/250 (7%)
 Frame = +1

Query  19   VITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWFPPEVKK  198
            VI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLME+YRKI K +++ P WFP EV++
Sbjct  130  VINRKGYDGAKADIWSCGVVLFVLLAGYLPFHDSNLMELYRKIGKAEYRFPNWFPSEVRR  189

Query  199  LLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIFDDRSTS  378
            LL+KILDPNP  RIS++K+MENSWFQK       + P     N+ +           +T+
Sbjct  190  LLSKILDPNPKTRISITKIMENSWFQKG------LDPAVFGSNESAS----------TTA  233

Query  379  DPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSKFEEIAM  558
            +        + LNAFDIIS S  FDLSGLF+ +  KK E RFT++QPAS I+SK E+IA 
Sbjct  234  EAKQELATLSNLNAFDIISFSAGFDLSGLFEENKQKK-EVRFTSRQPASAIISKLEDIAK  292

Query  559  SEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTMEYRNFCE  735
                +V+KKD G++K++G+K+GRKG L+IDAEIFEVTPSFH+VEVKKSSGDT+EY+   +
Sbjct  293  RLMLKVKKKDGGLLKMEGSKEGRKGVLSIDAEIFEVTPSFHLVEVKKSSGDTLEYQKIVK  352

Query  736  QELRPSLKDI  765
            QE+RP+LKDI
Sbjct  353  QEIRPALKDI  362



>gb|ABQ09285.1| CBL-interacting protein kinase [Hordeum brevisubulatum]
Length=403

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 190/270 (70%), Gaps = 14/270 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP +D NLM MY+KI K +FKCP WF
Sbjct  128  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFQDKNLMNMYKKIGKAEFKCPSWF  187

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
              ++++LL +ILDPNP  RIS+ ++ME+ WF+K           Q K   P AD     +
Sbjct  188  SSDIRRLLLRILDPNPSTRISIERIMEHPWFRKGLDAKLLRYNLQAKDAVPAADM----T  243

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S      + +       + K + LNAFDIISLS   DLSG+F+ D +KK ES+FT+  
Sbjct  244  VTSDSPSSSNSAIEGKEQEAKKLSNLNAFDIISLSNGLDLSGMFE-DNDKKRESKFTSTN  302

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTIVSK E+IA     ++ KKD GM+K++G+K GRKG ++IDAEIFEVTP FH+VE+K
Sbjct  303  SASTIVSKIEDIAKGMRLKLVKKDGGMLKMEGSKPGRKGVMSIDAEIFEVTPDFHLVELK  362

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            K++GDT+EY+    QE+RP+LKDI+W W+G
Sbjct  363  KTNGDTLEYQRVLNQEMRPALKDIVWAWQG  392



>ref|NP_001060636.1| Os07g0678600 [Oryza sativa Japonica Group]
 sp|Q7X996.1|CIPK2_ORYSJ RecName: Full=CBL-interacting protein kinase 2; AltName: Full=OsCIPK02 
[Oryza sativa Japonica Group]
 dbj|BAC79539.1| putative Serine/threonine Kinase [Oryza sativa Japonica Group]
 dbj|BAF22550.1| Os07g0678600 [Oryza sativa Japonica Group]
 gb|EAZ05144.1| hypothetical protein OsI_27338 [Oryza sativa Indica Group]
 gb|EAZ41090.1| hypothetical protein OsJ_25582 [Oryza sativa Japonica Group]
 gb|ACD76974.1| CBL-interacting protein kinase 2 [Oryza sativa Japonica Group]
 dbj|BAG93180.1| unnamed protein product [Oryza sativa Japonica Group]
Length=443

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 188/267 (70%), Gaps = 21/267 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVILFVLLAGYLP  D NLM+MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRRGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF------TQLKPITPI-ADSQNDESP  339
              +V++LL +ILDPNP  RIS+ K+MEN WF+K          L+P   I  D   D   
Sbjct  237  NTDVRRLLLRILDPNPSTRISMDKIMENPWFRKGLDAKLLRYNLQPKDAIPVDMSTD---  293

Query  340  RSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
                D F+   T +      KP+ LNAFDIISLS   DLSG+F  + + K ES+FT+   
Sbjct  294  ---FDSFNSAPTLEK-----KPSNLNAFDIISLSTGLDLSGMF--EESDKKESKFTSTST  343

Query  520  ASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            ASTI+SK E+IA     ++ KKD G++K++G+K GRKG + IDAEIFEVTP+FH+VE+KK
Sbjct  344  ASTIISKIEDIAKGLRLKLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEVTPNFHLVELKK  403

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKW  777
            ++GDT+EYR    QE+RP+LKDI+W W
Sbjct  404  TNGDTLEYRKVLNQEMRPALKDIVWAW  430



>dbj|BAA96929.1| serine/threonine protein kinase [Arabidopsis thaliana]
Length=464

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 194/264 (73%), Gaps = 8/264 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--TQLKPITPIADSQNDESPRSVLD  354
             PEV++LL K+LDPNP  RI+++++ E+SWF+K     Q K    + +  + E+  +   
Sbjct  236  APEVRRLLCKMLDPNPETRITIARIRESSWFRKGLHMKQKKMEKRVKEINSVEAGTAGT-  294

Query  355  IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
              ++         + +PT LNAFD+I+LS  FDL+GLF  D NK+ ESRFT+Q+PAS I+
Sbjct  295  --NENGAGPSENGADEPTNLNAFDLIALSAGFDLAGLFG-DDNKR-ESRFTSQKPASVII  350

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK EE+A      ++K++ G+ KL+  K+GRKG L++DAEIF+VTP+FH+VEVKKS+GDT
Sbjct  351  SKLEEVAQRLKLSIRKREAGLFKLERLKEGRKGILSMDAEIFQVTPNFHLVEVKKSNGDT  410

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            +EY+    ++LRP+L DI+W W+G
Sbjct  411  LEYQKLVAEDLRPALSDIVWVWQG  434



>gb|AET80728.1| calcineurin B-like-interacting protein kinase [Hordeum brevisubulatum]
Length=452

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 190/270 (70%), Gaps = 14/270 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP +D NLM MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFQDKNLMNMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
              ++++LL +ILDPNP  RIS+ ++ME+ WF+K           Q K   P AD     +
Sbjct  237  SSDIRRLLLRILDPNPSTRISIERIMEHPWFRKGLDAKLLRYNLQAKDAVPAADM----T  292

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S      + +       + K + LNAFDIISLS   DLSG+F+ D +KK ES+FT+  
Sbjct  293  VTSDSPSSSNSAIEGKEQEAKKLSNLNAFDIISLSNGLDLSGMFE-DNDKKRESKFTSTN  351

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTIVSK E+IA     ++ KKD GM+K++G+K GRKG ++IDAEIFEVTP FH+VE+K
Sbjct  352  SASTIVSKIEDIAKGMRLKLVKKDGGMLKMEGSKPGRKGVMSIDAEIFEVTPDFHLVELK  411

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            K++GDT+EY+    QE+RP+LKDI+W W+G
Sbjct  412  KTNGDTLEYQRVLNQEMRPALKDIVWAWQG  441



>gb|EMT16422.1| CBL-interacting protein kinase 2 [Aegilops tauschii]
Length=454

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 188/270 (70%), Gaps = 14/270 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP +D NLM MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFQDKNLMNMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
              ++++LL +ILDPNP  RIS+ ++ME+ WF+K           Q K   P AD      
Sbjct  237  SSDIRRLLLRILDPNPSTRISIERIMEHPWFRKGLDAKLLRYNLQAKDAVPAADMTATSD  296

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S      + +T      + K + LNAFDIISLS   DLSG+F+ D +KK ES+FT+  
Sbjct  297  SLSC----SNSATEGKEQEAKKLSNLNAFDIISLSTGLDLSGMFE-DNDKKRESKFTSTN  351

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTIVSK E+IA     ++ KKD GM++++  K GRKG ++IDAEIFEVTP FH+VE+K
Sbjct  352  SASTIVSKIEDIAKCMRLKLVKKDGGMMRMESFKPGRKGVMSIDAEIFEVTPDFHLVELK  411

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            K++GDT+EY+    QE+RP+LKDI+W W+G
Sbjct  412  KTNGDTIEYQKVLNQEMRPALKDIVWAWQG  441



>ref|XP_010685966.1| PREDICTED: CBL-interacting protein kinase 2 [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 199/270 (74%), Gaps = 19/270 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I+++GYDG KADIWSCGVILFVL+AGYLP  DSNLMEMYRKI K ++KCP WF
Sbjct  176  AYVAPEIISRKGYDGAKADIWSCGVILFVLVAGYLPFHDSNLMEMYRKIGKAEYKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P + ++LL KILDPNP  RI+++K+ E+SWF+K+ +  KP+ P +DS      + VLD+ 
Sbjct  236  PKDARRLLGKILDPNPDTRITMAKIKESSWFRKELSP-KPVQPESDS------KEVLDVE  288

Query  361  DD------RSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTT  510
             D      RS++     S    +KP  LNAFDIISLS  F+LSGLFD D++ K E+RFT+
Sbjct  289  TDGDPGPSRSSTAANEESRQELIKPAELNAFDIISLSCGFNLSGLFD-DSSHKKEARFTS  347

Query  511  QQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVE  687
            ++PAS I+SK  E+A     +V++ D G++  +    GRKG ++ID EIFEVTPSF++VE
Sbjct  348  REPASVIISKLTEMAKRLKLKVRRMDKGLLNFERTTDGRKGAVSIDTEIFEVTPSFYLVE  407

Query  688  VKKSSGDTMEYRNFCEQELRPSLKDIIWKW  777
            ++K++GDT+EY+    +++RP+LKDI+W W
Sbjct  408  LRKANGDTLEYQKVVMEDVRPALKDIVWAW  437



>ref|XP_008233852.1| PREDICTED: CBL-interacting protein kinase 18-like [Prunus mume]
 ref|XP_008233853.1| PREDICTED: CBL-interacting protein kinase 18-like [Prunus mume]
Length=441

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 200/271 (74%), Gaps = 13/271 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEV+ ++ YDGEKADIWSCGVIL+VLLAG LP  D+NL++MY+KI K ++KCP WF
Sbjct  176  AYVAPEVVGRKAYDGEKADIWSCGVILYVLLAGCLPFHDTNLIQMYKKIGKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDI-  357
              EV+KLL++IL+PNP +RI +S +ME+ WF+K  +  K IT I +    E P +++D+ 
Sbjct  236  SVEVRKLLSRILNPNPNKRILISNIMESPWFRKGLSS-KSITTITEV---EKP-ALVDVD  290

Query  358  --FDDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
              FD+  +SD    +     +PT LNAFDIISLS  FDLSGLF +    K E++FT+ Q 
Sbjct  291  AAFDNCDSSDHNTEAKQELARPTNLNAFDIISLSSGFDLSGLF-MGKGTKKEAQFTSVQS  349

Query  520  ASTIVSKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            AS+I+SK E+IA     +V K  G++KL+ +K GRKG L+I+ EIFE TPSFH+VE+KKS
Sbjct  350  ASSIISKLEDIAQQLRLKVNKDGGLLKLEKSKDGRKGALSIETEIFEFTPSFHLVEMKKS  409

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +GDT+E++   ++++RP+LKDI+W W+G E+
Sbjct  410  NGDTLEFKKILKEDIRPALKDIVWAWQGEEK  440



>gb|AHG06442.1| CBL-interacting protein kinase 2 [Brassica napus]
 emb|CDX99009.1| BnaC09g48260D [Brassica napus]
Length=463

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/273 (54%), Positives = 193/273 (71%), Gaps = 16/273 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFT--------QLKPITPIADSQNDES  336
             PE K+LL K+LDPN   RI++S++ E+SWF+K           QL+  T +  +   E 
Sbjct  236  APEAKRLLCKMLDPNHESRITISRIRESSWFRKGLHLKQKKMDKQLRETTVVIPTV--EV  293

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S     +  S   PA    +   LNAFDIISLS  FDL GLF  D N K ESRF +++
Sbjct  294  GESSGSSENGESQEAPA----QLAYLNAFDIISLSAGFDLGGLFG-DANDKRESRFASRK  348

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            PA+ I+SK EE+A   + +++K+D G+ KL+G+K+GRKG L++DAEIF+VT +FH+VEVK
Sbjct  349  PAAEIISKLEEVARGLNLKIRKQDAGLFKLEGSKEGRKGALSMDAEIFQVTQTFHLVEVK  408

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            K  GDT+EY+   E++LRP+L D++W W+G ++
Sbjct  409  KCDGDTVEYQRLVEEDLRPALGDVVWVWQGDKE  441



>ref|NP_001147901.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
 gb|ACG29067.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
 gb|AFW77803.1| putative CBL-interacting protein kinase family protein [Zea mays]
Length=459

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 196/270 (73%), Gaps = 11/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG K D WSCGVILFVL+AGYLP +DSNLMEMYRKI K DFKCP WF
Sbjct  179  AYVAPEVISRKGYDGAKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKADFKCPPWF  238

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V+KL+++ILDPNP  R+ ++K++E  WF+K     K I    + +   S  + +++ 
Sbjct  239  PSDVRKLVSRILDPNPRTRMPITKIVECFWFKKGIDN-KLIRKNIEMKGKVSALTDVNVV  297

Query  361  --------DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
                    ++    D      K T LNAFDIISLS  F+LSGLF+ ++ K+ E+RFT+ Q
Sbjct  298  FSSTGIGSNNNKLVDVEQDVAKITNLNAFDIISLSEGFNLSGLFE-ESEKRKEARFTSSQ  356

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTI+SK E+ A      ++KK+ G++K++G  +GRKG L+IDAEIFEVTP+FH+VE+K
Sbjct  357  SASTIISKLEDAATCSKMTIKKKEGGVLKMEGANEGRKGVLSIDAEIFEVTPAFHLVEIK  416

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            K++GDT+EY N  +Q+++P+LKDI+W W+G
Sbjct  417  KNNGDTLEYENLFKQDMKPALKDIVWAWQG  446



>ref|XP_002533719.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF28664.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=428

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 195/265 (74%), Gaps = 10/265 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLME+YRKI K +FK P WF
Sbjct  141  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMELYRKIGKAEFKFPNWF  200

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPR----SV  348
             PEV+KLL+KILDPNP  RIS++++MENSWF+K    L+P   I++    E       +V
Sbjct  201  APEVRKLLSKILDPNPSTRISMARIMENSWFRKG---LEPRPLISEIDTTEPALVDCDAV  257

Query  349  LDIFDDRST-SDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
             ++ +   T S+P     KP  LNAFDIIS S  FDLSGLF+    KK E RFT  +PA+
Sbjct  258  FNVNESSCTGSEPKQDLAKPCNLNAFDIISYSSGFDLSGLFEEKEKKK-EVRFTANKPAA  316

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E+IA     + +KKD G++KL+G+K+GRKG L I+AEIFE+TP FH+VE+KK S
Sbjct  317  IIISKLEDIAKRLRLKTKKKDGGLLKLEGSKEGRKGVLGIEAEIFEITPCFHLVEMKKCS  376

Query  703  GDTMEYRNFCEQELRPSLKDIIWKW  777
            GDT+EY+   ++E+RP+LKDI+W W
Sbjct  377  GDTLEYQRVLKEEMRPALKDIVWSW  401



>emb|CDY02816.1| BnaC02g10730D [Brassica napus]
Length=443

 Score =   290 bits (743),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 191/261 (73%), Gaps = 18/261 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KAD+WSCGV+LFVLLAGYLP  DSNLMEMYRKI +G+FK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADVWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGRGEFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEVK+LL K+LDPNP  RI+++K+ E+SWF+K              +  +  + V ++ 
Sbjct  236  APEVKRLLCKMLDPNPETRITIAKIRESSWFRKGLHM----------KEKKMEKRVEEMS  285

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
             + S +D      +PT +NAFD+I+LS  FDLSGLF  D   K ESRFT+++PAS I+SK
Sbjct  286  SEESNTD------QPTSINAFDVIALSARFDLSGLFG-DVYDKRESRFTSKKPASVIISK  338

Query  541  FEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             EE A     +++K++ G+ KL+  K+GRKG L++DAEIF+VTP+FH+VEVKK +GDT+E
Sbjct  339  LEEAAQRLKLRIRKREAGLFKLERLKEGRKGVLSMDAEIFQVTPTFHMVEVKKCNGDTLE  398

Query  718  YRNFCEQELRPSLKDIIWKWE  780
            Y+   +++LRP+L DI+W W+
Sbjct  399  YQKLVKEDLRPALADIVWVWQ  419



>ref|XP_009769612.1| PREDICTED: CBL-interacting protein kinase 18-like [Nicotiana 
sylvestris]
 ref|XP_009769613.1| PREDICTED: CBL-interacting protein kinase 18-like [Nicotiana 
sylvestris]
Length=441

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 194/267 (73%), Gaps = 8/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  DSNLM MYRKI + ++KCP WF
Sbjct  176  AYVAPEVIGRKGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMNMYRKISRAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQN---DESPRSVL  351
            P EV+KLL++ILDPNP  RIS++K+ E+SWF+K        T +  +QN   D    S L
Sbjct  236  PLEVRKLLSRILDPNPHTRISIAKIKESSWFKKGLESRHVRTKLVQNQNVIADGDDVSSL  295

Query  352  DIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
            ++ +  S+SD      KPT LNAFDIISLS  FDLSGLF +  ++K E +FT+ +PA+ I
Sbjct  296  NLENSTSSSDTKLELAKPTNLNAFDIISLSSGFDLSGLF-IRNDQKEELQFTSVKPAAVI  354

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK EE+  + + +++KK+ G ++L+G+K    G L ID +IFEVT S++++E+++S GD
Sbjct  355  ISKLEEVGRNLNLEIKKKEGGFLRLEGSKY---GTLCIDVQIFEVTESYYLIELRRSCGD  411

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSE  789
             +EY+N   Q +RP+L++I+W W+G +
Sbjct  412  AIEYQNMLTQSIRPALEEIVWAWQGVQ  438



>gb|AFW98257.1| calcineurin B-like-interacting protein kinase [Hordeum brevisubulatum]
Length=450

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 190/270 (70%), Gaps = 14/270 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVL+AGYLP +D NLM MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLMAGYLPFQDKNLMNMYKKIGKAEFKCPSWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF--------TQLKPITPIADSQNDES  336
              ++++LL +ILDPNP  RIS+ K+ME+ WF+K           Q K   P +D     +
Sbjct  237  SSDIRRLLLRILDPNPSTRISIEKIMEHPWFRKGLDAKLLRYNLQAKDAVPASDM----T  292

Query  337  PRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
              S      + +       + K + +NAFDIISLS   DLSG+F+ D +KK ES+FT+  
Sbjct  293  ATSDSLSSSNSAIEGKEQETKKLSNMNAFDIISLSTGLDLSGMFE-DNDKKRESKFTSTN  351

Query  517  PASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
             ASTIVSK E+IA     ++ KKD GM+K++G+K GRKG ++IDAEIFEVTP FH+VE+K
Sbjct  352  SASTIVSKIEDIAKGMQLKLVKKDGGMLKMEGSKPGRKGVMSIDAEIFEVTPDFHLVELK  411

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            K++GDT+EY+    QE+RP+LKDI+W W+G
Sbjct  412  KTNGDTLEYQRVFNQEMRPALKDIVWAWQG  441



>ref|XP_007140104.1| hypothetical protein PHAVU_008G084600g [Phaseolus vulgaris]
 gb|ESW12098.1| hypothetical protein PHAVU_008G084600g [Phaseolus vulgaris]
Length=461

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 192/266 (72%), Gaps = 12/266 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAG+LP  DSNLMEMY+KIIKG FK PKWF
Sbjct  176  AYVAPEVINRKGYDGVKADIWSCGVILFVLLAGHLPFHDSNLMEMYKKIIKGQFKFPKWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
             P+V++LL++ILDPNP  RIS++++M+ SWF+        ITP   ++N E +P+    I
Sbjct  236  APDVRRLLSRILDPNPKTRISIARIMKCSWFKVGLEN-PAITP---TENQELAPQDADGI  291

Query  358  FDDRSTSDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
            F+      P  +       KP  LNAF IIS S  FDLSG+F  +T    E RF + +PA
Sbjct  292  FEACENDGPPIAESKHELTKPCNLNAFAIISFSTGFDLSGMFQ-ETVSMKEMRFMSNKPA  350

Query  523  STIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            S+I+SK EEI      +V+KKD G++K++G+K+GRKG L +DAEIFE+TP  H+VE++KS
Sbjct  351  SSIISKLEEICKRLSLKVRKKDGGLLKMEGSKEGRKGTLGVDAEIFEITPQLHMVELRKS  410

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKW  777
            +GDTMEY+    Q++RP+L+DI+W W
Sbjct  411  NGDTMEYQKLFTQDIRPALQDIVWTW  436



>ref|XP_006399186.1| hypothetical protein EUTSA_v10013492mg [Eutrema salsugineum]
 gb|ESQ40639.1| hypothetical protein EUTSA_v10013492mg [Eutrema salsugineum]
Length=457

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 193/268 (72%), Gaps = 12/268 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE K+LL K+LDPN   RI++S++ E+SWF+K   QLK        +  +  R    + 
Sbjct  236  APEAKRLLCKMLDPNHETRITISRIKESSWFRKGL-QLK------QKRMGKQVREANPME  288

Query  361  DDRSTSDPAGSSMKP---TCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
               S    +G + +P     LNAFDII+LS  FDL+GLF    N + ESRF +++PAS I
Sbjct  289  AGGSGPGDSGENHEPPQLGNLNAFDIIALSSGFDLAGLFGEVYNTR-ESRFASRKPASEI  347

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK EE+A     +++K+D G+ KL+G+K+G+KG L+IDAEIF+VT +FH+VEVKK +GD
Sbjct  348  ISKLEEVAKGLKLKIRKQDAGLFKLEGSKEGKKGALSIDAEIFQVTQTFHLVEVKKCNGD  407

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            TMEY+   E++L+P+L DI+W W+G ++
Sbjct  408  TMEYQKLVEEDLKPALADIVWVWQGEKE  435



>ref|XP_009771513.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana sylvestris]
Length=483

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 192/267 (72%), Gaps = 19/267 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAGYLP  DSNLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVILYVLLAGYLPFHDSNLMEMYRKIGKSEFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LL ++LDPNP  RIS++ + E+SW ++     K I   AD++  +   +     
Sbjct  236  PPEVRRLLVRMLDPNPHTRISIATIKESSWSKRGIAS-KSIK--ADTERKDLASAC----  288

Query  361  DDRSTSDPAGSS------MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
                T   AGSS       + + LNAFDIISLS  FDLS LF+ DT  K E+RFT+ +PA
Sbjct  289  ----TESAAGSSENKQDVARLSNLNAFDIISLSAGFDLSRLFE-DTPLKKEARFTSCKPA  343

Query  523  STIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            S IVSK E++A     +V K+D G+++ +G+K+GRKG L+ID EIFEVTP+F++VEVKKS
Sbjct  344  SVIVSKLEDVAKRLKLKVSKRDAGLLRFEGSKEGRKGILSIDTEIFEVTPAFYLVEVKKS  403

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWE  780
            +GDT+EY+    + LRP L+DI+W W+
Sbjct  404  NGDTLEYQKILNEGLRPGLQDIVWAWQ  430



>ref|XP_006399191.1| hypothetical protein EUTSA_v10013670mg [Eutrema salsugineum]
 dbj|BAJ34306.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40644.1| hypothetical protein EUTSA_v10013670mg [Eutrema salsugineum]
Length=416

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 190/270 (70%), Gaps = 16/270 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  135  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPSWF  194

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE K+LL K+LDPN   RI++S++ E+SWF+K   QLK    +     + +P       
Sbjct  195  APEAKRLLCKMLDPNHETRITISRIKESSWFRKGL-QLKQ-KRMGKQVREANPMEA----  248

Query  361  DDRSTSDPAGSSMKPTC-----LNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
                 S P  S           LNAFDII+LS  FDL+GLF    N + ESRF +++PAS
Sbjct  249  ---GGSGPGDSGENHEAPQLGNLNAFDIIALSSGFDLAGLFGEVYNTQ-ESRFASRKPAS  304

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK EE+A     +++K+D G+ KL+G+K+G+KG L+IDAEIF+VT +FH+VEVKK +
Sbjct  305  EIISKLEEVAKGLKLKIRKQDAGLFKLEGSKEGKKGALSIDAEIFQVTQTFHLVEVKKCN  364

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDTMEY+   E++L+P+L DI+W W+G ++
Sbjct  365  GDTMEYQKLVEEDLKPALADIVWVWQGEKE  394



>dbj|BAJ99952.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=384

 Score =   286 bits (731),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 194/267 (73%), Gaps = 8/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+K GYDG K+DIWSCGVILFVL+AGYLP +  NL+EMYRKI KGDF+CP W 
Sbjct  121  AYVAPEVISKGGYDGAKSDIWSCGVILFVLVAGYLPFQGQNLIEMYRKIEKGDFRCPGWV  180

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQK---DFTQLKPITPIADSQNDESPRSVL  351
             P+++KLL KI+DP+P +RIS+ K+ E++WF+K   +   +K   P  ++  D  P   L
Sbjct  181  SPKLQKLLHKIMDPDPNKRISIQKIKESTWFRKGPGENLTVKERLPNENTTTDAVP--TL  238

Query  352  DIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
             +   R  S      +  T LNAF+IIS S  FDLSGLF ++   K E+RFT++QPAS I
Sbjct  239  GV-RRRKNSHEVRKPLAVTNLNAFEIISFSTGFDLSGLF-IEKESKKEARFTSEQPASAI  296

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            VSK E++A   + +V+KKD G+VK+Q  K+GR G L  D+EIFE++PS+H++E+K++SGD
Sbjct  297  VSKLEDVAKQLNLRVRKKDNGVVKMQVRKEGRNGVLQFDSEIFEISPSYHLIEMKQTSGD  356

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSE  789
            ++EY+   E+ +RP+LKDIIW W G++
Sbjct  357  SLEYQKLLEEGIRPALKDIIWAWHGAD  383



>emb|CDY32704.1| BnaA02g07660D [Brassica napus]
Length=438

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 191/261 (73%), Gaps = 18/261 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KAD+WSCGV+LFVLLAGYLP RDSNLMEMYRKI +G+FK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADVWSCGVVLFVLLAGYLPFRDSNLMEMYRKIGRGEFKSPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEVK+LL K+LDPNP  RI+++K+ E+SWF+K              +  +  + V ++ 
Sbjct  236  APEVKRLLCKMLDPNPETRITIAKIRESSWFRKGLHM----------KQKKIEKRVKEMS  285

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
             + S +D      +P  +NAFD+I+LS  FDLSGLF  D   K ESRFT+++PAS I+SK
Sbjct  286  SEESNTD------QPRSINAFDVIALSSRFDLSGLFG-DVCDKRESRFTSKKPASEIISK  338

Query  541  FEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             EE A     +++K++ G+ KL+  K+GRKG +++DAEIF+VTP+FH+VEVKK +GDT+E
Sbjct  339  MEEAAQRLKLRIRKREAGLFKLERLKEGRKGVVSMDAEIFQVTPTFHMVEVKKCNGDTLE  398

Query  718  YRNFCEQELRPSLKDIIWKWE  780
            Y+   +++LRP+L DI+W W+
Sbjct  399  YQKLVKEDLRPALADIVWVWQ  419



>gb|ACQ83494.1| CBL-interacting protein kinase 25 [Sorghum bicolor]
Length=449

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/271 (52%), Positives = 187/271 (69%), Gaps = 14/271 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLLAGYLP  D NLM+MY+KI K +FKCP WF
Sbjct  177  AYVAPEVINRKGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIGKAEFKCPCWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKD-------FTQLKPITPIADSQNDESP  339
              + ++LL +ILDPNP  RIS+ K+MEN WF+K        +       P  D   D   
Sbjct  237  STDARRLLLRILDPNPSTRISMEKIMENPWFRKGLDAKLLRYNLQSKNAPQVDKNADSDS  296

Query  340  RSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
             S+     + +         KPT +NAFDIISLS   DLSGLF+   NK+ E +FT+   
Sbjct  297  LSI-----NITAESKQQEEKKPTNMNAFDIISLSTGLDLSGLFEESDNKR-EYKFTSTNT  350

Query  520  ASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            +STIVSK E++A +   ++ KKD G++K++ +K GRKG + IDAEIFEV+P+FH+VE+KK
Sbjct  351  SSTIVSKIEDVAKNLRLKLTKKDGGLLKMEASKPGRKGVMGIDAEIFEVSPNFHLVEIKK  410

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSE  789
            ++GDT+EY+    +E+RP+LKDI+W W+G +
Sbjct  411  TNGDTLEYQKVLNREMRPALKDIVWAWQGEQ  441



>gb|AEZ51505.1| CBL-interacting protein kinase 14 [Hordeum vulgare subsp. spontaneum]
Length=440

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/267 (53%), Positives = 195/267 (73%), Gaps = 8/267 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+K GYDG K+DIWSCGVILFVL+AGYLP +  NL+EMYRKI KGDF+CP W 
Sbjct  177  AYVAPEVISKGGYDGAKSDIWSCGVILFVLVAGYLPFQGQNLIEMYRKIEKGDFRCPGWV  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQK---DFTQLKPITPIADSQNDESPRSVL  351
             P+++KLL KI+DP+P +RIS+ K+ E++WF+K   +   +K   P  ++  D  P   L
Sbjct  237  SPKLQKLLHKIIDPDPNKRISIQKIKESTWFRKGPGENLTVKERLPNENTTTDAVP--TL  294

Query  352  DIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
             +   R  S      +  T LNAF+IIS S  FDLSGLF V+   K E+RFT++QPAS I
Sbjct  295  GV-RRRKNSHEDRKPLAVTNLNAFEIISFSTGFDLSGLF-VEKESKKEARFTSEQPASAI  352

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            VSK E++A + + +V+KKD G+VK+Q  K+GR G L  D+EIFE++PS+H++E+K++SGD
Sbjct  353  VSKLEDVAKALNLRVRKKDNGVVKMQVRKEGRNGVLQFDSEIFEISPSYHLIEMKQTSGD  412

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSE  789
            ++EY+   E+ +RP+LKDIIW W G++
Sbjct  413  SLEYQKLLEEGIRPALKDIIWAWHGAD  439



>ref|XP_011079428.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Sesamum indicum]
Length=433

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 181/258 (70%), Gaps = 15/258 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWSCGVILFVLLAGYLP +D N++ MYRKI +GDFKCP WF
Sbjct  180  AYVAPEVIGKKGYDGAKADIWSCGVILFVLLAGYLPFQDDNIVAMYRKIYRGDFKCPPWF  239

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE +KL+ K+LDPNP  RIS++K+ME+SWF+K  ++            +E   +V D  
Sbjct  240  SPESRKLITKMLDPNPSTRISIAKIMESSWFKKSLSK-------GLRTKEEQELAVEDEV  292

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPES-RFTTQQPASTIVS  537
            +        G   +   LNAF IISLS  FDLS LF+     + E  RF T +PAS+++S
Sbjct  293  N-------VGKGKETETLNAFHIISLSEGFDLSPLFEEKKRVEKEELRFATTRPASSVIS  345

Query  538  KFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
            K EE+A +++F ++K D  V+LQG   GRKG+L I A+IF V PSF VVEVKKSSGDT+E
Sbjct  346  KLEEVAKTKNFSIKKSDSCVRLQGQATGRKGKLGIAADIFAVAPSFLVVEVKKSSGDTLE  405

Query  718  YRNFCEQELRPSLKDIIW  771
            Y  FC +ELRP+LKDI+W
Sbjct  406  YNQFCSKELRPALKDIVW  423



>ref|XP_011015352.1| PREDICTED: CBL-interacting protein kinase 18-like [Populus euphratica]
 ref|XP_011015353.1| PREDICTED: CBL-interacting protein kinase 18-like [Populus euphratica]
 ref|XP_011015355.1| PREDICTED: CBL-interacting protein kinase 18-like [Populus euphratica]
Length=439

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 189/266 (71%), Gaps = 8/266 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  D+NL+ MYRKI K ++K P WF
Sbjct  176  AYVAPEVIYRKGYDGAKADIWSCGVVLFVLLAGYLPFHDANLILMYRKIRKAEYKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE+ +LL+++LDPNP  RIS++K+MENSWF+K F     +T I +      P +    F
Sbjct  236  SPEMCRLLSRMLDPNPKTRISITKIMENSWFRKGF-DFNTVT-IKNEVTGLDPLAADVTF  293

Query  361  D----DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
            D    D   ++      +PT LNAFDIISLS  FDLSGLF  D N+K E +F +   AST
Sbjct  294  DSCENDSVPAEAKKEMSQPTSLNAFDIISLSSGFDLSGLFAKD-NQKKEKKFISMHSAST  352

Query  529  IVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            I SK E+IA     +V+KKD G++KL+G+ +GRKG L+ID EIFE TPSFH+VEVK SSG
Sbjct  353  ITSKLEDIARLLKLKVKKKDRGLLKLEGSDKGRKGALSIDTEIFEFTPSFHLVEVKSSSG  412

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEG  783
            DT+EY    E  +RP+LKDI+W W+G
Sbjct  413  DTLEYLQILENGIRPALKDIVWAWQG  438



>ref|XP_007146859.1| hypothetical protein PHAVU_006G076200g [Phaseolus vulgaris]
 gb|ESW18853.1| hypothetical protein PHAVU_006G076200g [Phaseolus vulgaris]
Length=462

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 192/267 (72%), Gaps = 5/267 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCG++LFVLLAGYLP  D NL+EMYRKI K + KCP WF
Sbjct  176  AYVAPEVIKRKGYDGTKADIWSCGIVLFVLLAGYLPFHDPNLIEMYRKISKAELKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVL-DI  357
            PPEV KLL  +LDPNP  RI +S + E  WF+K+   +K    + ++    S  +VL D 
Sbjct  236  PPEVCKLLGMMLDPNPETRIPISNIREYCWFKKE-PNVKNKRSVVENNTVSSSGTVLPDQ  294

Query  358  FD-DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D D   ++  G S+ P  +NAFDIIS S  FDLS  FD D+ +K ESRF+++ PA+ I+
Sbjct  295  NDCDGLAAEANGESVAPLSINAFDIISRSVGFDLSRFFD-DSFQKKESRFSSRLPANVII  353

Query  535  SKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E+IA     +++KK  G++KL+G K+GRKG L IDAEIF+VTP FH VEVKKS+GDT
Sbjct  354  SKLEDIAKQLRMKIKKKAAGLLKLEGLKEGRKGVLTIDAEIFQVTPCFHFVEVKKSNGDT  413

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +EY+   ++E+RP+L+DI+W W+  +Q
Sbjct  414  LEYQKILKEEIRPALQDIVWVWQSDQQ  440



>ref|XP_002319966.2| calcineurin B-like-interacting protein kinase [Populus trichocarpa]
 gb|ABJ91221.1| CBL-interacting protein kinase 14 [Populus trichocarpa]
 gb|EEE95889.2| calcineurin B-like-interacting protein kinase [Populus trichocarpa]
Length=438

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 190/260 (73%), Gaps = 13/260 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLL+GYLP  DSNLMEMYRKI + +FKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLSGYLPFHDSNLMEMYRKIGRAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P + ++LL KILDPNP  RIS++++ E+SWF+K     K +  +  + +  S  S +   
Sbjct  236  PTDARRLLRKILDPNPSTRISMAEIKESSWFRKG----KEVAALDWNGSGSSENSSV---  288

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
                 S+    S KP  LNAFDIISLS  FDLSGLF+ +  K+ E+RFT+ QPAS I+SK
Sbjct  289  ----ASEAKQESAKPPSLNAFDIISLSAGFDLSGLFEENYQKR-EARFTSIQPASVIISK  343

Query  541  FEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             E+IA  +  +V KKD G++KL+G ++GRKG L++DAEIFEVTP+ H VEVKKS+GDT+E
Sbjct  344  LEDIAKRQKLKVIKKDAGLLKLEGMEEGRKGPLSVDAEIFEVTPNIHFVEVKKSNGDTLE  403

Query  718  YRNFCEQELRPSLKDIIWKW  777
            Y+   E+ +RP+L DI+  W
Sbjct  404  YQKILEEAIRPALNDIVCVW  423



>ref|XP_010683541.1| PREDICTED: CBL-interacting protein kinase 18-like [Beta vulgaris 
subsp. vulgaris]
Length=447

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 196/271 (72%), Gaps = 11/271 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI + GYDG KADIWSCGVILFVLLAGYLP +DSNLMEMYRKI K ++K P W 
Sbjct  177  AYVAPEVIRRHGYDGAKADIWSCGVILFVLLAGYLPFQDSNLMEMYRKIGKAEYKFPNWI  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF-TQLKPITPIADSQNDESPRSVLD-  354
            P + ++LL KILDPNP  RIS +K+M+NSWF+K F ++L  ++P+    ND  P  VLD 
Sbjct  237  PSDARRLLFKILDPNPRTRISTAKIMQNSWFRKGFDSKLLQVSPVI---NDMKP-DVLDI  292

Query  355  --IFDDRSTSDPAGSSMKPTC-LNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
              IF      +      +P   LNAFDIIS S  FDLSGLF+  + KK + RF+  Q AS
Sbjct  293  DAIFGPSDNIEAKQEDAQPCYNLNAFDIISFSEGFDLSGLFEEKSQKK-DVRFSACQTAS  351

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI+SK EE+A     +V+KKD G+++ +G K+GRKG L+ DAEIFEVTP+FH+VE+KK  
Sbjct  352  TIISKLEEVAKKLKLKVKKKDGGLMRFEGCKEGRKGVLSFDAEIFEVTPTFHMVELKKRG  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQP  795
            GD++EY+   ++E+RP+LKDI+W W+G ++ 
Sbjct  412  GDSLEYQKVVKKEMRPALKDILWTWQGEQEA  442



>ref|XP_009354341.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
[Pyrus x bretschneideri]
Length=456

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 190/260 (73%), Gaps = 3/260 (1%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGV+L+VLLAGYLP  DSNLMEMYRKI K +FKCP +F
Sbjct  176  AYVAPEVINRRGYDGVKADIWSCGVVLYVLLAGYLPFHDSNLMEMYRKIGKAEFKCPNFF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE ++LL ++LDPNP  RIS++K+ E+SW++K        + I +     +        
Sbjct  236  SPEARRLLYRMLDPNPNSRISIAKVRESSWYRKGPYSKNMKSEIGNKAVARTSAEASGSS  295

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
            ++   S+      +P  +NAFDIISLS  FDLSGLF+ D   + E+RFT++QPA+ I+SK
Sbjct  296  ENSMASEEKQEPGRPPNMNAFDIISLSAGFDLSGLFEKDPFHR-EARFTSRQPATVIISK  354

Query  541  FEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             EE+A     +V+KK DG++K+ G K+GRKG L+IDAEIFE+TP+FH+VEVKKSSGDT+E
Sbjct  355  LEEMAKQLELKVKKKDDGLLKIDGLKEGRKGILSIDAEIFEITPTFHLVEVKKSSGDTLE  414

Query  718  YRNFCEQELRPSLKDIIWKW  777
            ++   + ++RP+L+DI+W W
Sbjct  415  FQKMLD-DIRPALRDIVWVW  433



>ref|XP_002325810.1| calcineurin B-like-interacting protein kinase [Populus trichocarpa]
 gb|EEF00192.1| calcineurin B-like-interacting protein kinase [Populus trichocarpa]
Length=439

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 189/267 (71%), Gaps = 10/267 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  D+NL+ MYRKI K ++K P WF
Sbjct  176  AYVAPEVIYRKGYDGAKADIWSCGVVLFVLLAGYLPFHDANLILMYRKIRKAEYKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE+ +LL+++LDPNP  RIS++K+MENSWF+K          I +      P +  D+ 
Sbjct  236  SPEMCRLLSRMLDPNPKTRISITKIMENSWFRKGLDS--NAVTIKNEVTGLDPLAA-DVT  292

Query  361  DDRSTSDPAGSSMK-----PTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
             D   +D A +  K     PT LNAFDIISLS  FDLSGLF  D N+K E +F +   AS
Sbjct  293  FDSCENDSAPAEAKKELSQPTSLNAFDIISLSSGFDLSGLFAKD-NQKKEKKFISMHSAS  351

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            TI SK E+IA     +V+KKD G++KL+G+++GRKG L+ID EIFE TPSFH+VEVK SS
Sbjct  352  TITSKLEDIARLLKLKVKKKDGGLLKLEGSEKGRKGALSIDTEIFEFTPSFHLVEVKSSS  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEG  783
            GDT+EY    E  +RP+LKDI+W W+G
Sbjct  412  GDTLEYLQILENGIRPALKDIVWAWQG  438



>ref|XP_006654265.1| PREDICTED: CBL-interacting protein kinase 18-like [Oryza brachyantha]
Length=456

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 199/271 (73%), Gaps = 9/271 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG K D WSCGVILFVL+AGYLP +DSNLMEMYRKI K +FKCP WF
Sbjct  178  AYVAPEVISRKGYDGVKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKAEFKCPAWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V+KL+++ILDPNP  R+ ++K+ME  WF+K     K I    ++Q   +  + +++ 
Sbjct  238  PSDVRKLVSRILDPNPRSRMPITKIMETYWFKKGLDS-KLIRKNMETQASVTALADVNVI  296

Query  361  ------DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPA  522
                       ++    + K T LNAFDIISLS  FDLSGLF+ +T+KK E+RFT+ Q A
Sbjct  297  FSSMGSSSSKKTEEKQDAGKLTNLNAFDIISLSEGFDLSGLFE-ETDKKKEARFTSSQSA  355

Query  523  STIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKS  699
            S I+SK E+ A      V+KK+ G++K++G  +GRKG LAIDAEIFEVTPSFH+VE+KK+
Sbjct  356  SAIISKLEDAATCSKLTVKKKEGGVLKMEGANEGRKGVLAIDAEIFEVTPSFHLVEIKKN  415

Query  700  SGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +GDT+EY+N  +Q+++P+L+DI+W W+G  Q
Sbjct  416  NGDTLEYQNLWKQDMKPALQDIVWAWQGERQ  446



>ref|XP_010108499.1| CBL-interacting serine/threonine-protein kinase 10 [Morus notabilis]
 gb|EXC19561.1| CBL-interacting serine/threonine-protein kinase 10 [Morus notabilis]
Length=486

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 193/262 (74%), Gaps = 5/262 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+L+VLL GYLP  DSNLME+YRKI + DFKCP WF
Sbjct  176  AYVAPEVINRKGYDGAKADIWSCGVVLYVLLDGYLPFHDSNLMELYRKIGRADFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEVK+LL +ILDPNP  R S+ K+ E++W++K     K I   +++++  S  +    +
Sbjct  236  PPEVKRLLFRILDPNPSTRASIDKIKESTWYKKGLKS-KHINFESENKDASSLDTETSSW  294

Query  361  DDRSTSDPAGSS--MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             + ++    G    ++P  LNAFDIISLS  FDLSGLF+ D  ++ E+RF  ++PA+ IV
Sbjct  295  HESASVAAEGKQEPIRPPNLNAFDIISLSVGFDLSGLFEEDYRRR-EARFIFRKPATVIV  353

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK EEIA     +V+K+D G+ +L+G ++GRKG L+IDAEIFEVTPSFH+VEVK S+GD+
Sbjct  354  SKLEEIAKKLRMKVKKRDAGLFRLEGLREGRKGILSIDAEIFEVTPSFHLVEVKLSNGDS  413

Query  712  MEYRNFCEQELRPSLKDIIWKW  777
            MEY+   + +++P+L+DI W W
Sbjct  414  MEYQKILKDDIKPALQDIAWVW  435



>gb|ABK96146.1| unknown [Populus trichocarpa]
Length=393

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 185/259 (71%), Gaps = 14/259 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGVIL+VLLAG+LP +D N++ MYRKI +GDFKCP+WF
Sbjct  137  AYVAPEVIGKKGYDGAKADLWSCGVILYVLLAGFLPFQDDNIVAMYRKIYRGDFKCPQWF  196

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              E ++L+ K+LDPNP  RI+ SK+M+++WF+K      P T  +  + +       + F
Sbjct  197  SSEARRLITKLLDPNPSTRITTSKVMDSTWFKKSL----PKTVRSKEEME------FEAF  246

Query  361  DDRSTSDPAGSSMK-PTCLNAFDIISLSPSFDLSGLFDVDTNK-KPESRFTTQQPASTIV  534
            +     D  G   K P  LNAF IISLS  FDLS LF+  T + K E RF T +PAS+++
Sbjct  247  N--GEEDANGDKAKQPETLNAFHIISLSQGFDLSPLFEEKTREGKEELRFATTRPASSVI  304

Query  535  SKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            S+ EE+A + +F V+K D  V+LQG ++GRKG+LAI A+IF VTPSF VVEVKK +GDT+
Sbjct  305  SRLEEVAKAGNFNVKKSDSKVRLQGQERGRKGKLAIAADIFAVTPSFLVVEVKKDNGDTL  364

Query  715  EYRNFCEQELRPSLKDIIW  771
            EY  FC  ELRP+LKDI+W
Sbjct  365  EYNQFCSNELRPALKDIVW  383



>gb|ABK25045.1| unknown [Picea sitchensis]
Length=433

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 187/265 (71%), Gaps = 13/265 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AY+APEV++ +GY+G+KADIWSCGVILFVL+AGYLP + +NLM MY+KI KGDFKCP WF
Sbjct  177  AYLAPEVVSNKGYNGDKADIWSCGVILFVLMAGYLPFQCANLMVMYKKIDKGDFKCPPWF  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              + ++L+ +++DPNP  R+++ +LME  WF++ F +     P A ++ D     VLD  
Sbjct  237  SCDARRLVLRLMDPNPRTRMTVPQLMEVPWFRRGFKR-----PQAKNEVDVDV-GVLD--  288

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
                  + A  + KP CLNAFDIISLSP F LSGLF     K+  SRF + QPAS+I+SK
Sbjct  289  ----EVESAFFTAKPACLNAFDIISLSPGFSLSGLFKDKVVKQESSRFMSIQPASSIMSK  344

Query  541  FEEIAMSEHFQVQK-KDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             EEIA    F V+K K+  V+LQ +K+GRKG L IDAEIFEVTPS  +VE+ K+ GDT+E
Sbjct  345  LEEIARVLRFSVKKSKNCKVELQDSKKGRKGHLCIDAEIFEVTPSLFLVELGKTGGDTLE  404

Query  718  YRNFCEQELRPSLKDIIWKWEGSEQ  792
            Y  FC Q L+P LKDI+W W+G  Q
Sbjct  405  YSKFCSQALKPGLKDIVWAWDGDNQ  429



>ref|XP_009126755.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
[Brassica rapa]
Length=443

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 190/261 (73%), Gaps = 18/261 (7%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KAD+WSCGV+LFVLLAGYLP  DSNLMEMYRKI +G+FK P WF
Sbjct  176  AYVAPEVINRKGYDGTKADVWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGRGEFKAPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEVK+LL K+LDPNP  RI+++K+ E+SWF+K              +  +  + V ++ 
Sbjct  236  APEVKRLLCKMLDPNPETRITIAKIRESSWFRKGLHM----------KQKKIEKRVKEMS  285

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
             + S +D      +P  +NAFD+I+LS  FDLSG+F  D   K ESRFT+++PAS I+SK
Sbjct  286  SEESNTD------QPRSINAFDVIALSSRFDLSGIFG-DVCDKRESRFTSKKPASVIISK  338

Query  541  FEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
             EE A     +++K++ G+ KL+  K+GRKG +++DAEIF+VTP+FH+VEVKK +GDT+E
Sbjct  339  MEEAAQRLKLRIRKREAGLFKLERLKEGRKGVVSMDAEIFQVTPTFHMVEVKKCNGDTLE  398

Query  718  YRNFCEQELRPSLKDIIWKWE  780
            Y+   +++LRP+L DI+W W+
Sbjct  399  YQKLVKEDLRPALADIVWVWQ  419



>ref|XP_002309336.2| CBL-interacting protein kinase 6 [Populus trichocarpa]
 gb|EEE92859.2| CBL-interacting protein kinase 6 [Populus trichocarpa]
Length=437

 Score =   285 bits (729),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 184/258 (71%), Gaps = 12/258 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGVIL+VLLAG+LP +D N++ MYRKI +GDFKCP+WF
Sbjct  181  AYVAPEVIGKKGYDGAKADLWSCGVILYVLLAGFLPFQDDNIVAMYRKIYRGDFKCPQWF  240

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              E ++L+ K+LDPNP  RI+ SK+M+++WF+K         P      +E      +  
Sbjct  241  SSEARRLITKLLDPNPSTRITTSKVMDSTWFKKSL-------PKTVRSKEEMEFEAFNGE  293

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNK-KPESRFTTQQPASTIVS  537
            +D +  D A    +P  LNAF IISLS  FDLS LF+  T + K E RF T +PAS+++S
Sbjct  294  ED-ANGDKA---KQPETLNAFHIISLSQGFDLSPLFEEKTREGKEELRFATTRPASSVIS  349

Query  538  KFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
            + EE+A + +F V+K D  V+LQG ++GRKG+LAI A+IF VTPSF VVEVKK +GDT+E
Sbjct  350  RLEEVAKAGNFNVKKSDSKVRLQGQERGRKGKLAIAADIFAVTPSFLVVEVKKDNGDTLE  409

Query  718  YRNFCEQELRPSLKDIIW  771
            Y  FC  ELRP+LKDI+W
Sbjct  410  YNQFCSNELRPALKDIVW  427



>gb|ABJ91216.1| CBL-interacting protein kinase 9 [Populus trichocarpa]
Length=437

 Score =   285 bits (728),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 184/258 (71%), Gaps = 12/258 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGVIL+VLLAG+LP +D N++ MYRKI +GDFKCP+WF
Sbjct  181  AYVAPEVIGKKGYDGAKADLWSCGVILYVLLAGFLPFQDDNIVAMYRKIYRGDFKCPQWF  240

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              E ++L+ K+LDPNP  RI+ SK+M+++WF+K         P      +E      +  
Sbjct  241  SSEARRLITKLLDPNPSTRITTSKVMDSTWFKKSL-------PKTVRSKEEMEFEAFNGE  293

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNK-KPESRFTTQQPASTIVS  537
            +D +  D A    +P  LNAF IISLS  FDLS LF+  T + K E RF T +PAS+++S
Sbjct  294  ED-ANGDKA---KQPETLNAFHIISLSQGFDLSPLFEEKTREGKEELRFATTRPASSVIS  349

Query  538  KFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
            + EE+A + +F V+K D  V+LQG ++GRKG+LAI A+IF VTPSF VVEVKK +GDT+E
Sbjct  350  RLEEVAKAGNFNVKKSDSKVRLQGQERGRKGKLAIAADIFAVTPSFLVVEVKKDNGDTLE  409

Query  718  YRNFCEQELRPSLKDIIW  771
            Y  FC  ELRP+LKDI+W
Sbjct  410  YNQFCSNELRPALKDIVW  427



>ref|NP_001054905.1| Os05g0208100 [Oryza sativa Japonica Group]
 sp|Q60EY8.1|CIPKK_ORYSJ RecName: Full=CBL-interacting protein kinase 20; AltName: Full=OsCIPK20 
[Oryza sativa Japonica Group]
 gb|AAU90191.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16819.1| Os05g0208100 [Oryza sativa Japonica Group]
 gb|EAY96939.1| hypothetical protein OsI_18856 [Oryza sativa Indica Group]
 dbj|BAG97933.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62709.1| hypothetical protein OsJ_17512 [Oryza sativa Japonica Group]
Length=466

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 187/267 (70%), Gaps = 23/267 (9%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            +YVAPE+I  +GYDG  AD+WSCGVILF+LLAGYLP  DSNLMEMY+KI  G+FK P WF
Sbjct  186  SYVAPEIIGDKGYDGATADVWSCGVILFLLLAGYLPFFDSNLMEMYKKITNGEFKVPDWF  245

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             P+ + L++++LDPNP  RI++ +L+++ WF+K  T+    +       +E P +     
Sbjct  246  TPDARSLISRLLDPNPTTRITIDELVKHPWFKKGHTKRPASSNTMKLNEEEKPAN-----  300

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLF--DVDTNKKPESRFTTQQPASTIV  534
                    A  +MKP  LNAFDIISLS  FDLSG+F     +++  +  F T +PA+ IV
Sbjct  301  --------AAMNMKPASLNAFDIISLSQGFDLSGMFCCHGHSSRTQDQLFVTGKPATAIV  352

Query  535  SKFEEIAMSEHFQV-------QKKDGM-VKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
            S+ EEIA +EHF V       Q++DGM VKLQG K+GRKGQLAIDAEIFEV+PS +VVEV
Sbjct  353  SRLEEIAETEHFTVKKKQKKRQEEDGMAVKLQGWKEGRKGQLAIDAEIFEVSPSCYVVEV  412

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIW  771
            KK++GDT+EY+ FC ++LRPSL DI W
Sbjct  413  KKTAGDTLEYQAFCNRDLRPSLNDICW  439



>ref|XP_002517716.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF44648.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=457

 Score =   285 bits (730),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 188/262 (72%), Gaps = 5/262 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGV+L+VLLAGYLP  DSNLMEMYRKI + +FKCP WF
Sbjct  176  AYVAPEVINRRGYDGAKADIWSCGVVLYVLLAGYLPFHDSNLMEMYRKIGRAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFT--QLKPITPIADSQNDESPRSVLD  354
            P + ++L+ K+LDPNP  RIS++K+ E+SWF+K     Q K      D  + E  RS   
Sbjct  236  PQDARRLVFKMLDPNPNTRISIAKIKESSWFKKGLNSKQNKTEAETRDISHLERNRSGPS  295

Query  355  IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
              +  S S+    S+ P  LNAFDIISLS  FDLSGLFD +   + E+RFT+ QPAS I+
Sbjct  296  EINSVS-SEAKQESVNPPKLNAFDIISLSAGFDLSGLFDENPQLR-EARFTSMQPASVII  353

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK EEIA     ++ KKD G++K++  ++GRKG L+IDAEIFEVTP+FH+VEVKKS+GD 
Sbjct  354  SKLEEIAKRLRLKITKKDAGLLKMEALEEGRKGLLSIDAEIFEVTPNFHLVEVKKSNGDL  413

Query  712  MEYRNFCEQELRPSLKDIIWKW  777
             EY+   + +++P+L DI+  W
Sbjct  414  YEYQKILKDDIQPALHDIVCVW  435



>ref|XP_003636793.1| CBL-interacting protein kinase [Medicago truncatula]
 gb|KEH36611.1| CBL-interacting kinase [Medicago truncatula]
Length=445

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 147/273 (54%), Positives = 190/273 (70%), Gaps = 14/273 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPE+I K+GYDG KADIWSCGVILFVLLAG+LP  D NLMEMY+KI   DFK P+WF
Sbjct  176  AYVAPEIIRKKGYDGAKADIWSCGVILFVLLAGFLPFNDRNLMEMYKKIATADFKFPQWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLK--PITPIADSQNDESPRSVLD  354
              +VK+LL +ILDP+P  RI+++K+M+NSWF+K + Q++   ++P     +D     V +
Sbjct  236  HSDVKRLLYRILDPDPKTRITINKIMQNSWFRKGYKQIEGPHLSPTHGDISD-----VHN  290

Query  355  IFDDRST-SDPAGSS-----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQ  516
             FDD ST S P         MK  C NAFDIISLS   DLSGLF+ DT++   +RF T +
Sbjct  291  AFDDLSTLSSPMSVKDEQCPMKLYCFNAFDIISLSSGLDLSGLFEKDTSEGQHARFATNR  350

Query  517  PASTIVSKFEEIA-MSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVK  693
            P STIVSK EE A +   F+V K++G+V+++G + G   QL ID EIFEV  SF++VEV 
Sbjct  351  PPSTIVSKLEETAQLVGRFKVMKQNGIVRVEGFETGVSEQLTIDTEIFEVASSFYIVEVN  410

Query  694  KSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            K SGDT+EY  F  Q L+PSL +I+W  +G EQ
Sbjct  411  KISGDTVEYTKFWNQYLKPSLSEIVWDSQGYEQ  443



>ref|XP_003616004.1| CBL-interacting protein kinase [Medicago truncatula]
 gb|AES98962.1| CBL-interacting kinase [Medicago truncatula]
Length=474

 Score =   286 bits (731),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 191/284 (67%), Gaps = 25/284 (9%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGY+P  DSNLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVIKRKGYDGSKADIWSCGVVLFVLLAGYVPFNDSNLMEMYRKISKAEFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWF--------QKDFTQLKPITPIAD------  318
            P  VKKLL K+LDPNP  RIS+ K+   SWF        +K   + K I+ +A       
Sbjct  236  PKNVKKLLGKMLDPNPDTRISIDKIKHCSWFKHGSNGRPKKREEEKKTISSLATNSAAPT  295

Query  319  --------SQNDESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDV  474
                    S  D     V +  D    ++   S + P  +NAFDIISLS  F+L G F+ 
Sbjct  296  CQIEGESVSNTDTKLTIVTNHLDQMDETEKQESDL-PLSINAFDIISLSSGFNLCGFFE-  353

Query  475  DTNKKPESRFTTQQPASTIVSKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAE  651
            D+ +K E+RFT++QPASTI+S+ EEIA     +++K+  G++KL+G  +GRKG L+ DAE
Sbjct  354  DSFQKREARFTSKQPASTIISRLEEIAKRLKMKIKKRAAGLLKLEGVHEGRKGILSFDAE  413

Query  652  IFEVTPSFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            IFEVTP FH+VEVKKS+GDT+EY+      +RP+L+DI+W W+G
Sbjct  414  IFEVTPFFHLVEVKKSNGDTLEYQKILNDNIRPALQDIVWAWQG  457



>gb|KHG11871.1| CBL-interacting protein kinase 2 [Gossypium arboreum]
Length=450

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 188/264 (71%), Gaps = 23/264 (9%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI +RGYDG KADIWSCGVIL+VLLAGYLP +DSNLMEMYRKI KG+F  P WF
Sbjct  176  AYVAPEVINRRGYDGCKADIWSCGVILYVLLAGYLPFQDSNLMEMYRKIGKGEFNFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             P+V++L++KILDPNP  RIS+ K+MEN WF+K                D  P  V    
Sbjct  236  APDVRRLISKILDPNPKTRISMEKIMENPWFRKGL--------------DPKPELV----  277

Query  361  DDRSTSDPAGS--SMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D    +PA    +  P  LNAFDIISLS  FDLSGLF  +  +K E RFT+ + ASTI+
Sbjct  278  -DPEVKEPAIGLQTGTPCNLNAFDIISLSAGFDLSGLFR-EQEQKKEVRFTSNKTASTIL  335

Query  535  SKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E++A     +++KK  G++K++G K+GRKG L IDAEIFE+TP FH+VEVKKS+GDT
Sbjct  336  SKLEDVAKRLRLKIKKKGGGLMKMEGCKEGRKGVLGIDAEIFEITPFFHLVEVKKSNGDT  395

Query  712  MEYRNFCEQELRPSLKDIIWKWEG  783
            +EY+   +Q++RP+L DI+W W+G
Sbjct  396  LEYQKVMKQDIRPALSDIVWAWQG  419



>gb|KDP21674.1| hypothetical protein JCGZ_03345 [Jatropha curcas]
Length=453

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 191/271 (70%), Gaps = 22/271 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GY+G KADIWSCGVIL+VLLAGYLP  D+NL+ +Y+KI K ++K P WF
Sbjct  176  AYVAPEVISRKGYNGAKADIWSCGVILYVLLAGYLPFHDANLILLYKKISKAEYKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFT-----------QLKPITPIADSQN  327
             PE +KL+AK+LDPN   RIS++K+ E  WF+K              +L+P    A    
Sbjct  236  SPEARKLIAKMLDPNTSTRISIAKIKETHWFKKGLNSKAVQTNNEVKKLEPFVADASLGP  295

Query  328  DESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFT  507
            DE+  S L+  D +          +PT LNAFDIISLS  FDLSG F   + K+ E++FT
Sbjct  296  DENNTSFLE--DKKELG-------RPTSLNAFDIISLSNGFDLSGFF-TQSYKEKETKFT  345

Query  508  TQQPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVV  684
            +   ASTIVSK E+ A +   +V+K+D G++KL+G+++GRKG L+IDAEIFE TPSFH+V
Sbjct  346  SMHSASTIVSKLEDTAKTLRLEVKKRDGGLLKLEGSEEGRKGALSIDAEIFEFTPSFHLV  405

Query  685  EVKKSSGDTMEYRNFCEQELRPSLKDIIWKW  777
            E+KKSSGDT+EY+   E+ LRP+LKDI+W W
Sbjct  406  EMKKSSGDTLEYKQVLEEGLRPALKDIVWVW  436



>ref|XP_010423258.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 2-like 
[Camelina sativa]
Length=455

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 191/267 (72%), Gaps = 6/267 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  175  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPTWF  234

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEVK+LL K+LDP+   RI+++K+ E+SWF+K   QLK    +     + +  S ++  
Sbjct  235  APEVKRLLCKMLDPHHETRITIAKIKESSWFRKGL-QLKQ-RKMEKQVREAAANSPVEAA  292

Query  361  DDRSTSDPAGSSMKPTC--LNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
                 S+   S   P    LNAFDII+LS  FDL+GL   D   K ESRF +++PAS I+
Sbjct  293  GGAGPSENGESHEPPQLANLNAFDIIALSMGFDLAGLLG-DLYDKRESRFASRKPASEII  351

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E++A     +++K+D G+ KL+  K+GRKG L +DAEIF+VTP+FH+VEVKK +GDT
Sbjct  352  SKLEDVAKCLKLKIRKQDAGLFKLERLKEGRKGVLTMDAEIFQVTPTFHLVEVKKCNGDT  411

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +EY+   E++LRP+L DI+W W+G ++
Sbjct  412  IEYQKLVEEDLRPALADIVWVWQGEKE  438



>emb|CDP13925.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 193/270 (71%), Gaps = 9/270 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVLLAGYLP  +SNLM+MYRKI K ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADIWSCGVILFVLLAGYLPFHESNLMDMYRKISKAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            PPEV++LL++ILDP+P  RIS++K+MEN+WF+K   Q      I D    ++P +    F
Sbjct  236  PPEVRRLLSRILDPSPYTRISIAKIMENTWFRKGLDQRDLRASIEDK--GKNPLNADIAF  293

Query  361  D-DRSTSDPAGSSM----KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            D +   S P+  +     KPT  NAFDIISLS  FDLSGLF V  ++K E +F +++ A 
Sbjct  294  DLNECCSGPSSETKLEVPKPTNFNAFDIISLSTGFDLSGLF-VRNDQKEEVQFISKKSAP  352

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            +++SK EEIA     +V K + G++KL+     R G ++ID EIFE+T SFH+VEV+KSS
Sbjct  353  SLISKIEEIARRLKLKVMKNEGGVMKLEQPNDCRNGTVSIDVEIFEITLSFHLVEVRKSS  412

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT++Y    +Q L+P+L +I+W W+G +Q
Sbjct  413  GDTLDYLKVLQQNLKPALTEIVWAWQGEQQ  442



>ref|XP_004506437.1| PREDICTED: CBL-interacting protein kinase 2-like [Cicer arietinum]
Length=464

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 187/266 (70%), Gaps = 6/266 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVIL+VLLAG+LP RDSNLMEMYRKI K +FK P WF
Sbjct  176  AYVAPEVINRKGYDGIKADIWSCGVILYVLLAGFLPFRDSNLMEMYRKIGKAEFKFPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              +V++LL+KILDPNP  RISL+K+ME+SWF+K    L+          +  P     +F
Sbjct  236  ASDVRRLLSKILDPNPKTRISLAKIMESSWFKKG---LEKHIDTNKEYKELPPLDADGVF  292

Query  361  DDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVSK  540
                  D    S     LNAFDIIS S  FDLSGLF+ + ++K E RFT+ +PAS I+SK
Sbjct  293  GACENGDHIELSKPCNNLNAFDIISFSSGFDLSGLFE-EKDRKTEVRFTSNKPASIIISK  351

Query  541  FEEIAMS-EHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTME  717
            FEEI  S      +K  G+ K +G+K+GRKG L  DAEIFE+TP FH+VE+KKS GDT+E
Sbjct  352  FEEICQSLGLKVKKKGGGLFKFEGSKEGRKGHLGFDAEIFEITPVFHLVEMKKSDGDTLE  411

Query  718  YRNFCEQELRPSLKDIIWKWEGSEQP  795
            Y+   ++ +RP+LKDI+W W+G EQP
Sbjct  412  YQKLLKENVRPALKDIVWTWQG-EQP  436



>gb|AFW03555.1| CBL interacting protein kinase 14 [Brachypodium distachyon]
Length=444

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 191/266 (72%), Gaps = 8/266 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+K GYDG K+DIWSCGV+LFVL+AGYLP +  NLMEMY KI +GDFKCP W 
Sbjct  177  AYVAPEVISKGGYDGAKSDIWSCGVVLFVLVAGYLPFQGQNLMEMYMKIEQGDFKCPGWV  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQK--DFTQLKPITPIADSQNDESPRSVLD  354
              +++KLL KI+DP+P +RIS+ K+ E++WF+K  + T      PI ++  + +P     
Sbjct  237  SIKLRKLLHKIMDPDPSKRISIQKIKESTWFRKGPEETLTMERIPIENASTNAAP----T  292

Query  355  IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
            +   R  S      +  T LNAF+IIS S  FDLSGLF V+   K E+RFT++ PAS I+
Sbjct  293  LMRRRKNSHGDAKPLAVTNLNAFEIISFSTGFDLSGLF-VEKESKKETRFTSENPASAII  351

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E++A + + +V+KKD G+VK+QG K+GR G +  D+EIF++TPS+H++E+K++SGD+
Sbjct  352  SKLEDVAKALNLRVRKKDNGVVKMQGRKEGRNGVVQFDSEIFQITPSYHLIEMKQTSGDS  411

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSE  789
            +EY+   E  +RP+LKDI+W W G +
Sbjct  412  LEYQKLLEDGIRPALKDIVWAWHGDD  437



>ref|XP_006594550.1| PREDICTED: CBL-interacting protein kinase 5-like [Glycine max]
 gb|KHN08425.1| CBL-interacting protein kinase 5 [Glycine soja]
Length=451

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/281 (53%), Positives = 193/281 (69%), Gaps = 24/281 (9%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWSCGVILFVLLAG+LP  D NLM+MY+KIIK DFK P WF
Sbjct  176  AYVAPEVIKKKGYDGAKADIWSCGVILFVLLAGFLPFNDKNLMQMYKKIIKADFKFPHWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKP--ITPIADSQNDESPRSVLD  354
              +VK LL +ILDPNP  RI ++K++++ WF+K + QL+   + P+       SPR+  D
Sbjct  236  SSDVKMLLYRILDPNPKTRIGIAKIVQSRWFRKGYVQLEAFQLPPL-------SPRNAKD  288

Query  355  IFDDRST--------------SDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKP  492
            I D ++               S+   S MK    NAFD+IS+S  FDLSGLF+ + N + 
Sbjct  289  ISDVQAAFASSSDSDSDGSPMSNKEDSPMKLYRFNAFDLISISSGFDLSGLFEDNQNGRQ  348

Query  493  ESRFTTQQPASTIVSKFEEIA-MSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTP  669
             +RFTT++P STIVS  EEIA +   F++ KK+G+V+L+  K G  GQL IDAEIFEVT 
Sbjct  349  LARFTTRKPPSTIVSMLEEIAQIDGRFKILKKNGVVRLEEYKAGINGQLTIDAEIFEVTS  408

Query  670  SFHVVEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            SFHVVEV K +G+T+EY  F +Q L+PSL +++W W+  EQ
Sbjct  409  SFHVVEVTKIAGNTLEYWKFWDQYLKPSLNEMVWVWQRYEQ  449



>gb|AFK39318.1| unknown [Lotus japonicus]
Length=443

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 191/270 (71%), Gaps = 10/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            +YVAPEVI K+GYDG +ADIWSCGVIL+VLLAG+LP  D NLMEMYRKI   DFK P WF
Sbjct  176  SYVAPEVIKKKGYDGARADIWSCGVILYVLLAGFLPFNDKNLMEMYRKITTADFKFPPWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFT-----QLKPITPIADSQNDESPRS  345
              + K+LL +ILDPNP  RI+++K+M+++WF K +      QL P++P      D   ++
Sbjct  236  RSDAKRLLYRILDPNPRTRINIAKIMQSTWFTKGYKEIETPQLPPLSPTGHDVPD--VQA  293

Query  346  VLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            + D     S   P  +++KP C NAFD+ISLS  FDLS LF+ D +++ ++ FTT++P S
Sbjct  294  IFDSSSSDSEDSP--TAVKPYCFNAFDLISLSSGFDLSSLFEKDNSERQQAMFTTRKPPS  351

Query  526  TIVSKFEEIAMSE-HFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
            T+VSK EEIAM +  F+V KK   V+L+ +K G + QL ID EIFEVT SF++VEVKK +
Sbjct  352  TVVSKLEEIAMIDGRFEVMKKSWAVRLERSKAGNRDQLTIDTEIFEVTSSFYIVEVKKIA  411

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EYR F +Q L+P L +I W W+G EQ
Sbjct  412  GDTLEYRKFWDQCLKPCLNEIAWVWQGYEQ  441



>ref|XP_004490705.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 2-like 
[Cicer arietinum]
Length=455

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 194/274 (71%), Gaps = 21/274 (8%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGY+P  D+NLMEMY+K+ KGDFKCP WF
Sbjct  176  AYVAPEVIKRKGYDGAKADIWSCGVVLFVLLAGYVPFNDTNLMEMYKKVSKGDFKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQ------------KDFTQLKPITPIADSQ  324
            P  VKKL+ K+LDPNP  RIS+ K+   SWF+            ++ T L  +T     Q
Sbjct  236  PKNVKKLMCKMLDPNPDTRISIDKIKRCSWFKYGANGRQKKDEGENKTTLSCVTTNPSDQ  295

Query  325  NDESPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRF  504
             DE+    L++    +  +P    + P  +NAFDIISLS  F+L G+F+ D+ KK E++F
Sbjct  296  RDETRSDDLEV---EAKEEP----VVPVSINAFDIISLSSGFNLCGIFE-DSFKKREAKF  347

Query  505  TTQQPASTIVSKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHV  681
            T++QPAS I+S+ EEIA     +++K+  G++KL+   +GRKG LAIDAEIFEVTP FH+
Sbjct  348  TSRQPASVIISRLEEIAKRLKLKIKKRAAGLLKLERVDEGRKGNLAIDAEIFEVTPFFHL  407

Query  682  VEVKKSSGDTMEYRNFCEQELRPSLKDIIWKWEG  783
            VEVKKS+GDT+EY     +++RP+L+DI+W W+G
Sbjct  408  VEVKKSNGDTLEYHKILNEDIRPALQDIVWVWQG  441



>ref|XP_010491305.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 2-like 
[Camelina sativa]
Length=454

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 190/268 (71%), Gaps = 11/268 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPTWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEVK+LL K+LDP+   RI+++K+ E+SWF+K   QLK        +   +   V    
Sbjct  236  APEVKRLLCKMLDPHHETRITIAKIKESSWFRKGL-QLKQRKMEKQVREAAANNPV----  290

Query  361  DDRSTSDPAGSSMKP---TCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
             + +     G S +P     LNAFDII+LS  FDL GLF  D   K ESRF +++PAS I
Sbjct  291  -EAAGPSENGESHEPPQLANLNAFDIIALSMGFDLGGLFG-DLFDKRESRFASRKPASEI  348

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
            +SK E++A     +++K+D G+ KL+  K+GRKG L +DAEIF+VTP+FH+VEVKK +GD
Sbjct  349  ISKLEDVAKCLKLKIRKQDAGLFKLERLKEGRKGVLTMDAEIFQVTPTFHLVEVKKCNGD  408

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            T+EY+   E++LRP+L DI+W W+G ++
Sbjct  409  TIEYQKLVEEDLRPALADIVWVWQGEKE  436



>ref|XP_009403856.1| PREDICTED: CBL-interacting protein kinase 18-like [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 191/267 (72%), Gaps = 5/267 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KADIWSCGVILFVL+AGYLP  DSNLMEMYRKI+K DFKC   F
Sbjct  178  AYVAPEVISRKGYDGAKADIWSCGVILFVLMAGYLPFLDSNLMEMYRKIVKADFKCMGLF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
            P +V++LL +ILDPNP  R+ ++K+MENSWF+K     K +     +Q  +    V ++F
Sbjct  238  PLDVRRLLVRILDPNPNTRMVIAKIMENSWFRKGLDG-KLLNDKKATQEIDPSDDVDEVF  296

Query  361  DD-RSTSDPAGSSM-KPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
            D   S    A   M K   LNAFDIIS S  FDLSGLF+ +T+ + E RF + QPAS+I+
Sbjct  297  DSCGSNGVEAKEEMGKLANLNAFDIISHSAGFDLSGLFE-ETDHRREVRFASDQPASSII  355

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK EEIA     +V+KKD G+++++G+K GR+G L IDAEIFE+ P FH+VE+KK+ GD 
Sbjct  356  SKLEEIAKRLKLKVKKKDYGVLRMEGSKVGRRGVLGIDAEIFEIAPKFHIVEIKKTQGDA  415

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +EY     Q++RP+LK I+W W+  +Q
Sbjct  416  LEYEEMWTQDIRPALKHIVWTWQCDQQ  442



>gb|AHB60733.1| CBL-interacting serine/threonine-protein kinase 6, partial [Populus 
x canadensis]
Length=392

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 184/259 (71%), Gaps = 14/259 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGVIL+ LLAG+LP +D N++ MYRKI +GDFKCP+WF
Sbjct  136  AYVAPEVIGKKGYDGAKADLWSCGVILYALLAGFLPFQDDNIVAMYRKIYRGDFKCPQWF  195

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              E ++L+ K+LDPNP  RI+ SK+M+++WF+K      P T  +  + +       + F
Sbjct  196  SSEARRLITKLLDPNPSTRITTSKVMDSTWFKKSL----PKTVRSKEEME------FEAF  245

Query  361  DDRSTSDPAGSSMK-PTCLNAFDIISLSPSFDLSGLFDVDTNK-KPESRFTTQQPASTIV  534
            +     D  G   K P  LNAF IISLS  FDLS LF+  T + K E RF T +PAS+++
Sbjct  246  N--GEEDANGDKAKQPETLNAFHIISLSQGFDLSPLFEEKTREGKEELRFATTRPASSVI  303

Query  535  SKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            S+ EE+A + +F V+K D  V+LQG ++GRKG+LAI A+IF VTPSF VVEVKK +GDT+
Sbjct  304  SRLEEVAKAGNFNVKKSDSKVRLQGQERGRKGKLAIAADIFAVTPSFLVVEVKKDNGDTL  363

Query  715  EYRNFCEQELRPSLKDIIW  771
            EY  FC  ELRP+LKDI+W
Sbjct  364  EYNQFCSNELRPALKDIVW  382



>ref|XP_003553229.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
isoform X1 [Glycine max]
 ref|XP_006602065.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
isoform X2 [Glycine max]
 ref|XP_006602066.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
isoform X3 [Glycine max]
Length=462

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 191/262 (73%), Gaps = 5/262 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCG++LFVLLAGYLP  D NL+EMYRKI K + KCP WF
Sbjct  176  AYVAPEVIKRKGYDGTKADIWSCGIVLFVLLAGYLPFHDPNLIEMYRKISKAELKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSV-LDI  357
            PPEV +LL  +L+PNP  RI +S + ENSWF+K    +K   P+ ++    S  +V LD 
Sbjct  236  PPEVCELLGMMLNPNPETRIPISTIRENSWFKKG-QNIKNKRPVVENNTVSSSSTVLLDQ  294

Query  358  FD-DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D D   ++  G S+ P  +NAFDIIS S  FDLS  FD ++ KK E+RF+++ PA+ I+
Sbjct  295  NDCDGLAAEANGESVVPLSINAFDIISRSVGFDLSRFFD-ESFKKKEARFSSRLPANVII  353

Query  535  SKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E+IA     +++KK  G++KL+   +GRKG L+IDAEIFEVTP FH+VEVKKS+GDT
Sbjct  354  SKLEDIANQLRMKIKKKAAGLLKLESLNEGRKGVLSIDAEIFEVTPCFHMVEVKKSNGDT  413

Query  712  MEYRNFCEQELRPSLKDIIWKW  777
            +EY+   ++++RP+L+DI+W W
Sbjct  414  LEYQKILKEDIRPALQDIVWVW  435



>ref|XP_011083993.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Sesamum indicum]
Length=423

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 180/259 (69%), Gaps = 25/259 (10%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KADIWSCGVIL+VLLAG+LP +D N+M MYRKI +GDFKCP WF
Sbjct  178  AYVAPEVIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIMSMYRKIYRGDFKCPPWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PE +KL+ K+LDPNP  RIS++K+M++ WF+K                   PR +    
Sbjct  238  SPEARKLITKMLDPNPSTRISIAKIMDSPWFKKSM-----------------PRCL----  276

Query  361  DDRSTSDPA-GSSMKPTCLNAFDIISLSPSFDLSGLFDVDTN-KKPESRFTTQQPASTIV  534
               +  +P  G   +   LNAF IISLS  FDLS LF+     +K E RF T +PAS+++
Sbjct  277  --STKEEPEFGKGEETKTLNAFHIISLSEGFDLSPLFEEKKRVEKGELRFATTRPASSVI  334

Query  535  SKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            SK EE+A +++F V+K D  V+LQG + GRKG+L I A+IF VTPSF VVEVKKSSGDT+
Sbjct  335  SKIEEVAKTKNFSVKKSDSCVRLQGQESGRKGKLGIAADIFAVTPSFLVVEVKKSSGDTL  394

Query  715  EYRNFCEQELRPSLKDIIW  771
            EY  FC +ELRP+LKDI W
Sbjct  395  EYNQFCSKELRPALKDIEW  413



>ref|XP_010452654.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 2 
[Camelina sativa]
Length=456

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 196/270 (73%), Gaps = 12/270 (4%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KAD+WSCGV+LFVLLAGYLP  DSNLMEMYRKI K DFKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADVWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKCPTWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEVK+LL K+LDP+   RI+++K+ E+SWF+K   QLK      + Q  E+  +  +  
Sbjct  236  APEVKRLLCKMLDPHHETRITIAKIKESSWFRKGL-QLKQRK--MEKQVREAAAN--NPV  290

Query  361  DDRSTSDPAGS--SMKP---TCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAS  525
            +    + P+G+  S +P     LNAFDII+LS  FDL GLF  D   K ESRF +++PAS
Sbjct  291  EAAGGAGPSGNGESHEPPQLANLNAFDIIALSMGFDLGGLFG-DLFDKRESRFASRKPAS  349

Query  526  TIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSS  702
             I+SK E++A     +++K+D G+ KL+  K+GRKG L +DAEIF+VTP+FH+VEVKK +
Sbjct  350  EIISKLEDVAKCLKLKIRKQDAGLFKLERLKEGRKGVLTMDAEIFQVTPTFHLVEVKKCN  409

Query  703  GDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            GDT+EY+   E++LRP+L DI+W W+G ++
Sbjct  410  GDTIEYQKLVEEDLRPALADIVWVWQGEKE  439



>gb|KEH34435.1| CBL-interacting kinase [Medicago truncatula]
Length=465

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 189/262 (72%), Gaps = 4/262 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCG++LFVLLAGYLP  DSNL+EMYRKI K + KCP WF
Sbjct  178  AYVAPEVIKRKGYDGAKADIWSCGIVLFVLLAGYLPFHDSNLIEMYRKIHKAELKCPGWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             PEV KLL+ ILDPNP  RIS+ K+ E+ WF+ + T       + ++    S   V D  
Sbjct  238  RPEVCKLLSDILDPNPDTRISIEKIKEHCWFKNELTARNKKQLLENNTVSSSSSVVSDQN  297

Query  361  D--DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
            D  D   S+    S+ P  +NAFDIISLS SFDLS  F  D  +K E+RF+++ PAS I+
Sbjct  298  DENDGPESEAKEESVVPISINAFDIISLSASFDLSRFFK-DGVQKREARFSSKLPASVII  356

Query  535  SKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E+IA     +++KK  G++KL+G  +GRKG L+IDAEIFEVTP+FH+VEVKKS+GDT
Sbjct  357  SKIEDIAKQLRMKIKKKAAGLLKLEGFDEGRKGVLSIDAEIFEVTPNFHLVEVKKSNGDT  416

Query  712  MEYRNFCEQELRPSLKDIIWKW  777
            +EY+   ++++RP+L+DI+W W
Sbjct  417  LEYQKILKEDIRPALQDIVWVW  438



>gb|KHN48398.1| CBL-interacting serine/threonine-protein kinase 10 [Glycine soja]
Length=462

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 191/262 (73%), Gaps = 5/262 (2%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCG++LFVLLAGYLP  D NL+EMYRKI K + KCP WF
Sbjct  176  AYVAPEVIKRKGYDGTKADIWSCGIVLFVLLAGYLPFHDPNLIEMYRKISKAELKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSV-LDI  357
            PPEV +LL  +L+PNP  RI +S + ENSWF+K    +K   P+ ++    S  +V LD 
Sbjct  236  PPEVCELLGMMLNPNPETRIPISTIRENSWFKKG-QNIKNKRPVVENNTVSSSSTVLLDQ  294

Query  358  FD-DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
             D D   ++  G S+ P  +NAFDIIS S  FDLS  FD ++ KK E+RF+++ PA+ I+
Sbjct  295  NDCDGLAAEANGESVVPLSINAFDIISRSVGFDLSRFFD-ESFKKKEARFSSRLPANVII  353

Query  535  SKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E+IA     +++KK  G++KL+   +GRKG L+IDAEIFEVTP FH+VEVKKS+GDT
Sbjct  354  SKLEDIANQLRMKIKKKAAGLLKLESLNEGRKGVLSIDAEIFEVTPCFHMVEVKKSNGDT  413

Query  712  MEYRNFCEQELRPSLKDIIWKW  777
            +EY+   ++++RP+L+DI+W W
Sbjct  414  LEYQKILKEDIRPALQDIVWIW  435



>ref|XP_011084844.1| PREDICTED: CBL-interacting protein kinase 18-like [Sesamum indicum]
Length=442

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 183/269 (68%), Gaps = 9/269 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGVILFVLL GYLP  D NL+EMYRKI + ++KCP W 
Sbjct  176  AYVAPEVIGRKGYDGAKADIWSCGVILFVLLTGYLPFHDPNLIEMYRKISRAEYKCPPWL  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
             P+V++LL++ILDPNP  RIS+ ++ME  WFQK +          D   +E P +  D  
Sbjct  236  SPQVRRLLSRILDPNPQTRISIEEIMETPWFQKGYDSKATRIKTGD---NEMPHTDTDSV  292

Query  361  DDRSTSDPAGSS----MKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPAST  528
               S+ D A  +     +P  LNAFDIISLS  FDLSG F V  ++K E RFT+ +  S 
Sbjct  293  SSHSSPDIAAETKVELARPASLNAFDIISLSTGFDLSGFF-VRKDQKDEVRFTSSKSTSA  351

Query  529  IVSKFEEIAMSEHFQVQKK-DGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSG  705
            IVSK EEIA      V+KK DG ++L+G+ +G    L+ID EIFE+  SFHVVEVKKSSG
Sbjct  352  IVSKLEEIASRLRLSVKKKDDGSMRLEGSDEGWNWTLSIDVEIFEIASSFHVVEVKKSSG  411

Query  706  DTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            DT++Y+N   Q++RP+L +II  WEG +Q
Sbjct  412  DTLDYQNMLRQDIRPALGEIICAWEGEQQ  440



>ref|XP_011033439.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Populus euphratica]
Length=437

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 185/259 (71%), Gaps = 14/259 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI K+GYDG KAD+WSCGVIL+VLL+G+LP +D N++ MYRKI +GDFKCP+WF
Sbjct  181  AYVAPEVIGKKGYDGAKADLWSCGVILYVLLSGFLPFQDDNIVAMYRKIYRGDFKCPQWF  240

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDESPRSVLDIF  360
              E ++L+ K+LDPNP  RI+ SK+M+++WF+K      P T  +  + +       + F
Sbjct  241  SSEARRLITKLLDPNPSTRITTSKVMDSTWFKKSL----PKTVRSKEEME------FEAF  290

Query  361  DDRSTSDPAGSSMK-PTCLNAFDIISLSPSFDLSGLFDVDTNK-KPESRFTTQQPASTIV  534
            +     D  G   K P  LNAF IISLS  FDLS LF+  T + K E RF T +PAS+++
Sbjct  291  N--GEEDANGDKAKQPETLNAFHIISLSQGFDLSPLFEEKTREGKEELRFATTRPASSVI  348

Query  535  SKFEEIAMSEHFQVQKKDGMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            S+ EE+A + +F V+K D  V+LQG ++GRKG+LAI A+IF VTPSF VVEVKK +GDT+
Sbjct  349  SRLEEVAKAGNFNVKKSDSKVRLQGQERGRKGKLAIAADIFAVTPSFLVVEVKKDNGDTL  408

Query  715  EYRNFCEQELRPSLKDIIW  771
            EY  FC  ELRP+LKDI+W
Sbjct  409  EYNQFCSNELRPALKDIVW  427



>ref|XP_010238807.1| PREDICTED: CBL-interacting protein kinase 15-like [Brachypodium 
distachyon]
Length=444

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 191/266 (72%), Gaps = 8/266 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+K GYDG K+DIWSCGV+LFVL+AGYLP +  NLMEMY KI +GDFKCP W 
Sbjct  177  AYVAPEVISKGGYDGAKSDIWSCGVVLFVLVAGYLPFQGQNLMEMYMKIEQGDFKCPGWV  236

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQK--DFTQLKPITPIADSQNDESPRSVLD  354
              +++KLL KI+DP+P +RIS+ K+ E++WF+K  + T      PI ++  + +P     
Sbjct  237  SIKLRKLLHKIMDPDPSKRISIQKIKESTWFRKGPEETLTMERIPIENAPTNAAP----T  292

Query  355  IFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIV  534
            +   R  S      +  T LNAF+IIS S  FDLSGLF V+   K E+RFT++ PAS I+
Sbjct  293  LMRRRKNSHGDAKPLAVTNLNAFEIISFSTGFDLSGLF-VEKESKKETRFTSENPASAII  351

Query  535  SKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDT  711
            SK E++A + + +V+KKD G+VK+QG K+GR G +  D+EIF++TPS+H++E+K++SGD+
Sbjct  352  SKLEDVAKALNLRVRKKDNGVVKMQGRKEGRNGVVQFDSEIFQITPSYHLIEMKQTSGDS  411

Query  712  MEYRNFCEQELRPSLKDIIWKWEGSE  789
            +EY+   E  +RP+LKDI+W W G +
Sbjct  412  LEYQKLLEDGIRPALKDIVWAWHGDD  437



>ref|XP_008808322.1| PREDICTED: CBL-interacting protein kinase 18-like [Phoenix dactylifera]
Length=446

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 193/268 (72%), Gaps = 8/268 (3%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWS GVILFVLLAG LP  D NLMEMYRKI K +FKCP WF
Sbjct  178  AYVAPEVIRRKGYDGAKADIWSSGVILFVLLAGSLPFHDPNLMEMYRKIGKAEFKCPIWF  237

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
            P +V++LL ++L+PNP  RIS++K+MEN WF+K    L      +D++  E  P  V  +
Sbjct  238  PSDVRRLLLRVLNPNPSTRISIAKIMENPWFRKG---LDDRLLESDAETKEIVPVDVNAV  294

Query  358  FD--DRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTI  531
            F+  D +  +      K   LNAFDIISLS  FDLSGLF+ +T+ + E+RF + QPASTI
Sbjct  295  FNPSDGNMVEGKQEMGKLGNLNAFDIISLSAGFDLSGLFE-ETDHRREARFISSQPASTI  353

Query  532  VSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGD  708
              K E  A     +V+KKD G++K++G+  GRKG LAIDAEIFEVTP FH+VE+KK++GD
Sbjct  354  FVKLENTAKRLRLKVKKKDSGVLKMEGSTAGRKGVLAIDAEIFEVTPLFHLVEIKKTNGD  413

Query  709  TMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            T+EY+   +Q +RP+LKDI+W W+G +Q
Sbjct  414  TLEYQKMLKQGIRPALKDIVWAWQGEQQ  441



>ref|XP_002873295.1| cbl-interacting protein kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49554.1| cbl-interacting protein kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=457

 Score =   283 bits (723),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 192/272 (71%), Gaps = 15/272 (6%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI ++GYDG KADIWSCGV+LFVLLAGYLP  DSNLMEMYRKI K +FKCP WF
Sbjct  176  AYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKAEFKCPSWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDF------TQLKPITPIADSQND-ESP  339
             PEVK+LL K+ DPN   RI+++K+ E+SWF+K         +      + ++ N  E+ 
Sbjct  236  APEVKRLLCKMFDPNHETRITIAKIKESSWFRKGLHLKQKKMEKMEKQQVREATNHMEAG  295

Query  340  RSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQP  519
             S L+  ++R   +P     +   LNAFDII+LS  F L+GLF  D   K ESRF +Q+P
Sbjct  296  GSGLN--ENRENHEPP----RLATLNAFDIIALSTGFGLAGLFG-DLYDKRESRFASQKP  348

Query  520  ASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKK  696
            AS I+SK EE+A     +++K+  G+ KL+  K+G+KG L +DAEIF+VTP+FH+VEVKK
Sbjct  349  ASEIISKLEEVAKYLKLKIRKQGAGVFKLERLKEGKKGILTMDAEIFQVTPTFHLVEVKK  408

Query  697  SSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
             +GDTMEY+   E++LRP+L DI+W W+G ++
Sbjct  409  YNGDTMEYQKLMEEDLRPALADIVWVWQGEKE  440



>ref|XP_011076604.1| PREDICTED: CBL-interacting protein kinase 2-like [Sesamum indicum]
 ref|XP_011076605.1| PREDICTED: CBL-interacting protein kinase 2-like [Sesamum indicum]
Length=444

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 189/266 (71%), Gaps = 3/266 (1%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG KAD+WSCGVILFVLLAGYLP  D+NLMEMYRKI + ++KCP WF
Sbjct  176  AYVAPEVISRKGYDGAKADVWSCGVILFVLLAGYLPFYDANLMEMYRKISRAEYKCPNWF  235

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQKDFTQLKPITPIADSQNDE-SPRSVLDI  357
            PPEV++L  +ILDPNP  RIS++K+ME SWF+K        T   D +       +VL  
Sbjct  236  PPEVRRLFMRILDPNPNSRISIAKIMEKSWFRKGLDSKDTGTSAGDIEKRPIDIDAVLKP  295

Query  358  FDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQQPASTIVS  537
             D  + +       KPT LNAFDIISLS  FDLSGLF V  ++K E +FT+ + AS I+S
Sbjct  296  SDCDNIAPTKPELAKPTNLNAFDIISLSTGFDLSGLF-VSNDQKDEVQFTSTKSASFIMS  354

Query  538  KFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEVKKSSGDTM  714
            K E+IA    F++ KKD G ++++G+   R   L++D  IFE++PSF++VE+ KSSGD++
Sbjct  355  KLEDIARLLRFELTKKDQGSMRIEGSNDSRNATLSVDVTIFEISPSFYLVELTKSSGDSI  414

Query  715  EYRNFCEQELRPSLKDIIWKWEGSEQ  792
            +Y+    Q++RP+L++I+W W+G +Q
Sbjct  415  DYQRLLRQKIRPALREIVWAWQGEQQ  440



>ref|NP_001055223.1| Os05g0332300 [Oryza sativa Japonica Group]
 sp|Q5W736.1|CIPKI_ORYSJ RecName: Full=CBL-interacting protein kinase 18; AltName: Full=OsCIPK18 
[Oryza sativa Japonica Group]
 gb|AAV43835.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|AAV43911.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF17137.1| Os05g0332300 [Oryza sativa Japonica Group]
 gb|ACD76981.1| CBL-interacting protein kinase 18 [Oryza sativa Japonica Group]
 gb|ACD76982.1| CBL-interacting protein kinase 22 [Oryza sativa Japonica Group]
 dbj|BAG95024.1| unnamed protein product [Oryza sativa Japonica Group]
Length=457

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 197/274 (72%), Gaps = 15/274 (5%)
 Frame = +1

Query  1    AYVAPEVITKRGYDGEKADIWSCGVILFVLLAGYLPLRDSNLMEMYRKIIKGDFKCPKWF  180
            AYVAPEVI+++GYDG K D WSCGVILFVL+AGYLP +DSNLMEMYRKI K +FKCP WF
Sbjct  179  AYVAPEVISRKGYDGVKVDTWSCGVILFVLMAGYLPFQDSNLMEMYRKIGKAEFKCPAWF  238

Query  181  PPEVKKLLAKILDPNPIRRISLSKLMENSWFQ---------KDFTQLKPITPIADSQNDE  333
              +V+KL+++ILDPNP  R+ ++K+ME  WF+         K+    +P+T +AD  N  
Sbjct  239  SSDVRKLVSRILDPNPRSRMPITKIMETYWFKKGLDSKLILKNVETNEPVTALADV-NVV  297

Query  334  SPRSVLDIFDDRSTSDPAGSSMKPTCLNAFDIISLSPSFDLSGLFDVDTNKKPESRFTTQ  513
                             AG   K T LNAFDIISLS  FDLSGLF+ +T+KK E+RFT+ 
Sbjct  298  FSSMGSSSSKKTEEKQDAG---KLTNLNAFDIISLSEGFDLSGLFE-ETDKKKEARFTSS  353

Query  514  QPASTIVSKFEEIAMSEHFQVQKKD-GMVKLQGNKQGRKGQLAIDAEIFEVTPSFHVVEV  690
            Q AS I+SK E++A      V+KK+ G++K++G  +GRKG LAIDAEIFEVTPSFH+VE+
Sbjct  354  QSASAIISKLEDVASCSKLTVKKKEGGVLKMEGASEGRKGVLAIDAEIFEVTPSFHLVEI  413

Query  691  KKSSGDTMEYRNFCEQELRPSLKDIIWKWEGSEQ  792
            KK++GDT+EY++  +++++P+LKDI+W W+G  Q
Sbjct  414  KKNNGDTLEYQHLWKEDMKPALKDIVWAWQGERQ  447



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2205876588188