BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6420_g2_i1 len=699 path=[2441:0-698]

Length=699
                                                                      Score     E

ref|XP_004236068.1|  PREDICTED: COBRA-like protein 4                    378   9e-127   
ref|XP_009606716.1|  PREDICTED: COBRA-like protein 4                    379   1e-126   
ref|XP_006345105.1|  PREDICTED: COBRA-like protein 4-like               377   3e-126   
ref|XP_009780773.1|  PREDICTED: COBRA-like protein 4                    374   1e-124   
gb|EYU23624.1|  hypothetical protein MIMGU_mgv1a006366mg                371   5e-124   
ref|XP_006374429.1|  phytochelatin synthetase-like family protein       369   3e-123   
ref|XP_007032846.1|  COBRA-like extracellular glycosyl-phosphatid...    365   7e-122   
ref|XP_008393239.1|  PREDICTED: COBRA-like protein 4                    364   2e-121   
ref|XP_011006293.1|  PREDICTED: COBRA-like protein 4                    364   4e-121   
ref|XP_008351868.1|  PREDICTED: COBRA-like protein 4                    364   6e-121   
gb|KHG07276.1|  COBRA-like protein 4                                    362   1e-120   
ref|XP_010260547.1|  PREDICTED: COBRA-like protein 4                    363   1e-120   
ref|XP_010037255.1|  PREDICTED: COBRA-like protein 4                    363   1e-120   
ref|XP_002514628.1|  Protein COBRA precursor, putative                  363   1e-120   Ricinus communis
gb|AFZ78569.1|  COBRA-like protein                                      362   2e-120   
ref|XP_008453301.1|  PREDICTED: COBRA-like protein 4                    362   3e-120   
gb|KDP31374.1|  hypothetical protein JCGZ_11750                         362   4e-120   
ref|XP_011087370.1|  PREDICTED: COBRA-like protein 4                    360   5e-120   
ref|XP_010257979.1|  PREDICTED: COBRA-like protein 4                    362   5e-120   
gb|KEH21749.1|  COBRA-like protein 2 precursor                          360   5e-120   
ref|XP_009589606.1|  PREDICTED: COBRA-like protein 4                    360   9e-120   
ref|XP_010660571.1|  PREDICTED: COBRA-like protein 4                    360   1e-119   
gb|KGN63776.1|  hypothetical protein Csa_1G015700                       360   2e-119   
ref|XP_011099033.1|  PREDICTED: COBRA-like protein 4                    359   2e-119   
ref|XP_007209118.1|  hypothetical protein PRUPE_ppa005430mg             360   2e-119   
ref|XP_009338030.1|  PREDICTED: COBRA-like protein 4                    360   2e-119   
ref|NP_001242075.1|  uncharacterized protein LOC100783410 precursor     358   2e-119   
gb|KHN30324.1|  COBRA-like protein 4                                    358   3e-119   
ref|XP_010099317.1|  hypothetical protein L484_018179                   358   5e-119   
ref|XP_004299286.1|  PREDICTED: COBRA-like protein 4-like               358   5e-119   
ref|XP_007139432.1|  hypothetical protein PHAVU_008G029000g             358   5e-119   
ref|XP_009126060.1|  PREDICTED: COBRA-like protein 4                    357   8e-119   
emb|CBI16945.3|  unnamed protein product                                357   2e-118   
ref|XP_004304208.1|  PREDICTED: COBRA-like protein 4-like               356   3e-118   
emb|CDP20884.1|  unnamed protein product                                357   3e-118   
gb|KHN37931.1|  COBRA-like protein 4                                    356   3e-118   
ref|XP_008240086.1|  PREDICTED: COBRA-like protein 4                    357   4e-118   
ref|XP_009600081.1|  PREDICTED: COBRA-like protein 4                    356   4e-118   
ref|XP_006363258.1|  PREDICTED: COBRA-like protein 4-like               355   7e-118   
ref|XP_010420232.1|  PREDICTED: COBRA-like protein 4                    355   7e-118   
ref|XP_010492405.1|  PREDICTED: COBRA-like protein 4                    355   8e-118   
ref|XP_006400085.1|  hypothetical protein EUTSA_v10013604mg             355   1e-117   
ref|XP_009763133.1|  PREDICTED: COBRA-like protein 4                    355   1e-117   
gb|AAR13305.1|  phytochelatin synthetase-like protein                   355   1e-117   Phaseolus vulgaris [French bean]
ref|XP_009394778.1|  PREDICTED: COBRA-like protein 4 isoform X2         355   1e-117   
ref|NP_001242777.1|  uncharacterized protein LOC100784352 precursor     354   2e-117   
ref|XP_009131486.1|  PREDICTED: COBRA-like protein 4                    353   3e-117   
ref|XP_007037618.1|  COBRA-like extracellular glycosyl-phosphatid...    355   3e-117   
ref|XP_010695259.1|  PREDICTED: COBRA-like protein 4                    354   3e-117   
gb|KFK25792.1|  hypothetical protein AALP_AA8G161300                    353   3e-117   
gb|KDO65677.1|  hypothetical protein CISIN_1g013089mg                   354   4e-117   
emb|CDX78644.1|  BnaA03g05560D                                          353   4e-117   
ref|XP_008464584.1|  PREDICTED: COBRA-like protein 4                    353   4e-117   
ref|XP_006477707.1|  PREDICTED: COBRA-like protein 4-like               353   4e-117   
ref|XP_009761753.1|  PREDICTED: COBRA-like protein 4                    353   4e-117   
ref|XP_004138334.1|  PREDICTED: COBRA-like protein 4-like               352   6e-117   
ref|XP_009394776.1|  PREDICTED: COBRA-like protein 4 isoform X1         354   6e-117   
dbj|BAM05576.1|  COBRA-like protein                                     352   7e-117   
gb|KGN53787.1|  hypothetical protein Csa_4G129040                       352   7e-117   
ref|XP_009346173.1|  PREDICTED: COBRA-like protein 4                    353   8e-117   
ref|XP_008374649.1|  PREDICTED: COBRA-like protein 4                    353   8e-117   
ref|XP_010453698.1|  PREDICTED: COBRA-like protein 4                    352   9e-117   
ref|XP_004491892.1|  PREDICTED: COBRA-like protein 4-like               352   1e-116   
emb|CDX70627.1|  BnaC03g07110D                                          365   1e-116   
ref|XP_002871675.1|  hypothetical protein ARALYDRAFT_488408             352   1e-116   
ref|NP_197067.2|  COBRA-like protein 4                                  351   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338344.1|  PREDICTED: COBRA-like protein 4-like               351   3e-116   
ref|XP_010936445.1|  PREDICTED: COBRA-like protein 4                    351   8e-116   
ref|XP_006287794.1|  hypothetical protein CARUB_v10001005mg             350   8e-116   
ref|XP_008775851.1|  PREDICTED: COBRA-like protein 4                    351   1e-115   
dbj|BAM05578.1|  COBRA-like protein                                     348   2e-115   
ref|XP_004234909.1|  PREDICTED: COBRA-like protein 4                    348   2e-115   
ref|XP_004232142.1|  PREDICTED: COBRA-like protein 4                    348   3e-115   
ref|XP_007216522.1|  hypothetical protein PRUPE_ppa024465mg             348   3e-115   
ref|XP_002264378.1|  PREDICTED: COBRA-like protein 4                    349   5e-115   Vitis vinifera
gb|KHG24029.1|  COBRA-like protein 4                                    348   5e-115   
ref|XP_008230409.1|  PREDICTED: COBRA-like protein 4                    348   5e-115   
ref|XP_011085598.1|  PREDICTED: COBRA-like protein 4                    347   1e-114   
ref|XP_006368071.1|  PREDICTED: COBRA-like protein 4-like               346   1e-114   
ref|XP_010549989.1|  PREDICTED: COBRA-like protein 4                    347   2e-114   
ref|XP_010551802.1|  PREDICTED: COBRA-like protein 4                    347   2e-114   
ref|XP_010663466.1|  PREDICTED: COBRA-like protein 4 isoform X1         346   3e-114   
ref|XP_010032553.1|  PREDICTED: COBRA-like protein 4                    346   3e-114   
emb|CDX90983.1|  BnaC02g06140D                                          346   3e-114   
ref|XP_004137260.1|  PREDICTED: COBRA-like protein 4-like               346   4e-114   
gb|KHN04371.1|  COBRA-like protein 4                                    345   5e-114   
gb|EYU44225.1|  hypothetical protein MIMGU_mgv1a006751mg                345   6e-114   
gb|AFY03623.1|  COBRA-like protein                                      345   6e-114   
ref|XP_003554956.1|  PREDICTED: COBRA-like protein 4-like               344   1e-113   
ref|XP_007151374.1|  hypothetical protein PHAVU_004G041400g             343   2e-113   
gb|KEH25135.1|  COBRA-like protein 2 precursor                          343   2e-113   
ref|XP_006440799.1|  hypothetical protein CICLE_v10020292mg             343   3e-113   
gb|KHG27746.1|  COBRA-like protein 4                                    342   7e-113   
emb|CDX85543.1|  BnaA02g02700D                                          343   8e-113   
ref|XP_010092075.1|  hypothetical protein L484_007355                   345   1e-112   
ref|XP_004154765.1|  PREDICTED: COBRA-like protein 4-like               342   1e-112   
gb|ACI24390.1|  COBRA-like protein                                      342   1e-112   Eucalyptus nitens
ref|XP_004958244.1|  PREDICTED: COBRA-like protein 6-like isoform X3    338   2e-112   
ref|XP_010694050.1|  PREDICTED: COBRA-like protein 4                    340   3e-112   
emb|CDX69511.1|  BnaA10g18600D                                          340   1e-111   
gb|EYU44221.1|  hypothetical protein MIMGU_mgv1a006633mg                338   3e-111   
ref|XP_004958242.1|  PREDICTED: COBRA-like protein 6-like isoform X1    338   4e-111   
gb|EAZ27328.1|  hypothetical protein OsJ_11270                          337   7e-111   Oryza sativa Japonica Group [Japonica rice]
emb|CBI15331.3|  unnamed protein product                                350   2e-110   
ref|NP_001050366.1|  Os03g0416200                                       337   3e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463158.1|  hypothetical protein SORBIDRAFT_02g038740          336   3e-110   Sorghum bicolor [broomcorn]
ref|XP_004984022.1|  PREDICTED: COBRA-like protein 5-like               336   4e-110   
ref|XP_008240111.1|  PREDICTED: COBRA-like protein 4                    334   9e-110   
gb|EMT05391.1|  hypothetical protein F775_18404                         334   2e-109   
ref|XP_006650197.1|  PREDICTED: COBRA-like protein 5-like               334   2e-109   
ref|XP_008341798.1|  PREDICTED: COBRA-like protein 4                    333   2e-109   
ref|XP_006374430.1|  phytochelatin synthetase-like family protein       333   2e-109   
gb|ACA04978.1|  GPI-anchored protein                                    333   3e-109   Bambusa oldhamii
ref|XP_010031033.1|  PREDICTED: COBRA-like protein 4 isoform X1         333   4e-109   
gb|EPS71579.1|  hypothetical protein M569_03177                         332   6e-109   
dbj|BAK05255.1|  predicted protein                                      332   1e-108   
ref|XP_009373789.1|  PREDICTED: COBRA-like protein 4                    331   2e-108   
gb|EMT09067.1|  COBRA-like protein 6                                    331   3e-108   
ref|XP_009122873.1|  PREDICTED: COBRA-like protein 4                    330   3e-108   
dbj|BAK01816.1|  predicted protein                                      330   5e-108   
ref|NP_001105971.1|  brittle stalk-2-like protein 7 precursor           329   2e-107   Zea mays [maize]
ref|XP_002467689.1|  hypothetical protein SORBIDRAFT_01g032480          329   2e-107   Sorghum bicolor [broomcorn]
tpg|DAA63525.1|  TPA: hypothetical protein ZEAMMB73_009152              328   3e-107   
ref|NP_001105928.1|  brittle stalk2 precursor                           328   3e-107   Zea mays [maize]
gb|AFW88100.1|  hypothetical protein ZEAMMB73_767703                    329   5e-107   
ref|XP_003522282.1|  PREDICTED: COBRA-like protein 4-like isoform X1    327   2e-106   
ref|XP_007210750.1|  hypothetical protein PRUPE_ppa021191mg             325   2e-106   
gb|KHN03079.1|  COBRA-like protein 4                                    327   2e-106   
ref|XP_002531001.1|  Protein COBRA precursor, putative                  325   2e-106   Ricinus communis
ref|XP_003557715.1|  PREDICTED: COBRA-like protein 5                    326   2e-106   
ref|XP_007037621.1|  COBRA-like extracellular glycosyl-phosphatid...    325   6e-106   
gb|KCW83758.1|  hypothetical protein EUGRSUZ_B00629                     323   8e-106   
ref|XP_002514629.1|  Protein COBRA precursor, putative                  322   1e-105   Ricinus communis
ref|XP_008379444.1|  PREDICTED: COBRA-like protein 4                    323   1e-105   
gb|KHN19596.1|  COBRA-like protein 4                                    324   2e-105   
ref|XP_003528239.1|  PREDICTED: COBRA-like protein 4-like               324   2e-105   
ref|XP_006657931.1|  PREDICTED: COBRA-like protein 6-like               324   2e-105   
ref|XP_006394554.1|  hypothetical protein EUTSA_v10004178mg             323   3e-105   
gb|AAM62930.1|  phytochelatin synthetase-like protein                   323   3e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45756.1|  unknown                                                 323   4e-105   
ref|XP_011006292.1|  PREDICTED: COBRA-like protein 4                    322   5e-105   
gb|KEH21748.1|  COBRA-like protein 2 precursor                          322   8e-105   
ref|XP_003562730.1|  PREDICTED: COBRA-like protein 6                    322   8e-105   
ref|NP_568930.1|  glycosylphosphatidylinositol-anchored protein C...    322   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138217.1|  PREDICTED: protein COBRA-like                      322   1e-104   
emb|CAC01762.1|  putative phytochelatin synthetase                      320   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27869.1|  hypothetical protein AALP_AA8G439700                    321   3e-104   
ref|XP_010695258.1|  PREDICTED: protein COBRA-like                      321   3e-104   
ref|XP_007138375.1|  hypothetical protein PHAVU_009G203200g             321   3e-104   
ref|XP_006280281.1|  hypothetical protein CARUB_v10026206mg             323   4e-104   
ref|XP_006477704.1|  PREDICTED: protein COBRA-like                      313   4e-104   
ref|XP_006603925.1|  PREDICTED: protein COBRA-like                      320   4e-104   
gb|KDP24286.1|  hypothetical protein JCGZ_25582                         320   5e-104   
ref|XP_003552600.1|  PREDICTED: protein COBRA-like                      320   5e-104   
ref|XP_009346186.1|  PREDICTED: protein COBRA-like                      320   6e-104   
ref|XP_006440797.1|  hypothetical protein CICLE_v10021527mg             314   6e-104   
ref|XP_002264600.1|  PREDICTED: protein COBRA                           320   7e-104   Vitis vinifera
ref|XP_008374650.1|  PREDICTED: protein COBRA-like                      319   1e-103   
ref|XP_002531000.1|  Protein COBRA precursor, putative                  319   1e-103   Ricinus communis
ref|XP_010087345.1|  hypothetical protein L484_012678                   324   1e-103   
gb|KDO65676.1|  hypothetical protein CISIN_1g038127mg                   318   2e-103   
ref|XP_002866404.1|  hypothetical protein ARALYDRAFT_496244             319   2e-103   
ref|XP_007151373.1|  hypothetical protein PHAVU_004G041300g             318   2e-103   
ref|XP_010456834.1|  PREDICTED: protein COBRA                           319   2e-103   
sp|Q6Z4G7.1|COBL6_ORYSJ  RecName: Full=COBRA-like protein 6; AltN...    318   2e-103   Oryza sativa Japonica Group [Japonica rice]
gb|KDP31373.1|  hypothetical protein JCGZ_11749                         319   2e-103   
emb|CDP21871.1|  unnamed protein product                                317   2e-103   
ref|XP_010443903.1|  PREDICTED: protein COBRA-like                      318   3e-103   
emb|CDY02184.1|  BnaA03g39830D                                          318   3e-103   
emb|CDY58691.1|  BnaC07g49800D                                          318   3e-103   
ref|XP_009136413.1|  PREDICTED: protein COBRA                           318   3e-103   
ref|XP_004232141.1|  PREDICTED: protein COBRA                           318   3e-103   
ref|XP_010257981.1|  PREDICTED: protein COBRA-like isoform X2           316   4e-103   
ref|XP_008240088.1|  PREDICTED: protein COBRA-like isoform X2           315   5e-103   
gb|AHC30880.1|  COBRA-like protein                                      318   5e-103   
gb|KHN30325.1|  Protein COBRA                                           317   7e-103   
gb|KHG21362.1|  Protein COBRA -like protein                             317   8e-103   
ref|NP_001241986.1|  uncharacterized protein LOC100782876 precursor     317   8e-103   
gb|ADE67031.1|  COBRA-like 4 protein                                    316   1e-102   
gb|ADE67026.1|  COBRA-like 4 protein                                    316   1e-102   
gb|ADE67018.1|  COBRA-like 4 protein                                    316   1e-102   
ref|XP_009338021.1|  PREDICTED: protein COBRA-like                      317   1e-102   
gb|ADE67012.1|  COBRA-like 4 protein                                    316   1e-102   
gb|ADE67042.1|  COBRA-like 4 protein                                    316   1e-102   
gb|ADE67011.1|  COBRA-like 4 protein                                    316   1e-102   
gb|ADE67039.1|  COBRA-like 4 protein                                    316   1e-102   
gb|ADE67025.1|  COBRA-like 4 protein                                    316   1e-102   
gb|ADE67020.1|  COBRA-like 4 protein                                    316   1e-102   
ref|XP_010257980.1|  PREDICTED: protein COBRA-like isoform X1           317   1e-102   
gb|KDP24287.1|  hypothetical protein JCGZ_25583                         315   2e-102   
gb|ADE67019.1|  COBRA-like 4 protein                                    315   2e-102   
gb|ADE67014.1|  COBRA-like 4 protein                                    315   2e-102   
gb|ADE67017.1|  COBRA-like 4 protein                                    315   2e-102   
emb|CDX85277.1|  BnaC07g25880D                                          315   2e-102   
gb|ADE67037.1|  COBRA-like 4 protein                                    315   2e-102   
gb|ADE67015.1|  COBRA-like 4 protein                                    315   2e-102   
gb|KEH38144.1|  COBRA-like protein 2 precursor                          316   3e-102   
gb|KHN19598.1|  Protein COBRA                                           316   3e-102   
ref|XP_011014071.1|  PREDICTED: COBRA-like protein 4                    315   3e-102   
ref|XP_008393240.1|  PREDICTED: protein COBRA-like                      316   4e-102   
gb|KEH38143.1|  COBRA-like protein 2 precursor                          315   4e-102   
ref|XP_007208787.1|  hypothetical protein PRUPE_ppa024172mg             315   4e-102   
ref|XP_010087346.1|  hypothetical protein L484_012679                   315   4e-102   
ref|XP_010037254.1|  PREDICTED: protein COBRA-like                      315   5e-102   
ref|XP_011014072.1|  PREDICTED: COBRA-like protein 1                    315   6e-102   
ref|XP_002306058.1|  phytochelatin synthetase-like family protein       314   6e-102   Populus trichocarpa [western balsam poplar]
ref|XP_008240087.1|  PREDICTED: protein COBRA-like isoform X1           315   8e-102   
gb|ADE67032.1|  COBRA-like 4 protein                                    314   8e-102   
ref|XP_010546210.1|  PREDICTED: protein COBRA-like                      315   9e-102   
ref|XP_003527117.1|  PREDICTED: protein COBRA                           315   9e-102   
ref|XP_009616573.1|  PREDICTED: protein COBRA-like                      314   1e-101   
ref|XP_007037617.1|  COBRA-like extracellular glycosyl-phosphatid...    314   1e-101   
emb|CDX87193.1|  BnaC09g05080D                                          314   2e-101   
emb|CDY16831.1|  BnaA09g05510D                                          314   2e-101   
ref|XP_004299285.1|  PREDICTED: protein COBRA-like                      313   2e-101   
gb|AFK33956.1|  unknown                                                 313   3e-101   
ref|XP_009151763.1|  PREDICTED: COBRA-like protein 2                    313   3e-101   
ref|XP_011099166.1|  PREDICTED: protein COBRA-like                      315   3e-101   
ref|XP_007138374.1|  hypothetical protein PHAVU_009G203100g             313   3e-101   
gb|KHG07280.1|  COBRA-like protein 1                                    313   4e-101   
ref|XP_002305390.1|  phytochelatin synthetase family protein            313   5e-101   Populus trichocarpa [western balsam poplar]
emb|CDP19973.1|  unnamed protein product                                305   5e-101   
ref|XP_004491893.1|  PREDICTED: protein COBRA-like                      312   5e-101   
gb|ADE67036.1|  COBRA-like 4 protein                                    311   6e-101   
ref|XP_007139435.1|  hypothetical protein PHAVU_008G029100g             312   8e-101   
ref|XP_008453302.1|  PREDICTED: protein COBRA-like                      312   1e-100   
ref|XP_004488434.1|  PREDICTED: COBRA-like protein 4-like isoform X2    311   1e-100   
ref|XP_006440800.1|  hypothetical protein CICLE_v10023912mg             311   1e-100   
ref|XP_002321786.2|  phytochelatin synthetase family protein            311   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_011006295.1|  PREDICTED: protein COBRA-like                      311   1e-100   
ref|XP_004488433.1|  PREDICTED: COBRA-like protein 4-like isoform X1    311   1e-100   
ref|XP_010522480.1|  PREDICTED: protein COBRA                           311   2e-100   
ref|XP_006291010.1|  hypothetical protein CARUB_v10017122mg             312   2e-100   
ref|XP_011087367.1|  PREDICTED: protein COBRA-like isoform X1           311   2e-100   
gb|ABK25470.1|  unknown                                                 311   2e-100   Picea sitchensis
ref|XP_010260537.1|  PREDICTED: protein COBRA-like isoform X1           311   2e-100   
ref|XP_004488435.1|  PREDICTED: protein COBRA-like                      310   3e-100   
gb|KEH25134.1|  COBRA-like protein 2 precursor                          310   3e-100   
ref|XP_010663467.1|  PREDICTED: COBRA-like protein 4 isoform X2         309   3e-100   
ref|XP_010459308.1|  PREDICTED: COBRA-like protein 1                    310   3e-100   
gb|ABS88990.1|  ch-cobra                                                310   4e-100   Cunninghamia lanceolata [China fir]
gb|ABK25014.1|  unknown                                                 310   4e-100   Picea sitchensis
gb|AAM67179.1|  phytochelatin synthetase-like protein                   310   4e-100   Arabidopsis thaliana [mouse-ear cress]
gb|EYU34590.1|  hypothetical protein MIMGU_mgv1a006245mg                310   4e-100   
gb|AFZ78568.1|  COBRA-like protein                                      310   4e-100   
ref|XP_010528423.1|  PREDICTED: COBRA-like protein 2                    310   4e-100   
ref|XP_010936446.1|  PREDICTED: COBRA-like protein 1                    313   5e-100   
ref|XP_006477734.1|  PREDICTED: COBRA-like protein 4-like               309   5e-100   
gb|KCW48927.1|  hypothetical protein EUGRSUZ_K02540                     310   5e-100   
ref|XP_006338345.1|  PREDICTED: protein COBRA-like                      310   5e-100   
ref|XP_009606715.1|  PREDICTED: COBRA-like protein 4                    308   6e-100   
gb|AFZ78570.1|  COBRA-like protein                                      309   7e-100   
ref|XP_003522986.1|  PREDICTED: protein COBRA-like                      310   9e-100   
ref|XP_009776823.1|  PREDICTED: protein COBRA-like                      309   1e-99    
ref|XP_010463618.1|  PREDICTED: COBRA-like protein 1                    309   1e-99    
ref|XP_006408435.1|  hypothetical protein EUTSA_v10020716mg             309   1e-99    
ref|XP_010425766.1|  PREDICTED: COBRA-like protein 2                    308   1e-99    
dbj|BAB02996.1|  phytochelatin synthetase-like protein                  308   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006477706.1|  PREDICTED: protein COBRA-like                      309   2e-99    
ref|XP_009782894.1|  PREDICTED: protein COBRA-like                      308   2e-99    
ref|XP_006365658.1|  PREDICTED: protein COBRA-like                      308   2e-99    
ref|XP_011085599.1|  PREDICTED: protein COBRA                           308   2e-99    
ref|XP_007139436.1|  hypothetical protein PHAVU_008G029200g             307   3e-99    
ref|XP_008775852.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    308   3e-99    
gb|AAG12670.1|AC027033_5  unknown protein; 31818-33764                  306   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010808.1|  PREDICTED: COBRA-like protein 4                    307   4e-99    
ref|XP_010514669.1|  PREDICTED: COBRA-like protein 2                    307   5e-99    
gb|KHG10282.1|  COBRA-like protein 1                                    307   5e-99    
ref|NP_001265883.1|  protein COBRA-like precursor                       307   5e-99    
ref|XP_007032845.1|  COBRA-like protein 1 precursor                     307   5e-99    
ref|XP_010032552.1|  PREDICTED: protein COBRA-like                      308   5e-99    
gb|KHN18376.1|  Protein COBRA                                           306   6e-99    
ref|XP_009415817.1|  PREDICTED: COBRA-like protein 1                    307   7e-99    
ref|XP_008464583.1|  PREDICTED: COBRA-like protein 1                    307   8e-99    
emb|CDP21681.1|  unnamed protein product                                307   9e-99    
ref|XP_004304207.1|  PREDICTED: protein COBRA-like                      306   1e-98    
ref|NP_566851.1|  COBRA-like protein 2                                  306   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009763134.1|  PREDICTED: protein COBRA                           306   1e-98    
ref|XP_004137135.1|  PREDICTED: protein COBRA-like                      306   2e-98    
ref|XP_002875546.1|  hypothetical protein ARALYDRAFT_484733             306   2e-98    
ref|XP_007155211.1|  hypothetical protein PHAVU_003G183000g             306   2e-98    
ref|XP_003550707.1|  PREDICTED: protein COBRA-like                      306   2e-98    
ref|XP_009395002.1|  PREDICTED: COBRA-like protein 1                    306   2e-98    
gb|KEH21750.1|  COBRA-like protein 2 precursor                          305   3e-98    
emb|CDY60470.1|  BnaAnng16830D                                          306   3e-98    
ref|XP_006395263.1|  hypothetical protein EUTSA_v10004232mg             305   3e-98    
ref|XP_010939207.1|  PREDICTED: COBRA-like protein 1                    305   4e-98    
ref|XP_010660572.1|  PREDICTED: protein COBRA                           305   4e-98    
emb|CBI16946.3|  unnamed protein product                                305   4e-98    
ref|XP_010502992.1|  PREDICTED: COBRA-like protein 2 isoform X4         305   4e-98    
emb|CAN68249.1|  hypothetical protein VITISV_020126                     306   4e-98    
ref|XP_009373790.1|  PREDICTED: COBRA-like protein 1 isoform X1         305   4e-98    
ref|XP_010502991.1|  PREDICTED: COBRA-like protein 2 isoform X3         305   4e-98    
ref|XP_006297664.1|  hypothetical protein CARUB_v10013688mg             305   5e-98    
ref|XP_006440798.1|  hypothetical protein CICLE_v10020097mg             305   5e-98    
gb|AFK41534.1|  unknown                                                 304   6e-98    
ref|XP_003543887.1|  PREDICTED: protein COBRA-like isoform X1           305   7e-98    
ref|XP_010502988.1|  PREDICTED: COBRA-like protein 2 isoform X1         304   8e-98    
ref|XP_010502989.1|  PREDICTED: COBRA-like protein 2 isoform X2         304   8e-98    
ref|XP_009600080.1|  PREDICTED: protein COBRA                           304   8e-98    
ref|XP_003518180.1|  PREDICTED: protein COBRA-like                      304   1e-97    
ref|XP_008785625.1|  PREDICTED: COBRA-like protein 1                    304   2e-97    
gb|EAZ04638.1|  hypothetical protein OsI_26786                          305   2e-97    
ref|XP_009147371.1|  PREDICTED: COBRA-like protein 1                    303   2e-97    
ref|XP_009111966.1|  PREDICTED: protein COBRA-like                      303   2e-97    
ref|XP_008353506.1|  PREDICTED: COBRA-like protein 1 isoform X1         303   2e-97    
ref|XP_008341799.1|  PREDICTED: COBRA-like protein 1 isoform X1         303   3e-97    
ref|XP_009386184.1|  PREDICTED: COBRA-like protein 1                    303   3e-97    
emb|CDY43250.1|  BnaC05g48430D                                          303   3e-97    
gb|EPS71578.1|  hypothetical protein M569_03176                         302   3e-97    
gb|KHN08345.1|  Protein COBRA                                           302   5e-97    
ref|XP_010502993.1|  PREDICTED: COBRA-like protein 2 isoform X5         302   5e-97    
ref|XP_010095794.1|  hypothetical protein L484_017602                   296   6e-97    
ref|XP_002884308.1|  phytochelatin synthetase family protein            302   7e-97    
ref|XP_009373791.1|  PREDICTED: COBRA-like protein 1 isoform X2         302   9e-97    
emb|CDY70289.1|  BnaAnng33230D                                          300   1e-96    
ref|NP_186870.1|  COBRA-like protein 1 precursor                        301   1e-96    
ref|XP_007215357.1|  hypothetical protein PRUPE_ppa005522mg             301   1e-96    
ref|XP_004301102.1|  PREDICTED: COBRA-like protein 4-like               301   2e-96    
ref|XP_007037616.1|  COBRA-like extracellular glycosyl-phosphatid...    301   2e-96    
ref|XP_010694055.1|  PREDICTED: protein COBRA-like                      301   2e-96    
ref|XP_010551800.1|  PREDICTED: COBRA-like protein 1 isoform X2         300   3e-96    
ref|XP_008341800.1|  PREDICTED: COBRA-like protein 1 isoform X2         300   7e-96    
ref|XP_009124784.1|  PREDICTED: COBRA-like protein 2                    299   7e-96    
ref|XP_008353507.1|  PREDICTED: COBRA-like protein 1 isoform X2         300   7e-96    
ref|XP_010551799.1|  PREDICTED: COBRA-like protein 1 isoform X1         301   8e-96    
ref|XP_002514627.1|  hypothetical protein RCOM_1468720                  313   1e-95    
ref|XP_006650604.1|  PREDICTED: COBRA-like protein 3-like               298   2e-95    
ref|XP_002987954.1|  hypothetical protein SELMODRAFT_271954             298   3e-95    
ref|XP_002991329.1|  hypothetical protein SELMODRAFT_133233             297   3e-95    
gb|AAR01674.1|  putative phytochelatin synthetase, 3'-partial           291   6e-95    
ref|XP_008230280.1|  PREDICTED: COBRA-like protein 1                    297   6e-95    
ref|XP_010525122.1|  PREDICTED: COBRA-like protein 1                    296   8e-95    
ref|XP_009589615.1|  PREDICTED: protein COBRA-like isoform X1           297   9e-95    
ref|XP_004958241.1|  PREDICTED: COBRA-like protein 1-like               296   1e-94    
ref|XP_006655271.1|  PREDICTED: COBRA-like protein 3-like               296   1e-94    
ref|XP_006602955.1|  PREDICTED: protein COBRA-like                      295   1e-94    
gb|KHN10040.1|  Protein COBRA                                           295   2e-94    
ref|XP_007210248.1|  hypothetical protein PRUPE_ppa014838mg             295   3e-94    
gb|EAZ04637.1|  hypothetical protein OsI_26785                          295   3e-94    
ref|NP_001060219.2|  Os07g0604300                                       295   3e-94    
ref|XP_004507298.1|  PREDICTED: protein COBRA-like                      295   3e-94    
ref|XP_009780772.1|  PREDICTED: COBRA-like protein 1                    295   4e-94    
gb|ABD96927.1|  hypothetical protein                                    294   5e-94    
ref|XP_004236067.1|  PREDICTED: COBRA-like protein 1                    295   5e-94    
gb|EMS55416.1|  hypothetical protein TRIUR3_34464                       292   5e-94    
ref|NP_001055419.1|  Os05g0386800                                       294   7e-94    
ref|XP_009606717.1|  PREDICTED: COBRA-like protein 1                    294   9e-94    
ref|XP_003559251.1|  PREDICTED: COBRA-like protein 3                    294   9e-94    
ref|XP_006363260.1|  PREDICTED: COBRA-like protein 3-like               294   1e-93    
gb|EEE63576.1|  hypothetical protein OsJ_18393                          293   1e-93    
gb|EAY97880.1|  hypothetical protein OsI_19799                          294   1e-93    
ref|XP_006345208.1|  PREDICTED: protein COBRA-like                      293   2e-93    
ref|XP_006658783.1|  PREDICTED: COBRA-like protein 1-like               293   2e-93    
ref|XP_009589623.1|  PREDICTED: protein COBRA-like isoform X2           292   4e-93    
gb|KHN37929.1|  Protein COBRA                                           290   6e-93    
ref|XP_010483748.1|  PREDICTED: protein COBRA-like                      290   8e-93    
ref|XP_008379442.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    291   2e-92    
gb|EAY91898.1|  hypothetical protein OsI_13550                          290   2e-92    
ref|XP_006856413.1|  hypothetical protein AMTR_s00047p00216570          289   3e-92    
ref|XP_010039079.1|  PREDICTED: COBRA-like protein 4                    291   4e-92    
ref|XP_002460985.1|  hypothetical protein SORBIDRAFT_02g038720          290   4e-92    
gb|KCW48930.1|  hypothetical protein EUGRSUZ_K02543                     288   4e-92    
ref|XP_006345207.1|  PREDICTED: uncharacterized protein LOC102589523    303   5e-92    
gb|AAX83600.1|  BRITTLE CULM1                                           285   8e-92    
tpg|DAA51440.1|  TPA: hypothetical protein ZEAMMB73_864332              285   1e-91    
gb|AAX83588.1|  BRITTLE CULM1                                           284   1e-91    
gb|AAX83596.1|  BRITTLE CULM1                                           284   1e-91    
ref|XP_009784021.1|  PREDICTED: protein COBRA-like isoform X1           289   1e-91    
ref|XP_003559376.1|  PREDICTED: COBRA-like protein 3                    288   2e-91    
gb|AAX83616.1|  BRITTLE CULM1                                           283   3e-91    
ref|XP_002463862.1|  hypothetical protein SORBIDRAFT_01g007760          287   4e-91    
ref|NP_001105969.1|  brittle stalk-2-like protein 4 precursor           287   4e-91    
gb|ACG27916.1|  COBRA-like protein 4 precursor                          287   4e-91    
emb|CDY26444.1|  BnaC09g42240D                                          284   5e-91    
ref|XP_010099318.1|  hypothetical protein L484_018180                   286   5e-91    
ref|XP_008240110.1|  PREDICTED: COBRA-like protein 4                    286   7e-91    
ref|XP_004981735.1|  PREDICTED: COBRA-like protein 3-like               286   1e-90    
ref|XP_010031023.1|  PREDICTED: COBRA-like protein 1                    286   1e-90    
ref|XP_009784022.1|  PREDICTED: protein COBRA-like isoform X2           285   3e-90    
ref|XP_006373387.1|  hypothetical protein POPTR_0017s13310g             283   4e-90    
ref|NP_001050367.1|  Os03g0416300                                       284   6e-90    
gb|EPS70668.1|  hypothetical protein M569_04090                         281   1e-89    
gb|ACG33719.1|  COBRA-like protein 4 precursor                          283   2e-89    
ref|NP_001104946.1|  brittle stalk-2-like protein 3 precursor           283   2e-89    
gb|KGN63777.1|  hypothetical protein Csa_1G015710                       281   2e-89    
gb|ABF98936.1|  COBRA-like protein 4 precursor, putative, expressed     274   3e-89    
ref|NP_001051307.2|  Os03g0754500                                       275   3e-89    
dbj|BAJ91851.1|  predicted protein                                      283   3e-89    
emb|CDP15248.1|  unnamed protein product                                283   3e-89    
gb|KHG18541.1|  COBRA-like protein 4                                    281   4e-89    
dbj|BAJ99591.1|  predicted protein                                      283   4e-89    
gb|EYU34591.1|  hypothetical protein MIMGU_mgv1a006208mg                282   4e-89    
ref|XP_011087368.1|  PREDICTED: protein COBRA-like isoform X2           280   5e-89    
ref|XP_010087960.1|  hypothetical protein L484_016828                   285   6e-89    
ref|XP_006856414.1|  hypothetical protein AMTR_s00047p00216760          280   8e-89    
ref|XP_004304213.1|  PREDICTED: protein COBRA-like                      281   1e-88    
ref|XP_006373386.1|  hypothetical protein POPTR_0017s13300g             280   1e-88    
dbj|BAJ86473.1|  predicted protein                                      281   1e-88    
ref|XP_009339585.1|  PREDICTED: COBRA-like protein 4                    274   2e-88    
gb|AAO86520.1|  phytochelatin synthetase                                280   2e-88    
ref|XP_006343506.1|  PREDICTED: protein COBRA-like                      274   2e-88    
gb|EMT17778.1|  hypothetical protein F775_25414                         280   3e-88    
gb|KGN64072.1|  hypothetical protein Csa_1G039860                       279   3e-88    
ref|XP_004958243.1|  PREDICTED: COBRA-like protein 6-like isoform X2    278   3e-88    
ref|XP_002465127.1|  hypothetical protein SORBIDRAFT_01g032460          276   5e-88    
ref|NP_001105970.1|  brittle stalk-2-like protein 6 precursor           279   7e-88    
ref|XP_002463861.1|  hypothetical protein SORBIDRAFT_01g007750          278   8e-88    
ref|XP_006651506.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    278   9e-88    
ref|XP_010092076.1|  hypothetical protein L484_007358                   279   3e-87    
ref|XP_001778885.1|  predicted protein                                  277   4e-87    
ref|XP_008777346.1|  PREDICTED: COBRA-like protein 3                    276   7e-87    
gb|EAY90462.1|  hypothetical protein OsI_12049                          268   1e-86    
ref|XP_011021064.1|  PREDICTED: COBRA-like protein 1                    275   1e-86    
ref|XP_010937850.1|  PREDICTED: COBRA-like protein 1                    275   2e-86    
ref|XP_003559986.1|  PREDICTED: COBRA-like protein 1                    275   2e-86    
ref|XP_004137604.1|  PREDICTED: COBRA-like protein 4-like               273   4e-86    
ref|XP_003557716.1|  PREDICTED: COBRA-like protein 2                    274   7e-86    
ref|XP_010031041.1|  PREDICTED: COBRA-like protein 4 isoform X2         271   1e-85    
gb|EMS58622.1|  hypothetical protein TRIUR3_14619                       273   4e-85    
gb|EMT25608.1|  hypothetical protein F775_09574                         272   4e-85    
gb|EYU44226.1|  hypothetical protein MIMGU_mgv1a022766mg                264   4e-85    
gb|EMT31496.1|  hypothetical protein F775_27513                         272   5e-85    
emb|CDP20883.1|  unnamed protein product                                271   8e-85    
ref|XP_001760765.1|  predicted protein                                  271   1e-84    
gb|EYU44224.1|  hypothetical protein MIMGU_mgv1a019628mg                270   2e-84    
dbj|BAK04997.1|  predicted protein                                      270   2e-84    
gb|AAR14311.1|  phytochelatin synthetase                                269   6e-84    
gb|EMS68786.1|  hypothetical protein TRIUR3_15417                       268   1e-83    
dbj|BAJ97141.1|  predicted protein                                      267   3e-83    
ref|XP_004309891.1|  PREDICTED: protein COBRA-like                      263   6e-82    
ref|XP_002318574.2|  hypothetical protein POPTR_0012s05940g             261   7e-82    
ref|XP_010694042.1|  PREDICTED: protein COBRA                           255   9e-82    
ref|XP_004981736.1|  PREDICTED: COBRA-like protein 3-like               261   2e-81    
ref|XP_007139434.1|  hypothetical protein PHAVU_008G029100g             262   4e-81    
gb|EMS47000.1|  hypothetical protein TRIUR3_01702                       261   7e-81    
gb|EMT26577.1|  hypothetical protein F775_19541                         259   1e-80    
ref|XP_010260542.1|  PREDICTED: protein COBRA-like isoform X2           259   1e-80    
gb|KEH39624.1|  COBRA-like protein 2 precursor                          258   5e-80    
ref|XP_007139433.1|  hypothetical protein PHAVU_008G029100g             256   5e-80    
gb|ACU18662.1|  unknown                                                 247   3e-79    
ref|XP_009794712.1|  PREDICTED: protein COBRA-like                      246   1e-78    
ref|XP_006593701.1|  PREDICTED: protein COBRA-like isoform X2           254   1e-78    
gb|EMT17564.1|  hypothetical protein F775_22023                         248   3e-78    
gb|EAY79078.1|  hypothetical protein OsI_34187                          250   4e-77    
gb|EMT09066.1|  hypothetical protein F775_27360                         251   5e-77    
ref|NP_001064961.1|  Os10g0497700                                       249   2e-76    
ref|XP_001766389.1|  predicted protein                                  249   3e-76    
gb|AAR13303.1|  phytochelatin synthetase-like protein                   246   9e-76    
ref|XP_006394552.1|  hypothetical protein EUTSA_v10004931mg             238   3e-75    
gb|KEH25133.1|  COBRA-like protein 2 precursor                          243   5e-75    
ref|XP_006662477.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    242   6e-74    
ref|XP_008663686.1|  PREDICTED: COBRA-like protein 3                    234   6e-74    
ref|XP_002975319.1|  hypothetical protein SELMODRAFT_174860             242   2e-73    
ref|XP_006578523.1|  PREDICTED: COBRA-like protein 4-like isoform X2    239   4e-73    
gb|KFK27874.1|  hypothetical protein AALP_AA8G440100                    232   6e-73    
gb|EMS49526.1|  hypothetical protein TRIUR3_12656                       237   3e-72    
gb|EMS57525.1|  hypothetical protein TRIUR3_13620                       229   5e-72    
ref|XP_010456862.1|  PREDICTED: COBRA-like protein 5                    230   6e-72    
ref|XP_002964476.1|  hypothetical protein SELMODRAFT_405727             237   6e-72    
ref|XP_009136418.1|  PREDICTED: COBRA-like protein 5                    228   2e-71    
ref|XP_010483751.1|  PREDICTED: COBRA-like protein 5                    228   2e-71    
ref|XP_010443908.1|  PREDICTED: COBRA-like protein 5                    228   2e-71    
ref|XP_010522491.1|  PREDICTED: COBRA-like protein 5                    226   2e-70    
ref|XP_006281938.1|  hypothetical protein CARUB_v10028146mg             226   2e-70    
ref|XP_006856415.1|  hypothetical protein AMTR_s00047p00217040          230   6e-70    
emb|CDY58695.1|  BnaC07g49830D                                          223   2e-69    
gb|KDO65675.1|  hypothetical protein CISIN_1g040362mg                   228   2e-69    
ref|XP_008445923.1|  PREDICTED: COBRA-like protein 4                    228   2e-68    
ref|XP_008351867.1|  PREDICTED: COBRA-like protein 4                    217   1e-66    
ref|XP_010456855.1|  PREDICTED: COBRA-like protein 5                    211   5e-65    
gb|KFK27873.1|  hypothetical protein AALP_AA8G440000                    212   7e-65    
emb|CDY29033.1|  BnaC07g32390D                                          210   1e-64    
gb|KHG25808.1|  COBRA-like protein 6                                    215   6e-64    
ref|NP_200903.1|  COBRA-like protein 5                                  209   8e-64    
ref|XP_009595325.1|  PREDICTED: COBRA-like protein 2 isoform X1         207   1e-62    
emb|CAA07251.1|  putative phytochelatin synthetase                      210   2e-62    
ref|XP_006471247.1|  PREDICTED: COBRA-like protein 6-like               212   2e-62    
ref|XP_010314626.1|  PREDICTED: COBRA-like protein 6 isoform X1         211   1e-61    
emb|CDY14723.1|  BnaC05g19800D                                          207   2e-61    
ref|XP_011087711.1|  PREDICTED: COBRA-like protein 6 isoform X2         209   2e-61    
ref|XP_011087710.1|  PREDICTED: COBRA-like protein 6 isoform X1         206   5e-60    
gb|AFZ78571.1|  COBRA-like protein                                      206   5e-60    
ref|XP_009397865.1|  PREDICTED: COBRA-like protein 7 isoform X4         205   7e-60    
ref|XP_009397863.1|  PREDICTED: COBRA-like protein 3 isoform X3         205   7e-60    
ref|XP_009397861.1|  PREDICTED: COBRA-like protein 7 isoform X1         205   8e-60    
ref|XP_009397862.1|  PREDICTED: COBRA-like protein 7 isoform X2         205   8e-60    
ref|XP_010919369.1|  PREDICTED: COBRA-like protein 7                    205   1e-59    
ref|XP_006349429.1|  PREDICTED: COBRA-like protein 6-like               204   2e-59    
gb|EYU26510.1|  hypothetical protein MIMGU_mgv1a004710mg                204   4e-59    
ref|XP_011028305.1|  PREDICTED: COBRA-like protein 6                    203   5e-59    
gb|EYU26509.1|  hypothetical protein MIMGU_mgv1a004710mg                204   1e-58    
ref|XP_009776069.1|  PREDICTED: COBRA-like protein 6 isoform X1         202   2e-58    
ref|XP_008791642.1|  PREDICTED: COBRA-like protein 7                    201   6e-58    
emb|CBI29736.3|  unnamed protein product                                200   8e-58    
ref|XP_011088767.1|  PREDICTED: COBRA-like protein 1                    201   1e-57    
ref|XP_010658027.1|  PREDICTED: COBRA-like protein 6                    199   2e-57    
ref|XP_010030140.1|  PREDICTED: COBRA-like protein 6 isoform X2         199   2e-57    
gb|KCW55470.1|  hypothetical protein EUGRSUZ_I01370                     199   2e-57    
ref|XP_010030139.1|  PREDICTED: COBRA-like protein 6 isoform X1         199   3e-57    



>ref|XP_004236068.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=447

 Score =   378 bits (971),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = +1

Query  85   LAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            LAKL+F AV L  + PHA+ FDPLDPFGNITIKWDVMSWT DGYVA VTMNNFQMYR IM
Sbjct  15   LAKLTFFAVVLSSVLPHADAFDPLDPFGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIM  74

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            SPGWTLGW+W KKEVIWSIVG+Q TEQGDCSKFKGNVPHCCK+ P +VDLLPGVPYNQQF
Sbjct  75   SPGWTLGWNWPKKEVIWSIVGSQTTEQGDCSKFKGNVPHCCKRDPVLVDLLPGVPYNQQF  134

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            SNCCKGGV+ASWGEDPS SVS+FQ+SVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAKIV
Sbjct  135  SNCCKGGVLASWGEDPSESVSSFQISVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIV  194

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
            PSTVFLTAD RRKTQALMTWNVTCT
Sbjct  195  PSTVFLTADHRRKTQALMTWNVTCT  219



>ref|XP_009606716.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=456

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = +1

Query  85   LAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            LAKL F A+ L  I PHA+ FDPLDPFGNITIKWDV+SWT DGYVA VTMNNFQMYR IM
Sbjct  24   LAKLIFFAIVLSSILPHADAFDPLDPFGNITIKWDVLSWTPDGYVAVVTMNNFQMYRHIM  83

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            SPGWTLGW+WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKK P I+DLLPGVPYNQQF
Sbjct  84   SPGWTLGWNWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKDPVILDLLPGVPYNQQF  143

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            SNCCKGGV+ASWGEDPS SVS+FQ+SVGLAGTSNKTVKLP NF+L+GPGPGYTCGPAKIV
Sbjct  144  SNCCKGGVMASWGEDPSESVSSFQLSVGLAGTSNKTVKLPKNFSLLGPGPGYTCGPAKIV  203

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
            PSTVFLT+D RRKTQALMTWNVTCT
Sbjct  204  PSTVFLTSDHRRKTQALMTWNVTCT  228



>ref|XP_006345105.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=455

 Score =   377 bits (968),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 195/218 (89%), Gaps = 3/218 (1%)
 Frame = +1

Query  46   YSQQPKHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAA  225
            YSQQ + F  P  LAKL+F AV L  + PHA+ FDPLDPFGNITIKWDVMSW  DGYVA 
Sbjct  13   YSQQCQ-FLFP--LAKLTFFAVVLSSVLPHADAFDPLDPFGNITIKWDVMSWAPDGYVAV  69

Query  226  VTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTI  405
            VTMNNFQMYR IMSPGWTLGW+W KKEVIWSIVG+Q TEQGDCSKFKGNVPHCCK+ P +
Sbjct  70   VTMNNFQMYRHIMSPGWTLGWNWPKKEVIWSIVGSQTTEQGDCSKFKGNVPHCCKRDPVL  129

Query  406  VDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMG  585
            VDLLPGVPYNQQFSNCCKGGV+ASWGEDPS SVS+FQ+SVGLAGTSNKTVKLP NFTL+G
Sbjct  130  VDLLPGVPYNQQFSNCCKGGVLASWGEDPSESVSSFQISVGLAGTSNKTVKLPKNFTLLG  189

Query  586  PGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            PGPGYTCGPAKIVPSTVFLTAD RRKTQALMTWNVTCT
Sbjct  190  PGPGYTCGPAKIVPSTVFLTADHRRKTQALMTWNVTCT  227



>ref|XP_009780773.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=461

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A  L  I PHA+ FDPLDPFGNITIKWDVMSWT DGYVA VTMNNFQMYR IMSPGWTLG
Sbjct  36   AFVLSAILPHADAFDPLDPFGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLG  95

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W+WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKK P I+DLLPGVPYNQQFSNCCKGG
Sbjct  96   WNWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKDPVILDLLPGVPYNQQFSNCCKGG  155

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            V+ASWGEDPS SVS+FQ+SVGLAGTSNKTVKLP NF+L+GPGPGYTCGPAKIVPSTVFLT
Sbjct  156  VMASWGEDPSESVSSFQISVGLAGTSNKTVKLPKNFSLLGPGPGYTCGPAKIVPSTVFLT  215

Query  646  ADRRRKTQALMTWNVTCT  699
            AD RRKTQALMTWNVTCT
Sbjct  216  ADHRRKTQALMTWNVTCT  233



>gb|EYU23624.1| hypothetical protein MIMGU_mgv1a006366mg [Erythranthe guttata]
Length=447

 Score =   371 bits (953),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = +1

Query  49   SQQPKHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAV  228
            S++P  F S ST++   + AV L ++   AE +DPLDPFGNITIKWDV+SWT DGYVA V
Sbjct  2    SRKPGMFLSLSTMSFTIWAAVILLMMISQAEAYDPLDPFGNITIKWDVVSWTPDGYVALV  61

Query  229  TMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIV  408
            TMNNFQMYR IMSPGWTL W WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKK PT+V
Sbjct  62   TMNNFQMYRHIMSPGWTLSWGWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKNPTVV  121

Query  409  DLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGP  588
            DLLPGVPYNQQ +NCCKGGVVASWG+DPS++VS+FQVSVGLAGT+NKTVKLPTNFTL+GP
Sbjct  122  DLLPGVPYNQQIANCCKGGVVASWGQDPSSAVSSFQVSVGLAGTTNKTVKLPTNFTLLGP  181

Query  589  GPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPGYTCGPAKIVPSTV+LT DRRRKTQALMTWNVTCT
Sbjct  182  GPGYTCGPAKIVPSTVYLTPDRRRKTQALMTWNVTCT  218



>ref|XP_006374429.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
 gb|ABK96050.1| unknown [Populus trichocarpa]
 gb|ERP52226.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
Length=453

 Score =   369 bits (948),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K  F    +F+I PHA  +DPLDP GNITIKWDVMSWT DGYVA VTM+NFQMYR I+SP
Sbjct  23   KFIFLIALVFMIVPHAAAYDPLDPNGNITIKWDVMSWTPDGYVATVTMSNFQMYRHIISP  82

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEV+WS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  83   GWTLSWSWAKKEVLWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFSN  142

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+A+WG+DP+ASVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  143  CCKGGVMAAWGQDPTASVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  202

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT DRRRKTQALMTWNVTCT
Sbjct  203  TVFLTPDRRRKTQALMTWNVTCT  225



>ref|XP_007032846.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
 gb|EOY03772.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
Length=432

 Score =   365 bits (937),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A+FLF++F HA  +DPLDP GN+TIKWD++SWT DGYVA VTMNNFQMYR IMSPGWTLG
Sbjct  7    ALFLFVLFSHAAAYDPLDPNGNVTIKWDIVSWTPDGYVAVVTMNNFQMYRHIMSPGWTLG  66

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQF+NCCKGG
Sbjct  67   WTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFTNCCKGG  126

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            V+++WG+DP A+VSAFQVS+GLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPST FLT
Sbjct  127  VLSAWGQDPQAAVSAFQVSIGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPSTTFLT  186

Query  646  ADRRRKTQALMTWNVTCT  699
             DRRR+TQALMTWNVTCT
Sbjct  187  PDRRRRTQALMTWNVTCT  204



>ref|XP_008393239.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=436

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +F AV   LI   A  +DPLDP GNITI+WDVMSWTADGYVAAVTMNNFQMYR I SP
Sbjct  2    KFTFLAVLYCLILSPAAAYDPLDPTGNITIRWDVMSWTADGYVAAVTMNNFQMYRQIPSP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGWSWAKKEVIW++VGAQ TEQGDCSKFK  +PHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWSWAKKEVIWTMVGAQTTEQGDCSKFKATIPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DPSA+VS FQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  122  CCKGGVLASWGQDPSAAVSGFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLTADRRRKTQALMTWNVTCT
Sbjct  182  TVFLTADRRRKTQALMTWNVTCT  204



>ref|XP_011006293.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
 ref|XP_011006294.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
Length=453

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K  F    +F+I   A  +DPLDP GNITIKWDVMSWT DGYVA VTM+NFQMYR I+SP
Sbjct  23   KFIFLIALVFMIVSRAAAYDPLDPNGNITIKWDVMSWTPDGYVATVTMSNFQMYRHIISP  82

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQ+SN
Sbjct  83   GWTLSWSWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQYSN  142

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+A+WG+DP+ASVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  143  CCKGGVIAAWGQDPTASVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  202

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT DRRRKTQALMTWNVTCT
Sbjct  203  TVFLTPDRRRKTQALMTWNVTCT  225



>ref|XP_008351868.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=458

 Score =   364 bits (934),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +F AV   LI   A  +DPLDP GNITI+WDVMSWTADGYVAAVTMNNFQMYR I SP
Sbjct  24   KFTFLAVLYCLILSPAAAYDPLDPTGNITIRWDVMSWTADGYVAAVTMNNFQMYRQIPSP  83

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGWSWAKKEVIW++VGAQ TEQGDCSKFK  +PHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  84   GWTLGWSWAKKEVIWTMVGAQTTEQGDCSKFKATIPHCCKKTPTVVDLLPGVPYNQQFSN  143

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DPSA+VS FQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  144  CCKGGVLASWGQDPSAAVSGFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  203

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLTADRRRKTQALMTWNVTCT
Sbjct  204  TVFLTADRRRKTQALMTWNVTCT  226



>gb|KHG07276.1| COBRA-like protein 4 [Gossypium arboreum]
 gb|KHG08964.1| COBRA-like protein 4 [Gossypium arboreum]
Length=433

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K     +FLF++F +A  +DPLDP GN+TIKWD++SWT DGYVA VTMNNFQMYR IMSP
Sbjct  2    KFFISVLFLFVLFSYAAAYDPLDPNGNVTIKWDIVSWTPDGYVAVVTMNNFQMYRHIMSP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  62   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFTN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+A+WG+DP ++VSAFQ+SVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  122  CCKGGVLAAWGQDPQSAVSAFQISVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT DRRRKTQALMTWNVTCT
Sbjct  182  TTFLTPDRRRKTQALMTWNVTCT  204



>ref|XP_010260547.1| PREDICTED: COBRA-like protein 4 [Nelumbo nucifera]
Length=451

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  82   TLAKLSFCAV--FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYR  255
            T+ K  F  V  F  ++F  +  FDPLDP GNITIKWDVMSWT DGYVAAVTM+NFQ+YR
Sbjct  17   TVVKFKFIIVSFFFVMMFSSSAAFDPLDPNGNITIKWDVMSWTPDGYVAAVTMSNFQLYR  76

Query  256  AIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYN  435
             I+SPGWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYN
Sbjct  77   HIISPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYN  136

Query  436  QQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPA  615
            QQFSNCCKGGVVA+WG+DP+ASVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPA
Sbjct  137  QQFSNCCKGGVVAAWGQDPTASVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPA  196

Query  616  KIVPSTVFLTADRRRKTQALMTWNVTCT  699
            KIVPST F T DRRRKTQALMTWNVTCT
Sbjct  197  KIVPSTTFFTPDRRRKTQALMTWNVTCT  224



>ref|XP_010037255.1| PREDICTED: COBRA-like protein 4 [Eucalyptus grandis]
 gb|KCW48928.1| hypothetical protein EUGRSUZ_K02541 [Eucalyptus grandis]
Length=459

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  70   GSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQM  249
            G  S   +L F A  L L+ PH   +DPLDP GNITIKWDV+SWTADGYVA+VTM+NFQM
Sbjct  19   GLLSPRLELMFLAAILMLMIPHTVAYDPLDPNGNITIKWDVVSWTADGYVASVTMSNFQM  78

Query  250  YRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVP  429
            YR I+ PGWTLGWSWAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKK P +VD LPGVP
Sbjct  79   YRPILLPGWTLGWSWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKDPIVVDFLPGVP  138

Query  430  YNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCG  609
            YNQQFSNCCKGGV++SWG+DP++SVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCG
Sbjct  139  YNQQFSNCCKGGVLSSWGQDPTSSVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCG  198

Query  610  PAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            PAKIVPSTV+LT DRRRKTQA+MTWNVTCT
Sbjct  199  PAKIVPSTVYLTPDRRRKTQAMMTWNVTCT  228



>ref|XP_002514628.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF47734.1| Protein COBRA precursor, putative [Ricinus communis]
Length=461

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            KL        L+ P+A+ +DPLDP GNITIKWDVMSWT DGYVA VTM+NFQMYR I+SP
Sbjct  31   KLILLVTLASLMLPYADAYDPLDPNGNITIKWDVMSWTPDGYVATVTMSNFQMYRHIISP  90

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEVIWS+ GAQATEQGDCSKFKGN+PHCCKKTPTIVDLLPGVPYNQQFSN
Sbjct  91   GWTLSWSWAKKEVIWSMNGAQATEQGDCSKFKGNIPHCCKKTPTIVDLLPGVPYNQQFSN  150

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSASVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  151  CCKGGVVAAWGQDPSASVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  210

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVF T D RRKTQALMTWNVTCT
Sbjct  211  TVFFTPDHRRKTQALMTWNVTCT  233



>gb|AFZ78569.1| COBRA-like protein [Populus tomentosa]
Length=453

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K  F    +F++   A  +DPLDP GNITIKWDVMSWT DGYVA VTM+NFQMYR I+SP
Sbjct  23   KFIFLIALVFVMVSRAAAYDPLDPNGNITIKWDVMSWTPDGYVATVTMSNFQMYRHIISP  82

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEV+WS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  83   GWTLSWSWAKKEVLWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFSN  142

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+A+WG+DP+ASVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAKIVPS
Sbjct  143  CCKGGVMAAWGQDPTASVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPS  202

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT DRRRKTQALMTWNVTCT
Sbjct  203  TVFLTPDRRRKTQALMTWNVTCT  225



>ref|XP_008453301.1| PREDICTED: COBRA-like protein 4 [Cucumis melo]
Length=456

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K++  A+ +F  F     +DPLDP GNITIKWDV+SWT DGYVA VTMNNFQMYR I SP
Sbjct  26   KIALLALLIFTAFYSTGAYDPLDPNGNITIKWDVVSWTPDGYVAVVTMNNFQMYRHINSP  85

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGWSWAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  86   GWTLGWSWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSN  145

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DP++SVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  146  CCKGGVLASWGQDPTSSVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  205

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT DRRRKTQALMTWNVTCT
Sbjct  206  TVFLTPDRRRKTQALMTWNVTCT  228



>gb|KDP31374.1| hypothetical protein JCGZ_11750 [Jatropha curcas]
Length=458

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K  F     FL+ P++  +DPLDP GNITIKWDVMSWT DGYVA VTM+NFQ+YR IMSP
Sbjct  27   KFIFLVGLAFLMLPNSAAYDPLDPNGNITIKWDVMSWTPDGYVATVTMSNFQLYRHIMSP  86

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEVIWS+VGAQATEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  87   GWTLSWSWAKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFTN  146

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS+SVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAKIVPS
Sbjct  147  CCKGGVVAAWGQDPSSSVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPS  206

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVF T D RRKTQALMTWNVTCT
Sbjct  207  TVFFTPDNRRKTQALMTWNVTCT  229



>ref|XP_011087370.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=435

 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K S  AV LF+IF  AE +DPLDPFGNITIKWDV+SWT DG  A VTMNNFQMYR IMSP
Sbjct  6    KFSMWAVLLFIIFSQAESYDPLDPFGNITIKWDVISWTPDGXXAVVTMNNFQMYRHIMSP  65

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL W WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCK+ PT+VDLLPGVPYNQQ +N
Sbjct  66   GWTLSWGWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKRNPTVVDLLPGVPYNQQIAN  125

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVASWG+DP+++VS+FQVSVGL+GTSNKTVKLPTNFTL+GPGPGYTCGPAKIVPS
Sbjct  126  CCKGGVVASWGQDPASAVSSFQVSVGLSGTSNKTVKLPTNFTLLGPGPGYTCGPAKIVPS  185

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TV+ T D RRKTQALMTWNVTCT
Sbjct  186  TVYFTPDHRRKTQALMTWNVTCT  208



>ref|XP_010257979.1| PREDICTED: COBRA-like protein 4 [Nelumbo nucifera]
Length=465

 Score =   362 bits (928),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +  + F  +IF +A  +DPLDP GNITIKWDVMSWT DGYVA VT+NNFQ+YR IMSP
Sbjct  35   KFTILSFFFVMIFSNAAAYDPLDPNGNITIKWDVMSWTPDGYVAVVTINNFQLYRHIMSP  94

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  95   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFTN  154

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVV +WG+DP+ASVSAFQVSVGLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPS
Sbjct  155  CCKGGVVTAWGQDPAASVSAFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPS  214

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT DRRRKTQ+LMTWNVTCT
Sbjct  215  TTFLTPDRRRKTQSLMTWNVTCT  237



>gb|KEH21749.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=431

 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L   A+ + ++F +A  +DPLDP GNITIKWDV+SWTADGYVAAVTM+NFQMYR IM+P
Sbjct  2    RLLISAICVIVLFSYAAAYDPLDPNGNITIKWDVVSWTADGYVAAVTMSNFQMYRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGWSWAKKEVIWS+VG+Q TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWSWAKKEVIWSMVGSQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS++VSAFQVSVG AGTSNKTVKLP NFTL+ PGPGYTCGPAKIVPS
Sbjct  122  CCKGGVVAAWGQDPSSAVSAFQVSVGQAGTSNKTVKLPKNFTLLAPGPGYTCGPAKIVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D+RRKTQALMTWNVTCT
Sbjct  182  TTFLTTDKRRKTQALMTWNVTCT  204



>ref|XP_009589606.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=434

 Score =   360 bits (924),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWS  291
            FLF+IF +   +DPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR IM+PGWTLGW+
Sbjct  11   FLFVIFSYGAAYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWT  70

Query  292  WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVV  471
            WAKKEVIW++VGAQATEQGDCSKFKGNVPHCCKKTPTIVD+LPGVPYNQQF+NCCKGGV+
Sbjct  71   WAKKEVIWTMVGAQATEQGDCSKFKGNVPHCCKKTPTIVDMLPGVPYNQQFTNCCKGGVL  130

Query  472  ASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTAD  651
            ASWG+DP ASVSAFQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAKIVPST F T D
Sbjct  131  ASWGQDPQASVSAFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTKFFTPD  190

Query  652  RRRKTQALMTWNVTCT  699
             RRKTQALMTWNVTCT
Sbjct  191  LRRKTQALMTWNVTCT  206



>ref|XP_010660571.1| PREDICTED: COBRA-like protein 4 [Vitis vinifera]
Length=464

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 6/223 (3%)
 Frame = +1

Query  37   ENMYSQQPKHFGSPSTLAKLSFC--AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTAD  210
             N + +Q +H      L K+ F   A F  ++F +   +DPLDP GNITIKWD+MSWT D
Sbjct  19   HNTHCRQYQH----EMLGKMRFVISAFFFLMMFSYTAAYDPLDPNGNITIKWDIMSWTPD  74

Query  211  GYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCK  390
            GYVA VTM+NFQMYR I+SPGWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCK
Sbjct  75   GYVAVVTMHNFQMYRHIISPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCK  134

Query  391  KTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTN  570
            KTPT+VDLLPGVPYNQQFSNCCKGGVV+SWG+DP+ASVSAFQVSVGLAGTSNKTVKLP N
Sbjct  135  KTPTVVDLLPGVPYNQQFSNCCKGGVVSSWGQDPAASVSAFQVSVGLAGTSNKTVKLPKN  194

Query  571  FTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            FTL+GPGPGYTCG AKIVP T FLT DRRRKTQALMTWNVTCT
Sbjct  195  FTLLGPGPGYTCGIAKIVPPTNFLTPDRRRKTQALMTWNVTCT  237



>gb|KGN63776.1| hypothetical protein Csa_1G015700 [Cucumis sativus]
Length=457

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K++  A+ +F  F     +DPLDP GNITIKWDV+SWT DGYVA VTMNNFQMYR I SP
Sbjct  26   KIALLALLIFTAFYSTGAYDPLDPNGNITIKWDVVSWTPDGYVAVVTMNNFQMYRHINSP  85

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGWSWAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTP +VDLLPGVPYNQQFSN
Sbjct  86   GWTLGWSWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPIVVDLLPGVPYNQQFSN  145

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DP++SVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  146  CCKGGVLASWGQDPTSSVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  205

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT DRRRKTQALMTWNVTCT
Sbjct  206  TVFLTPDRRRKTQALMTWNVTCT  228



>ref|XP_011099033.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=433

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            ++   A FL ++    + +DPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR IMSP
Sbjct  2    RVLIAASFLLVLVSSVDAYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKEVIWS+VGAQATEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTVGWTWAKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+A+WG+DP ASVSAFQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAKIVP 
Sbjct  122  CCKGGVLAAWGQDPQASVSAFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPP  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT DRRRKTQALMTWNVTCT
Sbjct  182  TNFLTPDRRRKTQALMTWNVTCT  204



>ref|XP_007209118.1| hypothetical protein PRUPE_ppa005430mg [Prunus persica]
 gb|EMJ10317.1| hypothetical protein PRUPE_ppa005430mg [Prunus persica]
Length=461

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +F AV   ++   A  +DPLDP GNITIKWDVMSWT DGYVAAVTMNNFQMYR I+SP
Sbjct  27   KFTFLAVLCCMVLSPAAAYDPLDPTGNITIKWDVMSWTPDGYVAAVTMNNFQMYRQIISP  86

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGWSW KKEVIW++VGAQ TEQGDCSKFK  +PHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  87   GWTLGWSWQKKEVIWTMVGAQTTEQGDCSKFKAAIPHCCKKTPTVVDLLPGVPYNQQFTN  146

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DP+ASVSAFQVSVG AGTSNKTVKLP NFTL GPGPGYTCGPAK+VPS
Sbjct  147  CCKGGVLASWGQDPTASVSAFQVSVGQAGTSNKTVKLPKNFTLFGPGPGYTCGPAKVVPS  206

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLTADRRRKTQALMTWNVTCT
Sbjct  207  TVFLTADRRRKTQALMTWNVTCT  229



>ref|XP_009338030.1| PREDICTED: COBRA-like protein 4 [Pyrus x bretschneideri]
Length=458

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +F AV   L+   A  +DPLDP GNITI+WDVMSWT DGYVAAVTMNNFQMYR I SP
Sbjct  24   KFTFLAVLYCLMLSPAAAYDPLDPTGNITIRWDVMSWTTDGYVAAVTMNNFQMYRQIPSP  83

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGWSWAKKEVIW++VGAQ TEQGDCSKFK  +PHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  84   GWTLGWSWAKKEVIWTMVGAQTTEQGDCSKFKATIPHCCKKTPTVVDLLPGVPYNQQFAN  143

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVASWG+DPSA+V+ FQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  144  CCKGGVVASWGQDPSAAVAGFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  203

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLTADRRRKTQALMTWNVTCT
Sbjct  204  TVFLTADRRRKTQALMTWNVTCT  226



>ref|NP_001242075.1| uncharacterized protein LOC100783410 precursor [Glycine max]
 gb|ACU18234.1| unknown [Glycine max]
Length=431

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L   AV + ++F +A  +DPLDP GNITIKWDV+SWT DGYVA VTM+NFQM+R IM+P
Sbjct  2    RLVISAVCVIVLFSYAAAYDPLDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS++VS+FQVS+GLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  122  CCKGGVVAAWGQDPSSAVSSFQVSIGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT D+RRKTQALMTWNVTCT
Sbjct  182  TVFLTPDKRRKTQALMTWNVTCT  204



>gb|KHN30324.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   358 bits (920),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L   AV + ++F +A  +DPLDP GNITIKWDV+SWT DGYVA VTM+NFQM+R IM+P
Sbjct  2    RLVISAVCVIVLFSYAAAYDPLDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS++VS+FQVS+GLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  122  CCKGGVVAAWGQDPSSAVSSFQVSIGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT D+RRKTQALMTWNVTCT
Sbjct  182  TVFLTPDKRRKTQALMTWNVTCT  204



>ref|XP_010099317.1| hypothetical protein L484_018179 [Morus notabilis]
 gb|EXB77663.1| hypothetical protein L484_018179 [Morus notabilis]
Length=433

 Score =   358 bits (919),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            ++   A F   IF +A  +DPLDP GNITIKWDVMSWTADGYVA VTMNNFQMYR IM+P
Sbjct  2    RVFISAFFFIAIFSYAVAYDPLDPNGNITIKWDVMSWTADGYVAVVTMNNFQMYRHIMTP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKK+VIWSIVGAQ TEQGDCSKFKGNVPHCCKK PT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKDVIWSIVGAQTTEQGDCSKFKGNVPHCCKKDPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV++SWG+DP+ASVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCG AKIVP 
Sbjct  122  CCKGGVLSSWGQDPAASVSAFQVSVGLAGTSNKTVKLPRNFTLLGPGPGYTCGGAKIVPP  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D RRKTQALMTWNVTCT
Sbjct  182  TTFLTPDHRRKTQALMTWNVTCT  204



>ref|XP_004299286.1| PREDICTED: COBRA-like protein 4-like [Fragaria vesca subsp. vesca]
Length=455

 Score =   358 bits (920),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K++F A+   ++      +DPLDP GNITIKWDVMSWT DGYVAAVTMNNFQMYR I +P
Sbjct  25   KITFLAMLFCVLVSPTAAYDPLDPTGNITIKWDVMSWTPDGYVAAVTMNNFQMYRQIANP  84

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIW++VGAQ TEQGDCSKFKGN PHCCKKTPT+VDLLPGVP+NQQFSN
Sbjct  85   GWTLGWTWAKKEVIWTMVGAQTTEQGDCSKFKGNTPHCCKKTPTVVDLLPGVPFNQQFSN  144

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DPSASVSAFQVSVG  GTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  145  CCKGGVMASWGQDPSASVSAFQVSVGQGGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  204

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLTADRRRKTQALMTWNVTCT
Sbjct  205  TVFLTADRRRKTQALMTWNVTCT  227



>ref|XP_007139432.1| hypothetical protein PHAVU_008G029000g [Phaseolus vulgaris]
 gb|ESW11426.1| hypothetical protein PHAVU_008G029000g [Phaseolus vulgaris]
Length=432

 Score =   358 bits (918),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            AV + ++F +A  +DPLDP GN+TIKWDV+SWT DGYVA VTM+NFQM+R IM+PGWTL 
Sbjct  8    AVCVLVLFSYAAAYDPLDPNGNVTIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNPGWTLS  67

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            WSWAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCKGG
Sbjct  68   WSWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGG  127

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VVA+WG+DPS++VS+FQVS+GLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPSTVFLT
Sbjct  128  VVAAWGQDPSSAVSSFQVSIGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPSTVFLT  187

Query  646  ADRRRKTQALMTWNVTCT  699
            AD+RRKTQALMTWNVTCT
Sbjct  188  ADKRRKTQALMTWNVTCT  205



>ref|XP_009126060.1| PREDICTED: COBRA-like protein 4 [Brassica rapa]
Length=434

 Score =   357 bits (917),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 185/203 (91%), Gaps = 1/203 (0%)
 Frame = +1

Query  94   LSFCAVFLFLI-FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            L FC+ F F+I F  +  +DPLDP GNIT+KWD+MSWTADGYVA VTMNNFQ+YR I +P
Sbjct  3    LFFCSCFFFMIIFSTSSAYDPLDPNGNITLKWDIMSWTADGYVATVTMNNFQIYRHIQNP  62

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKK PT+VDLLPGVPYNQQFSN
Sbjct  63   GWTLGWAWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKIPTVVDLLPGVPYNQQFSN  122

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVV +WG+DPS++VS FQVSVGLAGT+NKTVKLP NFTL+GPGPGY+CGPAKIVPS
Sbjct  123  CCKGGVVGAWGQDPSSAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYSCGPAKIVPS  182

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT D+RRKTQALMTWNVTCT
Sbjct  183  TVFLTTDKRRKTQALMTWNVTCT  205



>emb|CBI16945.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +    A F  ++F +   +DPLDP GNITIKWD+MSWT DGYVA VTM+NFQMYR I+SP
Sbjct  2    RFVISAFFFLMMFSYTAAYDPLDPNGNITIKWDIMSWTPDGYVAVVTMHNFQMYRHIISP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVV+SWG+DP+ASVSAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCG AKIVP 
Sbjct  122  CCKGGVVSSWGQDPAASVSAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGIAKIVPP  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT DRRRKTQALMTWNVTCT
Sbjct  182  TNFLTPDRRRKTQALMTWNVTCT  204



>ref|XP_004304208.1| PREDICTED: COBRA-like protein 4-like [Fragaria vesca subsp. vesca]
Length=433

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A+FL +IF +A  +DPLDP GNITI+WD+MSWT DGYVA VT+NNFQMYR IMSPGWTLG
Sbjct  7    ALFLLVIFSYAAAYDPLDPNGNITIRWDIMSWTPDGYVATVTINNFQMYRHIMSPGWTLG  66

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W+WAKKEVIWS VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQ+ NCCKGG
Sbjct  67   WTWAKKEVIWSAVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQYQNCCKGG  126

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VV +WG+DPSASVSAFQ+SVG+AGTSNKTVKLP NFTL+GPGPGYTCG AKIVPST+F +
Sbjct  127  VVGAWGQDPSASVSAFQLSVGMAGTSNKTVKLPKNFTLLGPGPGYTCGKAKIVPSTIFFS  186

Query  646  ADRRRKTQALMTWNVTCT  699
             D RRKTQALMTWNVTCT
Sbjct  187  PDHRRKTQALMTWNVTCT  204



>emb|CDP20884.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            KL   A+ L +    +E FDPLDPFGNITIKWDV+SWTADGYVA+V MNN+QMYR I +P
Sbjct  32   KLQLWAILLLMALSQSEAFDPLDPFGNITIKWDVVSWTADGYVASVIMNNYQMYRHINTP  91

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKK P IVDLLPGVPYNQQ++N
Sbjct  92   GWTLGWNWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKNPIIVDLLPGVPYNQQYAN  151

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVASWG+DPSA+VSAFQVSVG+AGTSNKT+KLP +F LMGPGPGYTCGPA++VPS
Sbjct  152  CCKGGVVASWGQDPSAAVSAFQVSVGVAGTSNKTLKLPKDFVLMGPGPGYTCGPAEVVPS  211

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVF T D RRKTQALMTW VTCT
Sbjct  212  TVFFTPDHRRKTQALMTWTVTCT  234



>gb|KHN37931.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            ++   AV   ++F +A  +DPLDP GNITIKWDV+SWT DGYVA VTM+NFQM+R IM+P
Sbjct  2    RVVISAVCAIVLFSYAAAYDPLDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS++VS+FQVS+GLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  122  CCKGGVVAAWGQDPSSAVSSFQVSIGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT D+RRKTQALMTWNVTCT
Sbjct  182  TVFLTPDKRRKTQALMTWNVTCT  204



>ref|XP_008240086.1| PREDICTED: COBRA-like protein 4 [Prunus mume]
Length=461

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +  AV   ++   A  +DPLDP GNITIKWDVMSWT DGYVAAVTMNNFQMYR I+SP
Sbjct  27   KFTILAVLCCMVLSPAAAYDPLDPTGNITIKWDVMSWTPDGYVAAVTMNNFQMYRQIISP  86

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGWSW KKEVIW++VGAQ TEQGDCSKFK  +PHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  87   GWTLGWSWQKKEVIWTMVGAQTTEQGDCSKFKAAIPHCCKKTPTVVDLLPGVPYNQQFTN  146

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DP+ASVSAFQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  147  CCKGGVLASWGQDPTASVSAFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  206

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT DRRRKTQALMTWNVTCT
Sbjct  207  TVFLTTDRRRKTQALMTWNVTCT  229



>ref|XP_009600081.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=435

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWS  291
            F+  + PHA  FDPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR IM+PGWTLGW+
Sbjct  12   FILALIPHAAAFDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWT  71

Query  292  WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVV  471
            WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKK PTIVDLLPGVPYNQQF+NCCKGGV+
Sbjct  72   WAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKNPTIVDLLPGVPYNQQFTNCCKGGVL  131

Query  472  ASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTAD  651
            ASWG+DP +SVSAFQ+SVG AGTSNKTVKLP NFTL+GPGPGYTCGPAKIVP T F T D
Sbjct  132  ASWGQDPQSSVSAFQISVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPPTKFFTPD  191

Query  652  RRRKTQALMTWNVTCT  699
             RRKTQALMTWNVTCT
Sbjct  192  LRRKTQALMTWNVTCT  207



>ref|XP_006363258.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=434

 Score =   355 bits (911),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWS  291
             LF++F +A  +DPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR IMSPGWTLGW+
Sbjct  11   LLFVLFSYAAAYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWT  70

Query  292  WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVV  471
            WAKKEVIW+++GAQATEQGDCSKFKGN+PHCCKKTPT+VD+LPGVPYNQQF+NCCKGGV+
Sbjct  71   WAKKEVIWTMIGAQATEQGDCSKFKGNIPHCCKKTPTVVDMLPGVPYNQQFTNCCKGGVL  130

Query  472  ASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTAD  651
            ASWG+DP +SVSAFQVSVG AGT+NKTVKLP NFTL+GPGPGYTC PAKIVP T F TAD
Sbjct  131  ASWGQDPQSSVSAFQVSVGQAGTTNKTVKLPKNFTLLGPGPGYTCSPAKIVPPTKFFTAD  190

Query  652  RRRKTQALMTWNVTCT  699
             RRKTQALMTWNVTCT
Sbjct  191  LRRKTQALMTWNVTCT  206



>ref|XP_010420232.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   355 bits (910),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 183/203 (90%), Gaps = 2/203 (1%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L  C  F F+I   A  +DPLDP GN+TIKWD+MSWTADGYVA VTMNNFQ+YR I +P
Sbjct  2    RLFLC--FFFMIIFSATAYDPLDPSGNVTIKWDIMSWTADGYVATVTMNNFQVYRHIQNP  59

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  60   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSN  119

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ +WG+DPSA+VS FQVS GLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPS
Sbjct  120  CCKGGVIGAWGQDPSAAVSQFQVSAGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPS  179

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT D+RRKTQALMTWNVTCT
Sbjct  180  TVFLTTDKRRKTQALMTWNVTCT  202



>ref|XP_010492405.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   355 bits (910),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 183/203 (90%), Gaps = 2/203 (1%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L  C  F F+I   A  +DPLDP GN+TIKWD+MSWTADGYVA VTMNNFQ+YR I +P
Sbjct  2    RLFLC--FFFMIIFSATAYDPLDPSGNVTIKWDIMSWTADGYVATVTMNNFQVYRHIQNP  59

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  60   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSN  119

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ +WG+DPSA+VS FQ+S GLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPS
Sbjct  120  CCKGGVIGAWGQDPSAAVSQFQISAGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPS  179

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT D+RRKTQALMTWNVTCT
Sbjct  180  TVFLTTDKRRKTQALMTWNVTCT  202



>ref|XP_006400085.1| hypothetical protein EUTSA_v10013604mg [Eutrema salsugineum]
 gb|ESQ41538.1| hypothetical protein EUTSA_v10013604mg [Eutrema salsugineum]
Length=432

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = +1

Query  121  LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAK  300
            +I   A  +DPLDP GNITIKWD+MSWTADGYVA VTMNNFQMYR I +PGWTLGW+WAK
Sbjct  12   MIILSATAYDPLDPSGNITIKWDIMSWTADGYVATVTMNNFQMYRHIQNPGWTLGWAWAK  71

Query  301  KEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASW  480
            KEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCKGGVV +W
Sbjct  72   KEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVGAW  131

Query  481  GEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRR  660
            G+DPS++VS FQVSVGLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPSTVFLT D+RR
Sbjct  132  GQDPSSAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTVFLTTDKRR  191

Query  661  KTQALMTWNVTCT  699
            KTQALMTWNVTCT
Sbjct  192  KTQALMTWNVTCT  204



>ref|XP_009763133.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=435

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWS  291
            F+  + PHA  FDPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR IM+PGWTLGW+
Sbjct  12   FIIALIPHAAAFDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWT  71

Query  292  WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVV  471
            WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPGVPYNQQF+NCCKGGV+
Sbjct  72   WAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKNPTVVDLLPGVPYNQQFTNCCKGGVL  131

Query  472  ASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTAD  651
            ASWG+DP +SVSAFQ+SVG AGTSNKTVKLP NFTL+GPGPGYTCGPAKIVP T F T D
Sbjct  132  ASWGQDPQSSVSAFQISVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPPTKFFTPD  191

Query  652  RRRKTQALMTWNVTCT  699
             RRKTQALMTWNVTCT
Sbjct  192  LRRKTQALMTWNVTCT  207



>gb|AAR13305.1| phytochelatin synthetase-like protein [Phaseolus vulgaris]
Length=463

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  118  FLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWA  297
            FL+F     +DPLDP GN+TIKWDV+SWT DGYVA VTM+NFQM+R IM+PGWTL WSWA
Sbjct  43   FLMFLIVAAYDPLDPNGNVTIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNPGWTLSWSWA  102

Query  298  KKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVAS  477
            KKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCKGGVVA+
Sbjct  103  KKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAA  162

Query  478  WGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRR  657
            WG+DPS++VS+FQVS+GLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPSTVFLTAD+R
Sbjct  163  WGQDPSSAVSSFQVSIGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPSTVFLTADKR  222

Query  658  RKTQALMTWNVTCT  699
            RKTQALMTWNVTCT
Sbjct  223  RKTQALMTWNVTCT  236



>ref|XP_009394778.1| PREDICTED: COBRA-like protein 4 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  115  LFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSW  294
            + L+  HA  +DPLDP GNITIKWDVMSWTADGYVA VTMNNFQMYR IMSPGWT+GW+W
Sbjct  17   VLLLSSHAVAYDPLDPTGNITIKWDVMSWTADGYVAVVTMNNFQMYRQIMSPGWTMGWTW  76

Query  295  AKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVA  474
            AKKEVIWS+VGAQATEQGDCSKFKGN+PHCCK+TP +VDLLPGVPYNQQ +NCCKGGVVA
Sbjct  77   AKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKRTPAVVDLLPGVPYNQQIANCCKGGVVA  136

Query  475  SWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADR  654
            S+G+DP+A+VSAFQVSVGL+GTSNKTVKLP NFTL+GPG GYTCGPAK+VPST FL+AD+
Sbjct  137  SYGQDPAAAVSAFQVSVGLSGTSNKTVKLPNNFTLLGPGLGYTCGPAKVVPSTTFLSADK  196

Query  655  RRKTQALMTWNVTCT  699
            RRKTQALMTWNVTCT
Sbjct  197  RRKTQALMTWNVTCT  211



>ref|NP_001242777.1| uncharacterized protein LOC100784352 precursor [Glycine max]
 gb|ACU17729.1| unknown [Glycine max]
Length=431

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            ++   AV   ++F +A  +DPLDP GNITIKWDV+SWT DGYVA VTM+NFQM+R IM+P
Sbjct  2    RVVISAVCAIVLFSYAAAYDPLDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS++VS+ QVS+GLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  122  CCKGGVVAAWGQDPSSAVSSLQVSIGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT D+RRKTQALMTWNVTCT
Sbjct  182  TVFLTPDKRRKTQALMTWNVTCT  204



>ref|XP_009131486.1| PREDICTED: COBRA-like protein 4 [Brassica rapa]
Length=433

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = +1

Query  133  HAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVI  312
            +A  +DPLDP GNITIKWD+MSWTADGYVA VTMNNFQ+YR I SPGWTLGW+WAKKEVI
Sbjct  16   NASAYDPLDPNGNITIKWDIMSWTADGYVATVTMNNFQIYRHIQSPGWTLGWAWAKKEVI  75

Query  313  WSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDP  492
            WS+VGAQATEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQ SNCCKGGVV +WG+DP
Sbjct  76   WSMVGAQATEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQISNCCKGGVVGAWGQDP  135

Query  493  SASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQA  672
            S++VS FQVSVGLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPSTVFLT D+RRKTQA
Sbjct  136  SSAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTVFLTTDKRRKTQA  195

Query  673  LMTWNVTCT  699
            LMTWNVTCT
Sbjct  196  LMTWNVTCT  204



>ref|XP_007037618.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
 gb|EOY22119.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
Length=463

 Score =   355 bits (910),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +1

Query  109  VFLFLI-FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            V LFLI  P+   +DPLDP GNITIKWD++SWTADGYVAAVTM+NFQMYR+IMSPGWTLG
Sbjct  39   VVLFLIMLPNTAAYDPLDPTGNITIKWDIVSWTADGYVAAVTMSNFQMYRSIMSPGWTLG  98

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKK P +VDLLPGVPYNQQFSNCCKGG
Sbjct  99   WQWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKNPIVVDLLPGVPYNQQFSNCCKGG  158

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VV++WG+DP  SVSAFQVSVG+AGTSNKTVKLPTNF+L+GPGPGYTCGPAK+VPSTV+ T
Sbjct  159  VVSAWGQDPIGSVSAFQVSVGVAGTSNKTVKLPTNFSLLGPGPGYTCGPAKVVPSTVYFT  218

Query  646  ADRRRKTQALMTWNVTCT  699
             D RRKTQALMTWNVTCT
Sbjct  219  PDHRRKTQALMTWNVTCT  236



>ref|XP_010695259.1| PREDICTED: COBRA-like protein 4 [Beta vulgaris subsp. vulgaris]
Length=464

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  55   QPKHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTM  234
            Q ++  + + L    + A  + ++  +AE +DPLDP GNITIKWDV+SWT DGYVA VTM
Sbjct  23   QCQYSAAQAELKFAVYAAFAVLMLSCYAEAYDPLDPNGNITIKWDVVSWTPDGYVALVTM  82

Query  235  NNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDL  414
            NNFQMYR IM+PGWTL W WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDL
Sbjct  83   NNFQMYRHIMNPGWTLTWMWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDL  142

Query  415  LPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGP  594
            LPGVPYNQQ +NCCKGGVVA+WG+DP ++VSAFQVSVG+AGTSNKTVKLP NFTL+GPGP
Sbjct  143  LPGVPYNQQIANCCKGGVVAAWGQDPDSAVSAFQVSVGVAGTSNKTVKLPQNFTLLGPGP  202

Query  595  GYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GYTCGPAKIVPSTV+LT DRRRKTQALMTWNVTCT
Sbjct  203  GYTCGPAKIVPSTVYLTPDRRRKTQALMTWNVTCT  237



>gb|KFK25792.1| hypothetical protein AALP_AA8G161300 [Arabis alpina]
Length=433

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L FC    F+I   +  +DPLDP GNITIKWD+MSWTADGYVA V +NNFQ+YR I +P
Sbjct  2    RLLFCFCIFFMIIFSSSAYDPLDPNGNITIKWDIMSWTADGYVATVAINNFQIYRHIQNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  62   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFTN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS++VS FQVSVGLAGT+NKTVKLP NFTL+GPG GYTCGPAKIVPS
Sbjct  122  CCKGGVVAAWGQDPSSAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGLGYTCGPAKIVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLTAD+RRKTQALMTWNVTCT
Sbjct  182  TAFLTADKRRKTQALMTWNVTCT  204



>gb|KDO65677.1| hypothetical protein CISIN_1g013089mg [Citrus sinensis]
Length=449

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 185/203 (91%), Gaps = 1/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +  A+  F++  HAE +DPLDP GN+TIKWDVMSWT DGYVAAVT+NNFQMYR I +P
Sbjct  20   KFALLAIAFFML-SHAEAYDPLDPTGNVTIKWDVMSWTPDGYVAAVTINNFQMYRHIGAP  78

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW WAKKEVIW++VGAQ TEQGDCSKFK N+PHCCK+TP +VDLLPGVPYNQQF+N
Sbjct  79   GWTLGWQWAKKEVIWTMVGAQTTEQGDCSKFKANIPHCCKRTPIVVDLLPGVPYNQQFAN  138

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+++WG+DP+++VSAFQVSVGLAGTSNKTVKLP NFTL GPGPGYTCGPAK+VPS
Sbjct  139  CCKGGVLSAWGQDPASAVSAFQVSVGLAGTSNKTVKLPKNFTLQGPGPGYTCGPAKVVPS  198

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TV+LT+DRRRKTQALMTWNVTCT
Sbjct  199  TVYLTSDRRRKTQALMTWNVTCT  221



>emb|CDX78644.1| BnaA03g05560D [Brassica napus]
Length=433

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = +1

Query  133  HAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVI  312
            +A  +DPLDP GNITIKWD+MSWTADGYVA VTMNNFQ+YR I SPGWTLGW+WAKKEVI
Sbjct  16   NASAYDPLDPNGNITIKWDIMSWTADGYVATVTMNNFQIYRHIQSPGWTLGWAWAKKEVI  75

Query  313  WSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDP  492
            WS+VGAQATEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQ SNCCKGGVV +WG+DP
Sbjct  76   WSMVGAQATEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQISNCCKGGVVGAWGQDP  135

Query  493  SASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQA  672
            S++VS FQVSVGLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPSTVFLT D+RRKTQA
Sbjct  136  SSAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTVFLTTDKRRKTQA  195

Query  673  LMTWNVTCT  699
            LMTWNVTCT
Sbjct  196  LMTWNVTCT  204



>ref|XP_008464584.1| PREDICTED: COBRA-like protein 4 [Cucumis melo]
Length=433

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            ++   AVFLF+ F     +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IMSP
Sbjct  2    RVFISAVFLFVFFSLGAAYDPLDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKEVIWS+VG+Q TEQGDCSKFKGN+PHCCKK PT+VDL+PGVPYNQQF+N
Sbjct  62   GWTMGWTWAKKEVIWSMVGSQTTEQGDCSKFKGNIPHCCKKNPTVVDLMPGVPYNQQFTN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DP A++SAFQ+SVG AGTSNKTVKLP NFTL+GPGPGYTCG AK+VPS
Sbjct  122  CCKGGVVAAWGQDPQAAISAFQLSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGRAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT DRRRKTQALMTWNVTCT
Sbjct  182  TTFLTPDRRRKTQALMTWNVTCT  204



>ref|XP_006477707.1| PREDICTED: COBRA-like protein 4-like [Citrus sinensis]
Length=449

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +1

Query  82   TLAKLSFCAVFL-FLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRA  258
            T  +L F  + + F +  HAE +DPLDP GN+TIKWDVMSWT DGYVAAVT+NNFQMYR 
Sbjct  15   TFLELKFALLAIAFFMLSHAEAYDPLDPTGNVTIKWDVMSWTPDGYVAAVTINNFQMYRH  74

Query  259  IMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQ  438
            I +PGWTLGW WAKKEV+W++VGAQ TEQGDCSKFK N+PHCCK+TP +VDLLPGVPYNQ
Sbjct  75   IGAPGWTLGWQWAKKEVLWTMVGAQTTEQGDCSKFKANIPHCCKRTPIVVDLLPGVPYNQ  134

Query  439  QFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAK  618
            QF+NCCKGGV+++WG+DP+++VSAFQVSVGLAGTSNKTVKLP NFTL GPGPGYTCGPAK
Sbjct  135  QFANCCKGGVLSAWGQDPASAVSAFQVSVGLAGTSNKTVKLPKNFTLQGPGPGYTCGPAK  194

Query  619  IVPSTVFLTADRRRKTQALMTWNVTCT  699
            +VPSTV+LT+DRRRKTQALMTWNVTCT
Sbjct  195  VVPSTVYLTSDRRRKTQALMTWNVTCT  221



>ref|XP_009761753.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=434

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWS  291
            FLF+ F +   +DPLDP GNITIKWDVMSWT DGYVA VT+NNFQMYR IM+PGWTLGW+
Sbjct  11   FLFVFFSYGAAYDPLDPNGNITIKWDVMSWTPDGYVAVVTINNFQMYRHIMTPGWTLGWT  70

Query  292  WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVV  471
            WAKKEVIW++VGAQ TEQGDCSKFKGNVPHCCKKTPT VD+LPGVPYNQQF+NCCKGGV+
Sbjct  71   WAKKEVIWTMVGAQTTEQGDCSKFKGNVPHCCKKTPTTVDMLPGVPYNQQFTNCCKGGVL  130

Query  472  ASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTAD  651
            ASWG+DP ASVSAFQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAKIVPST F T D
Sbjct  131  ASWGQDPQASVSAFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTKFFTPD  190

Query  652  RRRKTQALMTWNVTCT  699
             RRKTQALMTWNVTCT
Sbjct  191  LRRKTQALMTWNVTCT  206



>ref|XP_004138334.1| PREDICTED: COBRA-like protein 4-like, partial [Cucumis sativus]
 ref|XP_004171718.1| PREDICTED: COBRA-like protein 4-like, partial [Cucumis sativus]
Length=416

 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWDV+SWT DGYVA VTMNNFQMYR I SPGWTLGWSWAKKEVIWS+V
Sbjct  4    YDPLDPNGNITIKWDVVSWTPDGYVAVVTMNNFQMYRHINSPGWTLGWSWAKKEVIWSMV  63

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQ TEQGDCSKFKGNVPHCCKKTP +VDLLPGVPYNQQFSNCCKGGV+ASWG+DP++SV
Sbjct  64   GAQTTEQGDCSKFKGNVPHCCKKTPIVVDLLPGVPYNQQFSNCCKGGVLASWGQDPTSSV  123

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPSTVFLT DRRRKTQALMTW
Sbjct  124  SAFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPSTVFLTPDRRRKTQALMTW  183

Query  685  NVTCT  699
            NVTCT
Sbjct  184  NVTCT  188



>ref|XP_009394776.1| PREDICTED: COBRA-like protein 4 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   354 bits (908),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  115  LFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSW  294
            + L+  HA  +DPLDP GNITIKWDVMSWTADGYVA VTMNNFQMYR IMSPGWT+GW+W
Sbjct  17   VLLLSSHAVAYDPLDPTGNITIKWDVMSWTADGYVAVVTMNNFQMYRQIMSPGWTMGWTW  76

Query  295  AKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVA  474
            AKKEVIWS+VGAQATEQGDCSKFKGN+PHCCK+TP +VDLLPGVPYNQQ +NCCKGGVVA
Sbjct  77   AKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKRTPAVVDLLPGVPYNQQIANCCKGGVVA  136

Query  475  SWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADR  654
            S+G+DP+A+VSAFQVSVGL+GTSNKTVKLP NFTL+GPG GYTCGPAK+VPST FL+AD+
Sbjct  137  SYGQDPAAAVSAFQVSVGLSGTSNKTVKLPNNFTLLGPGLGYTCGPAKVVPSTTFLSADK  196

Query  655  RRKTQALMTWNVTCT  699
            RRKTQALMTWNVTCT
Sbjct  197  RRKTQALMTWNVTCT  211



>dbj|BAM05576.1| COBRA-like protein [Eucalyptus pilularis]
 dbj|BAM05577.1| COBRA-like protein [Eucalyptus pyrocarpa]
Length=430

 Score =   352 bits (904),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 184/205 (90%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   LAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            L  L+F  VF+F    HA  +DPLDP GN+TIKWD+MSWT+DGYVA VT+NNFQ+YR IM
Sbjct  3    LVILAFVFVFVF----HAAAYDPLDPNGNVTIKWDIMSWTSDGYVAVVTLNNFQLYRHIM  58

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            SPGWTLGW+WAKKE+IWS+VGAQ TEQGDCSKFK  +PHCCKKTPT+VDLLPGVPYNQQ+
Sbjct  59   SPGWTLGWAWAKKEIIWSVVGAQTTEQGDCSKFKAAIPHCCKKTPTVVDLLPGVPYNQQY  118

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCCKGGVVA+WG+DP ASVSAFQV VGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+V
Sbjct  119  ANCCKGGVVAAWGQDPLASVSAFQVGVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVV  178

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
            PST FLT D+RRKTQALMTWNVTCT
Sbjct  179  PSTNFLTPDKRRKTQALMTWNVTCT  203



>gb|KGN53787.1| hypothetical protein Csa_4G129040 [Cucumis sativus]
Length=433

 Score =   352 bits (904),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            ++   AVFLF+ F     +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IMSP
Sbjct  2    RVFISAVFLFVFFSLGAAYDPLDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKEVIWS+VG+Q TEQGDCSKFKGN+PH CKK PT+VDL+PGVPYNQQF+N
Sbjct  62   GWTMGWTWAKKEVIWSMVGSQTTEQGDCSKFKGNIPHSCKKNPTVVDLMPGVPYNQQFTN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DP A+VSAFQ+S+G AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  122  CCKGGVVAAWGQDPQAAVSAFQLSIGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT DRRRKTQALMTWNVTCT
Sbjct  182  TTFLTPDRRRKTQALMTWNVTCT  204



>ref|XP_009346173.1| PREDICTED: COBRA-like protein 4 [Pyrus x bretschneideri]
Length=457

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +F AV   L+   A  +DPLDP GNITIKWDVMSWT DGYVAAVTMNNFQMYR I +P
Sbjct  24   KFTFLAVLYCLVLSPASAYDPLDPTGNITIKWDVMSWTPDGYVAAVTMNNFQMYRQISNP  83

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEVIW++VGAQ TEQGDC+KFK  +PHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  84   GWTLTWSWAKKEVIWTMVGAQTTEQGDCTKFKATIPHCCKKTPTVVDLLPGVPYNQQFTN  143

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DP A+VS FQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  144  CCKGGVLASWGQDPLAAVSGFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  203

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT DRRRKTQALMTWNVTCT
Sbjct  204  TVFLTTDRRRKTQALMTWNVTCT  226



>ref|XP_008374649.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=461

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K +F AV   L+   A  +DPLDP GNITIKWDVMSWT DGYVAAVTMNNFQMYR I +P
Sbjct  24   KFTFLAVLYCLVLSPASAYDPLDPTGNITIKWDVMSWTPDGYVAAVTMNNFQMYRQISNP  83

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEVIW++VGAQ TEQGDCSKFK  +PHCCKKTPT+VDLLPGVPYNQQF+N
Sbjct  84   GWTLTWSWAKKEVIWTMVGAQTTEQGDCSKFKAAIPHCCKKTPTVVDLLPGVPYNQQFTN  143

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ASWG+DP A+VS FQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPS
Sbjct  144  CCKGGVLASWGQDPLAAVSGFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPS  203

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT DRRRKTQALMTWNVTCT
Sbjct  204  TVFLTTDRRRKTQALMTWNVTCT  226



>ref|XP_010453698.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
 ref|XP_010453699.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   352 bits (903),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = +1

Query  100  FCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWT  279
            F   F  +IF  A  +DPLDP GN+TIKWD+MSWTADGYVA VTMNNFQ+YR I +PGWT
Sbjct  4    FLCFFCMIIF-SATAYDPLDPSGNVTIKWDIMSWTADGYVATVTMNNFQVYRHIQNPGWT  62

Query  280  LGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCK  459
            LGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCK
Sbjct  63   LGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCK  122

Query  460  GGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVF  639
            GGV+ +WG+DPSA+VS FQVS GLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPSTVF
Sbjct  123  GGVIGAWGQDPSAAVSQFQVSAGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTVF  182

Query  640  LTADRRRKTQALMTWNVTCT  699
            LT D+RRKTQALMTWNVTCT
Sbjct  183  LTTDKRRKTQALMTWNVTCT  202



>ref|XP_004491892.1| PREDICTED: COBRA-like protein 4-like [Cicer arietinum]
Length=432

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A+ + ++F +A  +DPLDP GNITIKWDV+SWT DGYVA VTM+NFQMYR IM+PGWTLG
Sbjct  7    ALCVIVLFSYAAAYDPLDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMYRHIMNPGWTLG  66

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            WSWAKKEVIWS+VG+Q TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCKGG
Sbjct  67   WSWAKKEVIWSMVGSQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGG  126

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VVA+WG+DPS++VS+FQ+SVG  GTSNKTVKLP NFTL+ PGPGYTCGPAKIVPST FLT
Sbjct  127  VVAAWGQDPSSAVSSFQISVGQGGTSNKTVKLPKNFTLLAPGPGYTCGPAKIVPSTTFLT  186

Query  646  ADRRRKTQALMTWNVTCT  699
            AD+RRKTQALMTWNVTCT
Sbjct  187  ADKRRKTQALMTWNVTCT  204



>emb|CDX70627.1| BnaC03g07110D [Brassica napus]
Length=858

 Score =   365 bits (936),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K+  C  F  +I   A  +DPLDP GNITIKWD+MSWTADGYVA VTMNNFQ YR I SP
Sbjct  427  KMRLCFCFFLMIIFSASAYDPLDPNGNITIKWDIMSWTADGYVATVTMNNFQTYRHIQSP  486

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQATEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQ SN
Sbjct  487  GWTLGWAWAKKEVIWSMVGAQATEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQISN  546

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVV +WG+DPS++VS FQVSVGLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPS
Sbjct  547  CCKGGVVGAWGQDPSSAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPS  606

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            TVFLT D+RRKTQALMTWNVTCT
Sbjct  607  TVFLTTDKRRKTQALMTWNVTCT  629



>ref|XP_002871675.1| hypothetical protein ARALYDRAFT_488408 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47934.1| hypothetical protein ARALYDRAFT_488408 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GNITIKWD+MSWTADGYVA VTMNNFQMYR I +PGWTLGW+WAKKEVIW
Sbjct  18   ATAYDPLDPSGNITIKWDIMSWTADGYVATVTMNNFQMYRHIQNPGWTLGWTWAKKEVIW  77

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            S+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCKGGV+ +WG+DPS
Sbjct  78   SMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS  137

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
            A+VS FQVS GLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPSTVFLT D+RRKTQAL
Sbjct  138  AAVSQFQVSAGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTVFLTTDKRRKTQAL  197

Query  676  MTWNVTCT  699
            MTWNVTCT
Sbjct  198  MTWNVTCT  205



>ref|NP_197067.2| COBRA-like protein 4 [Arabidopsis thaliana]
 sp|Q9LFW3.2|COBL4_ARATH RecName: Full=COBRA-like protein 4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAT44976.1| At5g15630 [Arabidopsis thaliana]
 gb|AAW30024.1| At5g15630 [Arabidopsis thaliana]
 gb|AED92186.1| COBRA-like protein 4 [Arabidopsis thaliana]
Length=431

 Score =   351 bits (900),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GNITIKWD+MSWTADGYVA VTMNNFQ+YR I +PGWTLGW+WAKKEVIW
Sbjct  18   ATAYDPLDPSGNITIKWDIMSWTADGYVATVTMNNFQIYRHIQNPGWTLGWTWAKKEVIW  77

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            S+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCKGGV+ +WG+DPS
Sbjct  78   SMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS  137

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
            A+VS FQVS GLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPSTVFLT D+RRKTQAL
Sbjct  138  AAVSQFQVSAGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTVFLTTDKRRKTQAL  197

Query  676  MTWNVTCT  699
            MTWNVTCT
Sbjct  198  MTWNVTCT  205



>ref|XP_006338344.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=434

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWS  291
            FL  + PH   FDPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR IM+PGWTLGW+
Sbjct  11   FLIALIPHTVAFDPLDPNGNITIKWDVMSWTPDGYVATVTMNNFQMYRHIMTPGWTLGWT  70

Query  292  WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVV  471
            WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG PYNQQF+NCCKGGV+
Sbjct  71   WAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKNPTVVDLLPGTPYNQQFTNCCKGGVL  130

Query  472  ASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTAD  651
            ASWG+DP +SVSAFQVSVG AGT+NKTVKLP NFTL+GPGPGYTCGPAKIVP T F T D
Sbjct  131  ASWGQDPQSSVSAFQVSVGQAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPPTKFFTPD  190

Query  652  RRRKTQALMTWNVTCT  699
             RRKTQALMTWNVTCT
Sbjct  191  LRRKTQALMTWNVTCT  206



>ref|XP_010936445.1| PREDICTED: COBRA-like protein 4 [Elaeis guineensis]
Length=466

 Score =   351 bits (900),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 185/207 (89%), Gaps = 2/207 (1%)
 Frame = +1

Query  85   LAKLSFC-AVFLF-LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRA  258
              KL F  +VFL  ++F  A  +DPLDP GNIT KWDV+SWT DGYVA VTMNNFQMYR 
Sbjct  31   FRKLGFIMSVFLCGMMFHPAVGYDPLDPTGNITFKWDVISWTPDGYVAVVTMNNFQMYRH  90

Query  259  IMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQ  438
            IM+PGWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQ
Sbjct  91   IMNPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQ  150

Query  439  QFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAK  618
            Q +NCCKGGVV+SWG+DP+ SVS+FQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK
Sbjct  151  QIANCCKGGVVSSWGQDPAGSVSSFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAK  210

Query  619  IVPSTVFLTADRRRKTQALMTWNVTCT  699
            IVPST FLT D+RRKTQALMTWNVTCT
Sbjct  211  IVPSTTFLTPDKRRKTQALMTWNVTCT  237



>ref|XP_006287794.1| hypothetical protein CARUB_v10001005mg [Capsella rubella]
 gb|EOA20692.1| hypothetical protein CARUB_v10001005mg [Capsella rubella]
Length=432

 Score =   350 bits (897),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GN+TIKWD+MSWTADGYVA VTMNNFQ+YR I +PGWTLGW+WAKKEVIW
Sbjct  17   ATAYDPLDPSGNVTIKWDIMSWTADGYVATVTMNNFQIYRHIQNPGWTLGWTWAKKEVIW  76

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            S+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCKGGV+ +WG+DPS
Sbjct  77   SMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS  136

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
            A+VS FQVSVGLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPST FLT D+RRKTQAL
Sbjct  137  AAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTAFLTTDKRRKTQAL  196

Query  676  MTWNVTCT  699
            MTWNVTCT
Sbjct  197  MTWNVTCT  204



>ref|XP_008775851.1| PREDICTED: COBRA-like protein 4 [Phoenix dactylifera]
Length=466

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 184/205 (90%), Gaps = 2/205 (1%)
 Frame = +1

Query  91   KLSFC-AVFLF-LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            KL F  +VFL  ++F  A  +DPLDP GNITIKWDV+SWT DGYVA V MNNFQMYR IM
Sbjct  33   KLGFIMSVFLCGMMFHPAVGYDPLDPTGNITIKWDVISWTPDGYVAVVIMNNFQMYRHIM  92

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGWTLGWSWAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQ 
Sbjct  93   NPGWTLGWSWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQI  152

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCCKGGVV SWG+DP+A+VS+FQVSVGLAGTSNKTVKLP NFTL+GPGPGYTCGPAKIV
Sbjct  153  ANCCKGGVVGSWGQDPAAAVSSFQVSVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIV  212

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
            PST FLT D RRKTQALMTWNVTCT
Sbjct  213  PSTTFLTPDHRRKTQALMTWNVTCT  237



>dbj|BAM05578.1| COBRA-like protein [Eucalyptus globulus subsp. globulus]
Length=430

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 4/202 (2%)
 Frame = +1

Query  94   LSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            L+F  VF+F    HA  +DPLDP GN+TIKWD+MSWT DGYVA VT+NNFQMYR IMSPG
Sbjct  6    LAFVFVFVF----HAAAYDPLDPNGNVTIKWDIMSWTTDGYVAVVTLNNFQMYRHIMSPG  61

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WT+GW+WAKKE+IWS+VGAQ TEQGDCSKFK  +PHCCK+TPT+VDLLPGVPYN Q++NC
Sbjct  62   WTIGWAWAKKEIIWSMVGAQTTEQGDCSKFKAAIPHCCKRTPTVVDLLPGVPYNLQYANC  121

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CKGGVVA+WG+DP ASVSAFQ+SVGL+GTSNKTVKLP NFTL+GPGPGYTCGPAK+VPST
Sbjct  122  CKGGVVAAWGQDPLASVSAFQISVGLSGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPST  181

Query  634  VFLTADRRRKTQALMTWNVTCT  699
             FLT D+RRKTQALMTWNVTCT
Sbjct  182  NFLTTDKRRKTQALMTWNVTCT  203



>ref|XP_004234909.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=431

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +1

Query  100  FCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWT  279
            +    + L+F +A  +DPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR IMSPGWT
Sbjct  4    YLITLIGLLFGYAAAYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWT  63

Query  280  LGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCK  459
            LGW+WAKKEVIW+++GAQATEQGDCSKFKGN+PHCCKKTPT+VD+LPGVPYNQQF+NCCK
Sbjct  64   LGWTWAKKEVIWTMIGAQATEQGDCSKFKGNIPHCCKKTPTVVDMLPGVPYNQQFTNCCK  123

Query  460  GGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVF  639
            GGV+ASWG+DP +SVSAFQVSVG AGT+NKTVKLP NFTL+GPGPGYTC PAKIVP T F
Sbjct  124  GGVLASWGQDPQSSVSAFQVSVGQAGTTNKTVKLPKNFTLLGPGPGYTCSPAKIVPPTKF  183

Query  640  LTADRRRKTQALMTWNVTCT  699
             T D RRKTQALMTWN+TCT
Sbjct  184  FTPDLRRKTQALMTWNLTCT  203



>ref|XP_004232142.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=434

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +1

Query  85   LAKLSFCAVFLFL-IFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAI  261
            +  L   A FL + + PH   FDPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR I
Sbjct  1    MRGLIVVAGFLIIALIPHTVAFDPLDPNGNITIKWDVMSWTPDGYVATVTMNNFQMYRHI  60

Query  262  MSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQ  441
            M+PGWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG PYNQQ
Sbjct  61   MTPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKNPTVVDLLPGTPYNQQ  120

Query  442  FSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKI  621
            F+NCCKGGV+ASWG+DP +SVSAFQVSVG AGT+NKTVKLP NFTL+GPGPGYTCGPAKI
Sbjct  121  FTNCCKGGVLASWGQDPQSSVSAFQVSVGQAGTTNKTVKLPKNFTLLGPGPGYTCGPAKI  180

Query  622  VPSTVFLTADRRRKTQALMTWNVTCT  699
            VP T F T D RRKTQALMTWNVTCT
Sbjct  181  VPPTKFFTPDLRRKTQALMTWNVTCT  206



>ref|XP_007216522.1| hypothetical protein PRUPE_ppa024465mg [Prunus persica]
 gb|EMJ17721.1| hypothetical protein PRUPE_ppa024465mg [Prunus persica]
Length=432

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A+F  +IF +A  FDPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IMSPGWTLG
Sbjct  7    ALFSLVIFSYAAAFDPLDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSPGWTLG  66

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W+WA++EVIWS VGAQATEQGDCS+FKGN+PHCCK+ PT VDLLPGVPYNQQF+NCCKGG
Sbjct  67   WTWARREVIWSAVGAQATEQGDCSRFKGNIPHCCKRNPTFVDLLPGVPYNQQFTNCCKGG  126

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            V+ +WG+DPSA+VSAFQ+SVG AGTSN+TV+LP NFTL+GPGPGYTCG A++VP T+FLT
Sbjct  127  VLGAWGQDPSAAVSAFQLSVGSAGTSNRTVRLPRNFTLLGPGPGYTCGRARVVPPTIFLT  186

Query  646  ADRRRKTQALMTWNVTCT  699
             DRRRKTQALMTWNVTCT
Sbjct  187  PDRRRKTQALMTWNVTCT  204



>ref|XP_002264378.1| PREDICTED: COBRA-like protein 4 [Vitis vinifera]
Length=462

 Score =   349 bits (895),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K  F  V  F++  HA  +DPLDP GNITIKWDV+SWT DGYVA VTMNNFQMYR IM+P
Sbjct  33   KHIFSVVIFFMMVSHAIAYDPLDPTGNITIKWDVVSWTPDGYVALVTMNNFQMYRHIMTP  92

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEVIWS+VGAQ TEQGDCSKFK N+PHCC+KTPT+VDLLPGVPYNQQ +N
Sbjct  93   GWTLSWSWAKKEVIWSMVGAQTTEQGDCSKFKANIPHCCEKTPTVVDLLPGVPYNQQIAN  152

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCK GVVA+WG+DP+ SVS+FQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAKIVPS
Sbjct  153  CCKAGVVAAWGQDPAGSVSSFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPS  212

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T++LT D RRKTQA+MTWNVTCT
Sbjct  213  TIYLTPDHRRKTQAMMTWNVTCT  235



>gb|KHG24029.1| COBRA-like protein 4 [Gossypium arboreum]
Length=430

 Score =   348 bits (892),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 182/203 (90%), Gaps = 3/203 (1%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +    A+FLF++   A  +DPLDP GN+TIKWD++SWT DGYVA VTMNNFQMYR IMSP
Sbjct  2    RFVISALFLFVV---AAAYDPLDPNGNLTIKWDIVSWTPDGYVAVVTMNNFQMYRHIMSP  58

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+ GAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQ+SN
Sbjct  59   GWTLGWTWAKKEVIWSMNGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQYSN  118

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+ +WG DP ++VSAFQ+SVG+AGTSNKTVK+P NFTL+GPGPGYTCGPAK+VPS
Sbjct  119  CCKGGVLPAWGIDPQSAVSAFQISVGMAGTSNKTVKVPKNFTLLGPGPGYTCGPAKVVPS  178

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT DRRRKTQALMTWNVTCT
Sbjct  179  TTFLTQDRRRKTQALMTWNVTCT  201



>ref|XP_008230409.1| PREDICTED: COBRA-like protein 4 [Prunus mume]
Length=442

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A+F  +IF +A+ FDPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IMSPGWTLG
Sbjct  7    ALFFLVIFSYADAFDPLDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSPGWTLG  66

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W+WA++EVIWS VGAQATEQGDCS+FKGN+PHCCK+ PT VDLLP VPYNQQF+NCCKGG
Sbjct  67   WTWARREVIWSAVGAQATEQGDCSRFKGNIPHCCKRNPTFVDLLPSVPYNQQFTNCCKGG  126

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            V+ +WG+DPSA+VSAFQ+SVG AGTSN+TVKLP NFTL+GPGPG+TCG A++VP T+FLT
Sbjct  127  VLGAWGQDPSAAVSAFQLSVGSAGTSNRTVKLPRNFTLLGPGPGHTCGRARVVPPTIFLT  186

Query  646  ADRRRKTQALMTWNVTCT  699
             DRRRKTQALMTWNVTCT
Sbjct  187  PDRRRKTQALMTWNVTCT  204



>ref|XP_011085598.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=431

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWS  291
            F+ ++F   + +DPLDP GNITIKWD+MSWT DGYVA VTMNNFQMYR IMSPGWT+GW+
Sbjct  9    FVCVLFSSVDAYDPLDPNGNITIKWDIMSWTPDGYVAVVTMNNFQMYRHIMSPGWTVGWT  68

Query  292  WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVV  471
            WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG PYNQQFSNCCKGGV+
Sbjct  69   WAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKDPTVVDLLPGAPYNQQFSNCCKGGVL  128

Query  472  ASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTAD  651
            A+W +DP ASVSAFQVSVG AGT+NKTVKLP NFTL+GPGPGYTCGPAK+VP T FLT D
Sbjct  129  AAWAQDPQASVSAFQVSVGQAGTTNKTVKLPKNFTLLGPGPGYTCGPAKVVPPTNFLTPD  188

Query  652  RRRKTQALMTWNVTCT  699
            RRRKTQALMTWNVTCT
Sbjct  189  RRRKTQALMTWNVTCT  204



>ref|XP_006368071.1| PREDICTED: COBRA-like protein 4-like, partial [Solanum tuberosum]
Length=408

 Score =   346 bits (887),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GNITIKWDVMSWT DGYVA VTMNNFQMYR IMSPGWTLGW+WAKKEVIW
Sbjct  6    AAAYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIW  65

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            +++GAQATEQGDCSKFKGN+PHCCKKTPT+VD+LPGVPYNQQF+NCCKGGV+ASWG+DP 
Sbjct  66   TMIGAQATEQGDCSKFKGNIPHCCKKTPTVVDMLPGVPYNQQFTNCCKGGVLASWGQDPQ  125

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
            +SVSAFQVSVG AGT+NKTVKLP NFTL+GPGPGYTC PAKIVP T F TAD RRKTQAL
Sbjct  126  SSVSAFQVSVGQAGTTNKTVKLPKNFTLLGPGPGYTCSPAKIVPPTKFFTADLRRKTQAL  185

Query  676  MTWNVTCT  699
            MTWNVTCT
Sbjct  186  MTWNVTCT  193



>ref|XP_010549989.1| PREDICTED: COBRA-like protein 4 [Tarenaya hassleriana]
 gb|ABD96834.1| hypothetical protein [Cleome spinosa]
Length=440

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GN+TIKWDVMSWT DGYVA V MNNFQMYR I +PGWTLGW+WAKKEVIWS+V
Sbjct  26   YDPLDPNGNVTIKWDVMSWTPDGYVAVVAMNNFQMYRHIPNPGWTLGWTWAKKEVIWSMV  85

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQFSNCCKGGVVA+WG+DPSASV
Sbjct  86   GAQTTEQGDCSKFKGNVPHCCKKTPTLVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSASV  145

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S FQVSVGLAGTSNKTVKLP NFTL+GPG GYTCGPAKIVPST+FLT D+RRKTQALMTW
Sbjct  146  SQFQVSVGLAGTSNKTVKLPKNFTLLGPGLGYTCGPAKIVPSTIFLTPDKRRKTQALMTW  205

Query  685  NVTCT  699
            NVTCT
Sbjct  206  NVTCT  210



>ref|XP_010551802.1| PREDICTED: COBRA-like protein 4 [Tarenaya hassleriana]
Length=433

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWDVMSWT+DGYVA VTMNNFQMYR + +PGWTLGW+WAKKEVIWS+V
Sbjct  22   YDPLDPNGNITIKWDVMSWTSDGYVAVVTMNNFQMYRHVPNPGWTLGWTWAKKEVIWSMV  81

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQ TEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGV+A+WG+DPSASV
Sbjct  82   GAQTTEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVMAAWGQDPSASV  141

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S FQVSVGLAGT+NKTVKLP NFTL+GPG GYTCGPAKIVPST FLT D+RRKTQALMTW
Sbjct  142  SQFQVSVGLAGTTNKTVKLPKNFTLLGPGLGYTCGPAKIVPSTTFLTPDKRRKTQALMTW  201

Query  685  NVTCT  699
            NVTCT
Sbjct  202  NVTCT  206



>ref|XP_010663466.1| PREDICTED: COBRA-like protein 4 isoform X1 [Vitis vinifera]
Length=442

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            AVF  ++   A  +DPLDP GNITIKWDVMSWT+DGYVA VTM+NFQMYR IMSPGWTLG
Sbjct  17   AVFFSMVLSPAVAYDPLDPNGNITIKWDVMSWTSDGYVAVVTMSNFQMYRHIMSPGWTLG  76

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W WAKKEVIWS+VGAQATEQGDCSKFKGN+PHCCK+ PT++DLLPGVPYNQQ +NCCKGG
Sbjct  77   WIWAKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKRNPTVIDLLPGVPYNQQIANCCKGG  136

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VVASWG+D SA+VS+FQ+SVGL+GTSNKTV+LP NFTL+GPGPGYTCG AK VPS++FL+
Sbjct  137  VVASWGQDSSAAVSSFQLSVGLSGTSNKTVRLPKNFTLLGPGPGYTCGQAKTVPSSIFLS  196

Query  646  ADRRRKTQALMTWNVTCT  699
            +D RRKTQALMTWNVTCT
Sbjct  197  SDGRRKTQALMTWNVTCT  214



>ref|XP_010032553.1| PREDICTED: COBRA-like protein 4 [Eucalyptus grandis]
 gb|KCW51946.1| hypothetical protein EUGRSUZ_J01393 [Eucalyptus grandis]
Length=431

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 4/202 (2%)
 Frame = +1

Query  94   LSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            L+F  VF+F    HA  +DPLDP GN+TIKWD+MSWT DGYVA VT+NNFQMYR IMSPG
Sbjct  6    LAFVFVFVF----HAAAYDPLDPNGNVTIKWDIMSWTTDGYVAVVTLNNFQMYRHIMSPG  61

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WT+GW+WAKKE+IWS+VGAQ TEQGDCSKFK  +PH CK+TPT+VDLLPGVPYN Q++NC
Sbjct  62   WTIGWAWAKKEIIWSMVGAQTTEQGDCSKFKAAIPHSCKRTPTVVDLLPGVPYNLQYANC  121

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CKGGVVA+WG+DP ASVSAFQ+SVGL+GTSNKTVKLP NFTL+GPGPGYTCGPAK+VPST
Sbjct  122  CKGGVVAAWGQDPLASVSAFQISVGLSGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPST  181

Query  634  VFLTADRRRKTQALMTWNVTCT  699
             FLT D+RRKTQALMTWNVTCT
Sbjct  182  NFLTTDKRRKTQALMTWNVTCT  203



>emb|CDX90983.1| BnaC02g06140D [Brassica napus]
Length=435

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNIT+KWD+MSWTADGYVA VTMNNFQ+YR I +PGWTLGW+WAKKEVIWS+V
Sbjct  21   YDPLDPNGNITLKWDIMSWTADGYVATVTMNNFQIYRHIQNPGWTLGWAWAKKEVIWSMV  80

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQ TEQGDCSKFKGNVPHCCKK PT+VDLLPGVPYNQQFSNCCKGGVV +WG+DPS++V
Sbjct  81   GAQTTEQGDCSKFKGNVPHCCKKIPTVVDLLPGVPYNQQFSNCCKGGVVGAWGQDPSSAV  140

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S FQVSVGLAGT+NKTVKLP NFTL+GPGPGY+CGPAKIVPSTVF T D+RRKTQALMTW
Sbjct  141  SQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYSCGPAKIVPSTVFFTTDKRRKTQALMTW  200

Query  685  NVTCT  699
            NVTCT
Sbjct  201  NVTCT  205



>ref|XP_004137260.1| PREDICTED: COBRA-like protein 4-like [Cucumis sativus]
Length=451

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = +1

Query  118  FLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWA  297
            FL+F     +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IMSPGWT+GW+WA
Sbjct  29   FLLFWIVAAYDPLDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSPGWTMGWTWA  88

Query  298  KKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVAS  477
            KKEVIWS+VG+Q TEQGDCSKFKGN+PH CKK PT+VDL+PGVPYNQQF+NCCKGGVVA+
Sbjct  89   KKEVIWSMVGSQTTEQGDCSKFKGNIPHSCKKNPTVVDLMPGVPYNQQFTNCCKGGVVAA  148

Query  478  WGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRR  657
            WG+DP A+VSAFQ+S+G AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPST FLT DRR
Sbjct  149  WGQDPQAAVSAFQLSIGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPSTTFLTPDRR  208

Query  658  RKTQALMTWNVTCT  699
            RKTQALMTWNVTCT
Sbjct  209  RKTQALMTWNVTCT  222



>gb|KHN04371.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   345 bits (885),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L   A+ + ++F  A  +DPLDP GN+TIKWDVMSWT DGYVA VTM+NFQM+R IM+P
Sbjct  2    RLVVSALCVLVLFSCAVAYDPLDPNGNVTIKWDVMSWTPDGYVAVVTMHNFQMFRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS++GAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSMIGAQTTEQGDCSKFKGNIPHCCKKIPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS ++S+FQVSVG AGTSNKTVKLP NFTL  PGPGYTCGPAKIVPS
Sbjct  122  CCKGGVVAAWGQDPSQAISSFQVSVGQAGTSNKTVKLPKNFTLFAPGPGYTCGPAKIVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D+RRKTQALMTWNVTCT
Sbjct  182  TNFLTPDKRRKTQALMTWNVTCT  204



>gb|EYU44225.1| hypothetical protein MIMGU_mgv1a006751mg [Erythranthe guttata]
Length=433

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K    A+ L L+F     +D LDP GNITIKWD+M+WT DGYVA VT+NNFQMYR IMSP
Sbjct  2    KFLIAAISLSLLFSSTVAYDSLDPNGNITIKWDIMAWTPDGYVAIVTVNNFQMYRHIMSP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCC K PT+VDLLPGVPYNQQF+N
Sbjct  62   GWTVGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCNKKPTVVDLLPGVPYNQQFAN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGV+A+WG+DP ASVSAFQVSVGLAGT+NKTVKLP+NFTL+GPGPGYTCGPAK VP 
Sbjct  122  CCKGGVLAAWGQDPQASVSAFQVSVGLAGTNNKTVKLPSNFTLLGPGPGYTCGPAKTVPP  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FL+ DRRRKTQALMTWNVTCT
Sbjct  182  TNFLSPDRRRKTQALMTWNVTCT  204



>gb|AFY03623.1| COBRA-like protein [Eucalyptus globulus]
Length=430

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 4/202 (2%)
 Frame = +1

Query  94   LSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            L+F  VF+F    HA  +DPLDP GN+TIKWD+MSWT DGYVA VT+NNFQMYR IMSPG
Sbjct  6    LAFVFVFVF----HAAAYDPLDPNGNVTIKWDIMSWTTDGYVAVVTLNNFQMYRHIMSPG  61

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WT+GW+WAKKE+IWS+VGAQ TEQGDCSKFK  +PH CK+TPT+VDLLPGVPYN Q++NC
Sbjct  62   WTIGWAWAKKEIIWSMVGAQTTEQGDCSKFKAAIPHXCKRTPTVVDLLPGVPYNLQYANC  121

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CKGGVVA+WG+DP ASVSAFQ+SVGL+GTSNKTVKLP NFTL+GPGPGYTCGPAK+VPST
Sbjct  122  CKGGVVAAWGQDPLASVSAFQISVGLSGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPST  181

Query  634  VFLTADRRRKTQALMTWNVTCT  699
             FLT D+RRKTQALMTWNVTCT
Sbjct  182  NFLTTDKRRKTQALMTWNVTCT  203



>ref|XP_003554956.1| PREDICTED: COBRA-like protein 4-like [Glycine max]
Length=431

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L   A+ + ++F  A  +DPLDP GN+TIKWD+MSWT DGYVA VTM+NFQM+R IM+P
Sbjct  2    RLVVSALCVLVLFSCAVAYDPLDPNGNVTIKWDLMSWTPDGYVAVVTMHNFQMFRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS++GAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSMIGAQTTEQGDCSKFKGNIPHCCKKIPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS ++S+FQVSVG AGTSNKTVKLP NFTL  PGPGYTCGPAKIVPS
Sbjct  122  CCKGGVVAAWGQDPSQAISSFQVSVGQAGTSNKTVKLPKNFTLFAPGPGYTCGPAKIVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D+RRKTQALMTWNVTCT
Sbjct  182  TNFLTPDKRRKTQALMTWNVTCT  204



>ref|XP_007151374.1| hypothetical protein PHAVU_004G041400g [Phaseolus vulgaris]
 gb|ESW23368.1| hypothetical protein PHAVU_004G041400g [Phaseolus vulgaris]
Length=431

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L   A+ + + F  A  +DPLDP GNITIKWDVMSWT DGYVA VT++NFQM+R IM+P
Sbjct  2    RLVISALCVLVFFSCAGAYDPLDPNGNITIKWDVMSWTPDGYVAVVTVHNFQMFRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKG++PHCCKKTPT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGSIPHCCKKTPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPS ++S+FQVSVG AGT+NKTVKLP NFTL+ PGPGY+CGPAKIVPS
Sbjct  122  CCKGGVVAAWGQDPSQAISSFQVSVGQAGTTNKTVKLPKNFTLLAPGPGYSCGPAKIVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D+RRKTQALMTWNVTCT
Sbjct  182  TTFLTPDKRRKTQALMTWNVTCT  204



>gb|KEH25135.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=431

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            KL   +  + ++  +A  +DPLDP GNITIKWDVMSWT DGYVA VT++NFQM+R IM+P
Sbjct  2    KLVISSFCVLVLVSYAVAYDPLDPNGNITIKWDVMSWTPDGYVATVTIHNFQMFRHIMNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+ GAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWTWAKKEVIWSVTGAQTTEQGDCSKFKGNIPHCCKKIPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DP+ ++SAFQVSVG AGTSN+TVKLP NFTL+ PGPGYTCGPAK+VPS
Sbjct  122  CCKGGVVAAWGQDPAEAISAFQVSVGQAGTSNRTVKLPKNFTLLAPGPGYTCGPAKVVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT DRRRKTQALMTWNVTCT
Sbjct  182  TNFLTPDRRRKTQALMTWNVTCT  204



>ref|XP_006440799.1| hypothetical protein CICLE_v10020292mg [Citrus clementina]
 gb|ESR54039.1| hypothetical protein CICLE_v10020292mg [Citrus clementina]
Length=423

 Score =   343 bits (880),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +1

Query  127  FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKE  306
            F   E +DPLDP GN+TIKWDVMSWT DGYVAAVT+NNFQMYR I +PGWTLGW WAKKE
Sbjct  5    FVIVEAYDPLDPTGNVTIKWDVMSWTPDGYVAAVTINNFQMYRHIGAPGWTLGWQWAKKE  64

Query  307  VIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGE  486
            VIW++VGAQ TEQGDCSKFK N+PHCCK+ P +VDLLPGVPYNQQF+NCCKGGV+++WG+
Sbjct  65   VIWTMVGAQTTEQGDCSKFKANIPHCCKRIPIVVDLLPGVPYNQQFANCCKGGVLSAWGQ  124

Query  487  DPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKT  666
            DP+++VSAFQVSVGLAGTSNKTVKLP NFTL GPGPGYTCGPAK+VPSTV+LT+DRRRKT
Sbjct  125  DPASAVSAFQVSVGLAGTSNKTVKLPKNFTLQGPGPGYTCGPAKVVPSTVYLTSDRRRKT  184

Query  667  QALMTWNVTCT  699
            QALMTWNVTCT
Sbjct  185  QALMTWNVTCT  195



>gb|KHG27746.1| COBRA-like protein 4 [Gossypium arboreum]
Length=420

 Score =   342 bits (877),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWDV+SWTADGYVA+VTM+NFQMYR+I+SPGWTLGW WAKKEVIWS+V
Sbjct  8    YDPLDPTGNITIKWDVVSWTADGYVASVTMSNFQMYRSIVSPGWTLGWQWAKKEVIWSMV  67

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQ TEQGDCSKFKGNVPHCC + P +VDLLPGVPYNQQFSNCCK GVV++WG+DPS+SV
Sbjct  68   GAQTTEQGDCSKFKGNVPHCCLRKPVVVDLLPGVPYNQQFSNCCKAGVVSAWGQDPSSSV  127

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQVSVG+AGTSNKTVKLP NFTL+GPG GYTCGPAK+VPSTV+LTAD RRKTQALMTW
Sbjct  128  SAFQVSVGVAGTSNKTVKLPMNFTLLGPGLGYTCGPAKVVPSTVYLTADYRRKTQALMTW  187

Query  685  NVTCT  699
            NVTCT
Sbjct  188  NVTCT  192



>emb|CDX85543.1| BnaA02g02700D [Brassica napus]
Length=456

 Score =   343 bits (880),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 185/225 (82%), Gaps = 23/225 (10%)
 Frame = +1

Query  94   LSFCAVFLFLI-FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            L FC+ F F+I F  +  +DPLDP GNIT+KWD+MSWTADGYVA VTMNNFQ+YR I +P
Sbjct  3    LFFCSCFFFMIIFSTSSAYDPLDPNGNITLKWDIMSWTADGYVATVTMNNFQIYRHIQNP  62

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKK PT+VDLLPGVPYNQQFSN
Sbjct  63   GWTLGWAWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKIPTVVDLLPGVPYNQQFSN  122

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVV +WG+DPS++VS FQVSVGLAGT+NKTVKLP NFTL+GPGPGY+CGPAKIVPS
Sbjct  123  CCKGGVVGAWGQDPSSAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYSCGPAKIVPS  182

Query  631  TVFLTADRRRKTQAL----------------------MTWNVTCT  699
            TVFLT D+RRKTQAL                      +TWNVTCT
Sbjct  183  TVFLTTDKRRKTQALSKKYFSLIYIHTNGKDFFFCTNVTWNVTCT  227



>ref|XP_010092075.1| hypothetical protein L484_007355 [Morus notabilis]
 gb|EXB50055.1| hypothetical protein L484_007355 [Morus notabilis]
Length=514

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A    ++F HA  +DPLDP GNITIKWDVMSWT DGYVA VTM NFQMYR IMSPGWTLG
Sbjct  13   AALFVIMFSHAAAYDPLDPNGNITIKWDVMSWTPDGYVAVVTMTNFQMYRHIMSPGWTLG  72

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W WAKKEVIWS+VGAQATEQGDCSKFK ++PHCCKK PT+VDLLPGVPYNQQ +NCCKGG
Sbjct  73   WVWAKKEVIWSMVGAQATEQGDCSKFKSDIPHCCKKNPTVVDLLPGVPYNQQIANCCKGG  132

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VV+SWG+DPSA+VS+FQVSVG +GTSNKTVKLP NFTL GPGPGYTC  AKIVPSTVF++
Sbjct  133  VVSSWGQDPSAAVSSFQVSVGRSGTSNKTVKLPKNFTLTGPGPGYTCSQAKIVPSTVFIS  192

Query  646  ADRRRKTQALMTWNVTCT  699
            AD RR+TQA MTWNVTCT
Sbjct  193  ADGRRRTQAWMTWNVTCT  210



>ref|XP_004154765.1| PREDICTED: COBRA-like protein 4-like [Cucumis sativus]
Length=438

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IMSPGWT+GW+WAKKEVIWS+V
Sbjct  25   YDPLDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSPGWTMGWTWAKKEVIWSMV  84

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            G+Q TEQGDCSKFKGN+PH CKK PT+VDL+PGVPYNQQF+NCCKGGVVA+WG+DP A+V
Sbjct  85   GSQTTEQGDCSKFKGNIPHSCKKNPTVVDLMPGVPYNQQFTNCCKGGVVAAWGQDPQAAV  144

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQ+S+G AGTSNKTVKLP NFTL+GPGPGYTCGPAK+VPST FLT DRRRKTQALMTW
Sbjct  145  SAFQLSIGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKVVPSTTFLTPDRRRKTQALMTW  204

Query  685  NVTCT  699
            NVTCT
Sbjct  205  NVTCT  209



>gb|ACI24390.1| COBRA-like protein [Eucalyptus nitens]
Length=430

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +1

Query  94   LSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            L+F  VF+F    HA  +DPLDP GN+TIKWD+MSWT DGYVA VT+NNFQMYR IMSPG
Sbjct  6    LAFVFVFVF----HAAAYDPLDPNGNVTIKWDIMSWTTDGYVAVVTLNNFQMYRHIMSPG  61

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WT+GW+WAKKE+IWS+VGAQ TEQGDCSKFK  +PH CK+TPT+VDLLPGVPYN Q++NC
Sbjct  62   WTIGWAWAKKEIIWSMVGAQTTEQGDCSKFKAAIPHSCKRTPTVVDLLPGVPYNLQYANC  121

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CKGGVVA+WG+DP ASVSAFQ+SVGL+GTSNKTVKLP N TL+GPGPGY CGPAK+VPST
Sbjct  122  CKGGVVAAWGQDPLASVSAFQISVGLSGTSNKTVKLPKNLTLLGPGPGYACGPAKVVPST  181

Query  634  VFLTADRRRKTQALMTWNVTCT  699
             FLT D+RRKTQALMTWNVTCT
Sbjct  182  NFLTTDKRRKTQALMTWNVTCT  203



>ref|XP_004958244.1| PREDICTED: COBRA-like protein 6-like isoform X3 [Setaria italica]
Length=351

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IM+PGWT+GW+WAKKEVIWS+V
Sbjct  22   YDPLDPNGNITIKWDIMSWTPDGYVAVVTINNFQMYRQIMAPGWTVGWTWAKKEVIWSMV  81

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFKGN+PHCCK+TP +VDLLPGVPYNQQ +NCC+GGV++++G+DP A+V
Sbjct  82   GAQATEQGDCSKFKGNIPHCCKRTPAVVDLLPGVPYNQQIANCCRGGVISAYGQDPGAAV  141

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            +AFQVSVG AGT+N+TVK+P NFTL+GPGPGYTCGP KIVPSTVFLT DRRRKTQALMTW
Sbjct  142  AAFQVSVGQAGTTNRTVKVPKNFTLLGPGPGYTCGPGKIVPSTVFLTPDRRRKTQALMTW  201

Query  685  NVTCT  699
            NVTCT
Sbjct  202  NVTCT  206



>ref|XP_010694050.1| PREDICTED: COBRA-like protein 4 [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   340 bits (873),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 175/196 (89%), Gaps = 1/196 (1%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWS  291
            F+ L+F +A  +DPLDP GNIT+KWD+MSWT DGYVA VT+NNFQMYR +  PGW LGW+
Sbjct  10   FVTLVF-YAAAYDPLDPNGNITVKWDIMSWTPDGYVATVTINNFQMYRHVGDPGWQLGWT  68

Query  292  WAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVV  471
            WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKKTPT+VDLLPG PYNQQFSNCCKGGV+
Sbjct  69   WAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLPGTPYNQQFSNCCKGGVL  128

Query  472  ASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTAD  651
             SWG+D S SVS FQVSVG AGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPST FLT D
Sbjct  129  NSWGQDKSGSVSQFQVSVGQAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTNFLTQD  188

Query  652  RRRKTQALMTWNVTCT  699
            RRRKTQALMTWNVTCT
Sbjct  189  RRRKTQALMTWNVTCT  204



>emb|CDX69511.1| BnaA10g18600D [Brassica napus]
Length=455

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 180/225 (80%), Gaps = 22/225 (10%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +L FC  F  +I   A  +DPLDP GNIT+KWD+MSWTADGYVA VTMNNFQ+YR I +P
Sbjct  2    RLFFCFCFFSMIIFTASAYDPLDPNGNITLKWDIMSWTADGYVATVTMNNFQIYRHIQNP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKK PT+VDLLPGVPYNQQFSN
Sbjct  62   GWTLGWAWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKVPTVVDLLPGVPYNQQFSN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVV +WG+DPS++VS FQVSVGLAGT+NKTV LP NFTL+GPGP YTCGPAKIVPS
Sbjct  122  CCKGGVVGAWGQDPSSAVSQFQVSVGLAGTTNKTVNLPKNFTLLGPGPRYTCGPAKIVPS  181

Query  631  TVFLTADRRRKTQAL----------------------MTWNVTCT  699
            TVF T D+RRKTQAL                      MTWNVTCT
Sbjct  182  TVFFTTDKRRKTQALSKRAVLNQTKLAEPKFLVSPVMMTWNVTCT  226



>gb|EYU44221.1| hypothetical protein MIMGU_mgv1a006633mg [Erythranthe guttata]
Length=437

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +1

Query  82   TLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAI  261
            T  K    A+ L  +F     +D LDP GNITIKWD+M+WT DGYVA VT+NNFQMYR I
Sbjct  3    TQMKFLIAAISLSFLFSSIVAYDSLDPNGNITIKWDIMTWTPDGYVAIVTVNNFQMYRHI  62

Query  262  MSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQ  441
            MSPGWT+GW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCC K PT+VDLLPGVPYNQQ
Sbjct  63   MSPGWTVGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCNKKPTVVDLLPGVPYNQQ  122

Query  442  FSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKI  621
            F+NCCKGGV+A+WG+DP ASVSAFQVSVG AGT+NKTV+LP+NFTL+GPGPGYTCGPAK 
Sbjct  123  FANCCKGGVLAAWGQDPQASVSAFQVSVGQAGTTNKTVRLPSNFTLLGPGPGYTCGPAKT  182

Query  622  VPSTVFLTADRRRKTQALMTWNVTCT  699
            VP T FL+ D RRKTQALMTWNVTCT
Sbjct  183  VPPTNFLSPDLRRKTQALMTWNVTCT  208



>ref|XP_004958242.1| PREDICTED: COBRA-like protein 6-like isoform X1 [Setaria italica]
Length=446

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IM+PGWT+GW+WAKKEVIWS+V
Sbjct  22   YDPLDPNGNITIKWDIMSWTPDGYVAVVTINNFQMYRQIMAPGWTVGWTWAKKEVIWSMV  81

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFKGN+PHCCK+TP +VDLLPGVPYNQQ +NCC+GGV++++G+DP A+V
Sbjct  82   GAQATEQGDCSKFKGNIPHCCKRTPAVVDLLPGVPYNQQIANCCRGGVISAYGQDPGAAV  141

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            +AFQVSVG AGT+N+TVK+P NFTL+GPGPGYTCGP KIVPSTVFLT DRRRKTQALMTW
Sbjct  142  AAFQVSVGQAGTTNRTVKVPKNFTLLGPGPGYTCGPGKIVPSTVFLTPDRRRKTQALMTW  201

Query  685  NVTCT  699
            NVTCT
Sbjct  202  NVTCT  206



>gb|EAZ27328.1| hypothetical protein OsJ_11270 [Oryza sativa Japonica Group]
Length=441

 Score =   337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = +1

Query  85   LAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            L + S  A+ L +    A  +DPLDP GNITIKWDV+SWT DGYVA VTM+N+QMYR I+
Sbjct  3    LHRCSLLALLLAVTCSVAVAYDPLDPKGNITIKWDVISWTPDGYVAMVTMSNYQMYRQIL  62

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGWT+GWSWAKKEVIWSIVGAQATEQGDCSKFKG +PH CK+TP IVDLLPGVPYNQQ 
Sbjct  63   APGWTVGWSWAKKEVIWSIVGAQATEQGDCSKFKGGIPHSCKRTPAIVDLLPGVPYNQQI  122

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCCK GVV+++G+DP+ SVSAFQVSVGLAGT+NKTVKLPTNFTL GPGPGYTCGPA IV
Sbjct  123  ANCCKAGVVSAYGQDPAGSVSAFQVSVGLAGTTNKTVKLPTNFTLAGPGPGYTCGPATIV  182

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
            PSTV+LT DRRR+TQALMTW VTCT
Sbjct  183  PSTVYLTPDRRRRTQALMTWTVTCT  207



>emb|CBI15331.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   350 bits (899),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            K  F  V  F++  HA  +DPLDP GNITIKWDV+SWT DGYVA VTMNNFQMYR IM+P
Sbjct  525  KHIFSVVIFFMMVSHAIAYDPLDPTGNITIKWDVVSWTPDGYVALVTMNNFQMYRHIMTP  584

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWTL WSWAKKEVIWS+VGAQ TEQGDCSKFK N+PHCC+KTPT+VDLLPGVPYNQQ +N
Sbjct  585  GWTLSWSWAKKEVIWSMVGAQTTEQGDCSKFKANIPHCCEKTPTVVDLLPGVPYNQQIAN  644

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCK GVVA+WG+DP+ SVS+FQVSVG AGTSNKTVKLP NFTL+GPGPGYTCGPAKIVPS
Sbjct  645  CCKAGVVAAWGQDPAGSVSSFQVSVGQAGTSNKTVKLPKNFTLLGPGPGYTCGPAKIVPS  704

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T++LT D RRKTQA+MTWNVTCT
Sbjct  705  TIYLTPDHRRKTQAMMTWNVTCT  727


 Score =   345 bits (885),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            AVF  ++   A  +DPLDP GNITIKWDVMSWT+DGYVA VTM+NFQMYR IMSPGWTLG
Sbjct  34   AVFFSMVLSPAVAYDPLDPNGNITIKWDVMSWTSDGYVAVVTMSNFQMYRHIMSPGWTLG  93

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W WAKKEVIWS+VGAQATEQGDCSKFKGN+PHCCK+ PT++DLLPGVPYNQQ +NCCKGG
Sbjct  94   WIWAKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKRNPTVIDLLPGVPYNQQIANCCKGG  153

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VVASWG+D SA+VS+FQ+SVGL+GTSNKTV+LP NFTL+GPGPGYTCG AK VPS++FL+
Sbjct  154  VVASWGQDSSAAVSSFQLSVGLSGTSNKTVRLPKNFTLLGPGPGYTCGQAKTVPSSIFLS  213

Query  646  ADRRRKTQALMTWNVTCT  699
            +D RRKTQALMTWNVTCT
Sbjct  214  SDGRRKTQALMTWNVTCT  231



>ref|NP_001050366.1| Os03g0416200 [Oryza sativa Japonica Group]
 sp|Q10JL1.1|COBL5_ORYSJ RecName: Full=COBRA-like protein 5; AltName: Full=Protein BRITTLE 
CULM1; Flags: Precursor [Oryza sativa Japonica Group]
 sp|A2XHZ9.1|COBL5_ORYSI RecName: Full=COBRA-like protein 5; AltName: Full=Protein BRITTLE 
CULM1; Flags: Precursor [Oryza sativa Indica Group]
 gb|AAQ56120.1| BRITTLE CULM1 [Oryza sativa Japonica Group]
 gb|AAQ56121.1| BRITTLE CULM1 [Oryza sativa Indica Group]
 gb|AAS07098.1| putative phytochelatin synthetase [Oryza sativa Japonica Group]
 gb|ABF96617.1| Phytochelatin synthetase-like conserved region family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12280.1| Os03g0416200 [Oryza sativa Japonica Group]
 gb|EAY90459.1| hypothetical protein OsI_12047 [Oryza sativa Indica Group]
 dbj|BAG91525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=468

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = +1

Query  85   LAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            L + S  A+ L +    A  +DPLDP GNITIKWDV+SWT DGYVA VTM+N+QMYR I+
Sbjct  3    LHRCSLLALLLAVTCSVAVAYDPLDPKGNITIKWDVISWTPDGYVAMVTMSNYQMYRQIL  62

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGWT+GWSWAKKEVIWSIVGAQATEQGDCSKFKG +PH CK+TP IVDLLPGVPYNQQ 
Sbjct  63   APGWTVGWSWAKKEVIWSIVGAQATEQGDCSKFKGGIPHSCKRTPAIVDLLPGVPYNQQI  122

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCCK GVV+++G+DP+ SVSAFQVSVGLAGT+NKTVKLPTNFTL GPGPGYTCGPA IV
Sbjct  123  ANCCKAGVVSAYGQDPAGSVSAFQVSVGLAGTTNKTVKLPTNFTLAGPGPGYTCGPATIV  182

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
            PSTV+LT DRRR+TQALMTW VTCT
Sbjct  183  PSTVYLTPDRRRRTQALMTWTVTCT  207



>ref|XP_002463158.1| hypothetical protein SORBIDRAFT_02g038740 [Sorghum bicolor]
 gb|EER99679.1| hypothetical protein SORBIDRAFT_02g038740 [Sorghum bicolor]
Length=446

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQMYR IM+PGWT+GW+WAK+EVIWS+V
Sbjct  22   YDPLDPNGNITIKWDIMSWTPDGYVAVVTINNFQMYRQIMAPGWTVGWTWAKREVIWSMV  81

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCS+FK N+PHCCK+TPT+VDLLPGVPYNQQ +NCC+GGV++++G+DP+++V
Sbjct  82   GAQATEQGDCSRFKANIPHCCKRTPTVVDLLPGVPYNQQIANCCRGGVISAYGQDPASAV  141

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            +AFQVSVG AGT+N+TVK+P NFTL+GPGPGYTCGP KIVPSTVFLT DRRRKTQALMTW
Sbjct  142  AAFQVSVGQAGTTNRTVKVPKNFTLLGPGPGYTCGPGKIVPSTVFLTPDRRRKTQALMTW  201

Query  685  NVTCT  699
            NVTCT
Sbjct  202  NVTCT  206



>ref|XP_004984022.1| PREDICTED: COBRA-like protein 5-like [Setaria italica]
Length=461

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GNIT+KWDV+SWT DGYVA VTM+N+Q YR IM+PGWT+GWSWAKKEVIW
Sbjct  21   AVAYDPLDPNGNITLKWDVLSWTPDGYVAMVTMSNYQQYRQIMAPGWTVGWSWAKKEVIW  80

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            SIVGAQATEQGDCSKFKG +PHCCKKTP++VDLLPGVPYNQQ +NCCK GVV+++G+DP+
Sbjct  81   SIVGAQATEQGDCSKFKGGIPHCCKKTPSVVDLLPGVPYNQQIANCCKAGVVSAYGQDPA  140

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
             SVSAFQVSVGLAGT+NKTVKLP NFTLMGPGPGYTCGPAKIVPSTV+ T DRRRKTQAL
Sbjct  141  GSVSAFQVSVGLAGTTNKTVKLPKNFTLMGPGPGYTCGPAKIVPSTVYFTPDRRRKTQAL  200

Query  676  MTWNVTCT  699
            MTW VTCT
Sbjct  201  MTWTVTCT  208



>ref|XP_008240111.1| PREDICTED: COBRA-like protein 4 [Prunus mume]
Length=438

 Score =   334 bits (857),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +1

Query  94   LSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            L   AV   L  PHA  +DPLDP GNIT+KWDV+SWT+DGYVA VT NNFQMYR IMSPG
Sbjct  9    LVLSAVSFILTIPHAAAYDPLDPNGNITLKWDVISWTSDGYVAVVTTNNFQMYRHIMSPG  68

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WTLGW WAKKEVIWS+VGAQA +QGDCSKFKGN+PHCCKK PT+VDLLPGVPYNQQ +NC
Sbjct  69   WTLGWVWAKKEVIWSMVGAQAVDQGDCSKFKGNIPHCCKKNPTVVDLLPGVPYNQQIANC  128

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CK GVVASWG+DPSA+VS+FQ+SVG +GTSNK V+LP NFTL+GPGPGYTC  AKIV ST
Sbjct  129  CKAGVVASWGQDPSAAVSSFQLSVGRSGTSNKIVRLPKNFTLLGPGPGYTCSQAKIVRST  188

Query  634  VFLTADRRRKTQALMTWNVTCT  699
            VF + D RRKTQALMTWNV CT
Sbjct  189  VFNSPDGRRKTQALMTWNVICT  210



>gb|EMT05391.1| hypothetical protein F775_18404 [Aegilops tauschii]
Length=449

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = +1

Query  85   LAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            L K  F A+ L +I   A  +DPLDP GNITIKWD+ SWT DGYVA V MNN+Q YR IM
Sbjct  4    LRKSMFVALILAVICSVAVAYDPLDPTGNITIKWDIQSWTPDGYVAMVAMNNYQQYRQIM  63

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKG +PHCCK TP++VDLLPGVPYNQQ 
Sbjct  64   APGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGGIPHCCKHTPSVVDLLPGVPYNQQI  123

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCC+GGV++++G+DP+ S+SAFQVSVGLAGT+NKTVKLP NFTLMGPG GYTCGPA IV
Sbjct  124  ANCCRGGVISAYGQDPAGSLSAFQVSVGLAGTTNKTVKLPKNFTLMGPGLGYTCGPATIV  183

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
            PSTV+ +AD RRKTQALMTW VTCT
Sbjct  184  PSTVYWSADHRRKTQALMTWTVTCT  208



>ref|XP_006650197.1| PREDICTED: COBRA-like protein 5-like [Oryza brachyantha]
Length=450

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GNITIKWDV+SWT DGYVA VTMNN+QMYR IM+PGWTLGWSWAKKEVIW
Sbjct  22   AVAYDPLDPKGNITIKWDVISWTPDGYVAMVTMNNYQMYRQIMAPGWTLGWSWAKKEVIW  81

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            SIVGAQATEQGDCSKFKG +PH CK+TP IVDLLPGVPYNQQ +NCCK GVV+++G+DP+
Sbjct  82   SIVGAQATEQGDCSKFKGGIPHSCKRTPAIVDLLPGVPYNQQIANCCKAGVVSAYGQDPA  141

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
             ++S+FQVSVGLAGT+NKTVKLPTNFTL GPGPGYTCGPA IVPSTV+LT DRRR+TQAL
Sbjct  142  GALSSFQVSVGLAGTTNKTVKLPTNFTLAGPGPGYTCGPATIVPSTVYLTPDRRRRTQAL  201

Query  676  MTWNVTCT  699
            MTW VTCT
Sbjct  202  MTWTVTCT  209



>ref|XP_008341798.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=432

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  109  VFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGW  288
            +F   IF  A  +DPLDP GNIT+KWD+MSWT DGYVAAVT+NNFQMYR IMSPGWTLGW
Sbjct  8    LFFLAIFSCAAAYDPLDPNGNITVKWDIMSWTPDGYVAAVTVNNFQMYRHIMSPGWTLGW  67

Query  289  SWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGV  468
            +WA++EVIW+ VGA+ATEQGDCS+FKGNVPHCCKKTPT VDLLPGVPYNQQF+NCCKGGV
Sbjct  68   TWARREVIWAAVGAEATEQGDCSRFKGNVPHCCKKTPTFVDLLPGVPYNQQFTNCCKGGV  127

Query  469  VASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTA  648
            +++WG+DPS +VS+FQ+SVG AGT+N+TV+LP NFTL+GPG GYTCG A+IVP T+FLT+
Sbjct  128  LSAWGQDPSTAVSSFQLSVGSAGTTNRTVRLPRNFTLLGPGTGYTCGKARIVPPTIFLTS  187

Query  649  DRRRKTQALMTWNVTCT  699
              RR+TQALMTWNVTC+
Sbjct  188  AGRRRTQALMTWNVTCS  204



>ref|XP_006374430.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
 gb|ERP52227.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
Length=439

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +1

Query  100  FCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWT  279
            F AV   L+F  AE +D LDP GNIT+KWDV+SWT DGYVA VTM NFQMYR IMSPGWT
Sbjct  11   FSAVCFILVFSRAEAYDYLDPTGNITLKWDVISWTPDGYVAVVTMTNFQMYRHIMSPGWT  70

Query  280  LGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCK  459
            +GW+WAKKEVIWS+VGAQATEQGDCSKF+ N+PHCC K PT+VD+LPGVPYNQQ +NCCK
Sbjct  71   VGWTWAKKEVIWSMVGAQATEQGDCSKFRMNIPHCCMKNPTVVDMLPGVPYNQQIANCCK  130

Query  460  GGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVF  639
            GGVV+SWG+DPSA+VS+FQ+SVG +GT+NKTV+LP NFTL+GPG GY+C  AKIVPSTVF
Sbjct  131  GGVVSSWGQDPSAAVSSFQLSVGRSGTTNKTVRLPKNFTLLGPGLGYSCSQAKIVPSTVF  190

Query  640  LTADRRRKTQALMTWNVTCT  699
            LT+D RRKTQA+MTWNVTCT
Sbjct  191  LTSDGRRKTQAMMTWNVTCT  210



>gb|ACA04978.1| GPI-anchored protein [Bambusa oldhamii]
Length=451

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A+ L +    A  +DPLDP GNITIKWDV SWT DGYVA VTMNN+QMYR IM+PGWT+G
Sbjct  11   ALILAVTCSVAVAYDPLDPNGNITIKWDVTSWTPDGYVAMVTMNNYQMYRQIMAPGWTVG  70

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            WSWAKKEVIWSIVGAQATEQGDCSKFKG +PHCCK+TP IVDLLPGVPYNQQ +NCCK G
Sbjct  71   WSWAKKEVIWSIVGAQATEQGDCSKFKGGIPHCCKRTPAIVDLLPGVPYNQQIANCCKAG  130

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VV+++G+DP+ ++SAFQVSVGLAGT+NKTVKLP NFTLMGPG GYTCGPA IVPSTV+LT
Sbjct  131  VVSAYGQDPAGALSAFQVSVGLAGTTNKTVKLPKNFTLMGPGLGYTCGPATIVPSTVYLT  190

Query  646  ADRRRKTQALMTWNVTCT  699
             DRRRKTQALMTW VTCT
Sbjct  191  PDRRRKTQALMTWTVTCT  208



>ref|XP_010031033.1| PREDICTED: COBRA-like protein 4 isoform X1 [Eucalyptus grandis]
Length=434

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            +V   ++F HA  +DPLDP GNIT+KWD+MSWTADGYVA VTM NFQMYR IMSPGW LG
Sbjct  13   SVICVILFSHAGAYDPLDPNGNITMKWDIMSWTADGYVAVVTMTNFQMYRHIMSPGWKLG  72

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W WAKKEVIWS+VGAQATEQGDCSKFKGN+PHCCK+ PT+VDLLPGVPYNQQ +NCCKGG
Sbjct  73   WVWAKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKRNPTVVDLLPGVPYNQQIANCCKGG  132

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VV SWG+DPSA+VS+FQ+SVGL+GTSNKTVKLP N TL  PG GY+C  AKIVPS++F +
Sbjct  133  VVGSWGQDPSAAVSSFQISVGLSGTSNKTVKLPKNITLAAPGGGYSCSQAKIVPSSIFWS  192

Query  646  ADRRRKTQALMTWNVTCT  699
             D RRKTQALMTWN+TCT
Sbjct  193  PDGRRKTQALMTWNITCT  210



>gb|EPS71579.1| hypothetical protein M569_03177, partial [Genlisea aurea]
Length=412

 Score =   332 bits (850),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  148  DPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVG  327
            DPLDP GNIT+KWDVMSWT DGYVA VTM+NFQMYR IMSPGW+L W+WA+KEVIWS+VG
Sbjct  1    DPLDPNGNITMKWDVMSWTPDGYVAVVTMSNFQMYRHIMSPGWSLSWTWARKEVIWSMVG  60

Query  328  AQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVS  507
            AQATEQGDCSKFKGN+PHCCKKTPT+VDLLPGVPYNQQ SNCCKGGV+A+WG+DP  SVS
Sbjct  61   AQATEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQISNCCKGGVLAAWGQDPLDSVS  120

Query  508  AFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWN  687
             FQVSVG AGTSN+TVKLP NFTL+GPG GYTCGPAKIVP + F T DRRRKTQALMTWN
Sbjct  121  QFQVSVGQAGTSNRTVKLPLNFTLLGPGLGYTCGPAKIVPPSNFFTPDRRRKTQALMTWN  180

Query  688  VTCT  699
            VTCT
Sbjct  181  VTCT  184



>dbj|BAK05255.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GNITIKWDV+SWT DGYVA VT+NNFQ YR IM+PGWT+GW+WAK+EVIW
Sbjct  21   AVAYDPLDPNGNITIKWDVLSWTPDGYVATVTINNFQTYRQIMAPGWTVGWTWAKREVIW  80

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            S+VGAQATEQGDCSKFK N+PH CK+TP +VDLLPGVPYNQQ +NCC+GGVV+++G+DPS
Sbjct  81   SMVGAQATEQGDCSKFKANLPHSCKRTPAVVDLLPGVPYNQQIANCCRGGVVSAYGQDPS  140

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
             +VS+FQVSVG AGT+N+TVK+P NFTL+GPGPGYTCGPAK+VPSTVFLTAD RRKTQAL
Sbjct  141  GAVSSFQVSVGQAGTTNRTVKVPKNFTLLGPGPGYTCGPAKVVPSTVFLTADHRRKTQAL  200

Query  676  MTWNVTCT  699
            MTWNVTCT
Sbjct  201  MTWNVTCT  208



>ref|XP_009373789.1| PREDICTED: COBRA-like protein 4 [Pyrus x bretschneideri]
Length=432

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
             +F   IF  A  +DPLDP GNIT+KWD+MSWT DGYVAAVT+NNFQMYR IMSPGWTLG
Sbjct  7    VLFFLAIFSCAAAYDPLDPNGNITVKWDIMSWTPDGYVAAVTVNNFQMYRHIMSPGWTLG  66

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W+WA++EVIW+ VGA+ATEQGDCS+FKGNVPHCCKKTPT VDLLPGVPYNQQF+NCCKGG
Sbjct  67   WTWARREVIWAAVGAEATEQGDCSRFKGNVPHCCKKTPTFVDLLPGVPYNQQFTNCCKGG  126

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            V+++WG+DPS +VS+FQ+SVG AGT+N+TV+LP NFTL+GPG GYTCG A+IVP T+FLT
Sbjct  127  VLSAWGQDPSTAVSSFQLSVGSAGTTNRTVRLPRNFTLLGPGTGYTCGRARIVPPTIFLT  186

Query  646  ADRRRKTQALMTWNVTCT  699
               RR TQALMTWNVTC+
Sbjct  187  PAGRRTTQALMTWNVTCS  204



>gb|EMT09067.1| COBRA-like protein 6 [Aegilops tauschii]
Length=447

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GNITIKWDV+SWT DGYVA VT+NNFQ YR IM+PGWT+GW+WAK+EVIW
Sbjct  21   AVAYDPLDPNGNITIKWDVLSWTPDGYVATVTINNFQTYRQIMAPGWTVGWTWAKREVIW  80

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            S+VGAQATEQGDCSKFK N+PH CK+TP +VDLLPGVPYNQQ +NCC+GGVV+++G+DPS
Sbjct  81   SMVGAQATEQGDCSKFKANLPHSCKRTPAVVDLLPGVPYNQQIANCCRGGVVSAYGQDPS  140

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
             +VS+FQVSVG AGT+N+TVK+P NFTL+GPGPGYTCGPAK+VPSTVFLTAD RRKTQAL
Sbjct  141  GAVSSFQVSVGQAGTTNRTVKVPKNFTLLGPGPGYTCGPAKVVPSTVFLTADHRRKTQAL  200

Query  676  MTWNVTCT  699
            MTWNVTCT
Sbjct  201  MTWNVTCT  208



>ref|XP_009122873.1| PREDICTED: COBRA-like protein 4 [Brassica rapa]
Length=409

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 1/186 (1%)
 Frame = +1

Query  118  FLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWA  297
             LIF     +DPLDP GNIT+KWD+MSWTADGYVA VTMNNFQ+YR I +PGWTLGW+WA
Sbjct  14   MLIFT-TSAYDPLDPNGNITLKWDIMSWTADGYVATVTMNNFQIYRHIQNPGWTLGWAWA  72

Query  298  KKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVAS  477
            KKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKKTPT+VDLLPGVPYNQQ SNCCKGGVV +
Sbjct  73   KKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQISNCCKGGVVGA  132

Query  478  WGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRR  657
            WG+DPS++VS FQVSVGLAGT+NKTVKLP NFTL+GPGPGYTCGPAKIVPSTVF T D+R
Sbjct  133  WGQDPSSAVSQFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIVPSTVFFTTDKR  192

Query  658  RKTQAL  675
            RKTQAL
Sbjct  193  RKTQAL  198



>dbj|BAK01816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A+FL +    A  +DPLDP GNITIKWD+ SWT DGYVA V MNN+Q YR IM+PGWTLG
Sbjct  10   ALFLAITCSVAAAYDPLDPTGNITIKWDIQSWTPDGYVAMVAMNNYQQYRQIMAPGWTLG  69

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            WSWAKKEVIWSIVGAQATEQGDCSKFKG +PHCCK TP++VDLLPGVPYNQQ +NCC+GG
Sbjct  70   WSWAKKEVIWSIVGAQATEQGDCSKFKGGIPHCCKHTPSVVDLLPGVPYNQQIANCCRGG  129

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VV+++G+DP+ ++SAFQVSVGLAGT+NKTVKLP NFTLMGPG GYTCGPA +VPSTV+ +
Sbjct  130  VVSAYGQDPAGALSAFQVSVGLAGTTNKTVKLPKNFTLMGPGLGYTCGPATVVPSTVYWS  189

Query  646  ADRRRKTQALMTWNVTCT  699
            AD RRKTQALMTW VTCT
Sbjct  190  ADHRRKTQALMTWTVTCT  207



>ref|NP_001105971.1| brittle stalk-2-like protein 7 precursor [Zea mays]
 gb|ABL59987.1| brittle stalk-2-like protein 7 [Zea mays]
 gb|ACR36489.1| unknown [Zea mays]
 tpg|DAA63524.1| TPA: brittle stalk-2-like protein 7 [Zea mays]
Length=447

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQ YR I +PGWT+GW+WAK+EVIWS+V
Sbjct  24   YDPLDPNGNITIKWDIMSWTPDGYVAVVTINNFQTYRQITAPGWTVGWTWAKREVIWSMV  83

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCS+FK N+PHCCK+TP +VDLLPGVPYNQQ +NCC+GGVV+++G+DP+ +V
Sbjct  84   GAQATEQGDCSRFKANIPHCCKRTPAVVDLLPGVPYNQQIANCCRGGVVSAYGQDPATAV  143

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            +AFQVSVG AGT+N+TVK+P NFTL+GPGPGYTCGP K+VPSTVFLT DRRRKTQALMTW
Sbjct  144  AAFQVSVGQAGTTNRTVKVPKNFTLLGPGPGYTCGPGKVVPSTVFLTPDRRRKTQALMTW  203

Query  685  NVTCT  699
            NVTCT
Sbjct  204  NVTCT  208



>ref|XP_002467689.1| hypothetical protein SORBIDRAFT_01g032480 [Sorghum bicolor]
 gb|EER94687.1| hypothetical protein SORBIDRAFT_01g032480 [Sorghum bicolor]
Length=446

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWDV+SWT DGYVA VTM+N+QMYR IMSPGWT+GWSWAKKEVIWSIV
Sbjct  27   YDPLDPRGNITIKWDVISWTPDGYVAMVTMSNYQMYRHIMSPGWTVGWSWAKKEVIWSIV  86

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFKG +PHCCK+TP +VDLLPGVPYNQQ +NCCK GVV+++G+D + SV
Sbjct  87   GAQATEQGDCSKFKGGIPHCCKRTPAVVDLLPGVPYNQQIANCCKAGVVSAYGQDQAGSV  146

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQVSVGLAGT+NKTVKLP NFTLMGPGPGYTCGPA +VPSTV+ T D RR+TQALMTW
Sbjct  147  SAFQVSVGLAGTTNKTVKLPKNFTLMGPGPGYTCGPATVVPSTVYWTPDHRRRTQALMTW  206

Query  685  NVTCT  699
             VTCT
Sbjct  207  TVTCT  211



>tpg|DAA63525.1| TPA: hypothetical protein ZEAMMB73_009152 [Zea mays]
Length=449

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWD+MSWT DGYVA VT+NNFQ YR I +PGWT+GW+WAK+EVIWS+V
Sbjct  26   YDPLDPNGNITIKWDIMSWTPDGYVAVVTINNFQTYRQITAPGWTVGWTWAKREVIWSMV  85

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCS+FK N+PHCCK+TP +VDLLPGVPYNQQ +NCC+GGVV+++G+DP+ +V
Sbjct  86   GAQATEQGDCSRFKANIPHCCKRTPAVVDLLPGVPYNQQIANCCRGGVVSAYGQDPATAV  145

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            +AFQVSVG AGT+N+TVK+P NFTL+GPGPGYTCGP K+VPSTVFLT DRRRKTQALMTW
Sbjct  146  AAFQVSVGQAGTTNRTVKVPKNFTLLGPGPGYTCGPGKVVPSTVFLTPDRRRKTQALMTW  205

Query  685  NVTCT  699
            NVTCT
Sbjct  206  NVTCT  210



>ref|NP_001105928.1| brittle stalk2 precursor [Zea mays]
 gb|ABJ99754.1| brittle stalk-2 [Zea mays]
 gb|ACF79122.1| unknown [Zea mays]
 gb|ACG37428.1| COBRA-like protein 4 precursor [Zea mays]
 gb|ACN29061.1| unknown [Zea mays]
 gb|ACN34385.1| unknown [Zea mays]
 gb|ACN34438.1| unknown [Zea mays]
 gb|AFW88099.1| brittle stalk-2COBRA-like protein 4 [Zea mays]
Length=450

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWDV+SWT DGYVA VTM+N+QMYR IM+PGWTLGWSWAKKEVIWSIV
Sbjct  30   YDPLDPNGNITIKWDVISWTPDGYVAMVTMSNYQMYRHIMAPGWTLGWSWAKKEVIWSIV  89

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFKG +PHCCK+TP +VDLLPGVPYNQQ +NCCK GVV+++G+DP+ SV
Sbjct  90   GAQATEQGDCSKFKGGIPHCCKRTPAVVDLLPGVPYNQQIANCCKAGVVSAYGQDPAGSV  149

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQVSVGLAGT+NKTVKLP NFTLMGPG GYTCGPA +VPSTV+ T D RR+TQALMTW
Sbjct  150  SAFQVSVGLAGTTNKTVKLPRNFTLMGPGLGYTCGPAAVVPSTVYWTPDHRRRTQALMTW  209

Query  685  NVTCT  699
             VTCT
Sbjct  210  TVTCT  214



>gb|AFW88100.1| hypothetical protein ZEAMMB73_767703 [Zea mays]
Length=493

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWDV+SWT DGYVA VTM+N+QMYR IM+PGWTLGWSWAKKEVIWSIV
Sbjct  73   YDPLDPNGNITIKWDVISWTPDGYVAMVTMSNYQMYRHIMAPGWTLGWSWAKKEVIWSIV  132

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFKG +PHCCK+TP +VDLLPGVPYNQQ +NCCK GVV+++G+DP+ SV
Sbjct  133  GAQATEQGDCSKFKGGIPHCCKRTPAVVDLLPGVPYNQQIANCCKAGVVSAYGQDPAGSV  192

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQVSVGLAGT+NKTVKLP NFTLMGPG GYTCGPA +VPSTV+ T D RR+TQALMTW
Sbjct  193  SAFQVSVGLAGTTNKTVKLPRNFTLMGPGLGYTCGPAAVVPSTVYWTPDHRRRTQALMTW  252

Query  685  NVTCT  699
             VTCT
Sbjct  253  TVTCT  257



>ref|XP_003522282.1| PREDICTED: COBRA-like protein 4-like isoform X1 [Glycine max]
Length=458

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 183/216 (85%), Gaps = 3/216 (1%)
 Frame = +1

Query  52   QQPKHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVT  231
            QQPK   + + L  ++  A++L LI P AE FDPLDP GN+TI+WD+MSWT+DGY+A VT
Sbjct  8    QQPK--STFTCLKLVALIALYLVLISP-AESFDPLDPTGNVTIRWDIMSWTSDGYLATVT  64

Query  232  MNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVD  411
            + NFQ+YR IM+PGWTLGW+WAKKE+IW+++GAQATEQGDC+KFK  +PH CK+ P +VD
Sbjct  65   LFNFQLYRNIMNPGWTLGWTWAKKEIIWAMMGAQATEQGDCAKFKLKIPHSCKRNPQVVD  124

Query  412  LLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPG  591
            LLPG P+N QF+NCCKGGV+ SWG++PS +VSAFQ+ VGL+GTSNKTVKLP NF L+GPG
Sbjct  125  LLPGAPFNTQFTNCCKGGVLTSWGQNPSGAVSAFQIGVGLSGTSNKTVKLPKNFKLLGPG  184

Query  592  PGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            PGY+CGPAKIVPST  LT DRRRK QALM+WNVTCT
Sbjct  185  PGYSCGPAKIVPSTAILTEDRRRKMQALMSWNVTCT  220



>ref|XP_007210750.1| hypothetical protein PRUPE_ppa021191mg, partial [Prunus persica]
 gb|EMJ11949.1| hypothetical protein PRUPE_ppa021191mg, partial [Prunus persica]
Length=414

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNIT+KWDV SWT+DGYVA VTMNNFQMYR IMSPGWTLGW WAKKEVIWS+V
Sbjct  2    YDPLDPNGNITLKWDVKSWTSDGYVAVVTMNNFQMYRHIMSPGWTLGWVWAKKEVIWSMV  61

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQA +QGDC+KFKGN+PHCCKK PT+VDLLPGVPYNQQ +NCCK GVVASWG+DPSA+V
Sbjct  62   GAQAVDQGDCTKFKGNIPHCCKKNPTVVDLLPGVPYNQQIANCCKAGVVASWGQDPSAAV  121

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S+FQ+SVG +GTSNKTV+LP NFTL+GPGPGYTC  AKIV STVF + D RRKTQALMTW
Sbjct  122  SSFQLSVGRSGTSNKTVRLPKNFTLLGPGPGYTCSQAKIVRSTVFNSPDGRRKTQALMTW  181

Query  685  NVTCT  699
            NV CT
Sbjct  182  NVICT  186



>gb|KHN03079.1| COBRA-like protein 4 [Glycine soja]
Length=475

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 183/216 (85%), Gaps = 3/216 (1%)
 Frame = +1

Query  52   QQPKHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVT  231
            QQPK   + + L  ++  A++L LI P AE FDPLDP GN+TI+WD+MSWT+DGY+A VT
Sbjct  25   QQPK--STFTCLKLVALIALYLVLISP-AESFDPLDPTGNVTIRWDIMSWTSDGYLATVT  81

Query  232  MNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVD  411
            + NFQ+YR IM+PGWTLGW+WAKKE+IW+++GAQATEQGDC+KFK  +PH CK+ P +VD
Sbjct  82   LFNFQLYRNIMNPGWTLGWTWAKKEIIWAMMGAQATEQGDCAKFKLKIPHSCKRNPQVVD  141

Query  412  LLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPG  591
            LLPG P+N QF+NCCKGGV+ SWG++PS +VSAFQ+ VGL+GTSNKTVKLP NF L+GPG
Sbjct  142  LLPGAPFNTQFTNCCKGGVLTSWGQNPSGAVSAFQIGVGLSGTSNKTVKLPKNFKLLGPG  201

Query  592  PGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            PGY+CGPAKIVPST  LT DRRRK QALM+WNVTCT
Sbjct  202  PGYSCGPAKIVPSTAILTEDRRRKMQALMSWNVTCT  237



>ref|XP_002531001.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF31389.1| Protein COBRA precursor, putative [Ricinus communis]
Length=426

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A F  ++F  A  +DPLDP GN+TIKWD+M+WT+DGY A VT+NNFQ +R I+ PGWT+G
Sbjct  7    AFFYLVLFSCAAAYDPLDPTGNVTIKWDIMAWTSDGYTAIVTLNNFQTFRHIIKPGWTVG  66

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W+W KKE+IWS+VGAQA EQGDCSKFKGN+PH CK+ P +VDL+PG PYNQQF+NCCKGG
Sbjct  67   WAWKKKEIIWSMVGAQAVEQGDCSKFKGNIPHSCKRNPAVVDLMPGAPYNQQFANCCKGG  126

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            V+++WG+D SASVS FQ++VGLAGTSNKTVKLP NFTL+GPGPGYTCGPAK+VP+T FLT
Sbjct  127  VLSAWGQDLSASVSQFQITVGLAGTSNKTVKLPKNFTLLGPGPGYTCGPAKLVPATKFLT  186

Query  646  ADRRRKTQALMTWNVTCT  699
             D RR+TQALMTWNVTCT
Sbjct  187  PDGRRRTQALMTWNVTCT  204



>ref|XP_003557715.1| PREDICTED: COBRA-like protein 5 [Brachypodium distachyon]
Length=452

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A+ L +    A  +DPLDP GNITIKWD++SWT DGYVA VTMNN+Q YR IM+PGWTLG
Sbjct  11   ALILAVTCSVAVAYDPLDPTGNITIKWDIVSWTPDGYVAMVTMNNYQQYRQIMAPGWTLG  70

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            WSWAKKEVIWSIVGAQATEQGDCSKFKG +PH CK TP+IVDLLPGVPYNQQ +NCCKGG
Sbjct  71   WSWAKKEVIWSIVGAQATEQGDCSKFKGGIPHSCKHTPSIVDLLPGVPYNQQIANCCKGG  130

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            V++++G+DP+ ++SAFQVSVGLAGT+NKTVKLP NFTLMGPG GYTCGPA +VPSTV+ +
Sbjct  131  VISAYGQDPAGALSAFQVSVGLAGTTNKTVKLPKNFTLMGPGLGYTCGPATVVPSTVYWS  190

Query  646  ADRRRKTQALMTWNVTCT  699
            AD RRKTQ+LMTW VTCT
Sbjct  191  ADHRRKTQSLMTWTVTCT  208



>ref|XP_007037621.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
 gb|EOY22122.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
Length=438

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            A F   I   A  +DPLDP GNITIKWDVMSWT DGYVA VTM NFQM+R I SPGW LG
Sbjct  13   ATFFATIISQAAAYDPLDPTGNITIKWDVMSWTPDGYVAVVTMTNFQMFRHITSPGWNLG  72

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W WAKKEVIWS+VGAQA +QGDCSKFKGN+PHCCK+ PT+VDLLPGVPYNQQ +NCCKGG
Sbjct  73   WVWAKKEVIWSMVGAQANDQGDCSKFKGNIPHCCKRNPTVVDLLPGVPYNQQIANCCKGG  132

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VVASWG+DPSA+VS+FQ+SVG AGTSNKTV LP NFTL+ P  GYTC  AK V S+VF+T
Sbjct  133  VVASWGQDPSAAVSSFQLSVGRAGTSNKTVTLPKNFTLLDPALGYTCSQAKKVSSSVFIT  192

Query  646  ADRRRKTQALMTWNVTCT  699
            AD RRKTQALMTWNVTCT
Sbjct  193  ADGRRKTQALMTWNVTCT  210



>gb|KCW83758.1| hypothetical protein EUGRSUZ_B00629, partial [Eucalyptus grandis]
Length=410

 Score =   323 bits (829),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNIT+KWD+MSWTADGYVA VTM NFQMYR IMSPGW LGW WAKKEVIWS+V
Sbjct  2    YDPLDPNGNITMKWDIMSWTADGYVAVVTMTNFQMYRHIMSPGWKLGWVWAKKEVIWSMV  61

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFKGN+PHCCK+ PT+VDLLPGVPYNQQ +NCCKGGVV SWG+DPSA+V
Sbjct  62   GAQATEQGDCSKFKGNIPHCCKRNPTVVDLLPGVPYNQQIANCCKGGVVGSWGQDPSAAV  121

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S+FQ+SVGL+GTSNKTVKLP N TL  PG GY+C  AKIVPS++F + D RRKTQALMTW
Sbjct  122  SSFQISVGLSGTSNKTVKLPKNITLAAPGGGYSCSQAKIVPSSIFWSPDGRRKTQALMTW  181

Query  685  NVTCT  699
            N+TCT
Sbjct  182  NITCT  186



>ref|XP_002514629.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF47735.1| Protein COBRA precursor, putative [Ricinus communis]
Length=383

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = +1

Query  82   TLAKLS-FCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            ++ KLS F  + LF +    F  +E +D LDP GNITIKWDVMSWT DGYVA VTM NFQ
Sbjct  8    SITKLSTFTILLLFFLSSFTFTPSEAYDALDPNGNITIKWDVMSWTPDGYVAVVTMYNFQ  67

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGNVPHCCKK PT+VDLLPG 
Sbjct  68   QYRHIQAPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKDPTVVDLLPGT  127

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+ SW +DP+ +VS+FQVSVG AGTSNKTV+LP NFTL  PGPGYTC
Sbjct  128  PYNQQIANCCKGGVINSWAQDPATAVSSFQVSVGAAGTSNKTVRLPKNFTLKAPGPGYTC  187

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPAKIV  T F+T D+RR TQALMTWNVTCT
Sbjct  188  GPAKIVRPTKFVTPDKRRVTQALMTWNVTCT  218



>ref|XP_008379444.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=421

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNIT+KWD+MSWT DGYVA VTMNNFQ YR IMSPGWTLGW WA+KEVIW+ V
Sbjct  8    YDPLDPNGNITVKWDIMSWTPDGYVAVVTMNNFQTYRHIMSPGWTLGWMWARKEVIWAAV  67

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GA+AT+QGDCS FKGN+PHCCKKTPT+VDLLPG PYNQQF+NCCKGGVV++WG+DPS +V
Sbjct  68   GAEATKQGDCSWFKGNIPHCCKKTPTVVDLLPGAPYNQQFTNCCKGGVVSAWGQDPSTAV  127

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S+FQ+SVG AGT+ +TV+ P NFTL+GPGPGYTCG A++VPST+FL+ DRRR+TQALMTW
Sbjct  128  SSFQLSVGSAGTTKRTVRPPKNFTLLGPGPGYTCGRARVVPSTIFLSPDRRRRTQALMTW  187

Query  685  NVTCT  699
            NVTCT
Sbjct  188  NVTCT  192



>gb|KHN19596.1| COBRA-like protein 4 [Glycine soja]
Length=457

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 180/213 (85%), Gaps = 1/213 (0%)
 Frame = +1

Query  61   KHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNN  240
            K  G+ + L  ++  A+ L LI P AE FDPLDP GN+TI+WD+MSWT+DGY+A VT+ N
Sbjct  9    KQKGTFACLKMVALIALCLILISP-AESFDPLDPTGNVTIRWDIMSWTSDGYLATVTLFN  67

Query  241  FQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLP  420
            FQ+YR IM+PGWTLGW+WAKKE+IW+++GAQATEQGDC+KFK  +PH CK+ P +VDLLP
Sbjct  68   FQLYRNIMNPGWTLGWTWAKKEIIWAVMGAQATEQGDCAKFKLKIPHSCKRNPQVVDLLP  127

Query  421  GVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGY  600
            G P+N QF+NCC+GGV+ SWG++PS +VSAFQ+ VGL+GTSNKTVKLP NF L+GPGPGY
Sbjct  128  GAPFNMQFTNCCRGGVLTSWGQNPSGAVSAFQIGVGLSGTSNKTVKLPKNFKLLGPGPGY  187

Query  601  TCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            +CGPAKIVPST  LT DRRRK QALM+WNVTCT
Sbjct  188  SCGPAKIVPSTAILTDDRRRKMQALMSWNVTCT  220



>ref|XP_003528239.1| PREDICTED: COBRA-like protein 4-like [Glycine max]
Length=458

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 180/213 (85%), Gaps = 1/213 (0%)
 Frame = +1

Query  61   KHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNN  240
            K  G+ + L  ++  A+ L LI P AE FDPLDP GN+TI+WD+MSWT+DGY+A VT+ N
Sbjct  9    KQKGTFACLKMVALIALCLILISP-AESFDPLDPTGNVTIRWDIMSWTSDGYLATVTLFN  67

Query  241  FQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLP  420
            FQ+YR IM+PGWTLGW+WAKKE+IW+++GAQATEQGDC+KFK  +PH CK+ P +VDLLP
Sbjct  68   FQLYRNIMNPGWTLGWTWAKKEIIWAVMGAQATEQGDCAKFKLKIPHSCKRNPQVVDLLP  127

Query  421  GVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGY  600
            G P+N QF+NCC+GGV+ SWG++PS +VSAFQ+ VGL+GTSNKTVKLP NF L+GPGPGY
Sbjct  128  GAPFNMQFTNCCRGGVLTSWGQNPSGAVSAFQIGVGLSGTSNKTVKLPKNFKLLGPGPGY  187

Query  601  TCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            +CGPAKIVPST  LT DRRRK QALM+WNVTCT
Sbjct  188  SCGPAKIVPSTAILTDDRRRKMQALMSWNVTCT  220



>ref|XP_006657931.1| PREDICTED: COBRA-like protein 6-like [Oryza brachyantha]
Length=449

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWDVMSWT DGYVA VT+NN+QMYR IM+PGWT+GW+WA++EVIWS+V
Sbjct  23   YDPLDPNGNITIKWDVMSWTPDGYVATVTINNYQMYRHIMAPGWTVGWTWARREVIWSMV  82

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCS+FKGN+PHCCK+TP +VDLLPGVPYNQQ +NCC+GGVV ++G+DP+A+V
Sbjct  83   GAQATEQGDCSRFKGNIPHCCKRTPAVVDLLPGVPYNQQIANCCRGGVVPAYGQDPAAAV  142

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            +A  VSVG AGT+N+TVK+P NFTL+GPGPGYTCGPAKIVPSTVFLT DRRRKTQALMTW
Sbjct  143  AAIPVSVGQAGTTNRTVKVPKNFTLLGPGPGYTCGPAKIVPSTVFLTPDRRRKTQALMTW  202

Query  685  NVTCT  699
            NVTCT
Sbjct  203  NVTCT  207



>ref|XP_006394554.1| hypothetical protein EUTSA_v10004178mg [Eutrema salsugineum]
 gb|ESQ31840.1| hypothetical protein EUTSA_v10004178mg [Eutrema salsugineum]
Length=458

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 174/214 (81%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAVFLFLI-----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S + KLSF AV++F +     F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSIVFKLSFLAVYIFFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP  + S+FQ+SVG AGT+NKTV++P NFTLMGPGPG
Sbjct  128  PGTPYNQQIANCCKGGVLNSWVQDPGNAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVKPTKFVTPDTRRTTQAMMTWNITCT  221



>gb|AAM62930.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=456

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 177/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAVFL-FLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S ++KLSF A+++ FLI    F   E +D LDP GNITIKWDVMSWT DGYVA VTM 
Sbjct  8    STSIVSKLSFLALWIVFLISSSSFTSTEAYDALDPEGNITIKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP+ + S+FQ+SVG AGT+NKTV++P NFTLMGPGPG
Sbjct  128  PGTPYNQQIANCCKGGVMNSWVQDPATAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCT  221



>gb|AFK45756.1| unknown [Lotus japonicus]
Length=448

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 174/205 (85%), Gaps = 4/205 (2%)
 Frame = +1

Query  97   SFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            S C +FLFL+    F   + +DPLDP GNITIKWD+++WT+DGYVA VTMNNFQ YR I 
Sbjct  11   STCILFLFLLSCTCFTSTDAYDPLDPNGNITIKWDIITWTSDGYVAVVTMNNFQQYRHIA  70

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGW+LGW+WAKKEVIWS+VG QATEQGDCSKFKG++PHCCKK PT+VDLLPG PYN QF
Sbjct  71   APGWSLGWAWAKKEVIWSMVGGQATEQGDCSKFKGSIPHCCKKDPTVVDLLPGTPYNMQF  130

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            SNCCKGGV++SW +DP+ +V++FQVSVG AGT+NKTVK+P NFTL  PGPGYTCGPAKIV
Sbjct  131  SNCCKGGVLSSWAQDPTNAVASFQVSVGRAGTTNKTVKVPKNFTLKAPGPGYTCGPAKIV  190

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
              T F+  D+RR TQALMTWNVTCT
Sbjct  191  KPTKFIQPDKRRVTQALMTWNVTCT  215



>ref|XP_011006292.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
Length=439

 Score =   322 bits (826),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +1

Query  100  FCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWT  279
            F A+F  L+F  AE +D LDP GNIT+KWDV+SWT DGYVA VTM NFQMYR IMSPGWT
Sbjct  11   FSALFFILVFSRAEAYDYLDPTGNITLKWDVISWTPDGYVAVVTMTNFQMYRHIMSPGWT  70

Query  280  LGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCK  459
            +GW+WAKKEVIWS+VGAQAT QGDCSKF+ N+PHCC K+P +VD+L GVPYNQQ +NCCK
Sbjct  71   VGWTWAKKEVIWSMVGAQATGQGDCSKFRMNIPHCCMKSPAVVDMLSGVPYNQQIANCCK  130

Query  460  GGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVF  639
            GGVV+SWG+DPSA+VS+FQ+SVG +GT+NKTV+LP NFTL+GPG GY+C  AKIVP TVF
Sbjct  131  GGVVSSWGQDPSAAVSSFQLSVGRSGTTNKTVRLPKNFTLLGPGRGYSCSQAKIVPPTVF  190

Query  640  LTADRRRKTQALMTWNVTCT  699
             T D RRKTQA+MTWNVTCT
Sbjct  191  PTPDGRRKTQAMMTWNVTCT  210



>gb|KEH21748.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=446

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = +1

Query  103  CAVFLFLI-FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWT  279
            C +FLFL+ F   + +DPLDP GNITIKWD++ WT DGYVA VTMNNFQ YR I SPGW+
Sbjct  13   CILFLFLLSFTSTDAYDPLDPNGNITIKWDIIQWTPDGYVATVTMNNFQQYRHIASPGWS  72

Query  280  LGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCK  459
            LGW+WAKKEVIWS+VG+Q TEQGDCSKFKGNVPHCCKK PT+VDLLPG PYNQQ +NCCK
Sbjct  73   LGWTWAKKEVIWSMVGSQTTEQGDCSKFKGNVPHCCKKNPTVVDLLPGTPYNQQIANCCK  132

Query  460  GGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVF  639
            GGV++SW +DP+ +V AFQ+SVG AGT+NKTVK+P NFTL  PGPGYTCGPAKIV  T F
Sbjct  133  GGVLSSWAQDPTMAVGAFQISVGRAGTTNKTVKVPKNFTLNAPGPGYTCGPAKIVRPTQF  192

Query  640  LTADRRRKTQALMTWNVTCT  699
            +  D+RR TQALMTWNVTCT
Sbjct  193  IQPDKRRVTQALMTWNVTCT  212



>ref|XP_003562730.1| PREDICTED: COBRA-like protein 6 [Brachypodium distachyon]
Length=449

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWD++SWT DGYVAAVT+NNFQ YR I SPGWT+GW+WAK+EVIWS+V
Sbjct  24   YDPLDPHGNITIKWDIISWTPDGYVAAVTINNFQAYRQIPSPGWTVGWTWAKREVIWSMV  83

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFK N+PH CK+ P +VDLLPGVPYNQQ +NCC+GGVV+++G+DP+ +V
Sbjct  84   GAQATEQGDCSKFKSNLPHSCKRDPAVVDLLPGVPYNQQIANCCRGGVVSAFGQDPATAV  143

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQVSVG AGT+NKTVK+P NFT +GPG GYTCGPAK+VPSTVFL+ DRRRKTQALMTW
Sbjct  144  SAFQVSVGQAGTTNKTVKVPKNFTFLGPGNGYTCGPAKVVPSTVFLSPDRRRKTQALMTW  203

Query  685  NVTCT  699
            NVTCT
Sbjct  204  NVTCT  208



>ref|NP_568930.1| glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis 
thaliana]
 sp|Q94KT8.1|COBRA_ARATH RecName: Full=Protein COBRA; AltName: Full=Cell expansion protein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56072.1|AF319663_1 putative glycosylphosphatidylinositol-anchored protein [Arabidopsis 
thaliana]
 gb|AAM19781.1| AT5g60920/MSL3_40 [Arabidopsis thaliana]
 gb|AAN64510.1| At5g60920/MSL3_40 [Arabidopsis thaliana]
 gb|AED97397.1| glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis 
thaliana]
Length=456

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 177/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAVFL-FLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S ++KLSF A+++ FLI    F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSIVSKLSFLALWIVFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP+ + S+FQ+SVG AGT+NKTV++P NFTLMGPGPG
Sbjct  128  PGTPYNQQIANCCKGGVMNSWVQDPATAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCT  221



>ref|XP_004138217.1| PREDICTED: protein COBRA-like [Cucumis sativus]
 ref|XP_004171717.1| PREDICTED: protein COBRA-like [Cucumis sativus]
Length=455

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 176/220 (80%), Gaps = 5/220 (2%)
 Frame = +1

Query  55   QPKHFGSPSTLAKLSFCAVF-LFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYV  219
            + + F S  ++A L+  AV  LFL+    F   E +D LDP GNITIKWDVMSWT DGYV
Sbjct  2    RSRRFASTGSVADLTVIAVLVLFLLSSFSFTSTEAYDALDPNGNITIKWDVMSWTPDGYV  61

Query  220  AAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTP  399
            A VTM NFQ YR I +PGWTLGW+WAKKEVIWS++G+Q TEQGDCS+FKGN PHCCKK P
Sbjct  62   AVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGSQTTEQGDCSRFKGNTPHCCKKDP  121

Query  400  TIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTL  579
            T+VDLLPG PYNQQ +NCCKGGV+ SW +DP+ + S+FQVSVG AGTSNKTVKLP NFTL
Sbjct  122  TVVDLLPGTPYNQQIANCCKGGVINSWAQDPANAASSFQVSVGSAGTSNKTVKLPKNFTL  181

Query  580  MGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
              PGPGYTCGPAKIV  T F++ D+RR TQALMTWNVTCT
Sbjct  182  KAPGPGYTCGPAKIVRPTKFVSGDKRRVTQALMTWNVTCT  221



>emb|CAC01762.1| putative phytochelatin synthetase [Arabidopsis thaliana]
Length=395

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  193  MSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGN  372
            MSWTADGYVA VTMNNFQ+YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN
Sbjct  1    MSWTADGYVATVTMNNFQIYRHIQNPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGN  60

Query  373  VPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKT  552
            VPHCCKKTPT+VDLLPGVPYNQQFSNCCKGGV+ +WG+DPSA+VS FQVS GLAGT+NKT
Sbjct  61   VPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPSAAVSQFQVSAGLAGTTNKT  120

Query  553  VKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            VKLP NFTL+GPGPGYTCGPAKIVPSTVFLT D+RRKTQALMTWNVTCT
Sbjct  121  VKLPKNFTLLGPGPGYTCGPAKIVPSTVFLTTDKRRKTQALMTWNVTCT  169



>gb|KFK27869.1| hypothetical protein AALP_AA8G439700 [Arabis alpina]
Length=455

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 176/214 (82%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAV-FLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S +AK SF AV  +FLI    F  AE +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSLVAKSSFLAVCIVFLISSSFFTSAEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I +PGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIQTPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCC+GGV+ SW +DP+ + S+FQ+SVG AGT+NKTV++P NFTLMGPGPG
Sbjct  128  PGTPYNQQIANCCRGGVMNSWVQDPATAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVKPTKFVTTDTRRTTQAMMTWNITCT  221



>ref|XP_010695258.1| PREDICTED: protein COBRA-like [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 173/211 (82%), Gaps = 5/211 (2%)
 Frame = +1

Query  82   TLAKLSFCAVFLF-----LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            ++AKLS   +F+      L F   E +D LDP GNITIKWDV++WT DGY+A VTM NFQ
Sbjct  11   SIAKLSSFTIFIAFLLSSLFFTSTEAYDALDPNGNITIKWDVINWTPDGYLAVVTMFNFQ  70

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I  PGWTLGW+WAKK+VIWS+VGAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG 
Sbjct  71   QYRHIQPPGWTLGWTWAKKDVIWSMVGAQTTEQGDCSKFKGNIPHCCKKNPTVVDLLPGT  130

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCC+GGV+ SWG+DP+ +V AFQ+SVG AGTSNKTVKLP NFTL  PGPGYTC
Sbjct  131  PYNQQIANCCRGGVLTSWGQDPANAVGAFQISVGQAGTSNKTVKLPRNFTLQAPGPGYTC  190

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPA+IV ST F TAD+RR TQALMTWNVTCT
Sbjct  191  GPARIVKSTEFKTADKRRTTQALMTWNVTCT  221



>ref|XP_007138375.1| hypothetical protein PHAVU_009G203200g [Phaseolus vulgaris]
 gb|ESW10369.1| hypothetical protein PHAVU_009G203200g [Phaseolus vulgaris]
Length=456

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 178/216 (82%), Gaps = 4/216 (2%)
 Frame = +1

Query  52   QQPKHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVT  231
            QQ   FG    +A ++ C    F++   AE FD LDP GN+TI+WD+MSWT+DGY+A VT
Sbjct  9    QQKDTFGCFKLVALIALC----FVLISPAESFDALDPTGNVTIRWDIMSWTSDGYLATVT  64

Query  232  MNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVD  411
            + NFQ+YR IM+PGWTLGW+WAKKE+IW++VGAQATEQGDC+KFK  +PH CK+ P +VD
Sbjct  65   LFNFQLYRNIMNPGWTLGWTWAKKEIIWAVVGAQATEQGDCAKFKLKIPHSCKRNPQVVD  124

Query  412  LLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPG  591
            LLPG P+N QF+NCC+GGV+ SWG++PS +VS+FQ+ VGL+GTSNKTVKLP NF L+GPG
Sbjct  125  LLPGAPFNMQFTNCCRGGVLTSWGQNPSGAVSSFQIGVGLSGTSNKTVKLPKNFKLLGPG  184

Query  592  PGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            PGY+CGPAK+VPST  LT DRRRK QALM+WNVTCT
Sbjct  185  PGYSCGPAKVVPSTAILTDDRRRKMQALMSWNVTCT  220



>ref|XP_006280281.1| hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
 gb|EOA13179.1| hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
Length=537

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 177/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAVFL-FLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S +AKLSF A+++ FLI    F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  89   STSVVAKLSFLALWIVFLISSSSFTCTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  148

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  149  NFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLL  208

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP+ + S+FQ+SVG AGT+NKTV++P NFTLMGPGPG
Sbjct  209  PGTPYNQQIANCCKGGVMNSWVQDPATAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPG  268

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  269  YTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCT  302



>ref|XP_006477704.1| PREDICTED: protein COBRA-like [Citrus sinensis]
Length=257

 Score =   313 bits (803),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 174/212 (82%), Gaps = 5/212 (2%)
 Frame = +1

Query  79   STLAKLS-FCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNF  243
            S  +KLS F  + LFL+    F   E +D LDP GNITIKWD+MSWT DGYVA VT+ NF
Sbjct  11   SITSKLSGFTILLLFLLSCSTFTSTEAYDALDPNGNITIKWDIMSWTPDGYVAVVTIFNF  70

Query  244  QMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPG  423
            Q YR I +PGWTLGW+WAKKEVIWS++G Q TEQGDCSK+KGN+PHCCKK PT+VDLLPG
Sbjct  71   QQYRHIQAPGWTLGWTWAKKEVIWSMMGGQTTEQGDCSKYKGNIPHCCKKDPTVVDLLPG  130

Query  424  VPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYT  603
             PYNQQ +NCCKGGV++SW +DP+ ++S+FQ+SVG AGT+NKTV++P NFTL  PGPGYT
Sbjct  131  TPYNQQIANCCKGGVISSWAQDPTTALSSFQLSVGAAGTTNKTVRVPKNFTLKAPGPGYT  190

Query  604  CGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            CGPAK+   T F+T+D+RR TQA+MTWNVTCT
Sbjct  191  CGPAKVGKPTKFITSDKRRVTQAMMTWNVTCT  222



>ref|XP_006603925.1| PREDICTED: protein COBRA-like [Glycine max]
 gb|KHN04372.1| Protein COBRA [Glycine soja]
Length=454

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = +1

Query  109  VFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGW  288
            + LF++F   E +DPLDP+GNITIKWD++SWT DGYVA VTMNNFQ YR I  PGW+LGW
Sbjct  21   ILLFVLFSFTEAYDPLDPYGNITIKWDIISWTPDGYVAVVTMNNFQQYRHISEPGWSLGW  80

Query  289  SWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGV  468
            +WAKKEVIWS+VG Q TEQGDCSK+KGN+PHCCKK P +VDLLPG PYNQQ +NCCKGGV
Sbjct  81   TWAKKEVIWSMVGGQTTEQGDCSKYKGNIPHCCKKNPVVVDLLPGTPYNQQIANCCKGGV  140

Query  469  VASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTA  648
            ++SW +D S +VSAFQVSVG AGT+NKTVKLP +FTL  PGPGYTCGPA IV  T+F+  
Sbjct  141  LSSWAQDQSKAVSAFQVSVGSAGTTNKTVKLPKDFTLKAPGPGYTCGPATIVKPTLFIQP  200

Query  649  DRRRKTQALMTWNVTCT  699
            D+RR TQALMTWNVTCT
Sbjct  201  DKRRVTQALMTWNVTCT  217



>gb|KDP24286.1| hypothetical protein JCGZ_25582 [Jatropha curcas]
Length=445

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 170/204 (83%), Gaps = 4/204 (2%)
 Frame = +1

Query  100  FCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMS  267
            F  + LFL+    F   E +D LDP GNITIKWD++SWT DGYVA VTM NFQ YR I +
Sbjct  7    FTILILFLLSCTTFTRTEAYDALDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHIEA  66

Query  268  PGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFS  447
            PGWTLGW+WAKKEVIWS+VG QATEQGDCSKFKGN+PHCCKK+P +VDLLPG PYNQQ +
Sbjct  67   PGWTLGWTWAKKEVIWSMVGGQATEQGDCSKFKGNIPHCCKKSPAVVDLLPGTPYNQQIA  126

Query  448  NCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVP  627
            NCCKGGV++SW +DPS +VSAFQ+S+G AGT+NKTV+LP NFTL  PGPGYTCGPAKIV 
Sbjct  127  NCCKGGVISSWAQDPSKAVSAFQLSIGAAGTTNKTVRLPRNFTLKAPGPGYTCGPAKIVR  186

Query  628  STVFLTADRRRKTQALMTWNVTCT  699
             + FLT D+RR TQALMTWNVTCT
Sbjct  187  PSKFLTPDKRRVTQALMTWNVTCT  210



>ref|XP_003552600.1| PREDICTED: protein COBRA-like [Glycine max]
 gb|KHN37930.1| Protein COBRA [Glycine soja]
Length=448

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 175/211 (83%), Gaps = 4/211 (2%)
 Frame = +1

Query  79   STLAKLSFCAVFLFLIF----PHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            S L K + C +FL L+F       + +DPLDP GNITIKWD++SWT DGYVA VTMNNFQ
Sbjct  4    SLLPKATPCILFLALLFCTCFTSTDAYDPLDPNGNITIKWDIISWTPDGYVAVVTMNNFQ  63

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I SPGW++GW+WAKKEVIWS++G Q TEQGDCSKFKG +PHCCKK PT+VDLLPG 
Sbjct  64   QYRHIASPGWSMGWTWAKKEVIWSMMGGQTTEQGDCSKFKGGIPHCCKKDPTVVDLLPGT  123

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV++SW +DP+ +VS+FQVSVG AGT+NKTVK+P NFTL  PGPGYTC
Sbjct  124  PYNQQIANCCKGGVLSSWAQDPTNAVSSFQVSVGRAGTTNKTVKVPKNFTLKAPGPGYTC  183

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPAKIV  T F+T+D+RR TQALMTWNVTCT
Sbjct  184  GPAKIVAPTKFITSDKRRVTQALMTWNVTCT  214



>ref|XP_009346186.1| PREDICTED: protein COBRA-like [Pyrus x bretschneideri]
Length=456

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 180/220 (82%), Gaps = 5/220 (2%)
 Frame = +1

Query  55   QPKHFGSPSTLAKL-SFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYV  219
            +P+ F +  ++AKL SF  + +FL+    F   E +D LDP GNITIKWDV+SWT DGYV
Sbjct  2    EPQCFSAVGSMAKLTSFTILLVFLLSCFTFTSTEAYDALDPNGNITIKWDVISWTPDGYV  61

Query  220  AAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTP  399
            A VTM NFQ YR I +PGWTLGW+WAKKEVIWS+VGAQATEQGDCSK+KGNVPHCCKK P
Sbjct  62   AVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQATEQGDCSKYKGNVPHCCKKDP  121

Query  400  TIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTL  579
            TIVDLLPG PYNQQ +NCCKGGV+ SW +DP  ++S+FQ+SVG AGT+NKTV+LP NFTL
Sbjct  122  TIVDLLPGTPYNQQIANCCKGGVMQSWIQDPDNAISSFQISVGAAGTTNKTVRLPKNFTL  181

Query  580  MGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
              PGPGY+CG AKIV  T FLT+D+RR TQA+MTWNVTCT
Sbjct  182  KAPGPGYSCGIAKIVKPTRFLTSDKRRWTQAMMTWNVTCT  221



>ref|XP_006440797.1| hypothetical protein CICLE_v10021527mg [Citrus clementina]
 gb|ESR54037.1| hypothetical protein CICLE_v10021527mg [Citrus clementina]
Length=284

 Score =   314 bits (805),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 173/212 (82%), Gaps = 5/212 (2%)
 Frame = +1

Query  79   STLAKLS-FCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNF  243
            S  +KLS F  + LFL+    F   E +D LDP GNITIKWD+MSWT DGYVA VT+ NF
Sbjct  11   SITSKLSGFTILLLFLLSCSTFTSTEAYDALDPNGNITIKWDIMSWTPDGYVAVVTIFNF  70

Query  244  QMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPG  423
            Q YR I +PGWTLGW+WAKKEVIWS++G Q TEQGDCSK+KGN+PHCCKK PT+VDLLPG
Sbjct  71   QQYRHIQAPGWTLGWTWAKKEVIWSMMGGQTTEQGDCSKYKGNIPHCCKKDPTVVDLLPG  130

Query  424  VPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYT  603
             PYNQQ  NCCKGGV++SW +DP+ ++S+FQ+SVG AGT+NKTV++P NFTL  PGPGYT
Sbjct  131  TPYNQQIENCCKGGVISSWAQDPTTALSSFQLSVGAAGTTNKTVRVPKNFTLKAPGPGYT  190

Query  604  CGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            CGPAK+   T F+T+D+RR TQA+MTWNVTCT
Sbjct  191  CGPAKVGKPTKFITSDKRRVTQAMMTWNVTCT  222



>ref|XP_002264600.1| PREDICTED: protein COBRA [Vitis vinifera]
 emb|CBI15330.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   320 bits (820),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 171/211 (81%), Gaps = 5/211 (2%)
 Frame = +1

Query  82   TLAKLSFCAVFLFL-----IFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            ++ KLS  A+ L L     IF   E +D LDP GNITIKWDVMSWT DGYVA VTM NFQ
Sbjct  11   SITKLSSYAILLVLLFSCSIFTSTEAYDSLDPEGNITIKWDVMSWTPDGYVAVVTMFNFQ  70

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGW+LGWSWAKKEVIWS++G Q TEQGDCS+FKGNVPHCCKK PT+VDLLPG 
Sbjct  71   QYRHIQAPGWSLGWSWAKKEVIWSMMGGQTTEQGDCSRFKGNVPHCCKKDPTVVDLLPGT  130

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+ SW +DP+ + S+FQVSVG AGT+NKTVKLP NFTL  PGPGYTC
Sbjct  131  PYNQQIANCCKGGVINSWVQDPANAASSFQVSVGAAGTTNKTVKLPKNFTLRAPGPGYTC  190

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPAKIV  T F TAD+RR TQALMTWNVTCT
Sbjct  191  GPAKIVKPTKFTTADQRRVTQALMTWNVTCT  221



>ref|XP_008374650.1| PREDICTED: protein COBRA-like [Malus domestica]
Length=456

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 180/220 (82%), Gaps = 5/220 (2%)
 Frame = +1

Query  55   QPKHFGSPSTLAKL-SFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYV  219
            +P+ F +  ++AKL SF  + +FL+    F   E +D LDP GNITIKWDV+SWT DGYV
Sbjct  2    EPQCFSAVGSMAKLTSFTILLVFLLSCFTFTSTEAYDALDPNGNITIKWDVISWTPDGYV  61

Query  220  AAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTP  399
            A VTM NFQ YR I +PGWTLGW+WAKKEVIWS+VGAQATEQGDCSK+KGNVPHCCKK P
Sbjct  62   AVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQATEQGDCSKYKGNVPHCCKKDP  121

Query  400  TIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTL  579
            T+VDLLPG PYNQQ +NCCKGGV+ SW +DP  ++S+FQ+SVG AGT+NKTV+LP NFTL
Sbjct  122  TVVDLLPGTPYNQQIANCCKGGVMQSWIQDPDNAISSFQISVGAAGTTNKTVRLPKNFTL  181

Query  580  MGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
              PGPGY+CG AKIV  T FLT+D+RR TQA+MTWNVTCT
Sbjct  182  KAPGPGYSCGIAKIVKPTRFLTSDKRRWTQAMMTWNVTCT  221



>ref|XP_002531000.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF31388.1| Protein COBRA precursor, putative [Ricinus communis]
Length=456

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 171/208 (82%), Gaps = 2/208 (1%)
 Frame = +1

Query  82   TLAKLSFCAVFLF--LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYR  255
            TL++ S   +FL     F   E +D LDP GNITIKWD+++WT DGYVA VTM NFQ YR
Sbjct  11   TLSQFSILVLFLISCTTFTQTEAYDALDPTGNITIKWDIINWTPDGYVAVVTMYNFQQYR  70

Query  256  AIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYN  435
             I +PGWTLGW+WAKKEVIW++VG Q TEQGDCSKFKGN+PHCCKK PT+VDLLPG PYN
Sbjct  71   HIQAPGWTLGWTWAKKEVIWNMVGGQTTEQGDCSKFKGNIPHCCKKNPTVVDLLPGTPYN  130

Query  436  QQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPA  615
            QQ +NCCKGGV++SWG+DPS +VSAFQ+SVG AGT+NKTV++P NFTL  PGPGYTCGPA
Sbjct  131  QQIANCCKGGVISSWGQDPSKAVSAFQLSVGAAGTTNKTVRVPKNFTLKAPGPGYTCGPA  190

Query  616  KIVPSTVFLTADRRRKTQALMTWNVTCT  699
            KIV  + F T D+RR TQALMTWNVTCT
Sbjct  191  KIVRPSRFFTTDKRRVTQALMTWNVTCT  218



>ref|XP_010087345.1| hypothetical protein L484_012678 [Morus notabilis]
 gb|EXB28919.1| hypothetical protein L484_012678 [Morus notabilis]
Length=614

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 178/218 (82%), Gaps = 4/218 (2%)
 Frame = +1

Query  46   YSQQPKHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAA  225
            Y QQ   F       K  F AV   +    A  +DPLDP GN++I+WDVMSW  DGYVAA
Sbjct  170  YLQQGNLFAG----LKFIFLAVLCCMPLSPAAAYDPLDPNGNVSIRWDVMSWATDGYVAA  225

Query  226  VTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTI  405
            VT+NNFQ++R  MSPGW+LGW+WAKKE+IW+++GAQA EQGDCSKFK N+PH CK+ PT+
Sbjct  226  VTINNFQLFRHFMSPGWSLGWTWAKKEIIWTMLGAQAKEQGDCSKFKINIPHSCKRNPTV  285

Query  406  VDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMG  585
            VDLLP  P+NQQF NCCKGGV+ASWG+DPSA+V+AFQ++VGL+GTSNKTVKLP NFTL+G
Sbjct  286  VDLLPETPFNQQFGNCCKGGVLASWGQDPSAAVAAFQITVGLSGTSNKTVKLPKNFTLLG  345

Query  586  PGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            PGPGYTCGPAKIVPS+ FL+ D RRK QALMTWNVTCT
Sbjct  346  PGPGYTCGPAKIVPSSHFLSPDGRRKAQALMTWNVTCT  383



>gb|KDO65676.1| hypothetical protein CISIN_1g038127mg [Citrus sinensis]
Length=438

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +1

Query  121  LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAK  300
            LIF HA  +D LDP GNITIKWDVMSW  DGYVA VTM NFQMYR IM PGWTLGW+WAK
Sbjct  18   LIFSHAVAYDTLDPTGNITIKWDVMSWIPDGYVALVTMTNFQMYRHIMEPGWTLGWTWAK  77

Query  301  KEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASW  480
            KEVIWS+VGAQATEQGDCSKFK N+PH C K PT+VDLLPGVPYNQQ +NCCKGGVV SW
Sbjct  78   KEVIWSMVGAQATEQGDCSKFKINIPHSCMKNPTVVDLLPGVPYNQQIANCCKGGVVGSW  137

Query  481  GEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRR  660
            G+DPSA+VS+FQ+SVG +G+SNKTV+LP NFTL+GPG GYTC  AK V  T F++AD RR
Sbjct  138  GQDPSAAVSSFQLSVGRSGSSNKTVRLPKNFTLLGPGRGYTCSQAKNVLPTAFISADGRR  197

Query  661  KTQALMTWNVTCT  699
            +TQA+MTWNVTCT
Sbjct  198  RTQAMMTWNVTCT  210



>ref|XP_002866404.1| hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42663.1| hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 177/214 (83%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAVFL-FLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S ++KLSF A+++ FLI    F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSIVSKLSFWALWIVFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP+ + S+FQ+SVG AGT+NKTV++P NFTL+GPGPG
Sbjct  128  PGTPYNQQIANCCKGGVMNSWVQDPATAASSFQISVGAAGTTNKTVRVPRNFTLLGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCT  221



>ref|XP_007151373.1| hypothetical protein PHAVU_004G041300g [Phaseolus vulgaris]
 gb|ESW23367.1| hypothetical protein PHAVU_004G041300g [Phaseolus vulgaris]
Length=426

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 175/215 (81%), Gaps = 6/215 (3%)
 Frame = +1

Query  73   SPSTLAKLSFCA-VFLFLIFP-----HAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTM  234
            +P+  + +  CA + LFL+F        E +DPLDP GNITIKWD+MSWT DGYVA VTM
Sbjct  8    NPTIRSLVKPCACILLFLLFSCTCFTSTEAYDPLDPNGNITIKWDIMSWTPDGYVAVVTM  67

Query  235  NNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDL  414
            NNFQ YR I +PGW+LGW+WAKKEVIWS+VG Q TEQGDCS+FKGN+PHCC+K PT+VDL
Sbjct  68   NNFQKYRHISAPGWSLGWTWAKKEVIWSMVGGQTTEQGDCSRFKGNIPHCCRKDPTVVDL  127

Query  415  LPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGP  594
            LPG PYNQQ +NCCKGGV++SW +D S +VSAFQ+SVG AGT+NKTVKLP +FTL  PGP
Sbjct  128  LPGTPYNQQIANCCKGGVLSSWAQDQSKAVSAFQISVGSAGTTNKTVKLPQSFTLKAPGP  187

Query  595  GYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GYTCGPAKIV  T F+  D+RR TQALMTWNVTCT
Sbjct  188  GYTCGPAKIVEPTEFIQPDKRRVTQALMTWNVTCT  222



>ref|XP_010456834.1| PREDICTED: protein COBRA [Camelina sativa]
Length=456

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 176/214 (82%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAVFL-FLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S +AK SF A+++ FLI    F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSVVAKFSFLALWIVFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I +PGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIQTPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP+ + S+FQ+SVG AGT+NKTV++P NFTL+GPGPG
Sbjct  128  PGTPYNQQIANCCKGGVMNSWVQDPATAASSFQISVGAAGTTNKTVRVPRNFTLLGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCT  221



>sp|Q6Z4G7.1|COBL6_ORYSJ RecName: Full=COBRA-like protein 6; AltName: Full=Protein BRITTLE 
CULM1-like 7; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAC83873.1| putative phytochelatin synthetase [Oryza sativa Japonica Group]
 gb|EAZ40581.1| hypothetical protein OsJ_25038 [Oryza sativa Japonica Group]
Length=451

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  136  AEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIW  315
            A  +DPLDP GNITIKWDVMSWT DGYVA VT+NN+Q YR IM+PGWT+GW+WA++EVIW
Sbjct  19   AVAYDPLDPNGNITIKWDVMSWTPDGYVAMVTINNYQTYRQIMAPGWTVGWTWARQEVIW  78

Query  316  SIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPS  495
            S+VGAQAT+QGDCS+FK N+PHCC++TP +VDLLPGVPYNQQ +NCC+GGV+ ++G+ PS
Sbjct  79   SMVGAQATDQGDCSRFKANLPHCCRRTPAVVDLLPGVPYNQQIANCCRGGVLPAYGQAPS  138

Query  496  ASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQAL  675
            A+ +AFQVSVG AGT+N+TV+LP NFTL+GPGPGYTCG A++VPSTVFLTADRRRKTQAL
Sbjct  139  AAAAAFQVSVGQAGTTNRTVRLPRNFTLLGPGPGYTCGRARVVPSTVFLTADRRRKTQAL  198

Query  676  MTWNVTCT  699
            MTWNVTCT
Sbjct  199  MTWNVTCT  206



>gb|KDP31373.1| hypothetical protein JCGZ_11749 [Jatropha curcas]
Length=457

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 172/212 (81%), Gaps = 2/212 (1%)
 Frame = +1

Query  70   GSPSTLAKLSFCAVFLF--LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNF  243
            GS + L+  +   VFL     F   E +D LDP GNITIKWDV+SWT DGYVA VTM NF
Sbjct  10   GSVTKLSSFTIFLVFLLSCCTFTPIEAYDALDPNGNITIKWDVISWTPDGYVAVVTMYNF  69

Query  244  QMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPG  423
            Q YR I +PGWTLGW+WAKKEVIWS+VG Q TEQGDCSK+KGNVPHCCKK PT+VDLLPG
Sbjct  70   QQYRHIQAPGWTLGWTWAKKEVIWSMVGGQTTEQGDCSKYKGNVPHCCKKDPTVVDLLPG  129

Query  424  VPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYT  603
             PYNQQ +NCCKGGV+ SW +DP+ +VS+FQVSVG AGTSNKTV+LP NFTL  PGPGYT
Sbjct  130  TPYNQQIANCCKGGVLNSWAQDPATAVSSFQVSVGAAGTSNKTVRLPKNFTLKAPGPGYT  189

Query  604  CGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            CGPAKIV  T F+++D+RR TQALMTWNVTCT
Sbjct  190  CGPAKIVRPTKFISSDKRRSTQALMTWNVTCT  221



>emb|CDP21871.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +1

Query  193  MSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGN  372
            MSWT DGYVAAVTMNNFQMYR +MSPGWTLGW+WAKKEVIW++VGAQ TEQGDCSKFK N
Sbjct  1    MSWTPDGYVAAVTMNNFQMYRHVMSPGWTLGWTWAKKEVIWTMVGAQTTEQGDCSKFKAN  60

Query  373  VPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKT  552
            +PHCCKKTPT+VDLLPGVPYNQQF+NCCKGGV++SWG+DP ASVSAFQVSVG AGTSNKT
Sbjct  61   IPHCCKKTPTVVDLLPGVPYNQQFTNCCKGGVLSSWGQDPQASVSAFQVSVGQAGTSNKT  120

Query  553  VKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            VKLP NFTL+GPGPGYTCGPAK+VP T FLT DRRRKTQALMTWNVTCT
Sbjct  121  VKLPKNFTLLGPGPGYTCGPAKVVPPTNFLTPDRRRKTQALMTWNVTCT  169



>ref|XP_010443903.1| PREDICTED: protein COBRA-like [Camelina sativa]
Length=456

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 176/214 (82%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAVF-LFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S +AK SF A++ +FLI    F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSVVAKFSFLALWTVFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I +PGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIQTPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP+ + S+FQ+SVG AGT+NKTV++P NFTL+GPGPG
Sbjct  128  PGTPYNQQIANCCKGGVMNSWVQDPATAASSFQISVGAAGTTNKTVRVPRNFTLLGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCT  221



>emb|CDY02184.1| BnaA03g39830D [Brassica napus]
Length=457

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAV-FLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S ++K+SF AV  +FL+    F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSIVSKMSFLAVGIVFLVSSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNLPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP  + S+FQ+SVG AGT+NKTV++P NFTLMGPGPG
Sbjct  128  PGTPYNQQIANCCKGGVLNSWVQDPGTAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVRPTQFVTPDTRRTTQAMMTWNITCT  221



>emb|CDY58691.1| BnaC07g49800D [Brassica napus]
Length=458

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAV-FLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S ++K+SF AV  +FLI    F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSIVSKMSFLAVGIVFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNLPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP  + S+FQ+SVG AGT+NKTV++P NFTLMGPGPG
Sbjct  128  PGTPYNQQIANCCKGGVLNSWVQDPGTAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVRPTQFVTPDTRRTTQAMMTWNITCT  221



>ref|XP_009136413.1| PREDICTED: protein COBRA [Brassica rapa]
Length=457

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = +1

Query  73   SPSTLAKLSFCAV-FLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
            S S ++K+SF AV  +FL+    F   E +D LDP GNIT+KWDVMSWT DGYVA VTM 
Sbjct  8    STSIVSKMSFLAVGIVFLVSSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMF  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLL
Sbjct  68   NFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNLPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP  + S+FQ+SVG AGT+NKTV++P NFTLMGPGPG
Sbjct  128  PGTPYNQQIANCCKGGVLNSWVQDPGTAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+T D RR TQA+MTWN+TCT
Sbjct  188  YTCGPAKIVRPTQFVTPDTRRTTQAMMTWNITCT  221



>ref|XP_004232141.1| PREDICTED: protein COBRA [Solanum lycopersicum]
Length=447

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 171/201 (85%), Gaps = 4/201 (2%)
 Frame = +1

Query  109  VFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGW  276
            + LFLI    F   + FDPLDP GNITIKWDV+SWT DGYVA VTM NFQ YR I +PGW
Sbjct  12   LLLFLISCFSFSSTDAFDPLDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGW  71

Query  277  TLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCC  456
            +LGW+WAKKEVIW+++GAQ TEQGDCSK+KGN+PHCCKK PT+VD+LPG PYNQQ +NCC
Sbjct  72   SLGWTWAKKEVIWTMMGAQTTEQGDCSKYKGNIPHCCKKDPTVVDMLPGTPYNQQIANCC  131

Query  457  KGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTV  636
            KGGV+ SWG+DP+ +VS+FQVSVG AGT+NKTV++P NFTL  PGPGYTCGPAKIV ST 
Sbjct  132  KGGVINSWGQDPATAVSSFQVSVGAAGTTNKTVRVPKNFTLKAPGPGYTCGPAKIVKSTK  191

Query  637  FLTADRRRKTQALMTWNVTCT  699
            F++AD RR TQA+MTWNVTCT
Sbjct  192  FVSADGRRVTQAMMTWNVTCT  212



>ref|XP_010257981.1| PREDICTED: protein COBRA-like isoform X2 [Nelumbo nucifera]
Length=399

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +1

Query  82   TLAKLSFCAV-FLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            +++KL+ C + F+FL+    F   E +D LDP GNITIKWDV+SWT DGYVA VT+ NFQ
Sbjct  11   SISKLTSCTILFMFLLSCFSFTSTEAYDALDPNGNITIKWDVISWTPDGYVAVVTIYNFQ  70

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGWTLGW+WAKKEVIWS++G+Q TEQGDCS+FKGN+PHCCKK PT+VDLLPG 
Sbjct  71   QYRHIQAPGWTLGWTWAKKEVIWSMMGSQTTEQGDCSRFKGNIPHCCKKDPTVVDLLPGT  130

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+ SW +DP+ + S+FQVSVG AGT+NKTVKLP NFTL  PGPGYTC
Sbjct  131  PYNQQIANCCKGGVINSWVQDPTNAASSFQVSVGAAGTTNKTVKLPKNFTLKAPGPGYTC  190

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPAKIV  T F TAD+RR TQA+MTWNVTCT
Sbjct  191  GPAKIVKPTKFTTADQRRTTQAMMTWNVTCT  221



>ref|XP_008240088.1| PREDICTED: protein COBRA-like isoform X2 [Prunus mume]
Length=373

 Score =   315 bits (807),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 175/220 (80%), Gaps = 5/220 (2%)
 Frame = +1

Query  55   QPKHFGSPSTLAKLSFCAVFLFL-----IFPHAEPFDPLDPFGNITIKWDVMSWTADGYV  219
            +P++     ++ KLS  A+ L        F   E +D LDP GNITIKWDV+SWT DGYV
Sbjct  2    EPRYLSDTGSIVKLSSFAILLVFWLSCFSFTSTEAYDALDPTGNITIKWDVISWTPDGYV  61

Query  220  AAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTP  399
            A VTM NFQ YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCS++KGNVPHCCKK P
Sbjct  62   AVVTMFNFQQYRHIQTPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSRYKGNVPHCCKKDP  121

Query  400  TIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTL  579
            T+VDLLPG PYNQQ +NCCKGGV+ SW +DP+ ++S+FQ+SVG AGT+NKTV++P NFTL
Sbjct  122  TVVDLLPGTPYNQQIANCCKGGVMNSWIQDPANAISSFQISVGAAGTTNKTVRMPKNFTL  181

Query  580  MGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
              PGPGY+CG AKIV  T FLTAD+RR TQA+MTWNVTCT
Sbjct  182  KAPGPGYSCGIAKIVKPTRFLTADKRRWTQAMMTWNVTCT  221



>gb|AHC30880.1| COBRA-like protein [Oncidium hybrid cultivar]
 gb|AHJ14778.1| COBRA-like protein [Oncidium hybrid cultivar]
Length=461

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = +1

Query  73   SPSTLAKLSFCAVFLFLIF--PHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            S S LA  +   VF  L F     E FD LDP GNITIKWD+M WT DGYVA VT+NNFQ
Sbjct  15   SISMLAHFASFHVFFLLFFSLKSIEAFDALDPNGNITIKWDIMQWTPDGYVAVVTINNFQ  74

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I SPGWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG 
Sbjct  75   QYRHIQSPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKDPTVVDLLPGT  134

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYN Q +NCCKGGV++SW +DP  +VSAFQVSVG AGT+NKTV++P NFTL  PGPGYTC
Sbjct  135  PYNMQIANCCKGGVISSWAQDPPNAVSAFQVSVGAAGTTNKTVRVPKNFTLRAPGPGYTC  194

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            G AKIV  T F++ D RR TQALMTWNVTCT
Sbjct  195  GAAKIVKQTQFVSQDGRRTTQALMTWNVTCT  225



>gb|KHN30325.1| Protein COBRA [Glycine soja]
Length=448

 Score =   317 bits (812),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 174/209 (83%), Gaps = 4/209 (2%)
 Frame = +1

Query  85   LAKLSFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMY  252
            L K + C +FL L+    F   + +DPLDP GNITIKWD++SWT DGYVA VTMNNFQ Y
Sbjct  6    LPKATPCILFLALLSCTCFTSTDAYDPLDPNGNITIKWDIISWTPDGYVAVVTMNNFQQY  65

Query  253  RAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPY  432
            R I SPGW++GW+WAKKEVIWS++G Q TEQGDCSKFKG +PHCCKK PT+VDLLPG PY
Sbjct  66   RHIASPGWSMGWTWAKKEVIWSMMGGQTTEQGDCSKFKGGIPHCCKKDPTVVDLLPGTPY  125

Query  433  NQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGP  612
            NQQ +NCCKGGV++SW +DP+ +VS+FQVSVG AGT+N+TVK+P NFTL  PGPGYTCGP
Sbjct  126  NQQIANCCKGGVLSSWVQDPTNAVSSFQVSVGRAGTTNRTVKVPKNFTLKAPGPGYTCGP  185

Query  613  AKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            AKIV  T F+T+D+RR TQALMTWNVTCT
Sbjct  186  AKIVAPTKFITSDKRRVTQALMTWNVTCT  214



>gb|KHG21362.1| Protein COBRA -like protein [Gossypium arboreum]
Length=455

 Score =   317 bits (813),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = +1

Query  70   GSPSTLAKLSFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMN  237
             S S    +SF A+ LFL     F   E +D LDP GNITIKWDV+SWT DGYVA VTM 
Sbjct  8    ASRSISKLISFTALLLFLFSCSTFTSTEAYDALDPTGNITIKWDVISWTPDGYVAVVTMY  67

Query  238  NFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLL  417
            NFQ YR I +PGWTLGW+WAKKEVIWS++G+Q TEQGDCSK+KGNVPHCCKK PT+VDLL
Sbjct  68   NFQQYRHIQAPGWTLGWTWAKKEVIWSMMGSQTTEQGDCSKYKGNVPHCCKKDPTVVDLL  127

Query  418  PGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPG  597
            PG PYNQQ +NCCKGGV+ SW +DP+ + S+FQVSVG AGT+NKTV++P NFTL  PGPG
Sbjct  128  PGTPYNQQIANCCKGGVLNSWVQDPANAASSFQVSVGAAGTTNKTVRVPRNFTLKAPGPG  187

Query  598  YTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            YTCGPAKIV  T F+TAD+RR TQA+MTWNVTCT
Sbjct  188  YTCGPAKIVKPTKFITADKRRITQAMMTWNVTCT  221



>ref|NP_001241986.1| uncharacterized protein LOC100782876 precursor [Glycine max]
 gb|ACU21272.1| unknown [Glycine max]
Length=448

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 174/209 (83%), Gaps = 4/209 (2%)
 Frame = +1

Query  85   LAKLSFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMY  252
            L K + C +FL L+    F   + +DPLDP GNITIKWD++SWT DGYVA VTMNNFQ Y
Sbjct  6    LPKATPCILFLALLSCTCFTSTDAYDPLDPNGNITIKWDIISWTPDGYVAVVTMNNFQQY  65

Query  253  RAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPY  432
            R I SPGW++GW+WAKKEVIWS++G Q TEQGDCSKFKG +PHCCKK PT+VDLLPG PY
Sbjct  66   RHIASPGWSMGWTWAKKEVIWSMMGGQTTEQGDCSKFKGGIPHCCKKDPTVVDLLPGTPY  125

Query  433  NQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGP  612
            NQQ +NCCKGGV++SW +DP+ +VS+FQVSVG AGT+N+TVK+P NFTL  PGPGYTCGP
Sbjct  126  NQQIANCCKGGVLSSWVQDPTNAVSSFQVSVGRAGTTNRTVKVPKNFTLKAPGPGYTCGP  185

Query  613  AKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            AKIV  T F+T+D+RR TQALMTWNVTCT
Sbjct  186  AKIVAPTKFITSDKRRVTQALMTWNVTCT  214



>gb|ADE67031.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67026.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67043.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67018.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67045.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>ref|XP_009338021.1| PREDICTED: protein COBRA-like [Pyrus x bretschneideri]
Length=456

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 178/220 (81%), Gaps = 5/220 (2%)
 Frame = +1

Query  55   QPKHFGSPSTLAKL-SFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYV  219
            +P+ F +  ++AKL SF  +  FL+    F   E +D LDP GNITIKWDV+SWT DGYV
Sbjct  2    EPQCFSAVGSIAKLTSFTILLAFLLSCFTFTSTEAYDALDPTGNITIKWDVISWTPDGYV  61

Query  220  AAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTP  399
            A VTM NFQ YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCSK+KGNVPHCCKK P
Sbjct  62   AVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKYKGNVPHCCKKDP  121

Query  400  TIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTL  579
            T+VDLLPG PYNQQ +NCCKGGV+ SW +DP  ++S+FQVSVG AGT+NKTV+LP NFTL
Sbjct  122  TVVDLLPGTPYNQQIANCCKGGVMQSWIQDPPNAISSFQVSVGAAGTTNKTVRLPKNFTL  181

Query  580  MGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
              PGPGY+CG AKIV  T FLT+D+RR TQA+MTWNVTCT
Sbjct  182  RAPGPGYSCGIAKIVKPTRFLTSDKRRWTQAMMTWNVTCT  221



>gb|ADE67012.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67042.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67011.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67013.1| COBRA-like 4 protein [Populus tomentosa]
 gb|AFZ78567.1| COBRA-like protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67039.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67025.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67029.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67030.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67020.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67021.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67027.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67040.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67046.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>ref|XP_010257980.1| PREDICTED: protein COBRA-like isoform X1 [Nelumbo nucifera]
Length=455

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +1

Query  82   TLAKLSFCAV-FLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            +++KL+ C + F+FL+    F   E +D LDP GNITIKWDV+SWT DGYVA VT+ NFQ
Sbjct  11   SISKLTSCTILFMFLLSCFSFTSTEAYDALDPNGNITIKWDVISWTPDGYVAVVTIYNFQ  70

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGWTLGW+WAKKEVIWS++G+Q TEQGDCS+FKGN+PHCCKK PT+VDLLPG 
Sbjct  71   QYRHIQAPGWTLGWTWAKKEVIWSMMGSQTTEQGDCSRFKGNIPHCCKKDPTVVDLLPGT  130

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+ SW +DP+ + S+FQVSVG AGT+NKTVKLP NFTL  PGPGYTC
Sbjct  131  PYNQQIANCCKGGVINSWVQDPTNAASSFQVSVGAAGTTNKTVKLPKNFTLKAPGPGYTC  190

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPAKIV  T F TAD+RR TQA+MTWNVTCT
Sbjct  191  GPAKIVKPTKFTTADQRRTTQAMMTWNVTCT  221



>gb|KDP24287.1| hypothetical protein JCGZ_25583 [Jatropha curcas]
Length=431

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +1

Query  106  AVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLG  285
            ++F   +F  A  +DPLDP GN+TIKWD+++WT DGY A VT+ NFQ +R IM PGW +G
Sbjct  7    SLFFLALFSCAAAYDPLDPMGNVTIKWDIVAWTIDGYTATVTLFNFQTFRHIMDPGWKIG  66

Query  286  WSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGG  465
            W+WAKKE+IWS+VGAQA EQGDCSKFK  +PHCCK+ P +VDLLPG P+NQQF+NCCKGG
Sbjct  67   WTWAKKEIIWSMVGAQAAEQGDCSKFKAIIPHCCKRNPVVVDLLPGAPFNQQFANCCKGG  126

Query  466  VVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLT  645
            VV++WG+DP AS+S FQ++VGL+GTSNKTVK+P NFT++GPGPGYTC PAK+VPS+ FLT
Sbjct  127  VVSAWGQDPKASISQFQITVGLSGTSNKTVKMPKNFTMLGPGPGYTCSPAKLVPSSKFLT  186

Query  646  ADRRRKTQALMTWNVTCT  699
             D RR+TQAL+TWNVTCT
Sbjct  187  PDGRRRTQALITWNVTCT  204



>gb|ADE67019.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67038.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67041.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67048.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67049.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67051.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH C+++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCRRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67014.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67022.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67023.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67024.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67028.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67033.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67035.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67044.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67050.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH C+++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCRRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67017.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH C+++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCRRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>emb|CDX85277.1| BnaC07g25880D [Brassica napus]
Length=436

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = +1

Query  79   STLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRA  258
            ST++ L  C +F +  FP  E +D LDP GNITIKWD++SWTADGYVA V++ NFQ YR 
Sbjct  6    STISLLFLC-LFSWTSFPTTEAYDALDPTGNITIKWDIISWTADGYVAVVSIFNFQQYRH  64

Query  259  IMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQ  438
            I +PGW LGWSW KKEVIWS+VGAQATEQGDCSKFKGN+PHCCKKTPT+VDLLPG PYNQ
Sbjct  65   IQAPGWQLGWSWYKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKKTPTVVDLLPGTPYNQ  124

Query  439  QFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAK  618
            Q SNCC+GGV++SW +DP+ +VS+FQ+SVG +GT+N TV+ P N TL  PGPGYTCGPAK
Sbjct  125  QISNCCRGGVISSWAQDPATAVSSFQISVGQSGTTNTTVRAPRNVTLKAPGPGYTCGPAK  184

Query  619  IVPSTVFLTADRRRKTQALMTWNVTCT  699
            +VP T F++ D+RRKTQA++TWN+TCT
Sbjct  185  VVPPTKFISNDKRRKTQAMLTWNMTCT  211



>gb|ADE67037.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67047.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH C+++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCRRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|ADE67015.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67016.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67034.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH C+++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCRRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>gb|KEH38144.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=452

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 168/213 (79%), Gaps = 6/213 (3%)
 Frame = +1

Query  79   STLAKLSFCAVFLFLI------FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNN  240
            ST+   S   V LFL+      F   E +DPLDP GNITIKWDVM W  DGY+A VTM N
Sbjct  7    STIGSRSVFVVLLFLLISCSTLFTSTEAYDPLDPNGNITIKWDVMGWNPDGYIAIVTMYN  66

Query  241  FQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLP  420
            FQ YR I  PGWTLGW+WAKKEVIW+++G+Q TEQGDCSKFK  +PHCCKK PT+VDLLP
Sbjct  67   FQQYRHIQEPGWTLGWTWAKKEVIWNMMGSQTTEQGDCSKFKAGIPHCCKKDPTVVDLLP  126

Query  421  GVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGY  600
            G PYNQQ +NCCKGG++ SW +DPS +VS+FQ+SVG AGT+NKTVKLP NFTL  PGPGY
Sbjct  127  GTPYNQQIANCCKGGILNSWAQDPSNAVSSFQISVGSAGTTNKTVKLPRNFTLRAPGPGY  186

Query  601  TCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            TCGPAKIV  T F+T D+RR TQALMTWNVTCT
Sbjct  187  TCGPAKIVRPTQFITTDKRRVTQALMTWNVTCT  219



>gb|KHN19598.1| Protein COBRA [Glycine soja]
Length=456

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  127  FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKE  306
            F   E +DPLDP GNITIKWDV+SWT DGYVA VTM NFQ YR I +PGW+LGW+WAKKE
Sbjct  32   FTSIEAYDPLDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKE  91

Query  307  VIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGE  486
            VIWS++GAQ TEQGDCSKFK  +PHCCKK PT+VDLLPG PYNQQ +NCCKGGV+ SWG+
Sbjct  92   VIWSMMGAQTTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQ  151

Query  487  DPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKT  666
            DPS +VS+FQ+SVG AGT+NKTVK+P NFTL  PGPGYTCGPAK+V  TVF+T D+RR T
Sbjct  152  DPSNAVSSFQISVGSAGTTNKTVKMPKNFTLKAPGPGYTCGPAKVVKPTVFITNDKRRTT  211

Query  667  QALMTWNVTCT  699
            QA+MTWN+TCT
Sbjct  212  QAMMTWNITCT  222



>ref|XP_011014071.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
Length=434

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 171/202 (85%), Gaps = 1/202 (0%)
 Frame = +1

Query  94   LSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            L F A+FL L F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M PG
Sbjct  6    LFFIALFLVL-FSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKPG  64

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPG P+NQQF NC
Sbjct  65   WTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGAPFNQQFGNC  124

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CKGGVVA+WG+DPSA+VS FQ++VGL+GTSNKTVKLP  FTL+GPGPGYTCGP K+VPST
Sbjct  125  CKGGVVAAWGQDPSAAVSQFQITVGLSGTSNKTVKLPKRFTLLGPGPGYTCGPPKMVPST  184

Query  634  VFLTADRRRKTQALMTWNVTCT  699
             FLT D  R+TQAL+TWNVTCT
Sbjct  185  KFLTPDGLRRTQALLTWNVTCT  206



>ref|XP_008393240.1| PREDICTED: protein COBRA-like [Malus domestica]
Length=456

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 177/220 (80%), Gaps = 5/220 (2%)
 Frame = +1

Query  55   QPKHFGSPSTLAKL-SFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYV  219
            +P  F +  ++AKL SF  +  FL+    F   E +D LDP GNITIKWDV+SWT DGYV
Sbjct  2    EPXCFSAVGSIAKLTSFTILLAFLLSCFTFTSTEAYDALDPTGNITIKWDVISWTPDGYV  61

Query  220  AAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTP  399
            A VTM NFQ YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCSK+KGNVPHCCKK P
Sbjct  62   AVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKYKGNVPHCCKKDP  121

Query  400  TIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTL  579
            T+VDLLPG PYNQQ +NCCKGGV+ SW +DP  ++S+FQVSVG AGT+NKTV+LP NFTL
Sbjct  122  TVVDLLPGTPYNQQIANCCKGGVMQSWIQDPPNAISSFQVSVGAAGTTNKTVRLPKNFTL  181

Query  580  MGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
              PGPGY+CG AKIV  T FLT+D+RR TQA+MTWNVTCT
Sbjct  182  RAPGPGYSCGIAKIVKPTRFLTSDKRRWTQAMMTWNVTCT  221



>gb|KEH38143.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=442

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +1

Query  85   LAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            L  ++F A+ L LI P AE FDPLDP GN+TI+WD+MSWT+DGY+A VT+ NFQ+YR IM
Sbjct  6    LKLVAFFALCLILISP-AEAFDPLDPTGNVTIRWDIMSWTSDGYMATVTLFNFQLYRNIM  64

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGWTLGW+WAKKE+IW+++GAQATEQGDCSKFK  +PH CK++P +VDLLPG  YN Q+
Sbjct  65   NPGWTLGWTWAKKEIIWAMMGAQATEQGDCSKFKLKIPHSCKRSPQVVDLLPGASYNMQY  124

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCCKGGV+ SWG+DPS ++SAFQ+ VGL+G +NKTVKLP +F L+GPG GY+CGPAK V
Sbjct  125  TNCCKGGVLTSWGQDPSGAISAFQMGVGLSGRTNKTVKLPQDFKLLGPGAGYSCGPAKRV  184

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
            PSTV LT DRRRK QALM+WNVTCT
Sbjct  185  PSTVILTDDRRRKAQALMSWNVTCT  209



>ref|XP_007208787.1| hypothetical protein PRUPE_ppa024172mg [Prunus persica]
 gb|EMJ09986.1| hypothetical protein PRUPE_ppa024172mg [Prunus persica]
Length=447

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 177/220 (80%), Gaps = 5/220 (2%)
 Frame = +1

Query  55   QPKHFGSPSTLAKLS-FCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYV  219
            +P+      ++ KLS F  + +FL+    F   E +D LDP GNITIKWDV+SWT DGYV
Sbjct  2    EPRCLSDTGSIVKLSSFAILLVFLLSCFSFTSTEAYDALDPTGNITIKWDVISWTPDGYV  61

Query  220  AAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTP  399
            A VTM NFQ YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCS++KGNVPHCCKK P
Sbjct  62   AVVTMFNFQQYRHIQTPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSRYKGNVPHCCKKDP  121

Query  400  TIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTL  579
            T+VDLLPG PYNQQ +NCCKGGV+ SW +DP+ ++S+FQ+SVG AGT+NKTV+LP NFTL
Sbjct  122  TVVDLLPGTPYNQQIANCCKGGVMNSWIQDPANAISSFQISVGAAGTTNKTVRLPKNFTL  181

Query  580  MGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
              PGPGY+CG AKIV  T FLTAD+RR TQA+MTWNVTCT
Sbjct  182  KAPGPGYSCGIAKIVKPTRFLTADKRRWTQAMMTWNVTCT  221



>ref|XP_010087346.1| hypothetical protein L484_012679 [Morus notabilis]
 gb|EXB28920.1| hypothetical protein L484_012679 [Morus notabilis]
Length=449

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +1

Query  139  EPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWS  318
            E +D LDP GNITIKWDVMSWT DGYVA VTM NFQ YR I +PGWTLGW+WAKKEVIWS
Sbjct  27   EAYDALDPTGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWS  86

Query  319  IVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSA  498
            +VGAQ TEQGDCS+FKGNVPHCCKK PT+VDLLPG  YNQQ +NCCKGGV+ SW +DP+ 
Sbjct  87   MVGAQTTEQGDCSRFKGNVPHCCKKDPTVVDLLPGTAYNQQIANCCKGGVLNSWVQDPAN  146

Query  499  SVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALM  678
            + S+FQ+SVG AGT+NKTVKLP NFTL  PGPGYTCGPAKIV +T F+TAD+RR TQALM
Sbjct  147  AASSFQISVGAAGTTNKTVKLPKNFTLKAPGPGYTCGPAKIVRATKFITADKRRVTQALM  206

Query  679  TWNVTCT  699
            TWNVTCT
Sbjct  207  TWNVTCT  213



>ref|XP_010037254.1| PREDICTED: protein COBRA-like [Eucalyptus grandis]
 gb|KCW48926.1| hypothetical protein EUGRSUZ_K02540 [Eucalyptus grandis]
Length=458

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  130  PHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEV  309
            P AE +D LDP GNITIKWDV+SWT DGYVA VTM NFQ YR I SPGWTLGW+WAKKEV
Sbjct  33   PSAEAYDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQSPGWTLGWTWAKKEV  92

Query  310  IWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGED  489
            IWS++G+Q TEQGDCS++KGN PHCCKK PT+VDLLPG PYNQQ +NCCKGGV+ SW +D
Sbjct  93   IWSMMGSQTTEQGDCSRYKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQD  152

Query  490  PSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQ  669
            P+ + S+FQVSVG AGTSNKTV+LP NFTL  PGPGYTCGPAKIV ST F++AD+RR TQ
Sbjct  153  PANAASSFQVSVGAAGTSNKTVRLPKNFTLKAPGPGYTCGPAKIVRSTKFVSADKRRTTQ  212

Query  670  ALMTWNVTCT  699
            ALMTWNVTCT
Sbjct  213  ALMTWNVTCT  222



>ref|XP_011014072.1| PREDICTED: COBRA-like protein 1 [Populus euphratica]
Length=453

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 171/204 (84%), Gaps = 4/204 (2%)
 Frame = +1

Query  100  FCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMS  267
            F  + LF++    F   E +DPLDP GNITIKWD++SWTADGYVA VT+ NFQ YR I +
Sbjct  15   FTVLLLFVLWCASFTATEAYDPLDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQA  74

Query  268  PGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFS  447
            PGW+LGW+WAKKEVIWS++G QATEQGDCSKFKGN+PHCCKK+PT+VDLLPG+PYNQQ +
Sbjct  75   PGWSLGWTWAKKEVIWSMLGGQATEQGDCSKFKGNIPHCCKKSPTVVDLLPGIPYNQQTA  134

Query  448  NCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVP  627
            NCCKGGV++SW +DP+ + S+FQ+SVG AGTSNKTV+LP NFTL  PGPGYTC  AKIV 
Sbjct  135  NCCKGGVISSWAQDPANAASSFQLSVGSAGTSNKTVRLPKNFTLKAPGPGYTCARAKIVK  194

Query  628  STVFLTADRRRKTQALMTWNVTCT  699
             T F++ D+RR TQALMTWNVTCT
Sbjct  195  PTRFMSTDKRRITQALMTWNVTCT  218



>ref|XP_002306058.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
 gb|EEE86569.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
Length=433

 Score =   314 bits (805),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  4    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  63

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPG P+NQQF N
Sbjct  64   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGAPFNQQFGN  123

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA+VS FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  124  CCKGGVVAAWGKDPSAAVSQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  183

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  184  TKFLTPDGLRRTQALLTWNVTCT  206



>ref|XP_008240087.1| PREDICTED: protein COBRA-like isoform X1 [Prunus mume]
Length=456

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 175/220 (80%), Gaps = 5/220 (2%)
 Frame = +1

Query  55   QPKHFGSPSTLAKLSFCAVFLFL-----IFPHAEPFDPLDPFGNITIKWDVMSWTADGYV  219
            +P++     ++ KLS  A+ L        F   E +D LDP GNITIKWDV+SWT DGYV
Sbjct  2    EPRYLSDTGSIVKLSSFAILLVFWLSCFSFTSTEAYDALDPTGNITIKWDVISWTPDGYV  61

Query  220  AAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTP  399
            A VTM NFQ YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCS++KGNVPHCCKK P
Sbjct  62   AVVTMFNFQQYRHIQTPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSRYKGNVPHCCKKDP  121

Query  400  TIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTL  579
            T+VDLLPG PYNQQ +NCCKGGV+ SW +DP+ ++S+FQ+SVG AGT+NKTV++P NFTL
Sbjct  122  TVVDLLPGTPYNQQIANCCKGGVMNSWIQDPANAISSFQISVGAAGTTNKTVRMPKNFTL  181

Query  580  MGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
              PGPGY+CG AKIV  T FLTAD+RR TQA+MTWNVTCT
Sbjct  182  KAPGPGYSCGIAKIVKPTRFLTADKRRWTQAMMTWNVTCT  221



>gb|ADE67032.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   314 bits (804),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+GW+WAKKE+IWSI GAQA EQGDCSKFK N+PH C+++P +VDLLPG P+NQQF N
Sbjct  62   GWTIGWTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCRRSPAVVDLLPGAPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>ref|XP_010546210.1| PREDICTED: protein COBRA-like [Tarenaya hassleriana]
Length=455

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 172/212 (81%), Gaps = 5/212 (2%)
 Frame = +1

Query  79   STLAKLSFCAVF-LFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNF  243
            ST++K  F A++ +FLI    F   E +D LDP GNITIKWDVMSWT DGYVA VTM NF
Sbjct  10   STISKFGFLAIWVMFLISSTSFTSTEAYDALDPEGNITIKWDVMSWTPDGYVAVVTMYNF  69

Query  244  QMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPG  423
            Q YR I SPGWT+GW WAKKEVIWS+VG Q TEQGDCSK+KGN PHCCKK PT+VDLLPG
Sbjct  70   QKYRHIQSPGWTMGWKWAKKEVIWSMVGGQTTEQGDCSKYKGNTPHCCKKDPTVVDLLPG  129

Query  424  VPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYT  603
             PYNQQ +NCC+GGV+ SW +DPS + S+FQ+SVG AGT+NKTV++P NFTLM PGPGYT
Sbjct  130  TPYNQQIANCCRGGVLNSWVQDPSTAASSFQISVGAAGTTNKTVRVPRNFTLMAPGPGYT  189

Query  604  CGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            CGPAK+   T F+T+D RR TQA+MTWNVTCT
Sbjct  190  CGPAKVGRPTQFVTSDSRRTTQAMMTWNVTCT  221



>ref|XP_003527117.1| PREDICTED: protein COBRA [Glycine max]
Length=456

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  127  FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKE  306
            F   E +DPLDP GNITIKWDV+SWT DGYVA VTM NFQ YR I +PGW+LGW+WAKKE
Sbjct  32   FTSIEAYDPLDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKE  91

Query  307  VIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGE  486
            VIW+++GAQ TEQGDCSKFK  +PHCCKK PT+VDLLPG PYNQQ +NCCKGGV+ SWG+
Sbjct  92   VIWNMMGAQTTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQ  151

Query  487  DPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKT  666
            DPS +VS+FQ+SVG AGT+NKTVK+P NFTL  PGPGYTCGPAK+V  TVF+T D+RR T
Sbjct  152  DPSNAVSSFQISVGSAGTTNKTVKMPKNFTLKAPGPGYTCGPAKVVKPTVFITNDKRRTT  211

Query  667  QALMTWNVTCT  699
            QA+MTWN+TCT
Sbjct  212  QAMMTWNITCT  222



>ref|XP_009616573.1| PREDICTED: protein COBRA-like [Nicotiana tomentosiformis]
Length=452

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 171/211 (81%), Gaps = 5/211 (2%)
 Frame = +1

Query  82   TLAKLSFCAVFLFLI-----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            +L + +  AV L  +     F   + FDPLDP GNITIKWDV+SWT DGYVA VTM NFQ
Sbjct  6    SLPRFTATAVLLVFLLSCFSFKSTDAFDPLDPNGNITIKWDVISWTPDGYVAVVTMFNFQ  65

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGWTLGW+WAKKEVIW+++GAQ TEQGDCSKFKGN+PHCCKK PTIVDLLPG 
Sbjct  66   QYRHIQAPGWTLGWTWAKKEVIWNMMGAQTTEQGDCSKFKGNIPHCCKKDPTIVDLLPGT  125

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+ SWG+D + +VS+FQVSVG AGT+NKTV++P NFTL  PGPGYTC
Sbjct  126  PYNQQIANCCKGGVINSWGQDTATAVSSFQVSVGAAGTTNKTVRVPKNFTLKAPGPGYTC  185

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPAKIV  T F+T D RR TQA+MTWNVTCT
Sbjct  186  GPAKIVKPTKFVTQDGRRVTQAMMTWNVTCT  216



>ref|XP_007037617.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 2 [Theobroma cacao]
 gb|EOY22118.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 2 [Theobroma cacao]
Length=456

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 171/212 (81%), Gaps = 2/212 (1%)
 Frame = +1

Query  70   GSPSTLAKLSFCAVFLFL--IFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNF  243
            GS S L   +   +FLF    F   E +D LDP GN+TIKWDV+SWT DGYVA VT+ NF
Sbjct  10   GSISKLCSFTIVLLFLFSCSTFTSTEAYDALDPTGNVTIKWDVISWTPDGYVAVVTIYNF  69

Query  244  QMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPG  423
            Q YR I +PGWTLGW+WAKKEVIWS++GAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG
Sbjct  70   QQYRHIQAPGWTLGWTWAKKEVIWSMMGAQTTEQGDCSKFKGNIPHCCKKDPTVVDLLPG  129

Query  424  VPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYT  603
             PYNQQ +NCCKGGV+ SW +DP+ + S+FQVSVG AGT+NKTV++P NFTL  PGPGYT
Sbjct  130  TPYNQQIANCCKGGVINSWVQDPANAASSFQVSVGAAGTTNKTVRVPRNFTLRAPGPGYT  189

Query  604  CGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            CGPAKIV  T F+T D+RR TQA+MTWNVTCT
Sbjct  190  CGPAKIVRPTKFVTPDKRRITQAMMTWNVTCT  221



>emb|CDX87193.1| BnaC09g05080D [Brassica napus]
Length=456

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = +1

Query  91   KLSFCAVFL-FLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYR  255
            K+SF AV + FLI        E +D LDP GNIT+KWDVMSWT DGYVA VTM NFQ YR
Sbjct  14   KMSFLAVLVVFLISSSYITSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYR  73

Query  256  AIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYN  435
             I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLLPG PYN
Sbjct  74   HIPSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYN  133

Query  436  QQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPA  615
            QQ +NCCKGGV+ SW +DP  + S+FQ+SVG AGT+NKTV++P NFTLMGPGPGYTCGPA
Sbjct  134  QQIANCCKGGVLNSWVQDPGNAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPGYTCGPA  193

Query  616  KIVPSTVFLTADRRRKTQALMTWNVTCT  699
            K+V  T F+T D RR TQA+MTWN+TCT
Sbjct  194  KVVRPTKFVTTDTRRTTQAMMTWNITCT  221



>emb|CDY16831.1| BnaA09g05510D [Brassica napus]
Length=458

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 170/208 (82%), Gaps = 5/208 (2%)
 Frame = +1

Query  91   KLSFCAVFL-FLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYR  255
            K+SF AV + FLI        E +D LDP GNIT+KWDVMSWT DGYVA VTM NFQ YR
Sbjct  14   KMSFLAVLVVFLISSSYITSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYR  73

Query  256  AIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYN  435
             I SPGWTLGW WAKKEVIWS+VGAQ TEQGDCSK+KGN+PHCCKK PT+VDLLPG PYN
Sbjct  74   HIPSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYN  133

Query  436  QQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPA  615
            QQ +NCCKGGV+ SW +DP  + S+FQ+SVG AGT+NKTV++P NFTLMGPGPGYTCGPA
Sbjct  134  QQIANCCKGGVLNSWVQDPGNAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPGYTCGPA  193

Query  616  KIVPSTVFLTADRRRKTQALMTWNVTCT  699
            K+V  T F+T D RR TQA+MTWN+TCT
Sbjct  194  KVVRPTKFVTTDTRRTTQAMMTWNITCT  221



>ref|XP_004299285.1| PREDICTED: protein COBRA-like [Fragaria vesca subsp. vesca]
Length=456

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 171/211 (81%), Gaps = 5/211 (2%)
 Frame = +1

Query  82   TLAKLSFCAVFLF-----LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            ++AKLS   + LF     L F   E +D LDP GN+TIKWDV+SWT DGYVA VTM NFQ
Sbjct  11   SIAKLSSFTILLFFLVSSLTFTSTEAYDALDPLGNVTIKWDVISWTPDGYVAVVTMFNFQ  70

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCS++KGNVPHCCKK PT+VDLLPG 
Sbjct  71   QYRHIQAPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSRYKGNVPHCCKKDPTVVDLLPGT  130

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+ SW +DP  +VS+FQVSVG AGT+NKTV+LP NFTL  PGPGY+C
Sbjct  131  PYNQQIANCCKGGVMQSWIQDPGNAVSSFQVSVGAAGTTNKTVRLPKNFTLKAPGPGYSC  190

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            G A IV  T +LTAD+RR TQA+MTWN+TCT
Sbjct  191  GRAAIVKPTRYLTADKRRWTQAMMTWNITCT  221



>gb|AFK33956.1| unknown [Lotus japonicus]
Length=454

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 179/222 (81%), Gaps = 4/222 (2%)
 Frame = +1

Query  34   LENMYSQQPKHFGSPSTLAKLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADG  213
            L+N   QQ   F     L  +SF  + L LI P A+ FDPLDP GN+TI+WD+MSWT+DG
Sbjct  3    LDNGKKQQSCTF---EKLKLVSFITLCLILISP-ADAFDPLDPTGNVTIRWDIMSWTSDG  58

Query  214  YVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKK  393
            Y+A VT+ NFQ+YR IM+PGW LGW+WAKKEVI +++GAQATEQGDCSKFK  +PH CK+
Sbjct  59   YMATVTLFNFQLYRNIMNPGWNLGWTWAKKEVIMAMMGAQATEQGDCSKFKLKIPHSCKR  118

Query  394  TPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNF  573
             P +VDLLPG  +N Q++NCCKGGV+ SWG+DPS +VSAFQ++VGL+GTSNKTVKLP NF
Sbjct  119  NPQVVDLLPGASFNMQYTNCCKGGVLTSWGQDPSGTVSAFQMAVGLSGTSNKTVKLPKNF  178

Query  574  TLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
             L+GPGPGY+CGPAK+VPSTV  T D RRK QALM+WNVTCT
Sbjct  179  KLLGPGPGYSCGPAKMVPSTVIPTDDHRRKAQALMSWNVTCT  220



>ref|XP_009151763.1| PREDICTED: COBRA-like protein 2 [Brassica rapa]
 emb|CDX86358.1| BnaA06g30750D [Brassica napus]
Length=436

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 170/202 (84%), Gaps = 4/202 (2%)
 Frame = +1

Query  106  AVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
             +FLFL+    F   E +D LDP GNITIKWD++SWTADGYVA V++ NFQ YR I +PG
Sbjct  10   VLFLFLLSWTSFTSTEAYDALDPTGNITIKWDIISWTADGYVAVVSIFNFQQYRHIQAPG  69

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            W LGWSW KKEVIWS+VGAQATEQGDCSKFKGN+PHCCKKTPT+VDLLPG PYNQQ SNC
Sbjct  70   WQLGWSWYKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKKTPTVVDLLPGTPYNQQISNC  129

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            C+GGV++SW +DP+ +VS+FQ+SVG +GT+N TV+ P N TL  PGPGYTCGPAK+VP T
Sbjct  130  CRGGVISSWAQDPATAVSSFQISVGQSGTTNTTVRAPRNVTLKAPGPGYTCGPAKVVPPT  189

Query  634  VFLTADRRRKTQALMTWNVTCT  699
             F++ D+RRKTQA++TWN+TCT
Sbjct  190  KFISNDKRRKTQAMLTWNMTCT  211



>ref|XP_011099166.1| PREDICTED: protein COBRA-like [Sesamum indicum]
Length=520

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 178/228 (78%), Gaps = 8/228 (4%)
 Frame = +1

Query  31   GLENMYSQQPKHFGSPSTLAKLSFCAVFLFLI-----FPHAEPFDPLDPFGNITIKWDVM  195
            G EN+  +    F S   L ++S  A+ LF +     F   + +D LDP GNITIKWDV+
Sbjct  43   GQENLLREMELCFRS---LLRVSNSAILLFFLVSCFSFTSTDAYDALDPNGNITIKWDVI  99

Query  196  SWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNV  375
            SWT DGYVA VT+ NFQ YR I +PGWTLGW+WAKKEVIWS++G Q TEQGDCS+FKGN+
Sbjct  100  SWTPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGGQTTEQGDCSRFKGNI  159

Query  376  PHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTV  555
            PHCCKK PT+VDLLPG PYNQQ +NCCKGGV+ SWG+DP+++ S+FQ+SVG AGT+NKTV
Sbjct  160  PHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDPTSAASSFQLSVGAAGTTNKTV  219

Query  556  KLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            ++P NFTL  PGPGYTCGPAKIV  T F+T D RR TQA+MTWNVTCT
Sbjct  220  RVPKNFTLKAPGPGYTCGPAKIVKPTKFVTQDGRRVTQAMMTWNVTCT  267



>ref|XP_007138374.1| hypothetical protein PHAVU_009G203100g [Phaseolus vulgaris]
 gb|ESW10368.1| hypothetical protein PHAVU_009G203100g [Phaseolus vulgaris]
Length=452

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +1

Query  139  EPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWS  318
            E +DPLDP GNITIKWDV+SWTADGYVA VTM NFQ YR I +PGW+LGW+WAKKEVIWS
Sbjct  35   EAYDPLDPTGNITIKWDVISWTADGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWS  94

Query  319  IVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSA  498
            ++G+Q TEQGDCSKFK  +PHCCKK PT+VDLLPG PYNQQ +NCCKGGV+ SWG+DP +
Sbjct  95   MMGSQTTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDPGS  154

Query  499  SVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALM  678
            +VS+FQ+SVG +GT+NKTVK+P NFTL  PGPGYTCGPAKIV  T F+T D+RR TQA+M
Sbjct  155  AVSSFQISVGSSGTTNKTVKMPKNFTLKAPGPGYTCGPAKIVKPTTFITNDKRRTTQAMM  214

Query  679  TWNVTCT  699
            TWN+TCT
Sbjct  215  TWNITCT  221



>gb|KHG07280.1| COBRA-like protein 1 [Gossypium arboreum]
 gb|KHG08968.1| COBRA-like protein 1 [Gossypium arboreum]
Length=450

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  97   SFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            SF  + LFLI    FP  E +DPLDP GNITIKWD+MSWT+DGYVA VT+ NFQ YR I 
Sbjct  17   SFSLLILFLISCSSFPSTEAYDPLDPNGNITIKWDIMSWTSDGYVAVVTIYNFQQYRHIQ  76

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGW LGW+WAKKEVIWS++G + TEQGDCS+FKGN+PHCC K PT+VDLLPG PYNQQ 
Sbjct  77   APGWKLGWTWAKKEVIWSMMGGETTEQGDCSRFKGNIPHCCNKHPTVVDLLPGTPYNQQI  136

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCCKGGV+ SW +DP+ + S+FQ+SVG +GT+NKTV++P NFTL  PGPGYTCGPAKIV
Sbjct  137  ANCCKGGVLNSWAQDPATAASSFQLSVGQSGTTNKTVRVPVNFTLKAPGPGYTCGPAKIV  196

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
              + F+T D RR+TQA+MTWNVTCT
Sbjct  197  KPSRFVTPDGRRETQAMMTWNVTCT  221



>ref|XP_002305390.1| phytochelatin synthetase family protein [Populus trichocarpa]
 gb|EEE85901.1| phytochelatin synthetase family protein [Populus trichocarpa]
Length=453

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 170/204 (83%), Gaps = 4/204 (2%)
 Frame = +1

Query  100  FCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMS  267
            F  + LF++    F   E +DPLDP GNITIKWD++SWTADGYVA VT+ NFQ YR I +
Sbjct  15   FTVLLLFVLWCASFTSTEAYDPLDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQA  74

Query  268  PGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFS  447
            PGW+LGW+WAKKEVIWS++G QAT+QGDCSKFKGNVPHCCKK+PT+VDLLPG PYNQQ +
Sbjct  75   PGWSLGWTWAKKEVIWSMLGGQATDQGDCSKFKGNVPHCCKKSPTVVDLLPGTPYNQQTA  134

Query  448  NCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVP  627
            NCCKGGV++SW +DP+ + S+FQ+SVG AGTSNKTV+LP NFTL  PGPGYTC  AKIV 
Sbjct  135  NCCKGGVISSWAQDPANAASSFQLSVGSAGTSNKTVRLPKNFTLKAPGPGYTCARAKIVK  194

Query  628  STVFLTADRRRKTQALMTWNVTCT  699
             T F++ D+RR TQALMTWNVTCT
Sbjct  195  PTRFMSTDKRRITQALMTWNVTCT  218



>emb|CDP19973.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   305 bits (781),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 167/210 (80%), Gaps = 5/210 (2%)
 Frame = +1

Query  82   TLAKLSFCAVFLFLI-----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            +L+K + CA+ + L      F   E +D LDP GNITIKWDV++WT DGYVA VTM NFQ
Sbjct  8    SLSKFTACAIVVLLSLSCFSFTTTEAYDALDPNGNITIKWDVITWTPDGYVAVVTMFNFQ  67

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCS+FK N PHCCKK PT+VDLLPG 
Sbjct  68   QYRRIQAPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSRFKLNTPHCCKKDPTVVDLLPGT  127

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+  W +DP+ +VSAFQVSVG +GT+NKTV++P NFTL  PGPGYTC
Sbjct  128  PYNQQIANCCKGGVLNPWVQDPATAVSAFQVSVGSSGTTNKTVRMPKNFTLKAPGPGYTC  187

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTC  696
            GPAK+   T F TAD RR TQA+MTWNVTC
Sbjct  188  GPAKVGKPTKFFTADGRRTTQAMMTWNVTC  217



>ref|XP_004491893.1| PREDICTED: protein COBRA-like [Cicer arietinum]
Length=446

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 169/201 (84%), Gaps = 4/201 (2%)
 Frame = +1

Query  109  VFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGW  276
            +FLFL+    F   + +DPLDP GNITIKWD+++WT DGYVA VT+NNFQ YR I +PGW
Sbjct  12   LFLFLLSSSCFTSTDAYDPLDPNGNITIKWDIITWTPDGYVAVVTVNNFQQYRHIAAPGW  71

Query  277  TLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCC  456
            +LGW+WAKKEVIW +VG+Q TEQGDCSKFKGNVPHCCKK PT+VDLLPG PYNQQ +NCC
Sbjct  72   SLGWTWAKKEVIWGMVGSQTTEQGDCSKFKGNVPHCCKKDPTVVDLLPGTPYNQQIANCC  131

Query  457  KGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTV  636
            KGGV++SW +DP+ +V +FQ+SVG AGT+NKTVK+P NFTL  PGPGYTCGPAK+V  T 
Sbjct  132  KGGVLSSWAQDPTNAVGSFQISVGRAGTTNKTVKVPKNFTLKAPGPGYTCGPAKVVRPTQ  191

Query  637  FLTADRRRKTQALMTWNVTCT  699
            F+  D+RR TQALMTWNVTCT
Sbjct  192  FIQPDKRRVTQALMTWNVTCT  212



>gb|ADE67036.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   311 bits (798),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  91   KLSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP  270
            +  F  V   ++F  +  +DPLDP GN+TIKWD+MSWT DGY+A VT+ NFQ +R  M P
Sbjct  2    RFLFFIVLFLVLFSCSGAYDPLDPTGNVTIKWDIMSWTTDGYIAIVTLFNFQTFRHFMKP  61

Query  271  GWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSN  450
            GWT+G +WAKKE+IWSI GAQA EQGDCSKFK N+PH CK++P +VDLLPGVP+NQQF N
Sbjct  62   GWTIGCTWAKKEIIWSINGAQAVEQGDCSKFKANIPHSCKRSPAVVDLLPGVPFNQQFGN  121

Query  451  CCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPS  630
            CCKGGVVA+WG+DPSA++S FQ++VGL+GTSNKTVKLP +FTL+GPGPGYTCGP K+VPS
Sbjct  122  CCKGGVVAAWGQDPSAAISQFQITVGLSGTSNKTVKLPKSFTLLGPGPGYTCGPPKMVPS  181

Query  631  TVFLTADRRRKTQALMTWNVTCT  699
            T FLT D  R+TQAL+TWNVTCT
Sbjct  182  TKFLTPDGLRRTQALLTWNVTCT  204



>ref|XP_007139435.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris]
 gb|AAR13304.1| phytochelatin synthetase-like protein [Phaseolus vulgaris]
 gb|ESW11429.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris]
Length=448

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 169/210 (80%), Gaps = 4/210 (2%)
 Frame = +1

Query  79   STLAKLSFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            S L K + C + L L+    F   + +DPLDP GNITIKWD+++WT DGYVA VTMNNFQ
Sbjct  4    SLLPKATPCILLLVLLYCTCFTSTDAYDPLDPNGNITIKWDIITWTPDGYVAVVTMNNFQ  63

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I SPGW LGW+WAKKEVIWS++G Q TEQGDCSKFK  +PHCCKK PT+VDLLPG 
Sbjct  64   QYRHIASPGWRLGWTWAKKEVIWSMMGGQTTEQGDCSKFKAGIPHCCKKDPTVVDLLPGT  123

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+ SW +DP+ +VS+FQVSVG AGT+NKTVK+P NFTL  PGPGYTC
Sbjct  124  PYNQQIANCCKGGVLGSWVQDPTNAVSSFQVSVGRAGTTNKTVKVPKNFTLSAPGPGYTC  183

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTC  696
            GPAKIV  T F+ AD+RR TQALMTWNVTC
Sbjct  184  GPAKIVKPTQFIQADKRRVTQALMTWNVTC  213



>ref|XP_008453302.1| PREDICTED: protein COBRA-like [Cucumis melo]
Length=455

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +1

Query  139  EPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWS  318
            E +D LDP GNITIKWDVMSWT DGYVA VTM NFQ YR I +PGWTLGW+WAKKEVIWS
Sbjct  35   EAYDALDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  319  IVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSA  498
            ++G Q TEQGDCS+FKGN PHCCKK PT+VDLLPG PYNQQ +NCCKGGV+ SW +DP+ 
Sbjct  95   MMGGQTTEQGDCSRFKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPAN  154

Query  499  SVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALM  678
            + S+FQVSVG AGTSNKTVKLP NFTL  PGPGYTCGPAKIV  T F++ D+RR TQALM
Sbjct  155  AASSFQVSVGAAGTSNKTVKLPKNFTLKAPGPGYTCGPAKIVRPTKFVSGDKRRVTQALM  214

Query  679  TWNVTCT  699
            TWNVTCT
Sbjct  215  TWNVTCT  221



>ref|XP_004488434.1| PREDICTED: COBRA-like protein 4-like isoform X2 [Cicer arietinum]
Length=449

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 173/202 (86%), Gaps = 1/202 (0%)
 Frame = +1

Query  94   LSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            +SF A+ L L+ P A+ FDPLDP GN+TI+WD+MSWT+DGY+A VT+ NFQ+YR IM+PG
Sbjct  20   VSFVALCLILVSP-ADAFDPLDPTGNVTIRWDIMSWTSDGYMATVTLFNFQLYRNIMNPG  78

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WTLGW+WAKKE+IW+++GAQATEQGDC+KFK  +PH CK++P +VDLLPG  YN Q++NC
Sbjct  79   WTLGWTWAKKEIIWAMMGAQATEQGDCAKFKLKIPHSCKRSPQVVDLLPGASYNMQYTNC  138

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CKGGV+ SWG+DP+ ++SAFQ+ VGL+G SNKTVKLP +F L+GPGPGY+CGPAK VPST
Sbjct  139  CKGGVLTSWGQDPTGAISAFQMGVGLSGRSNKTVKLPKDFKLLGPGPGYSCGPAKRVPST  198

Query  634  VFLTADRRRKTQALMTWNVTCT  699
            V  T D RRK QALM+WNVTCT
Sbjct  199  VIFTDDHRRKAQALMSWNVTCT  220



>ref|XP_006440800.1| hypothetical protein CICLE_v10023912mg [Citrus clementina]
 gb|ESR54040.1| hypothetical protein CICLE_v10023912mg [Citrus clementina]
Length=438

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +D LDP G+I IKWDVMSWTADGYVA VTM NFQMYR IM PGWTLGW+WAKKEVIWS+V
Sbjct  26   YDSLDPHGSINIKWDVMSWTADGYVALVTMTNFQMYRHIMEPGWTLGWTWAKKEVIWSMV  85

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFK N+PH C K PT+VDLLPGVPYNQQ +NCCKGGVV SWG+DPSA+V
Sbjct  86   GAQATEQGDCSKFKINIPHSCMKNPTVVDLLPGVPYNQQIANCCKGGVVGSWGQDPSAAV  145

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S+FQ+SVG +G+SNKTV+LP NFTL+GPG GYTC  AK V  T F++AD RR+TQA+MTW
Sbjct  146  SSFQLSVGRSGSSNKTVRLPKNFTLLGPGRGYTCSQAKNVLPTAFISADGRRRTQAMMTW  205

Query  685  NVTCT  699
            NVTCT
Sbjct  206  NVTCT  210



>ref|XP_002321786.2| phytochelatin synthetase family protein [Populus trichocarpa]
 gb|ABK92936.1| unknown [Populus trichocarpa]
 gb|EEF05913.2| phytochelatin synthetase family protein [Populus trichocarpa]
Length=457

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 168/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  97   SFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            +F  + LFLI        E +D LDP GNITIKWDV+ WT DGYVA VTM NFQ YR I 
Sbjct  17   AFTILLLFLISCSTLTSTEAYDALDPNGNITIKWDVIQWTPDGYVAVVTMYNFQQYRHIQ  76

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGWTLGW+WAKKEVIW+++GAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG PYNQQ 
Sbjct  77   APGWTLGWTWAKKEVIWNMMGAQTTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQI  136

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCCKGGV+ SW +DP+ +VS+FQ+SVG AGT+NKTV++P N TL  PGPGYTCGPAKIV
Sbjct  137  ANCCKGGVINSWAQDPANAVSSFQISVGAAGTTNKTVRVPKNITLKAPGPGYTCGPAKIV  196

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
              T F++AD+RR TQALMTWN+TCT
Sbjct  197  RPTKFISADKRRITQALMTWNITCT  221



>ref|XP_011006295.1| PREDICTED: protein COBRA-like [Populus euphratica]
Length=458

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 168/205 (82%), Gaps = 4/205 (2%)
 Frame = +1

Query  97   SFCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIM  264
            +F  + LFLI        E +D LDP GNITIKWDV+ WT DGYVA VTM NFQ YR I 
Sbjct  17   AFTILLLFLISCSTLTSTEAYDALDPNGNITIKWDVIQWTPDGYVAVVTMYNFQQYRHIQ  76

Query  265  SPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQF  444
            +PGWTLGW+WAKKEVIW+++GAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG PYNQQ 
Sbjct  77   APGWTLGWTWAKKEVIWNMMGAQTTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQI  136

Query  445  SNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIV  624
            +NCCKGGV+ SW +DP+ +VS+FQ+SVG AGT+NKTV++P N TL  PGPGYTCGPAKIV
Sbjct  137  ANCCKGGVINSWAQDPANAVSSFQISVGAAGTTNKTVRVPKNITLRAPGPGYTCGPAKIV  196

Query  625  PSTVFLTADRRRKTQALMTWNVTCT  699
              T F++AD+RR TQALMTWN+TCT
Sbjct  197  RPTKFISADKRRITQALMTWNITCT  221



>ref|XP_004488433.1| PREDICTED: COBRA-like protein 4-like isoform X1 [Cicer arietinum]
Length=453

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 173/202 (86%), Gaps = 1/202 (0%)
 Frame = +1

Query  94   LSFCAVFLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            +SF A+ L L+ P A+ FDPLDP GN+TI+WD+MSWT+DGY+A VT+ NFQ+YR IM+PG
Sbjct  20   VSFVALCLILVSP-ADAFDPLDPTGNVTIRWDIMSWTSDGYMATVTLFNFQLYRNIMNPG  78

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WTLGW+WAKKE+IW+++GAQATEQGDC+KFK  +PH CK++P +VDLLPG  YN Q++NC
Sbjct  79   WTLGWTWAKKEIIWAMMGAQATEQGDCAKFKLKIPHSCKRSPQVVDLLPGASYNMQYTNC  138

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CKGGV+ SWG+DP+ ++SAFQ+ VGL+G SNKTVKLP +F L+GPGPGY+CGPAK VPST
Sbjct  139  CKGGVLTSWGQDPTGAISAFQMGVGLSGRSNKTVKLPKDFKLLGPGPGYSCGPAKRVPST  198

Query  634  VFLTADRRRKTQALMTWNVTCT  699
            V  T D RRK QALM+WNVTCT
Sbjct  199  VIFTDDHRRKAQALMSWNVTCT  220



>ref|XP_010522480.1| PREDICTED: protein COBRA [Tarenaya hassleriana]
Length=458

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 172/212 (81%), Gaps = 5/212 (2%)
 Frame = +1

Query  79   STLAKLSFCAVFL-FLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNF  243
            ST++K S  A+++ FL+    F   E +D LDP GNITIKWDVMSWT DGYVA VTM NF
Sbjct  10   STISKFSCLAIWVVFLVSSSSFTSTEAYDALDPEGNITIKWDVMSWTPDGYVAVVTMYNF  69

Query  244  QMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPG  423
            Q YR I SPGWTLGW WAKKEVIWS+VG Q TEQGDCSK+KGN+PHCCKK PT+VDLLPG
Sbjct  70   QKYRHIQSPGWTLGWKWAKKEVIWSMVGGQTTEQGDCSKYKGNIPHCCKKDPTVVDLLPG  129

Query  424  VPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYT  603
             PYNQQ +NCC+GGV+ SW +DPS + S+FQ+SVG AGT+NKTV++P NFTL+ PGPGYT
Sbjct  130  TPYNQQIANCCRGGVLNSWVQDPSTAASSFQISVGAAGTTNKTVRVPRNFTLLAPGPGYT  189

Query  604  CGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            CGPAK+   T F+T D RR TQA+MTWNVTCT
Sbjct  190  CGPAKVGKPTKFVTPDSRRTTQAMMTWNVTCT  221



>ref|XP_006291010.1| hypothetical protein CARUB_v10017122mg [Capsella rubella]
 gb|EOA23908.1| hypothetical protein CARUB_v10017122mg [Capsella rubella]
Length=482

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = +1

Query  85   LAKLSFCAVFL--FLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRA  258
            L++LS   +FL  ++ F   E +D LDP GNITIKWD+MSWT DGYVA VT+ NFQ YR 
Sbjct  48   LSRLSVLLLFLCSWISFTTTEAYDALDPNGNITIKWDIMSWTPDGYVAVVTIFNFQQYRH  107

Query  259  IMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQ  438
            I +PGW LGWSW KKEVIWS+VGAQATEQGDCSKFKGN+PHCCKKTP IVDLLPG PY Q
Sbjct  108  IEAPGWQLGWSWRKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKKTPAIVDLLPGTPYTQ  167

Query  439  QFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAK  618
            Q SNCC+GGV++SW +DP+ +VS+FQ+SVG +GT+N TV+ P N TL GPGPGYTCGPA+
Sbjct  168  QISNCCRGGVISSWAQDPATAVSSFQISVGQSGTTNTTVRAPRNITLKGPGPGYTCGPAQ  227

Query  619  IVPSTVFLTADRRRKTQALMTWNVTCT  699
            +V  + F++AD+RRKTQAL+TWN+TCT
Sbjct  228  LVRPSKFISADKRRKTQALLTWNITCT  254



>ref|XP_011087367.1| PREDICTED: protein COBRA-like isoform X1 [Sesamum indicum]
Length=454

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 168/201 (84%), Gaps = 1/201 (0%)
 Frame = +1

Query  100  FCAVFLF-LIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGW  276
            F  + +F L F   + +D LDP GNIT+KWDVMSWT DGYVA VT+ NFQ YR I SPGW
Sbjct  19   FVGILVFCLSFTTTDAYDALDPNGNITVKWDVMSWTPDGYVAVVTIFNFQKYRHIESPGW  78

Query  277  TLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCC  456
             LGW+WAKKEVIWS++G QATEQGDCS+FKGN+PHCCKK PTIVDLLPG PYNQQ +NCC
Sbjct  79   KLGWTWAKKEVIWSMLGGQATEQGDCSRFKGNIPHCCKKNPTIVDLLPGTPYNQQIANCC  138

Query  457  KGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTV  636
            KGGV++SW +DP+ + S+FQ+SVG AGTSNKTV+LP NFTL+GPGPGYTCGPAKIV  + 
Sbjct  139  KGGVISSWVQDPANAASSFQLSVGQAGTSNKTVRLPKNFTLLGPGPGYTCGPAKIVKPSK  198

Query  637  FLTADRRRKTQALMTWNVTCT  699
            F T D+RR TQALMTWNVTC+
Sbjct  199  FTTPDKRRVTQALMTWNVTCS  219



>gb|ABK25470.1| unknown [Picea sitchensis]
Length=471

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 167/197 (85%), Gaps = 1/197 (1%)
 Frame = +1

Query  112  FLFLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSP-GWTLGW  288
             L + F  A  +DPLDP GNITIKWD++SWTADGYVAAVTM+NFQ YR I SP GWTLGW
Sbjct  35   ILAIAFSPAGAYDPLDPNGNITIKWDIVSWTADGYVAAVTMHNFQQYRHIPSPPGWTLGW  94

Query  289  SWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGV  468
            +WAKKEVIW++VG Q TEQGDCSK+K   PHCCKK PT+VDLLPGVPYNQQF+NCCKGG 
Sbjct  95   NWAKKEVIWAVVGGQTTEQGDCSKWKAGSPHCCKKDPTVVDLLPGVPYNQQFTNCCKGGA  154

Query  469  VASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTA  648
            +ASW +DP  SV++FQVSVG +GT+NKTVKLP NFTL  PGPGYTCGPAKIV S++F + 
Sbjct  155  LASWAQDPPNSVASFQVSVGNSGTTNKTVKLPKNFTLKAPGPGYTCGPAKIVKSSLFFST  214

Query  649  DRRRKTQALMTWNVTCT  699
            DRRR TQALMTWNVTCT
Sbjct  215  DRRRTTQALMTWNVTCT  231



>ref|XP_010260537.1| PREDICTED: protein COBRA-like isoform X1 [Nelumbo nucifera]
Length=456

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 172/211 (82%), Gaps = 5/211 (2%)
 Frame = +1

Query  82   TLAKLSFCAVFLFL-----IFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            +++KL  C + + L      F   E +DPLDP GNITIKWD++SWT DGYVA VT+ NFQ
Sbjct  13   SISKLVKCTILVVLWFSCFSFTSTEAYDPLDPNGNITIKWDIISWTPDGYVAVVTIFNFQ  72

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGWTLGW+WAKKEVIWS++G Q TEQGDCS+FKGN+PHCCKK PT+VDLLPG 
Sbjct  73   QYRHIQAPGWTLGWTWAKKEVIWSMMGGQTTEQGDCSRFKGNIPHCCKKDPTVVDLLPGT  132

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCCKGGV+ SW +DP+ + S+FQ+SVG AGT+NKTV++P NFTL  PGPGYTC
Sbjct  133  PYNQQIANCCKGGVINSWVQDPANAASSFQLSVGAAGTTNKTVRVPKNFTLKAPGPGYTC  192

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            GPAKIV  T F++AD+RR TQA+MTWNVTCT
Sbjct  193  GPAKIVKPTKFISADKRRVTQAMMTWNVTCT  223



>ref|XP_004488435.1| PREDICTED: protein COBRA-like [Cicer arietinum]
Length=442

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = +1

Query  106  AVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPG  273
            +V L L     F   E +DPLDP GNIT+KWDV+SWT DGYVA VTM NFQ YR I  PG
Sbjct  8    SVLLLLFSCSTFTSIEAYDPLDPNGNITLKWDVISWTPDGYVAVVTMYNFQQYRHIQEPG  67

Query  274  WTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNC  453
            WTLGW+WAKKEVIW+++G+Q TEQGDCSKFK  +PHCCKK PT+VDLLPG PYNQQ +NC
Sbjct  68   WTLGWTWAKKEVIWNMMGSQTTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANC  127

Query  454  CKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPST  633
            CKGGV+ SW +DP+ +VS+FQ+SVG AGT+NKTVKLP NFTL  PGPGYTCGPAKIV  T
Sbjct  128  CKGGVLNSWAQDPNNAVSSFQISVGSAGTTNKTVKLPRNFTLKAPGPGYTCGPAKIVRPT  187

Query  634  VFLTADRRRKTQALMTWNVTCT  699
             F+T D+RR TQALMTWN+TCT
Sbjct  188  QFITNDKRRVTQALMTWNITCT  209



>gb|KEH25134.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=446

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 167/201 (83%), Gaps = 4/201 (2%)
 Frame = +1

Query  109  VFLFLIFP----HAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGW  276
            +F FLIF       E +DPLDP GNITIKWD++SWTADGYVA VTMNNFQ YR I SPGW
Sbjct  13   MFTFLIFTLFYTSTEAYDPLDPNGNITIKWDIISWTADGYVATVTMNNFQQYRHISSPGW  72

Query  277  TLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCC  456
            +LGW+WAKKEVIW++VG+Q TEQGDCSKFKGN+PHCCKK PT+VDLLPG PYNQQ +NCC
Sbjct  73   SLGWTWAKKEVIWNMVGSQTTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQTANCC  132

Query  457  KGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTV  636
            KGGV++SW +DP+ +V++FQV VG AGT+NKTVKLP NFTL  PGPGYTCG AK    T 
Sbjct  133  KGGVLSSWAQDPTNAVASFQVIVGRAGTTNKTVKLPQNFTLKAPGPGYTCGRAKTGTPTK  192

Query  637  FLTADRRRKTQALMTWNVTCT  699
            F T D+RR TQALMTWNVTCT
Sbjct  193  FTTPDKRRVTQALMTWNVTCT  213



>ref|XP_010663467.1| PREDICTED: COBRA-like protein 4 isoform X2 [Vitis vinifera]
Length=397

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +1

Query  193  MSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGN  372
            MSWT+DGYVA VTM+NFQMYR IMSPGWTLGW WAKKEVIWS+VGAQATEQGDCSKFKGN
Sbjct  1    MSWTSDGYVAVVTMSNFQMYRHIMSPGWTLGWIWAKKEVIWSMVGAQATEQGDCSKFKGN  60

Query  373  VPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKT  552
            +PHCCK+ PT++DLLPGVPYNQQ +NCCKGGVVASWG+D SA+VS+FQ+SVGL+GTSNKT
Sbjct  61   IPHCCKRNPTVIDLLPGVPYNQQIANCCKGGVVASWGQDSSAAVSSFQLSVGLSGTSNKT  120

Query  553  VKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            V+LP NFTL+GPGPGYTCG AK VPS++FL++D RRKTQALMTWNVTCT
Sbjct  121  VRLPKNFTLLGPGPGYTCGQAKTVPSSIFLSSDGRRKTQALMTWNVTCT  169



>ref|XP_010459308.1| PREDICTED: COBRA-like protein 1 [Camelina sativa]
Length=451

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 169/211 (80%), Gaps = 2/211 (1%)
 Frame = +1

Query  73   SPSTLAKLSFCAVFL--FLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQ  246
            S S   KL    +FL  F  +  +E +DPLDP GNITIKWD+M+WTADGYVA VT+ NFQ
Sbjct  6    SSSIFFKLGISIIFLVSFSCYTPSEAYDPLDPSGNITIKWDIMTWTADGYVAVVTIYNFQ  65

Query  247  MYRAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGV  426
             YR I +PGWTLGWSWAK+EVIW + G Q TEQGDCSKFKGN+PHCCKKTP++VDLLPG 
Sbjct  66   QYRHIQAPGWTLGWSWAKREVIWGMNGGQTTEQGDCSKFKGNIPHCCKKTPSVVDLLPGT  125

Query  427  PYNQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTC  606
            PYNQQ +NCC+GGV+ SW +DP+ +VSAFQ++VG AGT+NKTV++P NFTL  PGPGYTC
Sbjct  126  PYNQQIANCCRGGVINSWAQDPATAVSAFQLTVGQAGTTNKTVRVPKNFTLKAPGPGYTC  185

Query  607  GPAKIVPSTVFLTADRRRKTQALMTWNVTCT  699
             P KIV  T F+  D+RR TQALMTWNVTCT
Sbjct  186  SPGKIVKPTRFIGTDKRRVTQALMTWNVTCT  216



>gb|ABS88990.1| ch-cobra [Cunninghamia lanceolata]
Length=452

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWDV+SWT DGYVA VTM NFQ YR I +PGW+LGW+WAKKEVIWS+V
Sbjct  33   YDPLDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWSMV  92

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQAT+QGDCS+FKGN+PHCC KTP +VDLLPG PYNQQ +NCCKGGV+ASW +DP  +V
Sbjct  93   GAQATQQGDCSRFKGNIPHCCLKTPNVVDLLPGTPYNQQIANCCKGGVIASWAQDPINAV  152

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQVSVG AGTSN TV+LP NFTL  PGPGYTCGPAK V S++FL+AD RR TQALMTW
Sbjct  153  SAFQVSVGSAGTSNTTVRLPKNFTLKAPGPGYTCGPAKKVKSSLFLSADGRRFTQALMTW  212

Query  685  NVTCT  699
            NVTCT
Sbjct  213  NVTCT  217



>gb|ABK25014.1| unknown [Picea sitchensis]
Length=458

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +DPLDP GNITIKWD+MSWT DGY+A VT+NNFQ YR I SPGWTLGW+WAKKEVIWS+V
Sbjct  40   YDPLDPNGNITIKWDIMSWTPDGYLAVVTINNFQQYRHIQSPGWTLGWTWAKKEVIWSMV  99

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQ TEQGDCSK+KGN+PHCC K PT+VDLLPG PYNQQ +NCCKGGV+ASW +DP  +V
Sbjct  100  GAQTTEQGDCSKYKGNIPHCCNKNPTVVDLLPGTPYNQQIANCCKGGVIASWAQDPVNAV  159

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            SAFQVSVG AGT+N TV+LP NFTL  PGPGYTCGPAK V ++ FLT D RR TQALMTW
Sbjct  160  SAFQVSVGNAGTTNTTVRLPKNFTLKAPGPGYTCGPAKKVRASKFLTTDGRRVTQALMTW  219

Query  685  NVTCT  699
            N+TCT
Sbjct  220  NITCT  224



>gb|AAM67179.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=441

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 169/209 (81%), Gaps = 4/209 (2%)
 Frame = +1

Query  85   LAKLSFCAVFL----FLIFPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMY  252
             ++ SF  +FL       F   E +D LDP+GNITIKWD+MSWT DGYVA VT+ NFQ Y
Sbjct  5    FSRFSFLLLFLCSWTIFTFTTTEAYDALDPYGNITIKWDIMSWTGDGYVAVVTIFNFQQY  64

Query  253  RAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPY  432
            R I +PGW LGWSW KKEVIWS+VG QATEQGDCSKFKGN+PHCCKKTP IVDLLPG PY
Sbjct  65   RHIEAPGWQLGWSWMKKEVIWSMVGGQATEQGDCSKFKGNIPHCCKKTPAIVDLLPGTPY  124

Query  433  NQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGP  612
            NQQ SNCC+GGV+++W +DP+ ++S+FQ+SVG +GT+N TV+ P N TL  PGPGYTCGP
Sbjct  125  NQQISNCCRGGVISAWAQDPATAISSFQISVGQSGTTNTTVRAPRNITLKAPGPGYTCGP  184

Query  613  AKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            AK+V  + F++AD+RRKTQ+L+TWN+TCT
Sbjct  185  AKLVKPSRFISADKRRKTQSLLTWNITCT  213



>gb|EYU34590.1| hypothetical protein MIMGU_mgv1a006245mg [Erythranthe guttata]
Length=451

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +1

Query  139  EPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWS  318
            E +D LDP GNITIKWDV SWTADGYVA VTM NFQ YR I +PGWTLGW+WAKKEVIWS
Sbjct  32   EAYDALDPNGNITIKWDVTSWTADGYVALVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  91

Query  319  IVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSA  498
            ++G Q TEQGDCS+FKGN+PHCCKK PT+VDLLPG PYNQQ  NCCKGGV+ SW +DPS 
Sbjct  92   MMGGQTTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIGNCCKGGVINSWAQDPSN  151

Query  499  SVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALM  678
            S SAFQVSVG AGT+NKTVKLP NFTL  PGPGYTCGPAKIV  T +LT D RR TQA+M
Sbjct  152  SASAFQVSVGGAGTTNKTVKLPRNFTLRAPGPGYTCGPAKIVKPTKYLTGDGRRVTQAMM  211

Query  679  TWNVTCT  699
            TWN+TCT
Sbjct  212  TWNITCT  218



>gb|AFZ78568.1| COBRA-like protein [Populus tomentosa]
Length=453

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 170/204 (83%), Gaps = 4/204 (2%)
 Frame = +1

Query  100  FCAVFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMS  267
            F  + LF++    F   E +DPLDP GNITIKWD++SWTADGYVA VT+ NFQ YR I +
Sbjct  15   FTVLLLFVLWCASFTSTEAYDPLDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQA  74

Query  268  PGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFS  447
            PGW+LGW+WAKKEVIWS++G QAT+QGDCSKFKGN+PHCCKK+PT+VDLLPG+PYNQQ +
Sbjct  75   PGWSLGWTWAKKEVIWSMLGGQATDQGDCSKFKGNIPHCCKKSPTVVDLLPGIPYNQQTA  134

Query  448  NCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVP  627
            NCCKGGV++SW +D + + S+FQ+SVG AGTSNKTV+LP NFTL  PGPGYTC  AKIV 
Sbjct  135  NCCKGGVISSWAQDSANAASSFQLSVGSAGTSNKTVRLPKNFTLKAPGPGYTCARAKIVK  194

Query  628  STVFLTADRRRKTQALMTWNVTCT  699
             T F++ D+RR TQALMTWNVTCT
Sbjct  195  PTRFMSTDKRRITQALMTWNVTCT  218



>ref|XP_010528423.1| PREDICTED: COBRA-like protein 2 [Tarenaya hassleriana]
Length=445

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +1

Query  127  FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKE  306
            F   E +D LDP GNITIKWDVMSWT DGYVA VTM NFQ YR I +PGW LGW+WAKKE
Sbjct  21   FTPTEAYDALDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWQLGWTWAKKE  80

Query  307  VIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGE  486
            VIWS++G Q+TEQGDCSKFKGN+PHCCKK+PTIVDLLPG PYNQQ +NCCKGGV+ SW +
Sbjct  81   VIWSMLGGQSTEQGDCSKFKGNIPHCCKKSPTIVDLLPGTPYNQQIANCCKGGVINSWAQ  140

Query  487  DPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKT  666
            DP+ + ++FQ+SVG AGTSNKTV++P NFTL  PGPGYTCGPAKIV  + F+TAD RR T
Sbjct  141  DPATASASFQISVGQAGTSNKTVRVPRNFTLKAPGPGYTCGPAKIVKPSRFITADNRRFT  200

Query  667  QALMTWNVTCT  699
            QALMTWNVTCT
Sbjct  201  QALMTWNVTCT  211



>ref|XP_010936446.1| PREDICTED: COBRA-like protein 1 [Elaeis guineensis]
Length=547

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 171/209 (82%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   AKLSFCAVFL--FLIF---PHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMY  252
            +KL+  AVFL  FL+F   P  E +D LDP GNITIKWD+M WT DGYVA VTM NFQ Y
Sbjct  104  SKLTPLAVFLAFFLVFSSLPSTEAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMYNFQQY  163

Query  253  RAIMSPGWTLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPY  432
            R I +PGWTLGW+WAKKEVIWS+VGAQ TEQGDCSKFKGN+PHCCKK PT+VDLLPG PY
Sbjct  164  RHIQAPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPY  223

Query  433  NQQFSNCCKGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGP  612
            N Q +NCCKGGV++SW +DP+ + S+FQ+S G AGT+NKTV++P NFTL  PGPGYTCG 
Sbjct  224  NMQIANCCKGGVISSWIQDPANAASSFQISAGRAGTTNKTVRVPKNFTLNAPGPGYTCGA  283

Query  613  AKIVPSTVFLTADRRRKTQALMTWNVTCT  699
            AKIV  T F+TAD RR TQALMTWNVTCT
Sbjct  284  AKIVKPTKFVTADGRRTTQALMTWNVTCT  312



>ref|XP_006477734.1| PREDICTED: COBRA-like protein 4-like, partial [Citrus sinensis]
Length=423

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +D LDP GNITIKWDVMSW  DGYVA VTM NFQMYR IM PGWTLGW+WAKKEVIWS+V
Sbjct  11   YDTLDPTGNITIKWDVMSWIPDGYVALVTMTNFQMYRHIMEPGWTLGWTWAKKEVIWSMV  70

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            GAQATEQGDCSKFK N+PH C K PT+VDLLPGVPYNQQ +NCCKGGVV SWG+DPSA+V
Sbjct  71   GAQATEQGDCSKFKINIPHSCMKNPTVVDLLPGVPYNQQIANCCKGGVVGSWGQDPSAAV  130

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S+FQ+SVG +G+SNKTV+LP NFTL+GPG GYTC  AK V  T F++AD RR+TQA+MTW
Sbjct  131  SSFQLSVGRSGSSNKTVRLPKNFTLLGPGRGYTCSQAKNVLPTAFISADGRRRTQAMMTW  190

Query  685  NVTCT  699
            NVTCT
Sbjct  191  NVTCT  195



>gb|KCW48927.1| hypothetical protein EUGRSUZ_K02540 [Eucalyptus grandis]
Length=457

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +1

Query  145  FDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGWTLGWSWAKKEVIWSIV  324
            +D LDP GNITIKWDV+SWT DGYVA VTM NFQ YR I SPGWTLGW+WAKKEVIWS++
Sbjct  37   YDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQSPGWTLGWTWAKKEVIWSMM  96

Query  325  GAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVVASWGEDPSASV  504
            G+Q TEQGDCS++KGN PHCCKK PT+VDLLPG PYNQQ +NCCKGGV+ SW +DP+ + 
Sbjct  97   GSQTTEQGDCSRYKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPANAA  156

Query  505  SAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTVFLTADRRRKTQALMTW  684
            S+FQVSVG AGTSNKTV+LP NFTL  PGPGYTCGPAKIV ST F++AD+RR TQALMTW
Sbjct  157  SSFQVSVGAAGTSNKTVRLPKNFTLKAPGPGYTCGPAKIVRSTKFVSADKRRTTQALMTW  216

Query  685  NVTCT  699
            NVTCT
Sbjct  217  NVTCT  221



>ref|XP_006338345.1| PREDICTED: protein COBRA-like [Solanum tuberosum]
Length=459

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 168/201 (84%), Gaps = 4/201 (2%)
 Frame = +1

Query  109  VFLFLI----FPHAEPFDPLDPFGNITIKWDVMSWTADGYVAAVTMNNFQMYRAIMSPGW  276
            + LFL+    F   + FDPLDP GNITIKWDV+SW  DGYVA VTM NFQ YR I +PGW
Sbjct  24   LVLFLLSSFSFHSTDAFDPLDPNGNITIKWDVISWAPDGYVAVVTMYNFQQYRHIQAPGW  83

Query  277  TLGWSWAKKEVIWSIVGAQATEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCC  456
            +LGW+WAKKEVIW+++G Q TEQGDCSK+KGN+PHCCKK PT+VD+LPG PYNQQ +NCC
Sbjct  84   SLGWTWAKKEVIWTMMGGQTTEQGDCSKYKGNIPHCCKKDPTVVDMLPGTPYNQQIANCC  143

Query  457  KGGVVASWGEDPSASVSAFQVSVGLAGTSNKTVKLPTNFTLMGPGPGYTCGPAKIVPSTV  636
            KGGV+ SWG+DP+ +VS+FQ+SVG AGT+NKTV++P NFTL  PGPGYTCGPAKIV  T 
Sbjct  144  KGGVINSWGQDPANAVSSFQISVGAAGTTNKTVRVPKNFTLKAPGPGYTCGPAKIVKPTK  203

Query  637  FLTADRRRKTQALMTWNVTCT  699
            F++AD RR TQA+MTWNVTCT
Sbjct  204  FVSADGRRVTQAMMTWNVTCT  224



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1130594545322