BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6420_g1_i1 len=905 path=[883:0-904]

Length=905
                                                                      Score     E

ref|XP_011087370.1|  PREDICTED: COBRA-like protein 4                    390   1e-130   
gb|EYU23624.1|  hypothetical protein MIMGU_mgv1a006366mg                385   4e-128   
ref|XP_009606716.1|  PREDICTED: COBRA-like protein 4                    385   5e-128   
ref|XP_004236068.1|  PREDICTED: COBRA-like protein 4                    381   7e-127   
ref|XP_010260547.1|  PREDICTED: COBRA-like protein 4                    381   1e-126   
ref|XP_009780773.1|  PREDICTED: COBRA-like protein 4                    380   2e-126   
emb|CDP20884.1|  unnamed protein product                                379   6e-126   
gb|KHG27746.1|  COBRA-like protein 4                                    378   7e-126   
ref|XP_006345105.1|  PREDICTED: COBRA-like protein 4-like               379   1e-125   
ref|XP_002514628.1|  Protein COBRA precursor, putative                  377   5e-125   Ricinus communis
ref|XP_011099033.1|  PREDICTED: COBRA-like protein 4                    374   4e-124   
gb|AFZ78569.1|  COBRA-like protein                                      374   9e-124   
ref|XP_008393239.1|  PREDICTED: COBRA-like protein 4                    372   1e-123   
ref|XP_008240086.1|  PREDICTED: COBRA-like protein 4                    374   1e-123   
ref|XP_010936445.1|  PREDICTED: COBRA-like protein 4                    374   1e-123   
ref|XP_006338344.1|  PREDICTED: COBRA-like protein 4-like               372   2e-123   
ref|XP_010695259.1|  PREDICTED: COBRA-like protein 4                    373   3e-123   
ref|XP_006363258.1|  PREDICTED: COBRA-like protein 4-like               372   3e-123   
ref|XP_007209118.1|  hypothetical protein PRUPE_ppa005430mg             373   3e-123   
ref|XP_008351868.1|  PREDICTED: COBRA-like protein 4                    372   4e-123   
gb|KDP31374.1|  hypothetical protein JCGZ_11750                         372   5e-123   
ref|XP_004299286.1|  PREDICTED: COBRA-like protein 4-like               372   5e-123   
ref|XP_008775851.1|  PREDICTED: COBRA-like protein 4                    372   8e-123   
ref|XP_009346173.1|  PREDICTED: COBRA-like protein 4                    371   8e-123   
ref|XP_011085598.1|  PREDICTED: COBRA-like protein 4                    370   9e-123   
emb|CDP21871.1|  unnamed protein product                                369   9e-123   
gb|KHG07276.1|  COBRA-like protein 4                                    370   1e-122   
ref|XP_009761753.1|  PREDICTED: COBRA-like protein 4                    370   1e-122   
ref|XP_006374429.1|  phytochelatin synthetase-like family protein       370   1e-122   
gb|KHG24029.1|  COBRA-like protein 4                                    370   1e-122   
ref|XP_006650197.1|  PREDICTED: COBRA-like protein 5-like               370   2e-122   
ref|XP_007032846.1|  COBRA-like extracellular glycosyl-phosphatid...    369   2e-122   
ref|XP_006440799.1|  hypothetical protein CICLE_v10020292mg             369   3e-122   
ref|XP_009589606.1|  PREDICTED: COBRA-like protein 4                    369   4e-122   
ref|XP_006477707.1|  PREDICTED: COBRA-like protein 4-like               369   5e-122   
ref|XP_008374649.1|  PREDICTED: COBRA-like protein 4                    369   6e-122   
ref|XP_010257979.1|  PREDICTED: COBRA-like protein 4                    369   7e-122   
gb|KDO65677.1|  hypothetical protein CISIN_1g013089mg                   369   8e-122   
dbj|BAK01816.1|  predicted protein                                      368   1e-121   
ref|XP_011006293.1|  PREDICTED: COBRA-like protein 4                    368   1e-121   
ref|XP_010032553.1|  PREDICTED: COBRA-like protein 4                    367   1e-121   
ref|XP_006856413.1|  hypothetical protein AMTR_s00047p00216570          367   1e-121   
emb|CAC01762.1|  putative phytochelatin synthetase                      365   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008453301.1|  PREDICTED: COBRA-like protein 4                    367   5e-121   
ref|XP_009338030.1|  PREDICTED: COBRA-like protein 4                    367   5e-121   
ref|XP_004232142.1|  PREDICTED: COBRA-like protein 4                    366   6e-121   
ref|XP_007037618.1|  COBRA-like extracellular glycosyl-phosphatid...    367   6e-121   
ref|XP_009763133.1|  PREDICTED: COBRA-like protein 4                    366   6e-121   
ref|NP_197067.2|  COBRA-like protein 4                                  365   7e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557715.1|  PREDICTED: COBRA-like protein 5                    366   8e-121   
gb|KGN63776.1|  hypothetical protein Csa_1G015700                       366   8e-121   
ref|XP_010037255.1|  PREDICTED: COBRA-like protein 4                    366   9e-121   
ref|XP_006368071.1|  PREDICTED: COBRA-like protein 4-like               364   1e-120   
ref|XP_004234909.1|  PREDICTED: COBRA-like protein 4                    365   1e-120   
gb|EMT05391.1|  hypothetical protein F775_18404                         365   1e-120   
emb|CDX69511.1|  BnaA10g18600D                                          365   2e-120   
ref|XP_010551802.1|  PREDICTED: COBRA-like protein 4                    364   2e-120   
ref|XP_010549989.1|  PREDICTED: COBRA-like protein 4                    364   4e-120   
ref|XP_009600081.1|  PREDICTED: COBRA-like protein 4                    363   5e-120   
ref|XP_002264378.1|  PREDICTED: COBRA-like protein 4                    364   5e-120   Vitis vinifera
ref|XP_004138334.1|  PREDICTED: COBRA-like protein 4-like               362   8e-120   
ref|NP_001050366.1|  Os03g0416200                                       364   9e-120   Oryza sativa Japonica Group [Japonica rice]
gb|EYU44225.1|  hypothetical protein MIMGU_mgv1a006751mg                362   1e-119   
dbj|BAM05578.1|  COBRA-like protein                                     362   1e-119   
ref|XP_009394778.1|  PREDICTED: COBRA-like protein 4 isoform X2         362   1e-119   
ref|XP_009131486.1|  PREDICTED: COBRA-like protein 4                    362   2e-119   
gb|EYU44221.1|  hypothetical protein MIMGU_mgv1a006633mg                362   3e-119   
emb|CDX78644.1|  BnaA03g05560D                                          361   3e-119   
ref|XP_009126060.1|  PREDICTED: COBRA-like protein 4                    361   4e-119   
dbj|BAM05576.1|  COBRA-like protein                                     361   5e-119   
ref|XP_007216522.1|  hypothetical protein PRUPE_ppa024465mg             360   6e-119   
gb|AFY03623.1|  COBRA-like protein                                      360   6e-119   
ref|XP_006400085.1|  hypothetical protein EUTSA_v10013604mg             360   7e-119   
gb|KFK25792.1|  hypothetical protein AALP_AA8G161300                    360   1e-118   
gb|EPS71579.1|  hypothetical protein M569_03177                         359   1e-118   
gb|ACI24390.1|  COBRA-like protein                                      360   1e-118   Eucalyptus nitens
ref|XP_010099317.1|  hypothetical protein L484_018179                   359   2e-118   
ref|XP_007139432.1|  hypothetical protein PHAVU_008G029000g             358   5e-118   
gb|AAR13305.1|  phytochelatin synthetase-like protein                   359   6e-118   Phaseolus vulgaris [French bean]
emb|CDX85543.1|  BnaA02g02700D                                          359   6e-118   
ref|XP_008230409.1|  PREDICTED: COBRA-like protein 4                    358   7e-118   
ref|XP_002871675.1|  hypothetical protein ARALYDRAFT_488408             358   7e-118   
gb|ACA04978.1|  GPI-anchored protein                                    358   9e-118   Bambusa oldhamii
ref|XP_004304208.1|  PREDICTED: COBRA-like protein 4-like               357   2e-117   
emb|CDX90983.1|  BnaC02g06140D                                          357   2e-117   
ref|XP_008464584.1|  PREDICTED: COBRA-like protein 4                    356   4e-117   
ref|XP_006287794.1|  hypothetical protein CARUB_v10001005mg             356   4e-117   
ref|XP_007151374.1|  hypothetical protein PHAVU_004G041400g             356   4e-117   
ref|XP_010420232.1|  PREDICTED: COBRA-like protein 4                    355   5e-117   
ref|XP_010492405.1|  PREDICTED: COBRA-like protein 4                    355   5e-117   
ref|XP_004137260.1|  PREDICTED: COBRA-like protein 4-like               356   5e-117   
gb|KGN53787.1|  hypothetical protein Csa_4G129040                       355   6e-117   
gb|KHN37931.1|  COBRA-like protein 4                                    355   7e-117   
ref|XP_004154765.1|  PREDICTED: COBRA-like protein 4-like               355   7e-117   
ref|XP_010453698.1|  PREDICTED: COBRA-like protein 4                    355   8e-117   
gb|EAZ27328.1|  hypothetical protein OsJ_11270                          355   8e-117   Oryza sativa Japonica Group [Japonica rice]
gb|KHN30324.1|  COBRA-like protein 4                                    355   1e-116   
gb|KEH25135.1|  COBRA-like protein 2 precursor                          355   1e-116   
ref|XP_004491892.1|  PREDICTED: COBRA-like protein 4-like               354   2e-116   
ref|NP_001242777.1|  uncharacterized protein LOC100784352 precursor     353   3e-116   
ref|NP_001242075.1|  uncharacterized protein LOC100783410 precursor     352   2e-115   
emb|CBI15331.3|  unnamed protein product                                366   3e-115   
emb|CDX70627.1|  BnaC03g07110D                                          363   3e-115   
emb|CBI16945.3|  unnamed protein product                                351   4e-115   
ref|XP_004984022.1|  PREDICTED: COBRA-like protein 5-like               351   7e-115   
ref|XP_009394776.1|  PREDICTED: COBRA-like protein 4 isoform X1         352   8e-115   
ref|XP_010663467.1|  PREDICTED: COBRA-like protein 4 isoform X2         348   1e-114   
ref|XP_010660571.1|  PREDICTED: COBRA-like protein 4                    350   1e-114   
ref|XP_010663466.1|  PREDICTED: COBRA-like protein 4 isoform X1         349   2e-114   
dbj|BAK05255.1|  predicted protein                                      348   6e-114   
gb|KEH21749.1|  COBRA-like protein 2 precursor                          347   8e-114   
ref|XP_010694050.1|  PREDICTED: COBRA-like protein 4                    347   9e-114   
gb|ACF88191.1|  unknown                                                 340   1e-113   Zea mays [maize]
gb|KEH21750.1|  COBRA-like protein 2 precursor                          347   1e-113   
ref|XP_003554956.1|  PREDICTED: COBRA-like protein 4-like               346   2e-113   
gb|KHN04371.1|  COBRA-like protein 4                                    346   3e-113   
gb|KDP24287.1|  hypothetical protein JCGZ_25583                         346   3e-113   
ref|XP_002467689.1|  hypothetical protein SORBIDRAFT_01g032480          345   8e-113   Sorghum bicolor [broomcorn]
ref|XP_011006292.1|  PREDICTED: COBRA-like protein 4                    344   2e-112   
ref|NP_001105928.1|  brittle stalk2 precursor                           345   2e-112   Zea mays [maize]
ref|XP_006374430.1|  phytochelatin synthetase-like family protein       344   3e-112   
gb|AFW88100.1|  hypothetical protein ZEAMMB73_767703                    345   5e-112   
ref|XP_004958243.1|  PREDICTED: COBRA-like protein 6-like isoform X2    341   7e-112   
gb|EMS46999.1|  hypothetical protein TRIUR3_01700                       340   2e-111   
gb|EMT09067.1|  COBRA-like protein 6                                    342   3e-111   
ref|XP_010092075.1|  hypothetical protein L484_007355                   343   4e-111   
ref|XP_007037621.1|  COBRA-like extracellular glycosyl-phosphatid...    341   4e-111   
ref|XP_004958242.1|  PREDICTED: COBRA-like protein 6-like isoform X1    340   7e-111   
ref|NP_001105971.1|  brittle stalk-2-like protein 7 precursor           340   1e-110   Zea mays [maize]
ref|XP_010087345.1|  hypothetical protein L484_012678                   345   2e-110   
tpg|DAA63525.1|  TPA: hypothetical protein ZEAMMB73_009152              339   2e-110   
gb|KHG18541.1|  COBRA-like protein 4                                    336   8e-110   
ref|XP_002463158.1|  hypothetical protein SORBIDRAFT_02g038740          336   3e-109   Sorghum bicolor [broomcorn]
ref|XP_002306058.1|  phytochelatin synthetase-like family protein       335   4e-109   Populus trichocarpa [western balsam poplar]
gb|ADE67012.1|  COBRA-like 4 protein                                    335   5e-109   
gb|ADE67017.1|  COBRA-like 4 protein                                    335   5e-109   
ref|XP_011014071.1|  PREDICTED: COBRA-like protein 4                    335   1e-108   
gb|ADE67018.1|  COBRA-like 4 protein                                    334   1e-108   
gb|ADE67039.1|  COBRA-like 4 protein                                    334   1e-108   
gb|ADE67037.1|  COBRA-like 4 protein                                    334   1e-108   
gb|ADE67026.1|  COBRA-like 4 protein                                    334   2e-108   
gb|ADE67014.1|  COBRA-like 4 protein                                    334   2e-108   
gb|ADE67036.1|  COBRA-like 4 protein                                    333   2e-108   
gb|ADE67020.1|  COBRA-like 4 protein                                    333   4e-108   
gb|ADE67019.1|  COBRA-like 4 protein                                    333   4e-108   
gb|ADE67032.1|  COBRA-like 4 protein                                    333   5e-108   
gb|ADE67031.1|  COBRA-like 4 protein                                    333   5e-108   
gb|ADE67011.1|  COBRA-like 4 protein                                    333   5e-108   
gb|ADE67025.1|  COBRA-like 4 protein                                    333   5e-108   
ref|XP_008240111.1|  PREDICTED: COBRA-like protein 4                    333   5e-108   
gb|ADE67015.1|  COBRA-like 4 protein                                    333   5e-108   
gb|ADE67042.1|  COBRA-like 4 protein                                    332   1e-107   
ref|XP_006657931.1|  PREDICTED: COBRA-like protein 6-like               332   1e-107   
ref|XP_007210750.1|  hypothetical protein PRUPE_ppa021191mg             331   1e-107   
ref|XP_002514627.1|  hypothetical protein RCOM_1468720                  347   3e-107   Ricinus communis
sp|Q6Z4G7.1|COBL6_ORYSJ  RecName: Full=COBRA-like protein 6; AltN...    328   4e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002531001.1|  Protein COBRA precursor, putative                  326   2e-105   Ricinus communis
gb|KEH38143.1|  COBRA-like protein 2 precursor                          327   2e-105   
gb|ABS88990.1|  ch-cobra                                                326   4e-105   Cunninghamia lanceolata [China fir]
gb|AFK33956.1|  unknown                                                 325   7e-105   
ref|XP_010031041.1|  PREDICTED: COBRA-like protein 4 isoform X2         322   9e-105   
ref|XP_004488433.1|  PREDICTED: COBRA-like protein 4-like isoform X1    325   1e-104   
ref|XP_008341798.1|  PREDICTED: COBRA-like protein 4                    323   2e-104   
gb|ABK25470.1|  unknown                                                 325   2e-104   Picea sitchensis
gb|KCW83758.1|  hypothetical protein EUGRSUZ_B00629                     322   2e-104   
ref|XP_010031033.1|  PREDICTED: COBRA-like protein 4 isoform X1         323   3e-104   
ref|XP_006440800.1|  hypothetical protein CICLE_v10023912mg             322   6e-104   
gb|KHN19596.1|  COBRA-like protein 4                                    323   9e-104   
ref|XP_006477734.1|  PREDICTED: COBRA-like protein 4-like               321   1e-103   
gb|KDO65676.1|  hypothetical protein CISIN_1g038127mg                   322   1e-103   
ref|XP_003528239.1|  PREDICTED: COBRA-like protein 4-like               322   2e-103   
ref|XP_007138375.1|  hypothetical protein PHAVU_009G203200g             321   3e-103   
ref|XP_011087368.1|  PREDICTED: protein COBRA-like isoform X2           319   6e-103   
ref|XP_009373789.1|  PREDICTED: COBRA-like protein 4                    320   7e-103   
ref|XP_011087367.1|  PREDICTED: protein COBRA-like isoform X1           320   1e-102   
ref|XP_008379444.1|  PREDICTED: COBRA-like protein 4                    318   1e-102   
ref|XP_004488434.1|  PREDICTED: COBRA-like protein 4-like isoform X2    319   2e-102   
ref|XP_006578523.1|  PREDICTED: COBRA-like protein 4-like isoform X2    316   5e-102   
emb|CDP21681.1|  unnamed protein product                                318   6e-102   
ref|XP_010031023.1|  PREDICTED: COBRA-like protein 1                    317   7e-102   
gb|KHN03079.1|  COBRA-like protein 4                                    317   2e-101   
ref|XP_003522282.1|  PREDICTED: COBRA-like protein 4-like isoform X1    316   2e-101   
ref|XP_009122873.1|  PREDICTED: COBRA-like protein 4                    314   5e-101   
ref|XP_011085599.1|  PREDICTED: protein COBRA                           315   6e-101   
ref|XP_003562730.1|  PREDICTED: COBRA-like protein 6                    315   7e-101   
gb|ACF80833.1|  unknown                                                 308   1e-100   Zea mays [maize]
gb|EAZ04638.1|  hypothetical protein OsI_26786                          316   1e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_010522480.1|  PREDICTED: protein COBRA                           315   1e-100   
gb|KDP31373.1|  hypothetical protein JCGZ_11749                         314   2e-100   
ref|XP_010546210.1|  PREDICTED: protein COBRA-like                      314   2e-100   
ref|XP_009763134.1|  PREDICTED: protein COBRA                           314   2e-100   
ref|XP_008230280.1|  PREDICTED: COBRA-like protein 1                    314   2e-100   
gb|KCW48930.1|  hypothetical protein EUGRSUZ_K02543                     313   2e-100   
ref|XP_009147371.1|  PREDICTED: COBRA-like protein 1                    313   3e-100   
ref|XP_011099166.1|  PREDICTED: protein COBRA-like                      315   3e-100   
ref|XP_007215357.1|  hypothetical protein PRUPE_ppa005522mg             313   4e-100   
gb|ACU20777.1|  unknown                                                 305   4e-100   Glycine max [soybeans]
emb|CAA07251.1|  putative phytochelatin synthetase                      310   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009600080.1|  PREDICTED: protein COBRA                           313   6e-100   
ref|XP_002531000.1|  Protein COBRA precursor, putative                  313   7e-100   Ricinus communis
ref|XP_010032552.1|  PREDICTED: protein COBRA-like                      313   8e-100   
ref|XP_009606717.1|  PREDICTED: COBRA-like protein 1                    312   1e-99    
ref|XP_009776823.1|  PREDICTED: protein COBRA-like                      312   1e-99    
ref|XP_007037616.1|  COBRA-like extracellular glycosyl-phosphatid...    313   1e-99    
ref|XP_009782894.1|  PREDICTED: protein COBRA-like                      312   1e-99    
emb|CDY43250.1|  BnaC05g48430D                                          312   1e-99    
ref|XP_007037617.1|  COBRA-like extracellular glycosyl-phosphatid...    312   1e-99    
gb|ABK25014.1|  unknown                                                 312   1e-99    Picea sitchensis
ref|XP_010039079.1|  PREDICTED: COBRA-like protein 4                    313   1e-99    
ref|XP_009395002.1|  PREDICTED: COBRA-like protein 1                    311   2e-99    
ref|XP_008353506.1|  PREDICTED: COBRA-like protein 1 isoform X1         311   2e-99    
ref|XP_008341800.1|  PREDICTED: COBRA-like protein 1 isoform X2         311   2e-99    
ref|XP_008341799.1|  PREDICTED: COBRA-like protein 1 isoform X1         311   2e-99    
ref|XP_008353507.1|  PREDICTED: COBRA-like protein 1 isoform X2         311   2e-99    
ref|XP_010257980.1|  PREDICTED: protein COBRA-like isoform X1           311   2e-99    
emb|CDY60470.1|  BnaAnng16830D                                          311   2e-99    
ref|XP_006856414.1|  hypothetical protein AMTR_s00047p00216760          310   2e-99    
ref|NP_568930.1|  glycosylphosphatidylinositol-anchored protein C...    311   3e-99    Arabidopsis thaliana [mouse-ear cress]
gb|AAM62930.1|  phytochelatin synthetase-like protein                   311   3e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009616573.1|  PREDICTED: protein COBRA-like                      311   3e-99    
ref|XP_002866404.1|  hypothetical protein ARALYDRAFT_496244             311   3e-99    
emb|CDY58691.1|  BnaC07g49800D                                          311   3e-99    
ref|XP_010483748.1|  PREDICTED: protein COBRA-like                      309   4e-99    
ref|XP_009373790.1|  PREDICTED: COBRA-like protein 1 isoform X1         311   4e-99    
ref|XP_006394554.1|  hypothetical protein EUTSA_v10004178mg             310   5e-99    
ref|XP_010443903.1|  PREDICTED: protein COBRA-like                      310   5e-99    
ref|XP_010260542.1|  PREDICTED: protein COBRA-like isoform X2           309   5e-99    
ref|XP_009373791.1|  PREDICTED: COBRA-like protein 1 isoform X2         310   5e-99    
ref|XP_006338345.1|  PREDICTED: protein COBRA-like                      310   6e-99    
gb|EYU34590.1|  hypothetical protein MIMGU_mgv1a006245mg                310   6e-99    
ref|XP_004232141.1|  PREDICTED: protein COBRA                           310   6e-99    
emb|CDY02184.1|  BnaA03g39830D                                          310   9e-99    
ref|XP_009151763.1|  PREDICTED: COBRA-like protein 2                    309   9e-99    
ref|XP_010456834.1|  PREDICTED: protein COBRA                           310   1e-98    
ref|XP_002305390.1|  phytochelatin synthetase family protein            309   1e-98    Populus trichocarpa [western balsam poplar]
ref|XP_010260537.1|  PREDICTED: protein COBRA-like isoform X1           309   1e-98    
ref|XP_002264600.1|  PREDICTED: protein COBRA                           309   2e-98    Vitis vinifera
ref|XP_006655271.1|  PREDICTED: COBRA-like protein 3-like               309   2e-98    
ref|XP_006280281.1|  hypothetical protein CARUB_v10026206mg             311   2e-98    
ref|XP_008240087.1|  PREDICTED: protein COBRA-like isoform X1           309   2e-98    
ref|XP_004491893.1|  PREDICTED: protein COBRA-like                      308   2e-98    
ref|XP_009415817.1|  PREDICTED: COBRA-like protein 1                    309   2e-98    
emb|CAN68249.1|  hypothetical protein VITISV_020126                     309   2e-98    Vitis vinifera
gb|AFK45756.1|  unknown                                                 308   3e-98    
ref|NP_001105970.1|  brittle stalk-2-like protein 6 precursor           308   3e-98    Zea mays [maize]
ref|XP_003559376.1|  PREDICTED: COBRA-like protein 3                    308   3e-98    
gb|AFZ78568.1|  COBRA-like protein                                      308   4e-98    
emb|CDX85277.1|  BnaC07g25880D                                          307   5e-98    
ref|XP_007139433.1|  hypothetical protein PHAVU_008G029100g             305   5e-98    
ref|XP_006650604.1|  PREDICTED: COBRA-like protein 3-like               308   5e-98    
ref|XP_006477706.1|  PREDICTED: protein COBRA-like                      308   6e-98    
gb|EEE63576.1|  hypothetical protein OsJ_18393                          307   6e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009136413.1|  PREDICTED: protein COBRA                           308   6e-98    
gb|EAY97880.1|  hypothetical protein OsI_19799                          307   7e-98    Oryza sativa Indica Group [Indian rice]
ref|NP_001055419.1|  Os05g0386800                                       307   7e-98    Oryza sativa Japonica Group [Japonica rice]
gb|ABD96927.1|  hypothetical protein                                    306   9e-98    Tarenaya spinosa
ref|XP_008785625.1|  PREDICTED: COBRA-like protein 1                    307   1e-97    
ref|XP_004299285.1|  PREDICTED: protein COBRA-like                      306   1e-97    
ref|XP_009780772.1|  PREDICTED: COBRA-like protein 1                    307   1e-97    
ref|XP_009124784.1|  PREDICTED: COBRA-like protein 2                    306   1e-97    
ref|XP_010939207.1|  PREDICTED: COBRA-like protein 1                    307   1e-97    
ref|XP_009386184.1|  PREDICTED: COBRA-like protein 1                    306   1e-97    
ref|XP_006365658.1|  PREDICTED: protein COBRA-like                      306   1e-97    
ref|XP_003522986.1|  PREDICTED: protein COBRA-like                      306   2e-97    
emb|CBI16946.3|  unnamed protein product                                306   2e-97    
ref|XP_010525122.1|  PREDICTED: COBRA-like protein 1                    306   2e-97    
ref|XP_011014072.1|  PREDICTED: COBRA-like protein 1                    306   2e-97    
ref|XP_003550707.1|  PREDICTED: protein COBRA-like                      306   2e-97    
ref|XP_010660572.1|  PREDICTED: protein COBRA                           306   2e-97    
gb|KHN18376.1|  Protein COBRA                                           305   2e-97    
ref|XP_006440798.1|  hypothetical protein CICLE_v10020097mg             306   3e-97    
ref|XP_003559251.1|  PREDICTED: COBRA-like protein 3                    306   3e-97    
ref|XP_004981735.1|  PREDICTED: COBRA-like protein 3-like               305   3e-97    
gb|KFK27869.1|  hypothetical protein AALP_AA8G439700                    305   4e-97    
gb|KHG10282.1|  COBRA-like protein 1                                    305   5e-97    
ref|XP_002460985.1|  hypothetical protein SORBIDRAFT_02g038720          305   5e-97    Sorghum bicolor [broomcorn]
ref|XP_007208787.1|  hypothetical protein PRUPE_ppa024172mg             305   5e-97    
ref|XP_007139435.1|  hypothetical protein PHAVU_008G029100g             305   6e-97    
ref|XP_011006295.1|  PREDICTED: protein COBRA-like                      305   7e-97    
ref|XP_010037254.1|  PREDICTED: protein COBRA-like                      305   7e-97    
gb|KDP24286.1|  hypothetical protein JCGZ_25582                         304   8e-97    
gb|EAY91898.1|  hypothetical protein OsI_13550                          305   8e-97    
gb|KCW48927.1|  hypothetical protein EUGRSUZ_K02540                     305   8e-97    
ref|XP_003552600.1|  PREDICTED: protein COBRA-like                      304   8e-97    
ref|XP_007139434.1|  hypothetical protein PHAVU_008G029100g             305   8e-97    
ref|NP_001265883.1|  protein COBRA-like precursor                       304   9e-97    
ref|XP_002321786.2|  phytochelatin synthetase family protein            305   1e-96    
gb|ACF82520.1|  unknown                                                 297   1e-96    
ref|XP_004236067.1|  PREDICTED: COBRA-like protein 1                    304   1e-96    
ref|XP_009338021.1|  PREDICTED: protein COBRA-like                      304   1e-96    
gb|KHG07280.1|  COBRA-like protein 1                                    304   2e-96    
ref|XP_008393240.1|  PREDICTED: protein COBRA-like                      304   2e-96    
ref|XP_002875546.1|  hypothetical protein ARALYDRAFT_484733             303   2e-96    
gb|KEH21748.1|  COBRA-like protein 2 precursor                          303   2e-96    
gb|KHN10040.1|  Protein COBRA                                           303   3e-96    
gb|KHN19598.1|  Protein COBRA                                           303   3e-96    
ref|XP_010502992.1|  PREDICTED: COBRA-like protein 2 isoform X4         302   4e-96    
ref|XP_007032845.1|  COBRA-like protein 1 precursor                     303   4e-96    
ref|XP_003527117.1|  PREDICTED: protein COBRA                           303   4e-96    
gb|AHC30880.1|  COBRA-like protein                                      303   4e-96    
gb|KHG21362.1|  Protein COBRA -like protein                             303   4e-96    
ref|XP_010489636.1|  PREDICTED: COBRA-like protein 1                    295   4e-96    
ref|XP_006408435.1|  hypothetical protein EUTSA_v10020716mg             303   4e-96    
ref|XP_010514669.1|  PREDICTED: COBRA-like protein 2                    302   5e-96    
ref|NP_186870.1|  COBRA-like protein 1 precursor                        302   5e-96    
gb|KHN30325.1|  Protein COBRA                                           302   5e-96    
ref|XP_006345208.1|  PREDICTED: protein COBRA-like                      302   5e-96    
ref|XP_010087346.1|  hypothetical protein L484_012679                   302   5e-96    
ref|XP_007155211.1|  hypothetical protein PHAVU_003G183000g             302   5e-96    
ref|XP_009111966.1|  PREDICTED: protein COBRA-like                      303   6e-96    
ref|XP_010502989.1|  PREDICTED: COBRA-like protein 2 isoform X2         302   6e-96    
emb|CDY16831.1|  BnaA09g05510D                                          302   7e-96    
ref|XP_010425766.1|  PREDICTED: COBRA-like protein 2                    301   7e-96    
ref|XP_009346186.1|  PREDICTED: protein COBRA-like                      302   7e-96    
ref|XP_010528423.1|  PREDICTED: COBRA-like protein 2                    302   7e-96    
ref|XP_006593701.1|  PREDICTED: protein COBRA-like isoform X2           300   9e-96    
ref|XP_003518180.1|  PREDICTED: protein COBRA-like                      302   1e-95    
gb|KHN08345.1|  Protein COBRA                                           301   1e-95    
ref|XP_008374650.1|  PREDICTED: protein COBRA-like                      302   1e-95    
ref|XP_006603925.1|  PREDICTED: protein COBRA-like                      301   1e-95    
gb|KGN63777.1|  hypothetical protein Csa_1G015710                       300   1e-95    
ref|XP_002463862.1|  hypothetical protein SORBIDRAFT_01g007760          301   1e-95    
ref|XP_008453302.1|  PREDICTED: protein COBRA-like                      301   1e-95    
ref|NP_001104946.1|  brittle stalk-2-like protein 3 precursor           301   2e-95    
ref|XP_006297664.1|  hypothetical protein CARUB_v10013688mg             301   2e-95    
ref|XP_004138217.1|  PREDICTED: protein COBRA-like                      301   2e-95    
gb|ACG33719.1|  COBRA-like protein 4 precursor                          301   2e-95    
ref|XP_010463618.1|  PREDICTED: COBRA-like protein 1                    301   2e-95    
gb|EMS49526.1|  hypothetical protein TRIUR3_12656                       299   2e-95    
gb|EAZ04637.1|  hypothetical protein OsI_26785                          301   2e-95    
ref|XP_010695258.1|  PREDICTED: protein COBRA-like                      301   2e-95    
ref|XP_010502993.1|  PREDICTED: COBRA-like protein 2 isoform X5         300   3e-95    
emb|CDX87193.1|  BnaC09g05080D                                          301   3e-95    
gb|AAF24189.1|AF160475_1  phytochelatin synthetase-like protein         299   3e-95    
ref|XP_010502991.1|  PREDICTED: COBRA-like protein 2 isoform X3         300   3e-95    
ref|XP_006395263.1|  hypothetical protein EUTSA_v10004232mg             300   3e-95    
ref|XP_003543887.1|  PREDICTED: protein COBRA-like isoform X1           300   4e-95    
ref|NP_001060219.2|  Os07g0604300                                       300   4e-95    
ref|XP_004488435.1|  PREDICTED: protein COBRA-like                      300   4e-95    
gb|EMT17778.1|  hypothetical protein F775_25414                         300   4e-95    
ref|XP_002884308.1|  phytochelatin synthetase family protein            300   4e-95    
ref|XP_010502988.1|  PREDICTED: COBRA-like protein 2 isoform X1         300   5e-95    
gb|AAM67179.1|  phytochelatin synthetase-like protein                   299   6e-95    
ref|XP_007138374.1|  hypothetical protein PHAVU_009G203100g             300   6e-95    
gb|EMS55416.1|  hypothetical protein TRIUR3_34464                       297   6e-95    
ref|NP_001241986.1|  uncharacterized protein LOC100782876 precursor     300   7e-95    
ref|XP_008775852.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    300   7e-95    
ref|XP_010459308.1|  PREDICTED: COBRA-like protein 1                    300   7e-95    
ref|NP_001105969.1|  brittle stalk-2-like protein 4 precursor           299   9e-95    
ref|XP_010936446.1|  PREDICTED: COBRA-like protein 1                    302   9e-95    
gb|ACG27916.1|  COBRA-like protein 4 precursor                          299   1e-94    
ref|XP_010551800.1|  PREDICTED: COBRA-like protein 1 isoform X2         299   1e-94    
ref|XP_006658783.1|  PREDICTED: COBRA-like protein 1-like               299   1e-94    
ref|NP_566851.1|  COBRA-like protein 2                                  299   1e-94    
ref|XP_010551799.1|  PREDICTED: COBRA-like protein 1 isoform X1         300   2e-94    
gb|EPS71578.1|  hypothetical protein M569_03176                         298   2e-94    
ref|XP_004958241.1|  PREDICTED: COBRA-like protein 1-like               298   2e-94    
dbj|BAB02996.1|  phytochelatin synthetase-like protein                  298   2e-94    
ref|XP_003559986.1|  PREDICTED: COBRA-like protein 1                    298   3e-94    
gb|KEH38144.1|  COBRA-like protein 2 precursor                          298   3e-94    
ref|XP_008777346.1|  PREDICTED: COBRA-like protein 3                    298   4e-94    
ref|XP_008379442.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    297   5e-94    
gb|AAR14311.1|  phytochelatin synthetase                                297   7e-94    
dbj|BAJ86473.1|  predicted protein                                      297   7e-94    
dbj|BAJ91851.1|  predicted protein                                      297   1e-93    
dbj|BAJ99591.1|  predicted protein                                      298   1e-93    
gb|AAO86520.1|  phytochelatin synthetase                                296   2e-93    
gb|KEH25134.1|  COBRA-like protein 2 precursor                          296   2e-93    
gb|EMT31496.1|  hypothetical protein F775_27513                         296   2e-93    
gb|EMS58622.1|  hypothetical protein TRIUR3_14619                       297   2e-93    
emb|CDP20883.1|  unnamed protein product                                296   3e-93    
ref|XP_004304207.1|  PREDICTED: protein COBRA-like                      295   3e-93    
ref|XP_004507298.1|  PREDICTED: protein COBRA-like                      295   4e-93    
ref|XP_010937850.1|  PREDICTED: COBRA-like protein 1                    295   5e-93    
ref|XP_008464583.1|  PREDICTED: COBRA-like protein 1                    294   1e-92    
ref|XP_003557716.1|  PREDICTED: COBRA-like protein 2                    293   2e-92    
ref|XP_006595252.1|  PREDICTED: COBRA-like protein 4-like               284   2e-92    
ref|XP_007210248.1|  hypothetical protein PRUPE_ppa014838mg             292   4e-92    
ref|XP_004137135.1|  PREDICTED: protein COBRA-like                      293   4e-92    
ref|XP_006291010.1|  hypothetical protein CARUB_v10017122mg             293   7e-92    
ref|XP_008240110.1|  PREDICTED: COBRA-like protein 4                    291   1e-91    
gb|KHN08346.1|  COBRA-like protein 4                                    281   2e-91    
ref|NP_001050367.1|  Os03g0416300                                       291   2e-91    
ref|XP_010694055.1|  PREDICTED: protein COBRA-like                      289   8e-91    
gb|AFZ78570.1|  COBRA-like protein                                      288   9e-91    
ref|XP_006651506.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    289   9e-91    
ref|XP_004301102.1|  PREDICTED: COBRA-like protein 4-like               288   1e-90    
ref|XP_002318574.2|  hypothetical protein POPTR_0012s05940g             286   2e-90    
ref|XP_008445923.1|  PREDICTED: COBRA-like protein 4                    285   1e-89    
dbj|BAK04997.1|  predicted protein                                      285   3e-89    
ref|XP_009589623.1|  PREDICTED: protein COBRA-like isoform X2           285   3e-89    
ref|XP_009784022.1|  PREDICTED: protein COBRA-like isoform X2           285   3e-89    
gb|KGN64072.1|  hypothetical protein Csa_1G039860                       284   4e-89    
ref|XP_004137604.1|  PREDICTED: COBRA-like protein 4-like               284   4e-89    
ref|XP_009784021.1|  PREDICTED: protein COBRA-like isoform X1           285   5e-89    
ref|XP_009589615.1|  PREDICTED: protein COBRA-like isoform X1           285   6e-89    
gb|EPS70668.1|  hypothetical protein M569_04090                         282   1e-88    
gb|KGN57605.1|  hypothetical protein Csa_3G225840                       280   1e-88    
ref|XP_004304213.1|  PREDICTED: protein COBRA-like                      283   1e-88    
emb|CDP15248.1|  unnamed protein product                                283   2e-88    
gb|EMS47000.1|  hypothetical protein TRIUR3_01702                       283   3e-88    
ref|XP_004159883.1|  PREDICTED: COBRA-like protein 1-like               280   5e-88    
ref|XP_010548878.1|  PREDICTED: COBRA-like protein 6                    281   6e-88    
ref|XP_004146282.1|  PREDICTED: COBRA-like protein 1-like               281   7e-88    
dbj|BAJ97141.1|  predicted protein                                      281   1e-87    
ref|XP_006431744.1|  hypothetical protein CICLE_v10001652mg             277   2e-87    
ref|XP_011010808.1|  PREDICTED: COBRA-like protein 4                    279   4e-87    
gb|EMT09066.1|  hypothetical protein F775_27360                         280   4e-87    
gb|KDO43549.1|  hypothetical protein CISIN_1g040209mg                   276   1e-86    
ref|XP_010246052.1|  PREDICTED: COBRA-like protein 6                    276   2e-86    
ref|XP_007226624.1|  hypothetical protein PRUPE_ppa022902mg             276   2e-86    
gb|KEH39624.1|  COBRA-like protein 2 precursor                          278   2e-86    
ref|XP_008218770.1|  PREDICTED: COBRA-like protein 6                    275   3e-86    
ref|XP_006471247.1|  PREDICTED: COBRA-like protein 6-like               276   3e-86    
gb|EYU34591.1|  hypothetical protein MIMGU_mgv1a006208mg                277   5e-86    
emb|CDY26444.1|  BnaC09g42240D                                          274   5e-86    
gb|EMS68786.1|  hypothetical protein TRIUR3_15417                       277   5e-86    
gb|EYU44224.1|  hypothetical protein MIMGU_mgv1a019628mg                276   7e-86    
ref|XP_009606715.1|  PREDICTED: COBRA-like protein 4                    275   1e-85    
gb|EMT25608.1|  hypothetical protein F775_09574                         275   3e-85    
ref|XP_008456042.1|  PREDICTED: COBRA-like protein 6                    275   1e-84    
ref|XP_004301494.1|  PREDICTED: protein COBRA-like                      273   2e-84    
ref|XP_009355440.1|  PREDICTED: COBRA-like protein 6                    274   6e-84    
ref|XP_009602800.1|  PREDICTED: COBRA-like protein 6 isoform X2         270   7e-84    
ref|XP_002463861.1|  hypothetical protein SORBIDRAFT_01g007750          270   7e-84    
gb|KHG21688.1|  COBRA-like protein 6                                    268   7e-84    
ref|XP_006363260.1|  PREDICTED: COBRA-like protein 3-like               271   8e-84    
emb|CDY70289.1|  BnaAnng33230D                                          269   9e-84    
ref|XP_004288992.1|  PREDICTED: COBRA-like protein 3-like               271   1e-83    
ref|XP_009602799.1|  PREDICTED: COBRA-like protein 6 isoform X1         270   1e-83    
ref|XP_011087711.1|  PREDICTED: COBRA-like protein 6 isoform X2         269   2e-83    
gb|AFK36034.1|  unknown                                                 266   2e-83    
ref|XP_007042284.1|  COBRA-like protein 6 precursor                     270   3e-83    
ref|XP_008365309.1|  PREDICTED: COBRA-like protein 6                    269   3e-83    
ref|XP_011087710.1|  PREDICTED: COBRA-like protein 6 isoform X1         269   4e-83    
ref|XP_006384995.1|  hypothetical protein POPTR_0004s22890g             267   5e-83    
sp|Q7XR91.2|COBL7_ORYSJ  RecName: Full=COBRA-like protein 7; AltN...    268   6e-83    
emb|CAH67392.1|  H0115B09.4                                             268   7e-83    
ref|XP_010030140.1|  PREDICTED: COBRA-like protein 6 isoform X2         268   1e-82    
ref|XP_009776070.1|  PREDICTED: COBRA-like protein 6 isoform X2         266   1e-82    
ref|XP_010030139.1|  PREDICTED: COBRA-like protein 6 isoform X1         268   1e-82    
ref|XP_011028305.1|  PREDICTED: COBRA-like protein 6                    267   2e-82    
emb|CDM85471.1|  unnamed protein product                                266   2e-82    
ref|XP_010658027.1|  PREDICTED: COBRA-like protein 6                    266   4e-82    
emb|CBI29736.3|  unnamed protein product                                266   4e-82    
ref|XP_004486234.1|  PREDICTED: COBRA-like protein 6-like               266   4e-82    
ref|XP_009776069.1|  PREDICTED: COBRA-like protein 6 isoform X1         266   4e-82    
gb|KEH25133.1|  COBRA-like protein 2 precursor                          263   4e-82    
emb|CDO97585.1|  unnamed protein product                                265   7e-82    
ref|XP_004981736.1|  PREDICTED: COBRA-like protein 3-like               264   2e-81    
ref|XP_002991329.1|  hypothetical protein SELMODRAFT_133233             263   4e-81    
ref|XP_009345837.1|  PREDICTED: COBRA-like protein 6                    263   6e-81    
ref|XP_006349429.1|  PREDICTED: COBRA-like protein 6-like               262   1e-80    
gb|KDO65675.1|  hypothetical protein CISIN_1g040362mg                   259   2e-80    
gb|EYU26510.1|  hypothetical protein MIMGU_mgv1a004710mg                261   5e-80    
ref|XP_010314626.1|  PREDICTED: COBRA-like protein 6 isoform X1         260   2e-79    
ref|XP_004986900.1|  PREDICTED: COBRA-like protein 2-like               256   2e-79    
ref|XP_002987954.1|  hypothetical protein SELMODRAFT_271954             259   2e-79    
gb|EYU26509.1|  hypothetical protein MIMGU_mgv1a004710mg                261   2e-79    
ref|XP_008791642.1|  PREDICTED: COBRA-like protein 7                    258   7e-79    
ref|XP_009110800.1|  PREDICTED: COBRA-like protein 6                    257   2e-78    
ref|XP_006827863.1|  hypothetical protein AMTR_s00008p00083860          255   2e-78    
ref|XP_010919369.1|  PREDICTED: COBRA-like protein 7                    256   2e-78    
gb|AFK41846.1|  unknown                                                 246   6e-78    
gb|EMT13413.1|  hypothetical protein F775_43364                         249   6e-78    
ref|XP_010099318.1|  hypothetical protein L484_018180                   254   7e-78    
ref|XP_006373387.1|  hypothetical protein POPTR_0017s13310g             253   1e-77    
emb|CDY31063.1|  BnaA08g26130D                                          254   2e-77    
ref|XP_006856415.1|  hypothetical protein AMTR_s00047p00217040          251   3e-77    
emb|CDY20671.1|  BnaC08g13870D                                          254   4e-77    
ref|XP_008351897.1|  PREDICTED: COBRA-like protein 1                    248   5e-77    
ref|XP_009397862.1|  PREDICTED: COBRA-like protein 7 isoform X2         252   8e-77    
gb|KDP42406.1|  hypothetical protein JCGZ_00203                         248   1e-76    
ref|XP_002975319.1|  hypothetical protein SELMODRAFT_174860             252   1e-76    
ref|XP_002446868.1|  hypothetical protein SORBIDRAFT_06g023970          252   2e-76    
ref|XP_008669075.1|  PREDICTED: COBRA-like protein 7 isoform X2         251   2e-76    
tpg|DAA05840.1|  TPA: brittle stalk-2-like protein 9                    252   2e-76    
gb|EMT13412.1|  hypothetical protein F775_22458                         242   3e-76    
ref|XP_009397865.1|  PREDICTED: COBRA-like protein 7 isoform X4         250   3e-76    
ref|XP_006417537.1|  hypothetical protein EUTSA_v10007643mg             251   3e-76    
ref|XP_002964476.1|  hypothetical protein SELMODRAFT_405727             251   5e-76    
ref|XP_009397863.1|  PREDICTED: COBRA-like protein 3 isoform X3         249   6e-76    
ref|XP_009397861.1|  PREDICTED: COBRA-like protein 7 isoform X1         249   1e-75    
ref|XP_006373386.1|  hypothetical protein POPTR_0017s13300g             248   3e-75    
ref|XP_006602955.1|  PREDICTED: protein COBRA-like                      248   4e-75    
ref|XP_003581468.2|  PREDICTED: COBRA-like protein 7                    250   5e-75    
ref|XP_001778885.1|  predicted protein                                  248   7e-75    
gb|KHN37929.1|  Protein COBRA                                           246   1e-74    
gb|KDO65678.1|  hypothetical protein CISIN_1g030916mg                   238   1e-74    
gb|AAG12670.1|AC027033_5  unknown protein; 31818-33764                  245   2e-74    
ref|XP_006306034.1|  hypothetical protein CARUB_v10011331mg             246   2e-74    
gb|AAB60732.1|  F21M12.17 gene product                                  246   3e-74    
ref|NP_172450.2|  COBRA-like protein 6 precursor                        246   3e-74    
ref|XP_010475826.1|  PREDICTED: COBRA-like protein 6                    245   5e-74    
ref|XP_010462612.1|  PREDICTED: COBRA-like protein 6                    244   5e-74    
ref|XP_001760765.1|  predicted protein                                  246   5e-74    
gb|EMT16702.1|  hypothetical protein F775_09866                         246   7e-74    
ref|XP_010490321.1|  PREDICTED: COBRA-like protein 6                    244   9e-74    
ref|XP_002892524.1|  hypothetical protein ARALYDRAFT_471080             244   2e-73    
ref|XP_007148542.1|  hypothetical protein PHAVU_006G217400g             242   6e-73    



>ref|XP_011087370.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=435

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 206/233 (88%), Gaps = 2/233 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQLLVS++ TCCVS SSFYN+TIVPC  C+CGC +K +C+KS D+ +LK AG
Sbjct  202  TWNVTCTYSQLLVSKHPTCCVSLSSFYNETIVPCSTCSCGCENKKDCIKS-DSDKLKKAG  260

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTPRKDN  LLQCT HMCPIR+HWHVKINY++YWRVKIA+TNFNY+MNYTQWTLVAQHP
Sbjct  261  INTPRKDNVPLLQCTYHMCPIRIHWHVKINYREYWRVKIAITNFNYRMNYTQWTLVAQHP  320

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGP GNVQ+E+LLKKDK TF
Sbjct  321  NLNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPYGNVQTEILLKKDKNTF  380

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
            TL QGWAFPR+IYFNGDEC+LPPPDAYP LPNSA +   S S  + F++   V
Sbjct  381  TLKQGWAFPRKIYFNGDECQLPPPDAYPTLPNSAHKNLISFSRIAGFMVLVFV  433



>gb|EYU23624.1| hypothetical protein MIMGU_mgv1a006366mg [Erythranthe guttata]
Length=447

 Score =   385 bits (988),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 203/236 (86%), Gaps = 3/236 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ+LVS+   CCVSFSSFYN +I PC  C+CGC +K     SD+ +LK+ GI
Sbjct  212  TWNVTCTYSQVLVSKNPRCCVSFSSFYNDSITPCPTCSCGCQNKKDCIMSDSNKLKNVGI  271

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCPIRVHWHVKINY++YWRVK+AVTNFNY+MNYTQWTLVAQHPN
Sbjct  272  NTPRKDNAPLLQCTHHMCPIRVHWHVKINYREYWRVKVAVTNFNYRMNYTQWTLVAQHPN  331

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDT MFYGMKFYNDLLMEAGP GNVQ+E+LLKKDK+ FT
Sbjct  332  LNNVTQVFSFDYKPLVPYQSINDTAMFYGMKFYNDLLMEAGPYGNVQTEILLKKDKDIFT  391

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGY---YSSSPCSMFLLFFIVV  701
            L QGWAFPR+IYFNGDEC+LPPPDAYP LPNSA +     +S     MFLLF +VV
Sbjct  392  LKQGWAFPRKIYFNGDECQLPPPDAYPILPNSAHKNLIFSFSILEGLMFLLFLVVV  447



>ref|XP_009606716.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=456

 Score =   385 bits (988),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 203/234 (87%), Gaps = 0/234 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+Y +CCVSFS+FYN TI PC  CACGC+HK+    SD+++LK  GI
Sbjct  222  TWNVTCTYSQFLASKYPSCCVSFSTFYNDTITPCPTCACGCSHKHNCIMSDSEKLKKKGI  281

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCPIRVHWHVKINYKDYWRVKIA+TNFNY++NYTQWTLVAQHPN
Sbjct  282  NTPRKDNEPLLQCTHHMCPIRVHWHVKINYKDYWRVKIAITNFNYRLNYTQWTLVAQHPN  341

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSFNYKPLVPYQS+NDTGMFYGMKFYNDLLMEAGP+GNVQSEVL++KDKE+FT
Sbjct  342  LNNVTQVFSFNYKPLVPYQSVNDTGMFYGMKFYNDLLMEAGPAGNVQSEVLMQKDKESFT  401

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVS  704
            L  GW FPRR+YFNG ECKLPPPD+YP LPNS  +  +S S   + +++ I ++
Sbjct  402  LKSGWGFPRRVYFNGAECKLPPPDSYPTLPNSTEKRPFSFSITVICMIWMIFLT  455



>ref|XP_004236068.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=447

 Score =   381 bits (979),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 201/233 (86%), Gaps = 3/233 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+Y +CCVSFS+FYN TI PC  CACGC HK+     D+++LK  GI
Sbjct  213  TWNVTCTYSQFLSSKYPSCCVSFSTFYNDTITPCPSCACGCNHKHNCIMGDSEKLKRKGI  272

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRK+N  LLQCT+HMCPIRVHWHVK+NYKDYWRVKIA+TNFNY+ N+T WTLVAQHPN
Sbjct  273  NTPRKNNEPLLQCTHHMCPIRVHWHVKLNYKDYWRVKIAITNFNYRQNHTHWTLVAQHPN  332

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL++KDK TFT
Sbjct  333  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLMQKDKNTFT  392

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS---SSPCSMFLLFF  692
            L  GW FPRR+YFNGDECKLPPPD+YP LPNSA +G +S   ++ C++ ++F 
Sbjct  393  LKSGWGFPRRVYFNGDECKLPPPDSYPILPNSAEKGPFSFSNTAICTILMIFL  445



>ref|XP_010260547.1| PREDICTED: COBRA-like protein 4 [Nelumbo nucifera]
Length=451

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  +  +CCVSFSSFYN TI PC  CACGC  KN    SD+K L   GI
Sbjct  218  TWNVTCTYSQFLARKNPSCCVSFSSFYNNTITPCPSCACGCQSKNNCIKSDSKLLNVLGI  277

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCPIRVHWHVK+NYKDYWRVKIA+TNFNY+MNYTQWTLVAQHPN
Sbjct  278  NTPRKDNAPLLQCTHHMCPIRVHWHVKLNYKDYWRVKIAITNFNYRMNYTQWTLVAQHPN  337

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGP GNVQSE+LL+K+KETFT
Sbjct  338  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPLGNVQSEILLQKNKETFT  397

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAI  644
            L QGWAFPRR+YFNGDEC LPPPDAYP LPNSA 
Sbjct  398  LKQGWAFPRRVYFNGDECMLPPPDAYPFLPNSAF  431



>ref|XP_009780773.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=461

 Score =   380 bits (977),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 201/233 (86%), Gaps = 2/233 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+Y +CCVSFS+FYN TI PC  CACGC  K+    SD+++LK  GI
Sbjct  227  TWNVTCTYSQFLASKYPSCCVSFSTFYNDTITPCPTCACGCNRKHNCIMSDSEKLKKKGI  286

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCPIRVHWHVKINYKDYWRVKIA+TNFNY++NYTQWTLVAQHPN
Sbjct  287  NTPRKDNEPLLQCTHHMCPIRVHWHVKINYKDYWRVKIAITNFNYRLNYTQWTLVAQHPN  346

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSFNYKPLVPYQS+NDTGMFYGMKFYNDLLMEAGP+GNVQSEVL++KDKE+FT
Sbjct  347  LNNVTQVFSFNYKPLVPYQSVNDTGMFYGMKFYNDLLMEAGPAGNVQSEVLMQKDKESFT  406

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPN-SAIRGY-YSSSPCSMFLLFFI  695
            L  GW FPRR+YFNG ECKLPPPD+YP LPN +  R + +SS+   M L+ F+
Sbjct  407  LKSGWGFPRRVYFNGAECKLPPPDSYPTLPNFTEKRPFSFSSTVICMILMIFL  459



>emb|CDP20884.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   379 bits (974),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/222 (79%), Positives = 196/222 (88%), Gaps = 2/222 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TW VTCTYSQ+L S+Y +CCVSFSSFYN+T+ PC  CACGC +K     SD+KRL + GI
Sbjct  228  TWTVTCTYSQILSSKYPSCCVSFSSFYNETMTPCPSCACGCHNKRDCIMSDSKRLNTLGI  287

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCPIRVHWHVKINY+DYWRVKIAVTNFNY+MNYTQWTLVAQHPN
Sbjct  288  NTPKKDNTPLLQCTHHMCPIRVHWHVKINYRDYWRVKIAVTNFNYRMNYTQWTLVAQHPN  347

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            L+NVTQVFSF+YKPLVPYQ+INDT MFYGMKFYNDLLMEAGP GNVQSEVLL+KDK TFT
Sbjct  348  LSNVTQVFSFDYKPLVPYQAINDTAMFYGMKFYNDLLMEAGPLGNVQSEVLLRKDKTTFT  407

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA--IRGYYSS  662
            L QGW FPR+IYFNGDECKLPPPD+YP LPNSA  I  +YS+
Sbjct  408  LKQGWGFPRKIYFNGDECKLPPPDSYPFLPNSAHEIPSFYST  449



>gb|KHG27746.1| COBRA-like protein 4 [Gossypium arboreum]
Length=420

 Score =   378 bits (970),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 177/235 (75%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L ++   CCVSFSSFYNQTI PC  CACGC +KN    SD+K+    GI
Sbjct  186  TWNVTCTYSQFLAAKNPKCCVSFSSFYNQTITPCPKCACGCQNKNNCVVSDSKQAHKKGI  245

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCPIRVHWHVK+NYKDYWRVKIAVTNFNY+MNYTQWTLVAQHPN
Sbjct  246  NTPRKDNAPLLQCTHHMCPIRVHWHVKLNYKDYWRVKIAVTNFNYRMNYTQWTLVAQHPN  305

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LN VTQVFSF+YKPLVPY++INDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+K+K+TFT
Sbjct  306  LNAVTQVFSFDYKPLVPYEAINDTGMFYGMKFYNDLLMEAGPQGNVQSEVLLRKNKDTFT  365

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA-IRGYYSSSPCSMFLLFFIVVS  704
               GWAFPR++YFNGDEC LPPPDAYP LPNSA +     S+     LLF  ++S
Sbjct  366  FRHGWAFPRKVYFNGDECLLPPPDAYPFLPNSAKVNSITISTMVVSALLFLFIIS  420



>ref|XP_006345105.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=455

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 200/233 (86%), Gaps = 3/233 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+Y +CCVSFS+FYN TI PC  CACGC HK+     D+++LK  GI
Sbjct  221  TWNVTCTYSQFLSSKYPSCCVSFSTFYNDTITPCPSCACGCNHKHNCIMGDSEKLKRKGI  280

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVKIA+TNFNY+ N++ WTLVAQHPN
Sbjct  281  NTPRKDNEPLLQCTHHMCPIRVHWHVKLNYKDYWRVKIAITNFNYRQNHSHWTLVAQHPN  340

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL++KDK TFT
Sbjct  341  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLMQKDKNTFT  400

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS---SSPCSMFLLFF  692
            L  GW FPRR+YFNGDECKLPPPD+YP LPNSA +  +S   ++ C++ ++F 
Sbjct  401  LKSGWGFPRRVYFNGDECKLPPPDSYPILPNSAEKRPFSFSNTAICTILMIFL  453



>ref|XP_002514628.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF47734.1| Protein COBRA precursor, putative [Ricinus communis]
Length=461

 Score =   377 bits (969),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  TCCVS SSFYN+TI PC  CACGC +KN    SD+K     GI
Sbjct  227  TWNVTCTYSQFLASKNPTCCVSLSSFYNETITPCPSCACGCRNKNSCIMSDSKEAHRKGI  286

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK+NYKDYWR K+AVTNFNY+MNYTQWTLV QHPN
Sbjct  287  NTPKKDNTPLLQCTHHMCPVRVHWHVKVNYKDYWRAKVAVTNFNYRMNYTQWTLVVQHPN  346

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GN+QSEVLL+KD+ TFT
Sbjct  347  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNIQSEVLLRKDRNTFT  406

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
            L QGWAFPR++YFNGDECK+PPPDAYP+LPNSA R
Sbjct  407  LKQGWAFPRKVYFNGDECKMPPPDAYPYLPNSAYR  441



>ref|XP_011099033.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=433

 Score =   374 bits (960),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 198/235 (84%), Gaps = 2/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN+TI  C  CACGC +KN    SD+K L   G+
Sbjct  198  TWNVTCTYSQFLARKHPSCCVSFSSFYNETITSCPSCACGCENKNKCIKSDSKLLSVVGV  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  L+QCT+HMCP+RVHWHVK+NYKDYWRVKIAVTNFNY+MNYTQWTLV QHPN
Sbjct  258  NTPRKDNTPLIQCTHHMCPVRVHWHVKVNYKDYWRVKIAVTNFNYRMNYTQWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFDYKPLVPYGSINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA--IRGYYSSSPCSMFLLFFIVV  701
            L QGWAFPR++YFNG+EC LPPPDAYP LPNSA   R + S S  S+ +L  I++
Sbjct  378  LKQGWAFPRKVYFNGEECMLPPPDAYPFLPNSAHLSRAFISVSMFSIVVLSLIMM  432



>gb|AFZ78569.1| COBRA-like protein [Populus tomentosa]
Length=453

 Score =   374 bits (959),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 195/232 (84%), Gaps = 0/232 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  TCCVSFSSFYN+TI PC  CACGC +KN    S++K     GI
Sbjct  219  TWNVTCTYSQFLASKNPTCCVSFSSFYNETITPCPTCACGCQNKNSCVKSNSKESHKKGI  278

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCPIRVHWHVK+NY+DYWR K+AVTNFNY+MNYT+WTLV QHPN
Sbjct  279  NTPKKDNTPLLQCTHHMCPIRVHWHVKVNYRDYWRAKVAVTNFNYRMNYTEWTLVVQHPN  338

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVT+VFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KDK TF+
Sbjct  339  LNNVTRVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLQKDKNTFS  398

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
            L QGWAFPR++YFNGDEC+LPPPD YP+LPNSA     S    +  LLF ++
Sbjct  399  LKQGWAFPRKVYFNGDECRLPPPDTYPYLPNSAYANPTSILSMAASLLFILL  450



>ref|XP_008393239.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=436

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 195/233 (84%), Gaps = 4/233 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TIVPC  CACGC   KNCV S D+K    AG
Sbjct  198  TWNVTCTYSQFLASKNPSCCVSFSSFYNETIVPCPSCACGCHNKKNCVMS-DSKLAHKAG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN+ LLQCT+HMCPIRVHWHVK NYKDYWRVK+AVTNFNY+MNYT+WTLV QHP
Sbjct  257  INTPKKDNSPLLQCTHHMCPIRVHWHVKQNYKDYWRVKMAVTNFNYRMNYTEWTLVVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF YKPLVPYQS+NDTGMFYGMKFYNDLLMEAGPSGN+QSEVL++KD+ TF
Sbjct  317  NLNNVTQVFSFGYKPLVPYQSVNDTGMFYGMKFYNDLLMEAGPSGNIQSEVLMQKDQNTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS--SSPCSMFLLFF  692
            T  QGWAFPR++YFNGDEC LPPPDAYP LPNS      S      SM L+ F
Sbjct  377  TFKQGWAFPRKVYFNGDECMLPPPDAYPSLPNSGHVNSISILQKAASMLLIMF  429



>ref|XP_008240086.1| PREDICTED: COBRA-like protein 4 [Prunus mume]
Length=461

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 200/239 (84%), Gaps = 5/239 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TIVPC  CACGC   KNC+KS D+K     G
Sbjct  223  TWNVTCTYSQFLASKNPSCCVSFSSFYNETIVPCPSCACGCHNKKNCIKS-DSKLAHKTG  281

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN  LLQCT+HMCPIRVHWHVK+NYK YWRVKI++TNFNY+MNYT+WTLVAQHP
Sbjct  282  INTPKKDNTPLLQCTHHMCPIRVHWHVKLNYKAYWRVKISITNFNYRMNYTEWTLVAQHP  341

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPL+PY+SINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLL+KD+ TF
Sbjct  342  NLNNVTQVFSFDYKPLLPYESINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLQKDQNTF  401

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA---IRGYYSSSPCSMFLLFFIVVSI  707
            T  QGWAFPRR+YFNGDEC LPPPDAYP LPNSA       +  +   + +LF I  S+
Sbjct  402  TFKQGWAFPRRVYFNGDECMLPPPDAYPALPNSAHVNSISIFKMAASVLLILFSICFSL  460



>ref|XP_010936445.1| PREDICTED: COBRA-like protein 4 [Elaeis guineensis]
Length=466

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/237 (73%), Positives = 201/237 (85%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+   CCVSFSSFYN TI PC  CACGC +KNC+KS D+K L +AGI
Sbjct  231  TWNVTCTYSQFLASKNPPCCVSFSSFYNTTITPCPKCACGCRNKNCIKS-DSKLLTAAGI  289

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCPIRVHWHVK+NYKDYWR K+A+TNFNY++NYTQWTLV QHPN
Sbjct  290  NTPRKDNAPLLQCTHHMCPIRVHWHVKLNYKDYWRAKVAITNFNYRLNYTQWTLVIQHPN  349

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQ+FSF+YKPLV Y SINDTGMFYGMK+YNDLLMEAGP GNVQSEVL +K+++TFT
Sbjct  350  LNNVTQLFSFDYKPLVSYGSINDTGMFYGMKYYNDLLMEAGPLGNVQSEVLFQKEQDTFT  409

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA---IRGYYSSSPCSMFLLFFIVVS  704
            L QGWAFPR++YFNGDEC +PPPD+YPHLPNSA   +     +   S+ LL  +V++
Sbjct  410  LKQGWAFPRKVYFNGDECAMPPPDSYPHLPNSAHVSVPVMLKTFATSVLLLMVMVLA  466



>ref|XP_006338344.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=434

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVS SSFYN+TI  C  CACGC ++N    SD+K L   G+
Sbjct  200  TWNVTCTYSQFLARKHPSCCVSMSSFYNETITTCPSCACGCENRNKCIKSDSKLLSVVGV  259

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA L+QCT+HMCPIRVHWHVK+NYKDYWRVK+ VTNFNY++NYTQWTLV QHPN
Sbjct  260  NTPRKDNAPLIQCTHHMCPIRVHWHVKLNYKDYWRVKLTVTNFNYRINYTQWTLVVQHPN  319

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSG VQSEVLL+KDKETF+
Sbjct  320  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGTVQSEVLLQKDKETFS  379

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
             NQGWAFPR++YFNGDEC LPPPD YP+LPNSA R
Sbjct  380  FNQGWAFPRKVYFNGDECMLPPPDTYPYLPNSAHR  414



>ref|XP_010695259.1| PREDICTED: COBRA-like protein 4 [Beta vulgaris subsp. vulgaris]
Length=464

 Score =   373 bits (957),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+   CCVSFSSFYN+TIVPC  C+CGC +K      ++K+  S GI
Sbjct  231  TWNVTCTYSQFLASKNPACCVSFSSFYNETIVPCASCSCGCQNKGSCIRINSKKSHSVGI  290

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDNA LLQCT+HMCPIRVHWHVKINYKDYWR KI+VTNFNY++NYTQWTLV QHPN
Sbjct  291  NTPKKDNAPLLQCTHHMCPIRVHWHVKINYKDYWRAKISVTNFNYRLNYTQWTLVVQHPN  350

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQS+NDTGMFYG KFYNDLLMEAGP GNVQSEVLL+KD  TFT
Sbjct  351  LNNVTQVFSFDYKPLVPYQSVNDTGMFYGTKFYNDLLMEAGPGGNVQSEVLLRKDANTFT  410

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L QGWAFPR++YFNGDECKLPPPDAYP LPNSA
Sbjct  411  LKQGWAFPRKVYFNGDECKLPPPDAYPALPNSA  443



>ref|XP_006363258.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=434

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 199/234 (85%), Gaps = 2/234 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  ++  CCVS S+FYN+TI  C  CACGC +K+    SD+K L   G+
Sbjct  200  TWNVTCTYSQFVAQKHPKCCVSLSTFYNETITSCPSCACGCENKHKCIKSDSKLLSMVGV  259

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT HMCP+R+HWHVK+NYK+YWRVKI +TNFNY++NYTQWTLVAQHPN
Sbjct  260  NTPRKDNAPLLQCTQHMCPVRIHWHVKLNYKEYWRVKITLTNFNYRVNYTQWTLVAQHPN  319

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGP+GNVQSEVLL+KDK+TFT
Sbjct  320  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPAGNVQSEVLLQKDKDTFT  379

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGY--YSSSPCSMFLLFFIV  698
            L QGWAFPR++YFNGDEC LPPPD YP+LPN A +    +S+  CS+FL+  ++
Sbjct  380  LKQGWAFPRKVYFNGDECMLPPPDTYPYLPNFAHQNLVAFSTLFCSIFLILLVL  433



>ref|XP_007209118.1| hypothetical protein PRUPE_ppa005430mg [Prunus persica]
 gb|EMJ10317.1| hypothetical protein PRUPE_ppa005430mg [Prunus persica]
Length=461

 Score =   373 bits (957),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 199/239 (83%), Gaps = 5/239 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TIVPC  CACGC   KNC+KS D+K     G
Sbjct  223  TWNVTCTYSQFLASKNPSCCVSFSSFYNETIVPCPSCACGCHNKKNCIKS-DSKLAHKTG  281

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN  LLQCT+HMCPIRVHWHVK+NYK YWRVKI++TNFNY+MNYT+WTLVAQHP
Sbjct  282  INTPKKDNTPLLQCTHHMCPIRVHWHVKLNYKAYWRVKISITNFNYRMNYTEWTLVAQHP  341

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF YKPL+PY+SINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLL+KD+ TF
Sbjct  342  NLNNVTQVFSFGYKPLLPYESINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLQKDQNTF  401

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA---IRGYYSSSPCSMFLLFFIVVSI  707
            T  QGWAFPRR+YFNGDEC LPPPDAYP LPNSA       +  +   + +LF I  S+
Sbjct  402  TFKQGWAFPRRVYFNGDECMLPPPDAYPALPNSAHVNSISIFKMAASVLLILFSICFSL  460



>ref|XP_008351868.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=458

 Score =   372 bits (955),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 195/233 (84%), Gaps = 4/233 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TIVPC  CACGC   KNCV S D+K    AG
Sbjct  220  TWNVTCTYSQFLASKNPSCCVSFSSFYNETIVPCPSCACGCHNKKNCVMS-DSKLAHKAG  278

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN+ LLQCT+HMCPIRVHWHVK NYKDYWRVK+AVTNFNY+MNYT+WTLV QHP
Sbjct  279  INTPKKDNSPLLQCTHHMCPIRVHWHVKQNYKDYWRVKMAVTNFNYRMNYTEWTLVVQHP  338

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF YKPLVPYQS+NDTGMFYGMKFYNDLLMEAGPSGN+QSEVL++KD+ TF
Sbjct  339  NLNNVTQVFSFGYKPLVPYQSVNDTGMFYGMKFYNDLLMEAGPSGNIQSEVLMQKDQNTF  398

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS--SSPCSMFLLFF  692
            T  QGWAFPR++YFNGDEC LPPPDAYP LPNS      S      SM L+ F
Sbjct  399  TFKQGWAFPRKVYFNGDECMLPPPDAYPSLPNSGHVNSISILQKAASMLLIMF  451



>gb|KDP31374.1| hypothetical protein JCGZ_11750 [Jatropha curcas]
Length=458

 Score =   372 bits (955),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 196/232 (84%), Gaps = 0/232 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TI PC  CACGC +K+    S++K     GI
Sbjct  223  TWNVTCTYSQFLASKNPSCCVSFSSFYNETITPCPSCACGCQNKHNCIMSNSKEAHKKGI  282

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK+NYKDYWR K+AVTNFNY++NYTQWTLV QHPN
Sbjct  283  NTPKKDNTPLLQCTHHMCPVRVHWHVKVNYKDYWRAKLAVTNFNYRLNYTQWTLVVQHPN  342

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KDK TFT
Sbjct  343  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLRKDKSTFT  402

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
            L QGWAFPR++YFNGDECKLPPPDAYP+LPNSA     + S  +  L+  ++
Sbjct  403  LKQGWAFPRKVYFNGDECKLPPPDAYPYLPNSACSNTVAFSTIAASLVLILL  454



>ref|XP_004299286.1| PREDICTED: COBRA-like protein 4-like [Fragaria vesca subsp. vesca]
Length=455

 Score =   372 bits (954),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 199/235 (85%), Gaps = 4/235 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQLL S+  +CCVSFSSFYN+T+VPC  C+CGC   K+C+K  D+K L+ AG
Sbjct  221  TWNVTCTYSQLLASKNPSCCVSFSSFYNETVVPCPSCSCGCHNKKDCIKG-DSKLLQKAG  279

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTPRKDN  LLQCT+HMCPIRVHWHVK NYKDYWRVKI+VTNFNY++NYT+WTLVAQHP
Sbjct  280  INTPRKDNTPLLQCTHHMCPIRVHWHVKQNYKDYWRVKISVTNFNYRLNYTEWTLVAQHP  339

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNN+TQVFSF+YKPLV YQSINDTGMFYGMKFYNDLLMEAGP GNVQSEVL++KDK TF
Sbjct  340  NLNNITQVFSFDYKPLVAYQSINDTGMFYGMKFYNDLLMEAGPLGNVQSEVLMQKDKNTF  399

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS--SSPCSMFLLFFIV  698
            T  QGWAFPR++YFNGDEC+LPPPDAYP LPNS      S      S+ L+ F +
Sbjct  400  TFKQGWAFPRKVYFNGDECRLPPPDAYPSLPNSGHVDSVSILKMAASLLLIMFCI  454



>ref|XP_008775851.1| PREDICTED: COBRA-like protein 4 [Phoenix dactylifera]
Length=466

 Score =   372 bits (954),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+   CCVSFSSFYN TI PC  CACGC +KNC+KS D+KRL  AGI
Sbjct  231  TWNVTCTYSQFLASKNPPCCVSFSSFYNSTITPCPKCACGCRNKNCIKS-DSKRLTGAGI  289

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCPIRVHWHVK+NYKDYWR KIA+TNFNY++NYTQW+LV QHPN
Sbjct  290  NTPRKDNAPLLQCTHHMCPIRVHWHVKLNYKDYWRAKIAITNFNYRLNYTQWSLVIQHPN  349

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LN+VTQVFSF+YKPL+PY SINDTGMFYGMKFYNDLLMEAG  GNVQSEVLL+KD++TFT
Sbjct  350  LNHVTQVFSFDYKPLLPYGSINDTGMFYGMKFYNDLLMEAGALGNVQSEVLLQKDQDTFT  409

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L QGWAFPR++YFNGDEC +P PD+YP+LPNSA
Sbjct  410  LKQGWAFPRKVYFNGDECAMPSPDSYPYLPNSA  442



>ref|XP_009346173.1| PREDICTED: COBRA-like protein 4 [Pyrus x bretschneideri]
Length=457

 Score =   371 bits (953),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S++ +CCVSFSSFYN+TIVPC+ CACGC +KN    SD+      GI
Sbjct  220  TWNVTCTYSQFLASKHPSCCVSFSSFYNETIVPCKSCACGCHNKNTCLKSDSVLAHKTGI  279

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN+ LLQCT+HMCPIRVHWHVK NYKDYWRVK++VTNFNY+MNYT+WTLVAQHPN
Sbjct  280  NTPKKDNSPLLQCTHHMCPIRVHWHVKQNYKDYWRVKMSVTNFNYRMNYTEWTLVAQHPN  339

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPL+PYQS+NDTGMFYGMKFYNDLLMEAGP GN+QSEVL++KD+ TFT
Sbjct  340  LNNVTQVFSFDYKPLIPYQSVNDTGMFYGMKFYNDLLMEAGPLGNIQSEVLMRKDQNTFT  399

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC LPPPDAYP LPNS 
Sbjct  400  FKQGWAFPRRVYFNGDECMLPPPDAYPSLPNSG  432



>ref|XP_011085598.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=431

 Score =   370 bits (951),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 195/233 (84%), Gaps = 4/233 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  ++ +CCVSFSSFYN+TI+PC  CACGC +K+     D+K L   G+
Sbjct  198  TWNVTCTYSQFIAQKHPSCCVSFSSFYNETIIPCPSCACGCENKDKCIKRDSKLLSVVGV  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MNYTQWTLV QHPN
Sbjct  258  NTPRKDNTPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAITNFNYRMNYTQWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY SINDTGMFYGMKFYN+L MEAGP GN+QSEVLL+KD  TFT
Sbjct  318  LNNVTQVFSFDYKPLVPYGSINDTGMFYGMKFYNELFMEAGPFGNLQSEVLLQKDINTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            L QGWAFPR++YFNGDEC LPPPD+YP LPNSA    + + P +  L FF V+
Sbjct  378  LKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA----HPTQPFTSLLFFFSVI  426



>emb|CDP21871.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   369 bits (947),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 196/235 (83%), Gaps = 2/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN+TI PC  CACGC +K     SD+K L   GI
Sbjct  163  TWNVTCTYSQFLARKHPSCCVSFSSFYNETITPCASCACGCENKKKCIKSDSKLLSVVGI  222

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCP+RVHWHVKINY+DYWR KIA+TNFNY+MNYTQWTLV QHPN
Sbjct  223  NTPRKDNAPLLQCTHHMCPVRVHWHVKINYRDYWRAKIAITNFNYRMNYTQWTLVVQHPN  282

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPL PY +INDTGMFYGMKFYNDLLMEAG  GNVQSEVLL+KDK+TFT
Sbjct  283  LNNVTQVFSFDYKPLEPYGAINDTGMFYGMKFYNDLLMEAGQFGNVQSEVLLRKDKDTFT  342

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRG--YYSSSPCSMFLLFFIVV  701
            L QGWAFPR++YFNGDEC +PPP+AYP LPNSA +    +S+  CS+  L  + +
Sbjct  343  LKQGWAFPRKVYFNGDECMMPPPEAYPFLPNSANQNPVRFSTWICSVLTLLIVWI  397



>gb|KHG07276.1| COBRA-like protein 4 [Gossypium arboreum]
 gb|KHG08964.1| COBRA-like protein 4 [Gossypium arboreum]
Length=433

 Score =   370 bits (950),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/236 (72%), Positives = 198/236 (84%), Gaps = 0/236 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  +   CCVSFSSFYN+TI PC  CACGC +KN    SD+K LK  G+
Sbjct  198  TWNVTCTYSQFLARKNPNCCVSFSSFYNETITPCPTCACGCQNKNNCVKSDSKFLKMVGL  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCP+RVHWHVK+NYK+YWRVK+++TNFNY+MNYT W+LV QHPN
Sbjct  258  NTPRKDNAPLLQCTHHMCPVRVHWHVKLNYKEYWRVKVSITNFNYRMNYTLWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMK+YNDLLMEAGP GNVQSEVLL+KDK+TFT
Sbjct  318  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKYYNDLLMEAGPLGNVQSEVLLRKDKDTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              QGWAFPR++YFNGDEC LPPPD YP LPNSA +    +S   +  +FF+ V+ +
Sbjct  378  FKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSAHQHLSFTSFTFIAAMFFLFVTFW  433



>ref|XP_009761753.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=434

 Score =   370 bits (950),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  ++ TCCVS S+FYN+TI PC  CACGC +K+    SD+K L   GI
Sbjct  200  TWNVTCTYSQFIAQKHPTCCVSLSTFYNETITPCPSCACGCENKHKCIKSDSKLLSVVGI  259

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN+ LLQCT+HMCP+RVHWHVK+NYKDYWRVKI +TNFNY++N+TQWTLVAQHPN
Sbjct  260  NTPRKDNSPLLQCTHHMCPVRVHWHVKLNYKDYWRVKITITNFNYRVNHTQWTLVAQHPN  319

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLL+KDK+TFT
Sbjct  320  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLQKDKDTFT  379

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP+LPN A
Sbjct  380  FKQGWAFPRKVYFNGDECMLPPPDTYPYLPNLA  412



>ref|XP_006374429.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
 gb|ABK96050.1| unknown [Populus trichocarpa]
 gb|ERP52226.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
Length=453

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  TCCVSFSSFYN+TI PC  CACGC +KN    S++K     GI
Sbjct  219  TWNVTCTYSQFLASKNPTCCVSFSSFYNETITPCPTCACGCQNKNSCVKSNSKESHKKGI  278

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCPIRVHWHVK+NY+DYWR K+AVTNFNY+MNYT+WTLV QHPN
Sbjct  279  NTPKKDNTPLLQCTHHMCPIRVHWHVKVNYRDYWRAKVAVTNFNYRMNYTEWTLVVQHPN  338

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KDK TF+
Sbjct  339  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLQKDKNTFS  398

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L QGWAFPR++YFNGDEC LPPPD YP+LPNSA
Sbjct  399  LKQGWAFPRKVYFNGDECMLPPPDTYPYLPNSA  431



>gb|KHG24029.1| COBRA-like protein 4 [Gossypium arboreum]
Length=430

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 197/236 (83%), Gaps = 0/236 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  +  +CCVSFSSFYN+TI PC  CACGC +KN    S +K LK AG+
Sbjct  195  TWNVTCTYSQFLARKNPSCCVSFSSFYNETITPCPTCACGCQNKNSCVKSGSKVLKRAGV  254

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCP+RVHWHVK+NYK+YWRVK+++ NFNY+MNYT W+L  QHPN
Sbjct  255  NTPRKDNIPLLQCTHHMCPVRVHWHVKVNYKEYWRVKVSIINFNYRMNYTLWSLAVQHPN  314

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LN+VTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KDK+TFT
Sbjct  315  LNDVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLRKDKDTFT  374

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
            L QGWAFPR++YFNGDEC LPPPD YP LPNSA      S   ++  + F++V+++
Sbjct  375  LKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSAPHQQLFSGLTAIAAMVFLLVTVW  430



>ref|XP_006650197.1| PREDICTED: COBRA-like protein 5-like [Oryza brachyantha]
Length=450

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 187/223 (84%), Gaps = 10/223 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS----------  152
            TW VTCTYSQ L SRY TCCVSFSSFYN TIVPC  CACGC                   
Sbjct  203  TWTVTCTYSQQLASRYPTCCVSFSSFYNSTIVPCAKCACGCGAARSTSGGHSAGTECIMG  262

Query  153  DTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYT  332
            D+KR  SAG+NTPRKD A LLQCT+HMCPIRVHWHVK+NYKDYWR KIA+TNFNY+MNYT
Sbjct  263  DSKRALSAGVNTPRKDGAPLLQCTSHMCPIRVHWHVKLNYKDYWRAKIAITNFNYRMNYT  322

Query  333  QWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEV  512
            QWTLVAQHPNLNNVT+VFSF YKPL+PY +INDTGMFYG+KFYNDLLMEAGP GNVQSEV
Sbjct  323  QWTLVAQHPNLNNVTEVFSFQYKPLLPYGNINDTGMFYGLKFYNDLLMEAGPFGNVQSEV  382

Query  513  LLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L++KD +TFT +QGWAFPR+IYFNGDECK+PPPD+YP+LPNSA
Sbjct  383  LMRKDDKTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNSA  425



>ref|XP_007032846.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
 gb|EOY03772.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
Length=432

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 198/233 (85%), Gaps = 2/233 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVSFSSFYN+TI PC  CACGC +K NCVKS D+K LK  G
Sbjct  198  TWNVTCTYSQFLARKNPNCCVSFSSFYNETITPCPSCACGCQNKKNCVKS-DSKILKMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NTPRKDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVK+++TNFNY++NYT W+LV QHP
Sbjct  257  VNTPRKDNAPLLQCTHHMCPVRVHWHVKLNYKDYWRVKVSITNFNYRLNYTLWSLVVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMK+YNDLLMEAGP GNVQSEVLL+KD+ TF
Sbjct  317  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKYYNDLLMEAGPFGNVQSEVLLQKDQNTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
            T  +GWAFPR++YFNGDEC LPPPD YP LPNSA +  +S S     +LF ++
Sbjct  377  TFKEGWAFPRKVYFNGDECMLPPPDTYPFLPNSAHQDLFSISTVIAAILFLLM  429



>ref|XP_006440799.1| hypothetical protein CICLE_v10020292mg [Citrus clementina]
 gb|ESR54039.1| hypothetical protein CICLE_v10020292mg [Citrus clementina]
Length=423

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TI PC  CACGC +KN    S++K     GI
Sbjct  189  TWNVTCTYSQFLASKNPSCCVSFSSFYNETITPCPSCACGCHNKNNCIMSNSKAAHRTGI  248

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY+MNYTQWTLVAQHPN
Sbjct  249  NTPKKDNTPLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYRMNYTQWTLVAQHPN  308

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSE+LL+K+K+TFT
Sbjct  309  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPQGNVQSELLLQKNKDTFT  368

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  369  FKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  401



>ref|XP_009589606.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=434

 Score =   369 bits (946),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  ++ +CCVS S+FYN+TI PC  CACGC +K+    SD+K L   GI
Sbjct  200  TWNVTCTYSQFIAQKHPSCCVSLSTFYNETITPCPSCACGCENKHKCIKSDSKLLSVVGI  259

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN+ LLQCT+HMCP+RVHWHVK+NYKDYWRVKI +TNFNY++N+TQWTLVAQHPN
Sbjct  260  NTPRKDNSPLLQCTHHMCPVRVHWHVKLNYKDYWRVKITITNFNYRVNHTQWTLVAQHPN  319

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLL+KDK+TFT
Sbjct  320  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLQKDKDTFT  379

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP+LPN A
Sbjct  380  FKQGWAFPRKVYFNGDECMLPPPDTYPYLPNFA  412



>ref|XP_006477707.1| PREDICTED: COBRA-like protein 4-like [Citrus sinensis]
Length=449

 Score =   369 bits (947),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 199/236 (84%), Gaps = 1/236 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TI PC  CACGC +KN    S++K     GI
Sbjct  215  TWNVTCTYSQFLASKNPSCCVSFSSFYNETITPCPSCACGCHNKNNCIMSNSKAAHRTGI  274

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCPIRVHWHVK+NYK+YWRVK+A+TNFNY+MNYTQWTLVAQHPN
Sbjct  275  NTPKKDNTPLLQCTHHMCPIRVHWHVKVNYKEYWRVKVAITNFNYRMNYTQWTLVAQHPN  334

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSE+LL+K+K+TFT
Sbjct  335  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPQGNVQSELLLQKNKDTFT  394

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              QGWAFPR++YFNGDEC LPPPD YP LPNSA     +S   +  +L  +V+SI+
Sbjct  395  FKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSANANPITSLTMAASVL-LVVLSIW  449



>ref|XP_008374649.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=461

 Score =   369 bits (948),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S++ +CCVSFSSFYN+TIVPC  CACGC +KN    SD+      GI
Sbjct  220  TWNVTCTYSQFLASKHPSCCVSFSSFYNETIVPCPSCACGCHNKNNCLKSDSVLAHKTGI  279

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN+ LLQCT+HMCPIRVHWHVK NYKDYWRVK++VTNFNY+MNYT+WTLVAQHPN
Sbjct  280  NTPKKDNSPLLQCTHHMCPIRVHWHVKQNYKDYWRVKMSVTNFNYRMNYTEWTLVAQHPN  339

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPL+PYQS+NDTGMFYGMKFYNDLLMEAGP GN+QSEVL++KD+ TFT
Sbjct  340  LNNVTQVFSFDYKPLIPYQSVNDTGMFYGMKFYNDLLMEAGPLGNIQSEVLMRKDQNTFT  399

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC LPPPDAYP LPNS 
Sbjct  400  FKQGWAFPRRVYFNGDECMLPPPDAYPSLPNSG  432



>ref|XP_010257979.1| PREDICTED: COBRA-like protein 4 [Nelumbo nucifera]
Length=465

 Score =   369 bits (948),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  +   CCVSFSSFYN TI PC  CACGC +KN    SD+K L   GI
Sbjct  231  TWNVTCTYSQFLARKNPNCCVSFSSFYNDTITPCPSCACGCQNKNNCIKSDSKLLSVVGI  290

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KD+  LLQCT+HMCPIRVHWHVK+NYKDYWRVK+++TNFNY+MNYTQWTLV QHPN
Sbjct  291  NTPKKDSTPLLQCTHHMCPIRVHWHVKLNYKDYWRVKVSITNFNYRMNYTQWTLVVQHPN  350

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            L+NVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+K+KETFT
Sbjct  351  LDNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLQKNKETFT  410

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
            L QGWAFPR++YFNGDEC LPPPD YP LPNSA     + S   + +LF ++
Sbjct  411  LKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSAHANPLAFSTLIVSMLFLLM  462



>gb|KDO65677.1| hypothetical protein CISIN_1g013089mg [Citrus sinensis]
Length=449

 Score =   369 bits (946),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TI PC  CACGC +KN    S++K     GI
Sbjct  215  TWNVTCTYSQFLASKNPSCCVSFSSFYNETITPCPSCACGCHNKNNCIMSNSKAAHRTGI  274

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY+MNYTQWTLVAQHPN
Sbjct  275  NTPKKDNTPLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYRMNYTQWTLVAQHPN  334

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSE+LL+K+K+TFT
Sbjct  335  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPQGNVQSELLLQKNKDTFT  394

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  395  FKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  427



>dbj|BAK01816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 187/225 (83%), Gaps = 12/225 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC------------THKNCVK  146
            TW VTCTYSQ L SRY TCCVSFSSFYN TIVPC  CACGC            +H +   
Sbjct  201  TWTVTCTYSQQLASRYPTCCVSFSSFYNSTIVPCARCACGCGAHKSTGGRGGKSHSDGCI  260

Query  147  SSDTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMN  326
            + D+KR  + G+NTP+KD A LLQCTNHMCPIRVHWHVK+NYKDYWR KIAVTNFNY+MN
Sbjct  261  AGDSKRALTPGVNTPKKDGAQLLQCTNHMCPIRVHWHVKLNYKDYWRAKIAVTNFNYRMN  320

Query  327  YTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQS  506
            YTQWTLVAQHPNLNNVT+VFSF YKPL+PY +INDTGMFYG+K YNDLLMEAGP GNVQS
Sbjct  321  YTQWTLVAQHPNLNNVTEVFSFQYKPLLPYGNINDTGMFYGLKLYNDLLMEAGPFGNVQS  380

Query  507  EVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            EVL++KD  TFT  QGWAFPR+IYFNGDECK+PPPD+YP+LPNSA
Sbjct  381  EVLMRKDDATFTFGQGWAFPRKIYFNGDECKMPPPDSYPYLPNSA  425



>ref|XP_011006293.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
 ref|XP_011006294.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
Length=453

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  TCCVSFSSFYN+TI PC  CACGC +K NCVKS ++K     G
Sbjct  219  TWNVTCTYSQFLASKNPTCCVSFSSFYNETITPCPTCACGCQNKKNCVKS-NSKESHKKG  277

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN  LLQCT+HMCPIRVHWHVK+NY+DYWR K+AVTNFNY+MNYT+WTLV QHP
Sbjct  278  INTPKKDNTPLLQCTHHMCPIRVHWHVKVNYRDYWRAKVAVTNFNYRMNYTEWTLVVQHP  337

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KDK TF
Sbjct  338  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLQKDKNTF  397

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            +L QGWAFPR++YFNGDEC LPPPD YP+LP+SA
Sbjct  398  SLKQGWAFPRKVYFNGDECMLPPPDTYPYLPSSA  431



>ref|XP_010032553.1| PREDICTED: COBRA-like protein 4 [Eucalyptus grandis]
 gb|KCW51946.1| hypothetical protein EUGRSUZ_J01393 [Eucalyptus grandis]
Length=431

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 193/234 (82%), Gaps = 0/234 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  +  +CCVSFSSFYN+TI PC  CACGC +KN    SD+K L  AG+
Sbjct  197  TWNVTCTYSQFLARKNPSCCVSFSSFYNETITPCPSCACGCQNKNTCVKSDSKILSMAGV  256

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MNYT W+LV QHPN
Sbjct  257  NTPKKDNAPLLQCTHHMCPVRVHWHVKLNYKDYWRVKIAITNFNYRMNYTLWSLVVQHPN  316

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFS +YKPLV Y+SINDTGMF+GMK+YNDLLMEAGP GNVQSEVLL+KDK TFT
Sbjct  317  LNNVTQVFSMDYKPLVAYESINDTGMFFGMKYYNDLLMEAGPLGNVQSEVLLQKDKNTFT  376

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVS  704
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA R     S    ++L  +  +
Sbjct  377  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSARRKLLPVSTLVSWVLLMMFAA  430



>ref|XP_006856413.1| hypothetical protein AMTR_s00047p00216570 [Amborella trichopoda]
 gb|ERN17880.1| hypothetical protein AMTR_s00047p00216570 [Amborella trichopoda]
Length=433

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 185/213 (87%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  +  +CCVSFSSFYN+TI+PC +CACGC + N    SD+K L   G+
Sbjct  202  TWNVTCTYSQFLARKSPSCCVSFSSFYNETIIPCPNCACGCQNNNTCIQSDSKLLLKPGV  261

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY++NYTQWTLV QHPN
Sbjct  262  NTPRKDNAPLLQCTKHMCPIRVHWHVKVNYKEYWRVKIAITNFNYRLNYTQWTLVVQHPN  321

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPL+PY SINDTGMFYGMKFYNDLLMEAGP GNVQSE+LL+KD +TFT
Sbjct  322  LNNVTQVFSFDYKPLLPYGSINDTGMFYGMKFYNDLLMEAGPFGNVQSEILLQKDAQTFT  381

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR+IYFNGDEC LPPPD YP LPNS 
Sbjct  382  FKQGWAFPRKIYFNGDECMLPPPDTYPFLPNSG  414



>emb|CAC01762.1| putative phytochelatin synthetase [Arabidopsis thaliana]
Length=395

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  163  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTKKGL  222

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  223  NTPKKDNTPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAIQHPN  282

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKP+ PY SINDTGMFYG KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  283  LNNVTQVFSFDYKPVSPYGSINDTGMFYGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  342

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA +G ++S   ++ LL FI +
Sbjct  343  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA-QGNFASFSLTILLLLFISI  394



>ref|XP_008453301.1| PREDICTED: COBRA-like protein 4 [Cucumis melo]
Length=456

 Score =   367 bits (942),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/237 (73%), Positives = 197/237 (83%), Gaps = 5/237 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  TCCVS S+FYN TI  C  CACGC +K NC+KS D+K L   G
Sbjct  222  TWNVTCTYSQFLASKNPTCCVSLSTFYNDTITSCPTCACGCQNKHNCIKS-DSKLLHKEG  280

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN  LLQCT+HMCP+RVHWHVKINYKDYWRVK+AVTNFNY+MNYT WTL  QHP
Sbjct  281  INTPKKDNTPLLQCTHHMCPVRVHWHVKINYKDYWRVKVAVTNFNYRMNYTLWTLAVQHP  340

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVL+KKDK+TF
Sbjct  341  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLMKKDKDTF  400

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
            T  QGWAFPR++YFNGDEC++PPP++YP LPNS+  G   S P + F    I++  F
Sbjct  401  TFKQGWAFPRKVYFNGDECQMPPPESYPFLPNSSPVG---SGPVTKFTTSLILILWF  454



>ref|XP_009338030.1| PREDICTED: COBRA-like protein 4 [Pyrus x bretschneideri]
Length=458

 Score =   367 bits (942),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTH-KNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  +CCVSFSSFYN+TIVPC  CACGC + KNCVKS D+     AG
Sbjct  220  TWNVTCTYSQFLASKNPSCCVSFSSFYNETIVPCPSCACGCHNIKNCVKS-DSNLAHKAG  278

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN+ LLQCT+HMCP+RVHWHVK NYKDYWRVK+AVTNFNY+MNYT WTLV QHP
Sbjct  279  INTPKKDNSPLLQCTHHMCPVRVHWHVKQNYKDYWRVKMAVTNFNYRMNYTDWTLVVQHP  338

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF YKPLVPYQS+NDTGMFYGMKFYNDLLMEAGPSGN+QSEVL++KD+ TF
Sbjct  339  NLNNVTQVFSFGYKPLVPYQSVNDTGMFYGMKFYNDLLMEAGPSGNIQSEVLMQKDQNTF  398

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNGDEC LPPPD YP LPNS 
Sbjct  399  TFRQGWAFPRKVYFNGDECMLPPPDEYPSLPNSG  432



>ref|XP_004232142.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=434

 Score =   366 bits (939),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVS SSFYN+TI  C  CACGC ++N    SD+K L   G+
Sbjct  200  TWNVTCTYSQFLARKHPSCCVSMSSFYNETITSCPSCACGCENRNKCIKSDSKLLSVVGV  259

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA L+QCT+HMCPIRVHWHVK+NYKDYWRVK+ VTNFNY++NYTQWTLV QHPN
Sbjct  260  NTPRKDNAPLIQCTHHMCPIRVHWHVKLNYKDYWRVKLTVTNFNYRINYTQWTLVVQHPN  319

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQS+NDTGMFYGMKFYNDLLMEAGPSG VQSEVLL+KDKETF+
Sbjct  320  LNNVTQVFSFDYKPLVPYQSVNDTGMFYGMKFYNDLLMEAGPSGTVQSEVLLQKDKETFS  379

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP+LPN A
Sbjct  380  FKQGWAFPRKVYFNGDECMLPPPDTYPYLPNFA  412



>ref|XP_007037618.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
 gb|EOY22119.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
Length=463

 Score =   367 bits (941),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L +R  +CCVSFSSFYN+TI PC  CACGC +KN    S++K    AGI
Sbjct  230  TWNVTCTYSQFLAARNPSCCVSFSSFYNETITPCPSCACGCQNKNNCIRSNSKEAHRAGI  289

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVKIA+TNFNY+MNYTQWTLVAQHPN
Sbjct  290  NTRRKDNTPLLQCTHHMCPIRVHWHVKLNYKDYWRVKIAITNFNYRMNYTQWTLVAQHPN  349

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LN VTQVFSF+YKPLVPY++INDTGMFYGMK+YNDLLMEAGP GNVQSEVLL+K+K+TFT
Sbjct  350  LNAVTQVFSFDYKPLVPYEAINDTGMFYGMKYYNDLLMEAGPQGNVQSEVLLRKNKDTFT  409

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  410  FKQGWAFPRKVYFNGDECLLPPPDTYPFLPNSA  442



>ref|XP_009763133.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=435

 Score =   366 bits (939),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVS SSFYN+TI  C  CACGC +K+    SD+K L   GI
Sbjct  201  TWNVTCTYSQFLARKHPSCCVSLSSFYNETITSCPSCACGCENKHKCIKSDSKLLSVVGI  260

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA L+QCT+HMCP+RVHWHVK+NYKDYWRVK++VTNFNY++NYTQWTLV QHPN
Sbjct  261  NTPRKDNAPLIQCTHHMCPVRVHWHVKLNYKDYWRVKLSVTNFNYRINYTQWTLVVQHPN  320

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKF+NDLLMEAGPSGNVQSEVLL+KDK+TFT
Sbjct  321  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFFNDLLMEAGPSGNVQSEVLLQKDKDTFT  380

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD+YP+LP+ A
Sbjct  381  FKQGWAFPRKVYFNGDECMLPPPDSYPYLPSFA  413



>ref|NP_197067.2| COBRA-like protein 4 [Arabidopsis thaliana]
 sp|Q9LFW3.2|COBL4_ARATH RecName: Full=COBRA-like protein 4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAT44976.1| At5g15630 [Arabidopsis thaliana]
 gb|AAW30024.1| At5g15630 [Arabidopsis thaliana]
 gb|AED92186.1| COBRA-like protein 4 [Arabidopsis thaliana]
Length=431

 Score =   365 bits (938),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  199  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTKKGL  258

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  259  NTPKKDNTPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAIQHPN  318

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKP+ PY SINDTGMFYG KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  319  LNNVTQVFSFDYKPVSPYGSINDTGMFYGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  378

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA +G ++S   ++ LL FI +
Sbjct  379  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA-QGNFASFSLTILLLLFISI  430



>ref|XP_003557715.1| PREDICTED: COBRA-like protein 5 [Brachypodium distachyon]
Length=452

 Score =   366 bits (940),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 187/228 (82%), Gaps = 15/228 (7%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS----------  152
            TW VTCTYSQ L SRY TCCVSFSSFYN TIVPC  CACGC  +     S          
Sbjct  202  TWTVTCTYSQQLASRYPTCCVSFSSFYNSTIVPCAKCACGCGSRKAAARSAGRGGNSHSD  261

Query  153  -----DTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNY  317
                 D+KR  + G+NTP+KD A+LLQCTNHMCPIRVHWHVK+NYKDYWR KIAVTNFNY
Sbjct  262  GCIMGDSKRALTPGVNTPKKDGASLLQCTNHMCPIRVHWHVKLNYKDYWRAKIAVTNFNY  321

Query  318  KMNYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGN  497
            +MNYTQWTLVAQHPNLNNVT+VFSF YKPL+PY +INDTGMFYG+K YNDLLMEAGP GN
Sbjct  322  RMNYTQWTLVAQHPNLNNVTEVFSFQYKPLLPYGNINDTGMFYGLKLYNDLLMEAGPFGN  381

Query  498  VQSEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            VQSEVL++KD  TFT +QGWAFPR+IYFNGDECK+PPPD+YP+LPNSA
Sbjct  382  VQSEVLMRKDDNTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNSA  429



>gb|KGN63776.1| hypothetical protein Csa_1G015700 [Cucumis sativus]
Length=457

 Score =   366 bits (940),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 196/233 (84%), Gaps = 2/233 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  TCCVS S+FYN TI  C  CACGC +K NC+KS D+K L   G
Sbjct  222  TWNVTCTYSQFLASKNPTCCVSLSTFYNDTITSCPTCACGCQNKHNCIKS-DSKLLHKEG  280

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN  LLQCT+HMCP+RVHWHVKINYKDYWRVK+AVTNFNY+MNYT WTL  QHP
Sbjct  281  INTPKKDNTPLLQCTHHMCPVRVHWHVKINYKDYWRVKVAVTNFNYRMNYTLWTLAVQHP  340

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVL+KKDK+TF
Sbjct  341  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLMKKDKDTF  400

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
            +  QGWAFPR++YFNGDEC++PPP++YP LPNS+  GY   +  +  LL  I+
Sbjct  401  SFKQGWAFPRKVYFNGDECQMPPPESYPFLPNSSPVGYGPVTKFTTSLLILIL  453



>ref|XP_010037255.1| PREDICTED: COBRA-like protein 4 [Eucalyptus grandis]
 gb|KCW48928.1| hypothetical protein EUGRSUZ_K02541 [Eucalyptus grandis]
Length=459

 Score =   366 bits (940),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ LVS+  +CCVSFSSFYN +I PC  CACGC +K     SD+K L  AG+
Sbjct  222  TWNVTCTYSQFLVSKNPSCCVSFSSFYNNSITPCPSCACGCHNKKNCIPSDSKLLHKAGV  281

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVKIA+TNFNY++N+TQWTLVAQHPN
Sbjct  282  NTPRKDNTPLLQCTHHMCPIRVHWHVKLNYKDYWRVKIAITNFNYRLNHTQWTLVAQHPN  341

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LN++T+VFSF+YKPL+ Y+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KDK TFT
Sbjct  342  LNSITRVFSFDYKPLIAYESINDTGMFYGMKFYNDLLMEAGPEGNVQSEVLLQKDKNTFT  401

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  402  FKQGWAFPRKVYFNGDECMLPPPDQYPFLPNSA  434



>ref|XP_006368071.1| PREDICTED: COBRA-like protein 4-like, partial [Solanum tuberosum]
Length=408

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  ++  CCVS S+FYN+TI  C  CACGC +K+    SD+K L   G+
Sbjct  187  TWNVTCTYSQFVAQKHPKCCVSLSTFYNETITSCPSCACGCENKHKCIKSDSKLLSMVGV  246

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT HMCP+R+HWHVK+NYK+YWRVKI +TNFNY++NYTQWTLVAQHPN
Sbjct  247  NTPRKDNAPLLQCTQHMCPVRIHWHVKLNYKEYWRVKITLTNFNYRVNYTQWTLVAQHPN  306

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGP+GNVQSEVLL+KDK+TFT
Sbjct  307  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPAGNVQSEVLLQKDKDTFT  366

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L QGWAFPR++YFNGDEC LPPPD YP+LPN A
Sbjct  367  LKQGWAFPRKVYFNGDECMLPPPDTYPYLPNFA  399



>ref|XP_004234909.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=431

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 198/234 (85%), Gaps = 2/234 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWN+TCTYSQ +  ++  CCVS S+FYN+TI  C  CACGC +K+    SD+K L   G+
Sbjct  197  TWNLTCTYSQFVAQKHPRCCVSLSTFYNETITSCPSCACGCENKHKCIKSDSKLLSMVGV  256

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT HMCP+R+HWHVK+NYK+YWRVKI VTNFNY++NYTQWTLVAQHPN
Sbjct  257  NTPRKDNAPLLQCTQHMCPVRIHWHVKLNYKEYWRVKITVTNFNYRVNYTQWTLVAQHPN  316

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKFYNDLLMEAGP+GNVQSEVLL+K+K+TFT
Sbjct  317  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPAGNVQSEVLLQKNKDTFT  376

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGY--YSSSPCSMFLLFFIV  698
            L QGWAFPR++YFNGDEC LPPPD+YP+LPN A +    +S+   SM L+  ++
Sbjct  377  LKQGWAFPRKVYFNGDECMLPPPDSYPYLPNFAHQNLDAFSTLFRSMLLILLVL  430



>gb|EMT05391.1| hypothetical protein F775_18404 [Aegilops tauschii]
Length=449

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 187/225 (83%), Gaps = 12/225 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC------------THKNCVK  146
            TW VTCTYSQ L SRY TCCVSFSSFYN TIVPC  CACGC            +H +   
Sbjct  202  TWTVTCTYSQQLASRYPTCCVSFSSFYNSTIVPCAKCACGCGAHKSMGGRGGKSHSDGCI  261

Query  147  SSDTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMN  326
              D+KR  + G+NTP+KD A LLQCTNHMCPIRVHWHVK+NYKDYWR KIAVTNFNY+MN
Sbjct  262  MGDSKRALTPGVNTPKKDGAQLLQCTNHMCPIRVHWHVKLNYKDYWRAKIAVTNFNYRMN  321

Query  327  YTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQS  506
            YTQWTLVAQHPNLNNVT+VFSF YKPL+PY +INDTGMFYG+K YNDLLMEAGP GNVQS
Sbjct  322  YTQWTLVAQHPNLNNVTEVFSFQYKPLLPYGNINDTGMFYGLKLYNDLLMEAGPFGNVQS  381

Query  507  EVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            EVL++KD  TFT +QGWAFPR+IYFNGDECK+PPPD+YP+LPNSA
Sbjct  382  EVLMRKDDRTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNSA  426



>emb|CDX69511.1| BnaA10g18600D [Brassica napus]
Length=455

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 193/236 (82%), Gaps = 0/236 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  220  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTKKGL  279

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  280  NTPRKDNAPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  339

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMFYG KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  340  LNNVTQVFSFDYKSVAPYGSINDTGMFYGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  399

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA     S    S+ +L  + +SI+
Sbjct  400  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSARGNLASFRILSLTILILMFISIW  455



>ref|XP_010551802.1| PREDICTED: COBRA-like protein 4 [Tarenaya hassleriana]
Length=433

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     S++K L   GI
Sbjct  200  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKGCVKSNSKILSMKGI  259

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIAVTNFNY+MNYT WTL  QHPN
Sbjct  260  NTPKKDNAPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAVTNFNYRMNYTLWTLAIQHPN  319

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KDK TFT
Sbjct  320  LNNVTQVFSFDYKPLVPYGSINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLQKDKNTFT  379

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  380  FKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  412



>ref|XP_010549989.1| PREDICTED: COBRA-like protein 4 [Tarenaya hassleriana]
 gb|ABD96834.1| hypothetical protein [Cleome spinosa]
Length=440

 Score =   364 bits (934),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC + K CVKS D+K L   G
Sbjct  204  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCESKKGCVKS-DSKILSVKG  262

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTPRKDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIAVTNFNY+MN++ WTL  QHP
Sbjct  263  INTPRKDNAPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAVTNFNYRMNFSLWTLAIQHP  322

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMK+YNDLLMEAGP GNVQSEVLL+KD+ TF
Sbjct  323  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKYYNDLLMEAGPFGNVQSEVLLQKDRNTF  382

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  383  TFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  416



>ref|XP_009600081.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=435

 Score =   363 bits (933),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++  CCVS SSFYN+TI  C  CACGC +K+    SD+K L   GI
Sbjct  201  TWNVTCTYSQFLARKHPNCCVSLSSFYNETITSCPSCACGCENKHKCIKSDSKLLSVVGI  260

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA L+QCT+HMCP+RVHWHVK+NYKDYWRVK++VTNFNY++NYTQWTLV QHPN
Sbjct  261  NTPRKDNAPLIQCTHHMCPVRVHWHVKLNYKDYWRVKLSVTNFNYRINYTQWTLVVQHPN  320

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPYQSINDTGMFYGMKF+NDLLMEAGPSGNVQSEVLL+KDK TFT
Sbjct  321  LNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFFNDLLMEAGPSGNVQSEVLLQKDKNTFT  380

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP+LP+ A
Sbjct  381  FKQGWAFPRKVYFNGDECMLPPPDTYPYLPSFA  413



>ref|XP_002264378.1| PREDICTED: COBRA-like protein 4 [Vitis vinifera]
Length=462

 Score =   364 bits (935),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 199/236 (84%), Gaps = 2/236 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  TCCVSFSSFYN T+ PC  CACGC +KN   SSD+K+LK+  +
Sbjct  229  TWNVTCTYSQFLASKNPTCCVSFSSFYNDTMTPCPSCACGCRNKNMCISSDSKKLKA--L  286

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            + P++ N  LLQCT+HMCPIRVHWHVK+NYKDYWRVKIA+TNFNY+MNYTQWTLVAQHPN
Sbjct  287  HNPKRSNTPLLQCTHHMCPIRVHWHVKLNYKDYWRVKIAITNFNYRMNYTQWTLVAQHPN  346

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLL+EAG  GNVQSEVLL+K+K+TFT
Sbjct  347  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLVEAGQHGNVQSEVLLQKNKDTFT  406

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              QGWAFPR++YFNGDECKLPPPD YP LPNSA    ++    +  LL  I+ +I+
Sbjct  407  FKQGWAFPRKVYFNGDECKLPPPDTYPFLPNSAHANPFAFWTMAAPLLLMILYTIW  462



>ref|XP_004138334.1| PREDICTED: COBRA-like protein 4-like, partial [Cucumis sativus]
 ref|XP_004171718.1| PREDICTED: COBRA-like protein 4-like, partial [Cucumis sativus]
Length=416

 Score =   362 bits (930),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 195/233 (84%), Gaps = 3/233 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L S+  TCCVS S+FYN TI  C  CACGC +K NC+  +D+K L   G
Sbjct  182  TWNVTCTYSQFLASKNPTCCVSLSTFYNDTITSCPTCACGCQNKHNCI--NDSKLLHKEG  239

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+KDN  LLQCT+HMCP+RVHWHVKINYKDYWRVK+AVTNFNY+MNYT WTL  QHP
Sbjct  240  INTPKKDNTPLLQCTHHMCPVRVHWHVKINYKDYWRVKVAVTNFNYRMNYTLWTLAVQHP  299

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVL+KKDK+TF
Sbjct  300  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLMKKDKDTF  359

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
            +  QGWAFPR++YFNGDEC++PPP++YP LPNS+  GY   +  +  LL  I+
Sbjct  360  SFKQGWAFPRKVYFNGDECQMPPPESYPFLPNSSPVGYGPVTKFTTSLLILIL  412



>ref|NP_001050366.1| Os03g0416200 [Oryza sativa Japonica Group]
 sp|Q10JL1.1|COBL5_ORYSJ RecName: Full=COBRA-like protein 5; AltName: Full=Protein BRITTLE 
CULM1; Flags: Precursor [Oryza sativa Japonica Group]
 sp|A2XHZ9.1|COBL5_ORYSI RecName: Full=COBRA-like protein 5; AltName: Full=Protein BRITTLE 
CULM1; Flags: Precursor [Oryza sativa Indica Group]
 gb|AAQ56120.1| BRITTLE CULM1 [Oryza sativa Japonica Group]
 gb|AAQ56121.1| BRITTLE CULM1 [Oryza sativa Indica Group]
 gb|AAS07098.1| putative phytochelatin synthetase [Oryza sativa Japonica Group]
 gb|ABF96617.1| Phytochelatin synthetase-like conserved region family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12280.1| Os03g0416200 [Oryza sativa Japonica Group]
 gb|EAY90459.1| hypothetical protein OsI_12047 [Oryza sativa Indica Group]
 dbj|BAG91525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=468

 Score =   364 bits (934),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 176/269 (65%), Positives = 199/269 (74%), Gaps = 36/269 (13%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK----------------  134
            TW VTCTYSQ L SRY TCCVSFSSFYN TIVPC  CACGC H                 
Sbjct  201  TWTVTCTYSQQLASRYPTCCVSFSSFYNSTIVPCARCACGCGHDGYRGNGGGGKNARAGD  260

Query  135  -----------------NCVKSSDTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVK  263
                              C+   D+KR  SAG+NTPRKD A LLQCT+HMCPIRVHWHVK
Sbjct  261  GRSRRNSGGGGGHSGGTECIM-GDSKRALSAGVNTPRKDGAPLLQCTSHMCPIRVHWHVK  319

Query  264  INYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMF  443
            +NYKDYWR KIA+TNFNY+MNYTQWTLVAQHPNLNNVT+VFSF YKPL+PY +INDTGMF
Sbjct  320  LNYKDYWRAKIAITNFNYRMNYTQWTLVAQHPNLNNVTEVFSFQYKPLLPYGNINDTGMF  379

Query  444  YGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYP  623
            YG+KFYNDLLMEAGP GNVQSEVL++KD  TFT +QGWAFPR+IYFNGDECK+PPPD+YP
Sbjct  380  YGLKFYNDLLMEAGPFGNVQSEVLMRKDYNTFTFSQGWAFPRKIYFNGDECKMPPPDSYP  439

Query  624  HLPNSAIRGYYSS--SPCSMFLLFFIVVS  704
            +LPNSA  G   S  +  S  L+  ++V+
Sbjct  440  YLPNSAPIGPPRSVAAAASAILVVLLLVA  468



>gb|EYU44225.1| hypothetical protein MIMGU_mgv1a006751mg [Erythranthe guttata]
Length=433

 Score =   362 bits (930),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 195/235 (83%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN+TI PC  CACGC +KN     D+K L   G+
Sbjct  198  TWNVTCTYSQFLAQKHPSCCVSFSSFYNETITPCPSCACGCENKNKCVKGDSKLLSVVGV  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA L+QCT+HMCP+RVHWHVK NYK+YWRVKIAVTNFNY+MNYTQWTLV QHPN
Sbjct  258  NTPRKDNAPLVQCTHHMCPVRVHWHVKTNYKEYWRVKIAVTNFNYRMNYTQWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPL+PY SINDTGMFYGMKFYN++LMEAG  GNVQSEVL++KD  TF+
Sbjct  318  LNNVTQVFSFDYKPLLPYGSINDTGMFYGMKFYNEMLMEAGEFGNVQSEVLMQKDTNTFS  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
            L +GWAFPR++YFNG+EC LPPPD+YP LPNS      S +  S+F+ F ++ S+
Sbjct  378  LKEGWAFPRKVYFNGEECTLPPPDSYPFLPNSTPS---SQTFNSIFIFFMVIFSM  429



>dbj|BAM05578.1| COBRA-like protein [Eucalyptus globulus subsp. globulus]
Length=430

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 195/235 (83%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVSFSSFYN+TI PC  CACGC +KN CV  +D+K L  AG
Sbjct  197  TWNVTCTYSQFLARKNPSCCVSFSSFYNETITPCPSCACGCQNKNTCV--NDSKILSMAG  254

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NTP+KDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MNYT W+LV QHP
Sbjct  255  VNTPKKDNAPLLQCTHHMCPVRVHWHVKLNYKDYWRVKIAITNFNYRMNYTLWSLVVQHP  314

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFS +YKPLV Y+SINDTGMF+GMK+YNDLLMEAGP GNVQSEVLL+KDK TF
Sbjct  315  NLNNVTQVFSMDYKPLVAYESINDTGMFFGMKYYNDLLMEAGPLGNVQSEVLLQKDKNTF  374

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVS  704
            T  QGWAFPR++YFNGDEC LPPPD+YP LPNSA R     S    ++L  +  +
Sbjct  375  TFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSARRKLLPVSTLVSWVLLMMFAA  429



>ref|XP_009394778.1| PREDICTED: COBRA-like protein 4 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   362 bits (930),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 187/213 (88%), Gaps = 1/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S++ +CCVSFSSFYN TI+PC  CACGC +KNCVKS D+K L + GI
Sbjct  205  TWNVTCTYSQFLASKHPSCCVSFSSFYNDTIIPCPSCACGCENKNCVKS-DSKILSTPGI  263

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK+NYKDYWR K+A+TNFNY++NYTQWTLV QHPN
Sbjct  264  NTPKKDNTPLLQCTHHMCPVRVHWHVKLNYKDYWRAKVAITNFNYRLNYTQWTLVVQHPN  323

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            L+NVT+VFSF YKPLV Y SINDTGMFYGMK+YND+LMEAG  GNVQSEVLL+KD + FT
Sbjct  324  LDNVTEVFSFEYKPLVAYGSINDTGMFYGMKYYNDVLMEAGAYGNVQSEVLLRKDADAFT  383

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP+LPNS+
Sbjct  384  FKQGWAFPRKVYFNGDECMLPPPDVYPYLPNSS  416



>ref|XP_009131486.1| PREDICTED: COBRA-like protein 4 [Brassica rapa]
Length=433

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 191/236 (81%), Gaps = 0/236 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  198  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKRSCVKADSKILTKKGL  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCPIRVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  258  NTPRKDNAPLLQCTHHMCPIRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  318  LNNVTQVFSFDYKSVAPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              QGWAFPR++YFNGDEC LP PD+YP LPNSA     S S  S  +L  + +S++
Sbjct  378  FKQGWAFPRKVYFNGDECMLPSPDSYPFLPNSARGSLASLSTLSFTILVLVFISVW  433



>gb|EYU44221.1| hypothetical protein MIMGU_mgv1a006633mg [Erythranthe guttata]
Length=437

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 194/235 (83%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN+TI PC  CACGC +KN     D+K L   G+
Sbjct  202  TWNVTCTYSQFLARKHPSCCVSFSSFYNETITPCPSCACGCENKNKCVKGDSKLLSVVGV  261

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA L+QCT+HMCP+RVHWHVK NYK+YWRVKIAVTNFNY+MNYTQWTLV QHPN
Sbjct  262  NTPRKDNAPLVQCTHHMCPVRVHWHVKTNYKEYWRVKIAVTNFNYRMNYTQWTLVVQHPN  321

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVT VFSF+YKPL+PY SINDTGMFYGMKFYND+LMEAG  GNVQSEVL++KD  TF+
Sbjct  322  LNNVTHVFSFDYKPLLPYGSINDTGMFYGMKFYNDMLMEAGEFGNVQSEVLMQKDTNTFS  381

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
            L +GWAFPR++YFNG+EC LPPPD+YP LPNS      S +  S+F+ F ++ S+
Sbjct  382  LKEGWAFPRKVYFNGEECTLPPPDSYPFLPNSTPS---SRTFNSIFIFFMVIFSM  433



>emb|CDX78644.1| BnaA03g05560D [Brassica napus]
Length=433

 Score =   361 bits (927),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 191/236 (81%), Gaps = 0/236 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  198  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKRSCVKADSKILTKKGL  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCPIRVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  258  NTPRKDNAPLLQCTHHMCPIRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  318  LNNVTQVFSFDYKSVAPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              QGWAFPR++YFNGDEC LP PD+YP LPNSA     S    S+ +L  + +SI+
Sbjct  378  FKQGWAFPRKVYFNGDECMLPSPDSYPFLPNSARGSLASLWTLSLTILVLVFISIW  433



>ref|XP_009126060.1| PREDICTED: COBRA-like protein 4 [Brassica rapa]
Length=434

 Score =   361 bits (927),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/234 (71%), Positives = 190/234 (81%), Gaps = 0/234 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  199  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTKKGL  258

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCP+RVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  259  NTPRKDNAPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  318

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  319  LNNVTQVFSFDYKSVAPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDEKTFT  378

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVS  704
              QGWAFPR++YFNGDEC LPPPDAYP LPNSA     S    S+ +L  + +S
Sbjct  379  FKQGWAFPRKVYFNGDECMLPPPDAYPFLPNSARGNLASLWTLSLTVLLVVFIS  432



>dbj|BAM05576.1| COBRA-like protein [Eucalyptus pilularis]
 dbj|BAM05577.1| COBRA-like protein [Eucalyptus pyrocarpa]
Length=430

 Score =   361 bits (926),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 195/235 (83%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVSFSSFYN+TI  C  CACGC +K+ CV  +D+K L  AG
Sbjct  197  TWNVTCTYSQFLARKNPSCCVSFSSFYNETITRCPSCACGCQNKDTCV--NDSKILSMAG  254

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NTPRKDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MNYT W+LV QHP
Sbjct  255  VNTPRKDNAPLLQCTHHMCPVRVHWHVKLNYKDYWRVKIAITNFNYRMNYTLWSLVVQHP  314

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMF+G K+YNDLLMEAGP GNVQSEVLL+KDK TF
Sbjct  315  NLNNVTQVFSFDYKPLVPYESINDTGMFFGTKYYNDLLMEAGPLGNVQSEVLLQKDKNTF  374

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVS  704
            T  QGWAFPR++YFNGDEC LPPPD+YP LPNSA R     S    ++L  +  +
Sbjct  375  TFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSARRKLLPVSTLVSWVLLMMFAA  429



>ref|XP_007216522.1| hypothetical protein PRUPE_ppa024465mg [Prunus persica]
 gb|EMJ17721.1| hypothetical protein PRUPE_ppa024465mg [Prunus persica]
Length=432

 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 196/235 (83%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ+L  +Y +CCVS SSFYN T++PC  C CGC T  NCVKS D+K L + G
Sbjct  198  TWNVTCTYSQILARKYPSCCVSLSSFYNDTVIPCPPCTCGCQTKDNCVKS-DSKILSTVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NTP+KDN  LLQCT HMCP+RVHWHV+ NYKDYWRVK+++TNFNY+MNYT WTLV QHP
Sbjct  257  VNTPKKDNKPLLQCTRHMCPVRVHWHVQRNYKDYWRVKVSITNFNYRMNYTLWTLVVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYG+KF+ND LMEAGP GNVQSE+LL+KD+  F
Sbjct  317  NLNNVTQVFSFDYKPLVPYESINDTGMFYGLKFFNDQLMEAGPFGNVQSEILLRKDRNAF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS-SSPCSMFLLFFIVV  701
            TL +GWAFP ++YFNGDEC+LPPPDAYP LPNSA +   S S+  S F+ F I +
Sbjct  377  TLKEGWAFPHKVYFNGDECQLPPPDAYPFLPNSAYQNLLSFSTFISSFIFFLIAI  431



>gb|AFY03623.1| COBRA-like protein [Eucalyptus globulus]
Length=430

 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 188/214 (88%), Gaps = 3/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVSFSSFYN+TI PC  CACGC +KN CV  +D+K L  AG
Sbjct  197  TWNVTCTYSQFLARKNPSCCVSFSSFYNETITPCPSCACGCQNKNTCV--NDSKILSMAG  254

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NTP+KDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MNYT W+LV QHP
Sbjct  255  VNTPKKDNAPLLQCTHHMCPVRVHWHVKLNYKDYWRVKIAITNFNYRMNYTLWSLVVQHP  314

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFS +YKPLV Y+SINDTGMF+GMK+YNDLLMEAGP GNVQSEVLL+KDK TF
Sbjct  315  NLNNVTQVFSMDYKPLVAYESINDTGMFFGMKYYNDLLMEAGPLGNVQSEVLLQKDKNTF  374

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNGDEC LPPPD+YP LPNSA
Sbjct  375  TFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA  408



>ref|XP_006400085.1| hypothetical protein EUTSA_v10013604mg [Eutrema salsugineum]
 gb|ESQ41538.1| hypothetical protein EUTSA_v10013604mg [Eutrema salsugineum]
Length=432

 Score =   360 bits (925),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 187/219 (85%), Gaps = 1/219 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  198  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTKKGL  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  258  NTPRKDNAPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAITNFNYRMNHTLWTLAIQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMFYG KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  318  LNNVTQVFSFDYKSVAPYGSINDTGMFYGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS  659
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA RG ++
Sbjct  378  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA-RGNFA  415



>gb|KFK25792.1| hypothetical protein AALP_AA8G161300 [Arabis alpina]
Length=433

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFS+FYN TI PC  CACGC +K     +D+K L   GI
Sbjct  198  TWNVTCTYSQFLARKHPSCCVSFSTFYNDTITPCPSCACGCENKKGCVKADSKILTMKGI  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN+ LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  258  NTPKKDNSPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAITNFNYRMNHTLWTLAIQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKP+ PY SINDTGMFYG KFYNDLLMEAGPSGNVQSEVLL+KD +TFT
Sbjct  318  LNNVTQVFSFDYKPVAPYGSINDTGMFYGTKFYNDLLMEAGPSGNVQSEVLLQKDLKTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGY  653
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA R Y
Sbjct  378  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSAQRNY  414



>gb|EPS71579.1| hypothetical protein M569_03177, partial [Genlisea aurea]
Length=412

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 194/235 (83%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVS SSFYN+TI  C  CACGC ++N    SD+K L   G+
Sbjct  178  TWNVTCTYSQFLAQKHPSCCVSLSSFYNETITSCPSCACGCENRNKCIRSDSKLLSVVGV  237

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCP+RVHWHVK+NY+DYWR KIA+TNFNY+MNYTQWTLV QHPN
Sbjct  238  NTPRKDNLPLLQCTHHMCPVRVHWHVKVNYRDYWRAKIAITNFNYRMNYTQWTLVVQHPN  297

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLV Y SINDTGMFYG KFYNDLLMEAG  GNVQSE+LL+KDK TFT
Sbjct  298  LNNVTQVFSFDYKPLVAYGSINDTGMFYGTKFYNDLLMEAGKYGNVQSELLLQKDKNTFT  357

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA--IRGYYSSSP-CSMFLLFFIV  698
            L QGWAFPR++YFNGDEC LPPPD+YP LPNS   +RG++ +   CS+F +  ++
Sbjct  358  LTQGWAFPRKVYFNGDECMLPPPDSYPFLPNSGHKLRGFFITHILCSVFTIAVVL  412



>gb|ACI24390.1| COBRA-like protein [Eucalyptus nitens]
Length=430

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 193/235 (82%), Gaps = 3/235 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVSFSSF+N+TI PC  CACGC +KN CV  S  K L  AG
Sbjct  197  TWNVTCTYSQFLARKNPSCCVSFSSFHNETITPCPSCACGCQNKNTCVNGS--KILSMAG  254

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NTP+KDNA LLQCT+HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY+MNYT W+LV QHP
Sbjct  255  VNTPKKDNAPLLQCTHHMCPVRVHWHVKLNYKDYWRVKIAITNFNYRMNYTLWSLVVQHP  314

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFS +YKPLV Y+SINDTGMF+GMK+YNDLLMEAGP GNVQSEVLL+KDK TF
Sbjct  315  NLNNVTQVFSMDYKPLVAYESINDTGMFFGMKYYNDLLMEAGPLGNVQSEVLLQKDKNTF  374

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVS  704
            T  QGWAFPR++YFNGDEC LPPPD+YP LPNSA R     S    ++L  +  +
Sbjct  375  TFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSARRKLLPVSTLVSWVLLMMFAA  429



>ref|XP_010099317.1| hypothetical protein L484_018179 [Morus notabilis]
 gb|EXB77663.1| hypothetical protein L484_018179 [Morus notabilis]
Length=433

 Score =   359 bits (922),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 196/236 (83%), Gaps = 5/236 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ+L  +  +CCVS SSFYN TI  C HCACGC  K NCVK  ++K LKS G
Sbjct  198  TWNVTCTYSQILARKNPSCCVSLSSFYNDTITSCPHCACGCQDKRNCVKP-NSKILKSVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTP+K NA LLQCT+HMCPIRVHWHVK+NYKDYWRVK+A+TNFNY++NYT WTL  QHP
Sbjct  257  INTPKKSNAPLLQCTHHMCPIRVHWHVKVNYKDYWRVKVAITNFNYRLNYTLWTLAIQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NL+NVTQVFSF+YKPLVPY +INDTGMFYG+KFYNDLLMEAGPSGNVQSE+LL+KDK TF
Sbjct  317  NLDNVTQVFSFDYKPLVPYGNINDTGMFYGLKFYNDLLMEAGPSGNVQSEILLQKDKNTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGY---YSSSPCSMFLLFFIV  698
            TL  GW FPR++YFNG+EC +PPPDAYP+LPNSA +     +S    S+  LF ++
Sbjct  377  TLKNGWGFPRKVYFNGEECLMPPPDAYPYLPNSAHKNLLISFSKLISSLLFLFIVL  432



>ref|XP_007139432.1| hypothetical protein PHAVU_008G029000g [Phaseolus vulgaris]
 gb|ESW11426.1| hypothetical protein PHAVU_008G029000g [Phaseolus vulgaris]
Length=432

 Score =   358 bits (919),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVS SSFYN+TI PC  CACGC +K NC+KS D+KR+   G
Sbjct  199  TWNVTCTYSQFLARKNPGCCVSLSSFYNETITPCPSCACGCQNKRNCIKS-DSKRINMVG  257

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            I+TP+KDN  LLQCT+HMCPIRVHWHVK+NY DYWRVK+AVTNFNY+MNY+ WTL  QHP
Sbjct  258  IHTPKKDNEPLLQCTHHMCPIRVHWHVKLNYMDYWRVKVAVTNFNYRMNYSLWTLAVQHP  317

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKP++PY+SINDTGMFYGMK++NDLLMEAGP+GNVQSE+LL+KDK+TF
Sbjct  318  NLNNVTQVFSFDYKPILPYESINDTGMFYGMKYFNDLLMEAGPTGNVQSEILLQKDKDTF  377

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            TL QGWAFPR++YFNG+EC LPPPD YP LPNSA
Sbjct  378  TLKQGWAFPRKVYFNGEECMLPPPDTYPILPNSA  411



>gb|AAR13305.1| phytochelatin synthetase-like protein [Phaseolus vulgaris]
Length=463

 Score =   359 bits (922),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVS SSFYN+TI PC  CACGC +K NC+KS D+KR+   G
Sbjct  230  TWNVTCTYSQFLARKNPGCCVSLSSFYNETITPCPSCACGCQNKRNCIKS-DSKRINMVG  288

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            I+TP+KDN  LLQCT+HMCPIRVHWHVK+NY DYWRVK+AVTNFNY+MNY+ WTL  QHP
Sbjct  289  IHTPKKDNEPLLQCTHHMCPIRVHWHVKLNYMDYWRVKVAVTNFNYRMNYSLWTLAVQHP  348

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKP++PY+SINDTGMFYGMK++NDLLMEAGP+GNVQSE+LL+KDK+TF
Sbjct  349  NLNNVTQVFSFDYKPILPYESINDTGMFYGMKYFNDLLMEAGPTGNVQSEILLQKDKDTF  408

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            TL QGWAFPR++YFNG+EC LPPPD YP LPNSA
Sbjct  409  TLKQGWAFPRKVYFNGEECMLPPPDTYPILPNSA  442



>emb|CDX85543.1| BnaA02g02700D [Brassica napus]
Length=456

 Score =   359 bits (921),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 186/220 (85%), Gaps = 1/220 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  221  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTKKGL  280

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCP+RVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  281  NTPRKDNAPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  340

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  341  LNNVTQVFSFDYKSVAPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDEKTFT  400

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS  662
              QGWAFPR++YFNGDEC LPPPDAYP LPNSA RG  +S
Sbjct  401  FKQGWAFPRKVYFNGDECMLPPPDAYPFLPNSA-RGNLAS  439



>ref|XP_008230409.1| PREDICTED: COBRA-like protein 4 [Prunus mume]
Length=442

 Score =   358 bits (919),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 192/231 (83%), Gaps = 2/231 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ+L  +Y +CCVS SSFYN T+VPC  C CGC T  NCVKS D+K L   G
Sbjct  198  TWNVTCTYSQILARKYPSCCVSLSSFYNDTVVPCPPCTCGCQTKDNCVKS-DSKILSMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NTP+KDN  LLQCT HMCP+RVHWHV+ NYKDYWRVK+++TNFNY+MNYT WTLV QHP
Sbjct  257  VNTPKKDNKPLLQCTRHMCPVRVHWHVQRNYKDYWRVKVSITNFNYRMNYTLWTLVVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYG+KF+ND LMEAGP GNVQSE+LL+KDK TF
Sbjct  317  NLNNVTQVFSFDYKPLVPYESINDTGMFYGLKFFNDQLMEAGPFGNVQSEMLLRKDKNTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFF  692
            TL +GWAFP ++YFNGDEC+LPPPDAYP LPNSA +   S S  +   L F
Sbjct  377  TLKEGWAFPHKVYFNGDECQLPPPDAYPFLPNSAYQNLLSFSIVNRVSLLF  427



>ref|XP_002871675.1| hypothetical protein ARALYDRAFT_488408 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47934.1| hypothetical protein ARALYDRAFT_488408 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   358 bits (918),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  199  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKGCVKADSKILTMKGL  258

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  259  NTPKKDNTPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAIQHPN  318

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKP+ PY SINDTGMFYG KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  319  LNNVTQVFSFDYKPVSPYGSINDTGMFYGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  378

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L QGWAFPR++YFNGDEC LPPPD+YP LPNSA
Sbjct  379  LKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA  411



>gb|ACA04978.1| GPI-anchored protein [Bambusa oldhamii]
Length=451

 Score =   358 bits (919),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 189/226 (84%), Gaps = 14/226 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-------------NCV  143
            TW VTCTYSQ L SRY TCCVSFSSFYN TIVPC  CACGC H              +CV
Sbjct  202  TWTVTCTYSQQLASRYPTCCVSFSSFYNSTIVPCAKCACGCGHGHGHGGGHSDGGRGSCV  261

Query  144  KSSDTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKM  323
               D+KR  S G+NTPRKD AALLQCT HMCP+RVHWHVK+NYKDYWR KIA+TNFNY+M
Sbjct  262  MG-DSKRALSPGVNTPRKDGAALLQCTPHMCPVRVHWHVKLNYKDYWRAKIAITNFNYRM  320

Query  324  NYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQ  503
            NYTQWTLVAQHPNLNNVT+VFSF YKPL+PY +INDTGMFYG+KFYNDLLMEAGP GNVQ
Sbjct  321  NYTQWTLVAQHPNLNNVTEVFSFEYKPLLPYGNINDTGMFYGLKFYNDLLMEAGPFGNVQ  380

Query  504  SEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            SEVL++KD  TFT +QGWAFPR+IYFNGDECK+PPPD+YP+LPNSA
Sbjct  381  SEVLMRKDANTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNSA  426



>ref|XP_004304208.1| PREDICTED: COBRA-like protein 4-like [Fragaria vesca subsp. vesca]
Length=433

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 196/236 (83%), Gaps = 0/236 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQLL  +  +CCVS SSFYN+TIVPC  C+CGC +K+    S++K L   G+
Sbjct  198  TWNVTCTYSQLLARKNPSCCVSLSSFYNETIVPCPTCSCGCHNKDTCVKSNSKLLSMVGV  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDNA LLQCT+HMCP+R+HWHVK+NYK+YWRVK+ VTNFNY+MNYT WTLV QHPN
Sbjct  258  NTPKKDNAPLLQCTHHMCPVRIHWHVKVNYKEYWRVKVTVTNFNYRMNYTLWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQV+SF+YKPLVPY+SINDTGMFYG+K++ND LMEAGP GNVQSE+LLKKD  TFT
Sbjct  318  LNNVTQVYSFDYKPLVPYESINDTGMFYGLKYFNDQLMEAGPFGNVQSEILLKKDINTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              +GWAFPR++YFNGDEC++PPPD YP LPNSA      S    + +L F++++I+
Sbjct  378  FKEGWAFPRKVYFNGDECQMPPPDTYPFLPNSAPHQNLYSFSALVSILIFLLIAIW  433



>emb|CDX90983.1| BnaC02g06140D [Brassica napus]
Length=435

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  199  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTKKGL  258

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCP+RVHWHVK NYK+YWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  259  NTPRKDNAPLLQCTHHMCPVRVHWHVKTNYKEYWRVKIAITNFNYRMNHTLWTLAVQHPN  318

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  319  LNNVTQVFSFDYKSVAPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDEKTFT  378

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPDAYP LPNSA
Sbjct  379  FKQGWAFPRKVYFNGDECMLPPPDAYPFLPNSA  411



>ref|XP_008464584.1| PREDICTED: COBRA-like protein 4 [Cucumis melo]
Length=433

 Score =   356 bits (914),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  +   CCVSFSSFYN TI  C  CACGC +KN    +D+K LK  GI
Sbjct  198  TWNVTCTYSQFLARKNPNCCVSFSSFYNDTITSCPSCACGCQNKNNCVQNDSKILKLVGI  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LL CT+HMCP+RVHWHVK NYK+YWRVKI +TNFNY+MNY+ W+LV QHPN
Sbjct  258  NTPRKDNAPLLHCTHHMCPVRVHWHVKQNYKEYWRVKITITNFNYRMNYSLWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLRKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP LPN+A
Sbjct  378  FKQGWAFPRKVYFNGDECMLPPPDTYPFLPNAA  410



>ref|XP_006287794.1| hypothetical protein CARUB_v10001005mg [Capsella rubella]
 gb|EOA20692.1| hypothetical protein CARUB_v10001005mg [Capsella rubella]
Length=432

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  198  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKRSCVKADSKILTMKGL  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCP+RVHWHVK NYKDYWRVK+A+TNFNY+MN+T WTL  QHPN
Sbjct  258  NTPRKDNAPLLQCTHHMCPVRVHWHVKTNYKDYWRVKLAITNFNYRMNHTLWTLAVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMFYG KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  318  LNNVTQVFSFDYKSVSPYGSINDTGMFYGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA
Sbjct  378  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA  410



>ref|XP_007151374.1| hypothetical protein PHAVU_004G041400g [Phaseolus vulgaris]
 gb|ESW23368.1| hypothetical protein PHAVU_004G041400g [Phaseolus vulgaris]
Length=431

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 194/234 (83%), Gaps = 3/234 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  TCCVS SSFYN+TI PC  CACGC   KNCVKS ++K L+  G
Sbjct  198  TWNVTCTYSQFLARKNPTCCVSLSSFYNETITPCPSCACGCHNKKNCVKS-ESKILRMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +++P+KDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVKI +TNFNY+MN++ W+L  QHP
Sbjct  257  VHSPKKDNEPLLQCTHHMCPIRVHWHVKVNYKDYWRVKITITNFNYRMNHSLWSLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNN+TQVFSFNYKPL+PY SINDTGMFYG K++NDLLMEAGP+GNVQSE+LL+KDK+TF
Sbjct  317  NLNNLTQVFSFNYKPLLPYASINDTGMFYGTKYFNDLLMEAGPTGNVQSELLLQKDKDTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            T  QGWAFPR+IYFNGDEC +P PD YP LPNSA      +SP S+FLL F + 
Sbjct  377  TFKQGWAFPRKIYFNGDECMMPQPDTYPFLPNSAPPSLI-TSPASIFLLLFFLA  429



>ref|XP_010420232.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   355 bits (912),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  196  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTMKGL  255

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  256  NTPKKDNTPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  315

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKP+ PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  316  LNNVTQVFSFDYKPVSPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  375

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA
Sbjct  376  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA  408



>ref|XP_010492405.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   355 bits (912),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  196  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTMKGL  255

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  256  NTPKKDNTPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  315

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKP+ PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  316  LNNVTQVFSFDYKPVSPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  375

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA
Sbjct  376  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA  408



>ref|XP_004137260.1| PREDICTED: COBRA-like protein 4-like [Cucumis sativus]
Length=451

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVSFSSFYN TI  C  CACGC +K NCV++ D+K LK  G
Sbjct  216  TWNVTCTYSQFLARKNPNCCVSFSSFYNDTITSCPSCACGCQNKSNCVQN-DSKILKLVG  274

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTPRKDNA LL CT+HMCP+RVHWHVK NYK+YWRVKIA+TNFNY+MNY+ W+LV QHP
Sbjct  275  INTPRKDNAPLLHCTHHMCPVRVHWHVKQNYKEYWRVKIAITNFNYRMNYSLWSLVVQHP  334

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KD+ TF
Sbjct  335  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLRKDQNTF  394

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNGDEC LPPPD YP LPN+A
Sbjct  395  TFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNAA  428



>gb|KGN53787.1| hypothetical protein Csa_4G129040 [Cucumis sativus]
Length=433

 Score =   355 bits (912),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVSFSSFYN TI  C  CACGC +K NCV++ D+K LK  G
Sbjct  198  TWNVTCTYSQFLARKNPNCCVSFSSFYNDTITSCPSCACGCQNKSNCVQN-DSKILKLVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTPRKDNA LL CT+HMCP+RVHWHVK NYK+YWRVKIA+TNFNY+MNY+ W+LV QHP
Sbjct  257  INTPRKDNAPLLHCTHHMCPVRVHWHVKQNYKEYWRVKIAITNFNYRMNYSLWSLVVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KD+ TF
Sbjct  317  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLRKDQNTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNGDEC LPPPD YP LPN+A
Sbjct  377  TFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNAA  410



>gb|KHN37931.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   355 bits (911),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVS SSFYN+TI PC  CACGC   +NCVKS D+KR+   G
Sbjct  198  TWNVTCTYSQFLARKNPGCCVSLSSFYNETITPCPTCACGCQNRRNCVKS-DSKRINMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            I+TP+KDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVK+AVTNFNY+MNY+ WTL  QHP
Sbjct  257  IHTPKKDNEPLLQCTHHMCPIRVHWHVKLNYKDYWRVKVAVTNFNYRMNYSLWTLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPL+PY+SINDTGMFYGMK++NDLLMEAGP+GNVQSE+LL+K+++TF
Sbjct  317  NLNNVTQVFSFDYKPLLPYESINDTGMFYGMKYFNDLLMEAGPTGNVQSEILLQKNQDTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNG+EC LPPPD+YP LPNSA
Sbjct  377  TFKQGWAFPRKVYFNGEECMLPPPDSYPILPNSA  410



>ref|XP_004154765.1| PREDICTED: COBRA-like protein 4-like [Cucumis sativus]
Length=438

 Score =   355 bits (912),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVSFSSFYN TI  C  CACGC +K NCV++ D+K LK  G
Sbjct  203  TWNVTCTYSQFLARKNPNCCVSFSSFYNDTITSCPSCACGCQNKSNCVQN-DSKILKLVG  261

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            INTPRKDNA LL CT+HMCP+RVHWHVK NYK+YWRVKIA+TNFNY+MNY+ W+LV QHP
Sbjct  262  INTPRKDNAPLLHCTHHMCPVRVHWHVKQNYKEYWRVKIAITNFNYRMNYSLWSLVVQHP  321

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLLMEAGP GNVQSEVLL+KD+ TF
Sbjct  322  NLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSEVLLRKDQNTF  381

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNGDEC LPPPD YP LPN+A
Sbjct  382  TFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNAA  415



>ref|XP_010453698.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
 ref|XP_010453699.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   355 bits (911),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  196  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKSCVKADSKILTMKGL  255

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP+KDN  LLQCT+HMCP+RVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  256  NTPKKDNTPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  315

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKP+ PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  316  LNNVTQVFSFDYKPVSPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  375

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA
Sbjct  376  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA  408



>gb|EAZ27328.1| hypothetical protein OsJ_11270 [Oryza sativa Japonica Group]
Length=441

 Score =   355 bits (912),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 193/242 (80%), Gaps = 9/242 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQH------CACGCTHKNCVKSSDTKR  164
            TW VTCTYSQ L SRY TCCVSFSSFYN TIVPC                 C+   D+KR
Sbjct  201  TWTVTCTYSQQLASRYPTCCVSFSSFYNSTIVPCASRRNSGGGGGHSGGTECIMG-DSKR  259

Query  165  LKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTL  344
              SAG+NTPRKD A LLQCT+HMCPIRVHWHVK+NYKDYWR KIA+TNFNY+MNYTQWTL
Sbjct  260  ALSAGVNTPRKDGAPLLQCTSHMCPIRVHWHVKLNYKDYWRAKIAITNFNYRMNYTQWTL  319

Query  345  VAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
            VAQHPNLNNVT+VFSF YKPL+PY +INDTGMFYG+KFYNDLLMEAGP GNVQSEVL++K
Sbjct  320  VAQHPNLNNVTEVFSFQYKPLLPYGNINDTGMFYGLKFYNDLLMEAGPFGNVQSEVLMRK  379

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS--SPCSMFLLFFIV  698
            D  TFT +QGWAFPR+IYFNGDECK+PPPD+YP+LPNSA  G   S  +  S  L+  ++
Sbjct  380  DYNTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNSAPIGPPRSVAAAASAILVVLLL  439

Query  699  VS  704
            V+
Sbjct  440  VA  441



>gb|KHN30324.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 195/234 (83%), Gaps = 2/234 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVS SSFYN+TI PC  CACGC +K NCVKS ++KR+   G
Sbjct  198  TWNVTCTYSQFLARKNPGCCVSLSSFYNETITPCPTCACGCQNKRNCVKS-NSKRINMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            I+TP+KDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVK+AVTNFNY+MNY+ WTL  QHP
Sbjct  257  IHTPKKDNEPLLQCTHHMCPIRVHWHVKLNYKDYWRVKVAVTNFNYRMNYSLWTLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPL+PY+SINDTGMFYGMK++NDLLMEAGP+GNVQSE+LL+K+++TF
Sbjct  317  NLNNVTQVFSFDYKPLLPYESINDTGMFYGMKYFNDLLMEAGPTGNVQSEILLQKNQDTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            T  QGWAFPR++YFNG+EC LPPPD+YP LPNSA     +     + +L  I V
Sbjct  377  TFKQGWAFPRKVYFNGEECMLPPPDSYPILPNSAPVNLLNFPAFVLTMLVMITV  430



>gb|KEH25135.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=431

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVS SSFYN+TI PC HCACGC +K NCVKS ++K L   G
Sbjct  198  TWNVTCTYSQFLARKNPSCCVSLSSFYNETITPCPHCACGCQNKKNCVKS-ESKILSMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            ++TP+KDN  L+QCT+HMCPIRVHWHVK NYKDYWRVKIAVTNFNY+MNY+ W+L  QHP
Sbjct  257  VHTPKKDNEPLMQCTHHMCPIRVHWHVKTNYKDYWRVKIAVTNFNYRMNYSLWSLAIQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSFNYKPLVPY SINDTGMFYGMK++NDLLMEAGP GN+QSEVLL+K+K+TF
Sbjct  317  NLNNVTQVFSFNYKPLVPYASINDTGMFYGMKYFNDLLMEAGPKGNIQSEVLLQKNKDTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFP ++YFNGDEC LPPPD YP LPNSA
Sbjct  377  TFKQGWAFPHKVYFNGDECMLPPPDTYPFLPNSA  410



>ref|XP_004491892.1| PREDICTED: COBRA-like protein 4-like [Cicer arietinum]
Length=432

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVS SSFYN+TI PC  CACGC +K NCVK   +K L   G
Sbjct  198  TWNVTCTYSQFLARKNPSCCVSLSSFYNETITPCASCACGCQNKKNCVKG-HSKFLDMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
             +TP+KDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVKIAVTNFNY++NY+ WTL  QHP
Sbjct  257  FHTPKKDNEPLLQCTHHMCPIRVHWHVKVNYKDYWRVKIAVTNFNYRLNYSLWTLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPL+PYQSINDTGMFYGMKF+NDLLMEAGPSGNVQSEVLL+K+K+TF
Sbjct  317  NLNNVTQVFSFDYKPLLPYQSINDTGMFYGMKFFNDLLMEAGPSGNVQSEVLLQKNKDTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            TLNQGWAFPRR+YFNG+EC +P PD YP LPNS+
Sbjct  377  TLNQGWAFPRRVYFNGEECMMPSPDTYPFLPNSS  410



>ref|NP_001242777.1| uncharacterized protein LOC100784352 precursor [Glycine max]
 gb|ACU17729.1| unknown [Glycine max]
Length=431

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVS SSFYN+ I PC  CACGC ++ NCVKS D+KR+   G
Sbjct  198  TWNVTCTYSQFLARKNPGCCVSLSSFYNEAITPCPTCACGCQNRRNCVKS-DSKRINMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            I+TP+KDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVK+AVTNFNY+MNY+ WTL  QHP
Sbjct  257  IHTPKKDNEPLLQCTHHMCPIRVHWHVKLNYKDYWRVKVAVTNFNYRMNYSLWTLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVF F+YKPL+PY+SINDTGMFYGMK++NDLLMEAGP+GNVQSE+LL+K++ETF
Sbjct  317  NLNNVTQVFRFDYKPLLPYESINDTGMFYGMKYFNDLLMEAGPTGNVQSEILLQKNQETF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNG+EC LPPPD+YP LPNSA
Sbjct  377  TFKQGWAFPRKVYFNGEECMLPPPDSYPILPNSA  410



>ref|NP_001242075.1| uncharacterized protein LOC100783410 precursor [Glycine max]
 gb|ACU18234.1| unknown [Glycine max]
Length=431

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 194/234 (83%), Gaps = 2/234 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +   CCVS SSFYN+TI PC  CACGC +K NCVKS ++KR+   G
Sbjct  198  TWNVTCTYSQFLARKNPGCCVSLSSFYNETITPCPTCACGCQNKRNCVKS-NSKRINMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            I+T +KDN  LLQCT+HMCPIRVHWHVK+NYKDYWRVK+AVTNFNY+MNY+ WTL  QHP
Sbjct  257  IHTSKKDNEPLLQCTHHMCPIRVHWHVKLNYKDYWRVKVAVTNFNYRMNYSLWTLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPL+PY+SINDTGMFYGMK++NDLLMEAGP+GNVQSE+LL+K+++TF
Sbjct  317  NLNNVTQVFSFDYKPLLPYESINDTGMFYGMKYFNDLLMEAGPTGNVQSEILLQKNQDTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            T  QGWAFPR++YFNG+EC LPPPD+YP LPNSA     +     + +L  I V
Sbjct  377  TFKQGWAFPRKVYFNGEECMLPPPDSYPILPNSAPVNLLNFPAFVLTMLVMITV  430



>emb|CBI15331.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   366 bits (939),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 199/236 (84%), Gaps = 2/236 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+  TCCVSFSSFYN T+ PC  CACGC +KN   SSD+K+LK+  +
Sbjct  721  TWNVTCTYSQFLASKNPTCCVSFSSFYNDTMTPCPSCACGCRNKNMCISSDSKKLKA--L  778

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            + P++ N  LLQCT+HMCPIRVHWHVK+NYKDYWRVKIA+TNFNY+MNYTQWTLVAQHPN
Sbjct  779  HNPKRSNTPLLQCTHHMCPIRVHWHVKLNYKDYWRVKIAITNFNYRMNYTQWTLVAQHPN  838

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYNDLL+EAG  GNVQSEVLL+K+K+TFT
Sbjct  839  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLVEAGQHGNVQSEVLLQKNKDTFT  898

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              QGWAFPR++YFNGDECKLPPPD YP LPNSA    ++    +  LL  I+ +I+
Sbjct  899  FKQGWAFPRKVYFNGDECKLPPPDTYPFLPNSAHANPFAFWTMAAPLLLMILYTIW  954


 Score =   348 bits (892),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ++VS+Y +CCVSFSSFYN TI PC  CACGC +KN    SDTK     G+
Sbjct  225  TWNVTCTYSQMVVSKYPSCCVSFSSFYNSTITPCTSCACGCQNKNNCIMSDTKIESVVGL  284

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            +TP KDN  LLQCT H CP+RVHWHVK+NYK+YWRVKI +TNFNY+MNYTQWTLVAQHPN
Sbjct  285  HTPTKDNMPLLQCTQHNCPVRVHWHVKVNYKEYWRVKITITNFNYRMNYTQWTLVAQHPN  344

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNN+TQVFSF YKPL+PY SIND+GMFYG+KFYND+LME GP GNVQSE++L+KDK TFT
Sbjct  345  LNNITQVFSFAYKPLIPYTSINDSGMFYGIKFYNDVLMEDGPDGNVQSEMILQKDKNTFT  404

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L +GWAFP+RIYFNGDEC +P PD+YP L  SA
Sbjct  405  LKEGWAFPQRIYFNGDECMMPLPDSYPLLAGSA  437



>emb|CDX70627.1| BnaC03g07110D [Brassica napus]
Length=858

 Score =   363 bits (933),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 193/235 (82%), Gaps = 0/235 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  ++ +CCVSFSSFYN TI PC  CACGC +K     +D+K L   G+
Sbjct  623  TWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKRSCVKADSKILTKKGL  682

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDNA LLQCT+HMCPIRVHWHVK NYKDYWRVKIA+TNFNY+MN+T WTL  QHPN
Sbjct  683  NTPRKDNAPLLQCTHHMCPIRVHWHVKTNYKDYWRVKIAITNFNYRMNHTLWTLAVQHPN  742

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YK + PY SINDTGMF+G KFYNDLLMEAGPSGNVQSEVLL+KD++TFT
Sbjct  743  LNNVTQVFSFDYKSVAPYGSINDTGMFFGTKFYNDLLMEAGPSGNVQSEVLLQKDQKTFT  802

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
              QGWAFPR++YFNGDEC LPPPD+YP LPNSA     S S  S+ +L  +++S+
Sbjct  803  FKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSARGSLASLSTLSLTILVLVLISV  857



>emb|CBI16945.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   351 bits (900),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 189/232 (81%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQL   +  +CCVSFSSFYN+TI PC  CACGC +KN    SD+K L   GI
Sbjct  198  TWNVTCTYSQLRARKNPSCCVSFSSFYNETITPCPSCACGCQNKNNCVQSDSKLLSMVGI  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCP+RVHWH+KINYKDYWRVK+++TNFNY++NYT WTLV QHPN
Sbjct  258  NTPRKDNVPLLQCTHHMCPVRVHWHLKINYKDYWRVKVSITNFNYRLNYTLWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYND LMEAGP GNVQSEVL +KD  +FT
Sbjct  318  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDQLMEAGPFGNVQSEVLFQKD-NSFT  376

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
              QGWAFPR++YFNGDEC LP P+ YP LPNSA +   + S     ++F +V
Sbjct  377  FKQGWAFPRKVYFNGDECMLPLPETYPFLPNSAHQNLLAFSTFISSVIFLLV  428



>ref|XP_004984022.1| PREDICTED: COBRA-like protein 5-like [Setaria italica]
Length=461

 Score =   351 bits (901),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 190/236 (81%), Gaps = 24/236 (10%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTH-----------------  131
            TW VTCTYSQ L SRY +CCVSFSSFYN TIVPC  CACGC H                 
Sbjct  202  TWTVTCTYSQQLASRYPSCCVSFSSFYNDTIVPCDRCACGCGHSGGGAHGGRGGRSHGSH  261

Query  132  ------KNCVKSSDTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVK  293
                    C+ + D+KR  SAG+NTPRKD AALLQCT HMCPIRVHWHVK+NYKDYWR K
Sbjct  262  GGGGGGAECI-AGDSKRALSAGVNTPRKDGAALLQCTPHMCPIRVHWHVKLNYKDYWRAK  320

Query  294  IAVTNFNYKMNYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLL  473
            IA+TNFNY+MNYTQWTLVAQHPNL+NVT+VFSF YKPL+PY +INDTGMFYG+KFYNDLL
Sbjct  321  IAITNFNYRMNYTQWTLVAQHPNLDNVTEVFSFQYKPLLPYGAINDTGMFYGLKFYNDLL  380

Query  474  MEAGPSGNVQSEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            MEAGP GNVQSEVL++KD  TFT +QGWAFPR+IYFNGDECK+PPPD+YP+LPN+A
Sbjct  381  MEAGPFGNVQSEVLMRKDARTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNAA  436



>ref|XP_009394776.1| PREDICTED: COBRA-like protein 4 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   352 bits (902),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/241 (67%), Positives = 187/241 (78%), Gaps = 28/241 (12%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVK------------  146
            TWNVTCTYSQ L S++ +CCVSFSSFYN TI+PC  CACGC +KNCVK            
Sbjct  205  TWNVTCTYSQFLASKHPSCCVSFSSFYNDTIIPCPSCACGCENKNCVKYVHTPPHPVFKS  264

Query  147  ----------------SSDTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKD  278
                             SD+K L + GINTP+KDN  LLQCT+HMCP+RVHWHVK+NYKD
Sbjct  265  PIPNLSSILPPTRPWHRSDSKILSTPGINTPKKDNTPLLQCTHHMCPVRVHWHVKLNYKD  324

Query  279  YWRVKIAVTNFNYKMNYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKF  458
            YWR K+A+TNFNY++NYTQWTLV QHPNL+NVT+VFSF YKPLV Y SINDTGMFYGMK+
Sbjct  325  YWRAKVAITNFNYRLNYTQWTLVVQHPNLDNVTEVFSFEYKPLVAYGSINDTGMFYGMKY  384

Query  459  YNDLLMEAGPSGNVQSEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNS  638
            YND+LMEAG  GNVQSEVLL+KD + FT  QGWAFPR++YFNGDEC LPPPD YP+LPNS
Sbjct  385  YNDVLMEAGAYGNVQSEVLLRKDADAFTFKQGWAFPRKVYFNGDECMLPPPDVYPYLPNS  444

Query  639  A  641
            +
Sbjct  445  S  445



>ref|XP_010663467.1| PREDICTED: COBRA-like protein 4 isoform X2 [Vitis vinifera]
Length=397

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ++VS+Y +CCVSFSSFYN TI PC  CACGC +KN    SDTK     G+
Sbjct  163  TWNVTCTYSQMVVSKYPSCCVSFSSFYNSTITPCTSCACGCQNKNNCIMSDTKIESVVGL  222

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            +TP KDN  LLQCT H CP+RVHWHVK+NYK+YWRVKI +TNFNY+MNYTQWTLVAQHPN
Sbjct  223  HTPTKDNMPLLQCTQHNCPVRVHWHVKVNYKEYWRVKITITNFNYRMNYTQWTLVAQHPN  282

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNN+TQVFSF YKPL+PY SIND+GMFYG+KFYND+LME GP GNVQSE++L+KDK TFT
Sbjct  283  LNNITQVFSFAYKPLIPYTSINDSGMFYGIKFYNDVLMEDGPDGNVQSEMILQKDKNTFT  342

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L +GWAFP+RIYFNGDEC +P PD+YP L  SA
Sbjct  343  LKEGWAFPQRIYFNGDECMMPLPDSYPLLAGSA  375



>ref|XP_010660571.1| PREDICTED: COBRA-like protein 4 [Vitis vinifera]
Length=464

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 189/232 (81%), Gaps = 1/232 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQL   +  +CCVSFSSFYN+TI PC  CACGC +KN    SD+K L   GI
Sbjct  231  TWNVTCTYSQLRARKNPSCCVSFSSFYNETITPCPSCACGCQNKNNCVQSDSKLLSMVGI  290

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTPRKDN  LLQCT+HMCP+RVHWH+KINYKDYWRVK+++TNFNY++NYT WTLV QHPN
Sbjct  291  NTPRKDNVPLLQCTHHMCPVRVHWHLKINYKDYWRVKVSITNFNYRLNYTLWTLVVQHPN  350

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF+YKPLVPY+SINDTGMFYGMKFYND LMEAGP GNVQSEVL +KD  +FT
Sbjct  351  LNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDQLMEAGPFGNVQSEVLFQKD-NSFT  409

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
              QGWAFPR++YFNGDEC LP P+ YP LPNSA +   + S     ++F +V
Sbjct  410  FKQGWAFPRKVYFNGDECMLPLPETYPFLPNSAHQNLLAFSTFISSVIFLLV  461



>ref|XP_010663466.1| PREDICTED: COBRA-like protein 4 isoform X1 [Vitis vinifera]
Length=442

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 181/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ++VS+Y +CCVSFSSFYN TI PC  CACGC +KN    SDTK     G+
Sbjct  208  TWNVTCTYSQMVVSKYPSCCVSFSSFYNSTITPCTSCACGCQNKNNCIMSDTKIESVVGL  267

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            +TP KDN  LLQCT H CP+RVHWHVK+NYK+YWRVKI +TNFNY+MNYTQWTLVAQHPN
Sbjct  268  HTPTKDNMPLLQCTQHNCPVRVHWHVKVNYKEYWRVKITITNFNYRMNYTQWTLVAQHPN  327

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNN+TQVFSF YKPL+PY SIND+GMFYG+KFYND+LME GP GNVQSE++L+KDK TFT
Sbjct  328  LNNITQVFSFAYKPLIPYTSINDSGMFYGIKFYNDVLMEDGPDGNVQSEMILQKDKNTFT  387

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L +GWAFP+RIYFNGDEC +P PD+YP L  SA
Sbjct  388  LKEGWAFPQRIYFNGDECMMPLPDSYPLLAGSA  420



>dbj|BAK05255.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   348 bits (893),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 190/242 (79%), Gaps = 11/242 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS-DTKRLKSAG  179
            TWNVTCTYSQ L S+Y TCCVSFSSFYN TIVPC  C CGC HK C +S  D+KRL SA 
Sbjct  202  TWNVTCTYSQHLASKYPTCCVSFSSFYNDTIVPCAKCTCGCEHKTCARSERDSKRLMSAS  261

Query  180  INTP--------RKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQ  335
              +         R+  A LLQCT HMCP+RVHWHVK+NY DYWR K+ VTNFNY+MNYT 
Sbjct  262  GKSAVTARGHVNRQSAAPLLQCTTHMCPVRVHWHVKLNYHDYWRAKVTVTNFNYRMNYTG  321

Query  336  WTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL  515
            WTLVAQHPNL+N+T+VFSF+YKP+V Y SINDT +FYGMKF+ND LMEAGP GNVQSEVL
Sbjct  322  WTLVAQHPNLDNITEVFSFDYKPVVSYGSINDTALFYGMKFFNDQLMEAGPYGNVQSEVL  381

Query  516  LKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFI  695
            ++KD  TFT  QGWAFPR+IYFNGDEC++PPPD+YP+LPNSA     SS+  S  ++ F+
Sbjct  382  MRKDASTFTFRQGWAFPRKIYFNGDECRMPPPDSYPYLPNSAPASLLSSA--SAVIVAFL  439

Query  696  VV  701
            V+
Sbjct  440  VL  441



>gb|KEH21749.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=431

 Score =   347 bits (891),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVS SSFYN TI PC  CACGC +K NCVK   +K L   G
Sbjct  198  TWNVTCTYSQFLARKNPSCCVSLSSFYNSTITPCPSCACGCQNKKNCVKGR-SKFLDMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            ++TP++DN  LLQCT+HMCPIRVHWHVK NYKDYWRVKIAVTNFNY++NY+ WTL  QHP
Sbjct  257  LHTPKRDNEPLLQCTHHMCPIRVHWHVKTNYKDYWRVKIAVTNFNYRLNYSLWTLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPL+ YQSINDTGMFYG KF+NDLLMEAGPSGNVQSEVLL+K+K+TF
Sbjct  317  NLNNVTQVFSFDYKPLLAYQSINDTGMFYGTKFFNDLLMEAGPSGNVQSEVLLQKNKKTF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            TLNQGWAFPRR+YFNG+EC +P PD YP+LPNS+
Sbjct  377  TLNQGWAFPRRVYFNGEECMMPSPDTYPYLPNSS  410



>ref|XP_010694050.1| PREDICTED: COBRA-like protein 4 [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 193/239 (81%), Gaps = 4/239 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ +  +Y +CCVS S+FYN TI PC  C+CGC HK NCVKS D+K L  AG
Sbjct  198  TWNVTCTYSQFIARKYPSCCVSLSTFYNDTITPCPTCSCGCEHKKNCVKS-DSKILSMAG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            + + R  N+ LL CT+HMCPIRVHWHVK+NYKDYWRVK+++TNFNY  N++QWTLVAQHP
Sbjct  257  LKSKRY-NSPLLHCTHHMCPIRVHWHVKVNYKDYWRVKVSITNFNYHTNFSQWTLVAQHP  315

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVT+VFSFNYKPLVPY SINDTGMFYG KFYNDLLMEAGP GNVQSEVL++KD+ TF
Sbjct  316  NLNNVTEVFSFNYKPLVPYGSINDTGMFYGTKFYNDLLMEAGPFGNVQSEVLMQKDQNTF  375

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS-SPCSMFLLFFIVVSIFC  713
            T  QGWAFPR++YFNGDEC++PPPD +P LPNS ++  +S  +      L F+   +FC
Sbjct  376  TFRQGWAFPRKVYFNGDECRMPPPDTFPFLPNSGLKLSFSVLAMIGSLFLAFVNSGVFC  434



>gb|ACF88191.1| unknown [Zea mays]
Length=247

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 180/222 (81%), Gaps = 10/222 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC HK CV+  D+KRL   G 
Sbjct  2    TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCAKCACGCEHKTCVQG-DSKRLAVTGK  60

Query  183  NTP---------RKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQ  335
            +           R   A LLQCT HMCP+RVHWHVK+NYK+YWR KIA+TNFNY MNYTQ
Sbjct  61   HAHTAAAVRGQHRDKEAPLLQCTTHMCPVRVHWHVKLNYKEYWRAKIAITNFNYHMNYTQ  120

Query  336  WTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL  515
            WTLVAQHPNL+N+T+VFSF YKP+V Y SINDT MFYG+K++ND LM+AGP GNVQSEVL
Sbjct  121  WTLVAQHPNLDNITEVFSFGYKPVVSYGSINDTAMFYGLKYFNDHLMQAGPYGNVQSEVL  180

Query  516  LKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            ++KD  TFT  QGWAFPR++YFNGDEC++PPPDAYP+LPNSA
Sbjct  181  MRKDASTFTFRQGWAFPRKVYFNGDECQMPPPDAYPYLPNSA  222



>gb|KEH21750.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=421

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVS SSFYN TI PC  CACGC +K NCVK   +K L   G
Sbjct  188  TWNVTCTYSQFLARKNPSCCVSLSSFYNSTITPCPSCACGCQNKKNCVKGR-SKFLDMVG  246

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            ++TP++DN  LLQCT+HMCPIRVHWHVK NYKDYWRVKIAVTNFNY++NY+ WTL  QHP
Sbjct  247  LHTPKRDNEPLLQCTHHMCPIRVHWHVKTNYKDYWRVKIAVTNFNYRLNYSLWTLAVQHP  306

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF+YKPL+ YQSINDTGMFYG KF+NDLLMEAGPSGNVQSEVLL+K+K+TF
Sbjct  307  NLNNVTQVFSFDYKPLLAYQSINDTGMFYGTKFFNDLLMEAGPSGNVQSEVLLQKNKKTF  366

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            TLNQGWAFPRR+YFNG+EC +P PD YP+LPNS+
Sbjct  367  TLNQGWAFPRRVYFNGEECMMPSPDTYPYLPNSS  400



>ref|XP_003554956.1| PREDICTED: COBRA-like protein 4-like [Glycine max]
Length=431

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVS SSFYN+TI PC  CACGC +K +CVK  ++K L   G
Sbjct  198  TWNVTCTYSQFLARKNPSCCVSLSSFYNETITPCPSCACGCQNKKHCVKG-NSKILSMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            ++TP+KDN  LLQCT+HMCPIRVHWHVK NYKDYWRVK+A+TNFNY+MN++ W+L  QHP
Sbjct  257  VHTPKKDNEPLLQCTHHMCPIRVHWHVKTNYKDYWRVKVAITNFNYRMNHSLWSLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNN+TQVFSFNYKPL+PY SINDTGMFYGMK++NDLLMEAGP+GNVQSE+LL+KDK+ F
Sbjct  317  NLNNLTQVFSFNYKPLLPYGSINDTGMFYGMKYFNDLLMEAGPTGNVQSELLLQKDKDAF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  377  TFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  410



>gb|KHN04371.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQ L  +  +CCVS SSFYN+TI PC  CACGC +K +CVK  ++K L   G
Sbjct  198  TWNVTCTYSQFLARKNPSCCVSLSSFYNETITPCPSCACGCQNKKHCVKG-NSKILSMVG  256

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            ++TP+KDN  LLQCT+HMCPIRVHWHVK NYKDYWRVK+A+TNFNY+MN++ W+L  QHP
Sbjct  257  VHTPKKDNEPLLQCTHHMCPIRVHWHVKTNYKDYWRVKVAITNFNYRMNHSLWSLAVQHP  316

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNN+TQVFSFNYKPL+PY SINDTGMFYGMK++NDLLMEAGP+GNVQSE+LL+KDK+ F
Sbjct  317  NLNNLTQVFSFNYKPLLPYGSINDTGMFYGMKYFNDLLMEAGPTGNVQSELLLQKDKDAF  376

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  377  TFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  410



>gb|KDP24287.1| hypothetical protein JCGZ_25583 [Jatropha curcas]
Length=431

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 186/234 (79%), Gaps = 2/234 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L  +   CCVSFSSFYNQ I PC  CACGC + N   + D+K LK  G 
Sbjct  198  TWNVTCTYSQFLARKNPNCCVSFSSFYNQEITPCPTCACGCQNNNTCVNRDSKILKVVGA  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            N    +  +LLQCT+HMCP+RVHWHVK+NYK+YWRVKI++ NFNY+MNYT W+LV QHPN
Sbjct  258  NNTNNETTSLLQCTHHMCPVRVHWHVKVNYKEYWRVKISIVNFNYRMNYTLWSLVIQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSFNY+PL+PY+SINDTGMFYGMK+YND+LMEAGP GNVQSEVLL+KD  TFT
Sbjct  318  LNNVTQVFSFNYQPLIPYKSINDTGMFYGMKYYNDVLMEAGPLGNVQSEVLLQKDLNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS--SSPCSMFLLFFIV  698
              QGWAFPR++YFNGDEC LPPPDAYP LPNSA     S  +   ++F LF I+
Sbjct  378  FKQGWAFPRKVYFNGDECMLPPPDAYPFLPNSADGSLISFLTLISTLFFLFIIL  431



>ref|XP_002467689.1| hypothetical protein SORBIDRAFT_01g032480 [Sorghum bicolor]
 gb|EER94687.1| hypothetical protein SORBIDRAFT_01g032480 [Sorghum bicolor]
Length=446

 Score =   345 bits (886),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 184/218 (84%), Gaps = 5/218 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVK-----SSDTKRL  167
            TW VTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC H            D+KR 
Sbjct  205  TWTVTCTYSQQLASKYPSCCVSFSSFYNDTIVPCAKCACGCGHGGHAGPGGCIEGDSKRA  264

Query  168  KSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
             S G+NTPRKD  ALLQCT HMCP+RVHWHVK+NYKDYWR KIA+TNFNY+MNYTQWTLV
Sbjct  265  LSPGVNTPRKDGQALLQCTPHMCPVRVHWHVKLNYKDYWRAKIAITNFNYRMNYTQWTLV  324

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
            AQHPNL+NVT+VFSF YKPL+PY SINDTGMFYG+KFYND LMEAGP GNVQSEVL++KD
Sbjct  325  AQHPNLDNVTEVFSFQYKPLLPYGSINDTGMFYGLKFYNDFLMEAGPFGNVQSEVLMRKD  384

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              TFT +QGWAFPR+IYFNGDECK+PPPD+YP+LPN+A
Sbjct  385  ARTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNAA  422



>ref|XP_011006292.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
Length=439

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 189/232 (81%), Gaps = 2/232 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ+L SR  TCCVS SSFYN TI PC+ CACGC + +    SD+      G+
Sbjct  204  TWNVTCTYSQMLASRNPTCCVSMSSFYNSTITPCRSCACGCQNNSTCVPSDSMIQSVVGL  263

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
             TP KDN  L+QCT H CPIRVHWHVK+NYK+YWRVKI++TNFNY++NYTQWTLVAQHPN
Sbjct  264  KTPTKDNTPLVQCTKHNCPIRVHWHVKLNYKEYWRVKISITNFNYRLNYTQWTLVAQHPN  323

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNN+TQVFSF YKPL+PY+S ND+GMFYG+KF+ND+LMEAGP GN+QSE++L+KDK TFT
Sbjct  324  LNNITQVFSFAYKPLLPYKSANDSGMFYGVKFFNDILMEAGPDGNIQSELILQKDKNTFT  383

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
            LN+GWAFPR++YFNGDEC +P PD YP+LPNSA +     S   +F  FF++
Sbjct  384  LNKGWAFPRKVYFNGDECVMPLPDDYPYLPNSAPKNVIGLS--FLFSAFFVL  433



>ref|NP_001105928.1| brittle stalk2 precursor [Zea mays]
 gb|ABJ99754.1| brittle stalk-2 [Zea mays]
 gb|ACF79122.1| unknown [Zea mays]
 gb|ACG37428.1| COBRA-like protein 4 precursor [Zea mays]
 gb|ACN29061.1| unknown [Zea mays]
 gb|ACN34385.1| unknown [Zea mays]
 gb|ACN34438.1| unknown [Zea mays]
 gb|AFW88099.1| brittle stalk-2COBRA-like protein 4 [Zea mays]
Length=450

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 182/219 (83%), Gaps = 6/219 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVK------SSDTKR  164
            TW VTCTYSQ L SRY +CCVSFSSFYN TIVPC  CACGC               D+KR
Sbjct  208  TWTVTCTYSQQLASRYPSCCVSFSSFYNSTIVPCARCACGCGGHGGHAGPGGCIEGDSKR  267

Query  165  LKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTL  344
              SAG+NTPRKD  ALLQCT HMCPIRVHWHVK+NYKDYWR KIA+TN+NY+MNYTQWTL
Sbjct  268  ALSAGVNTPRKDGQALLQCTPHMCPIRVHWHVKLNYKDYWRAKIAITNYNYRMNYTQWTL  327

Query  345  VAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
            VAQHPNL+NVT+VFSF YKPL PY SINDTGMFYG+KFYND LMEAGP GNVQSEVL++K
Sbjct  328  VAQHPNLDNVTEVFSFQYKPLQPYGSINDTGMFYGLKFYNDFLMEAGPFGNVQSEVLMRK  387

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            D  TFT + GWAFPR+IYFNGDECK+PPPD+YP+LPN+A
Sbjct  388  DARTFTFSMGWAFPRKIYFNGDECKMPPPDSYPYLPNAA  426



>ref|XP_006374430.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
 gb|ERP52227.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
Length=439

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 191/236 (81%), Gaps = 8/236 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ+L S+  TCCVS SSFYN TI PC+ CACGC + +    SD+      G+
Sbjct  204  TWNVTCTYSQMLASKNPTCCVSMSSFYNSTITPCRTCACGCQNNSTCVPSDSMIQSVVGL  263

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NTP KDN  L+QCT H CPIRVHWHVK+NYK+YWRVKI++TNFNY++NYTQWTLVAQHPN
Sbjct  264  NTPTKDNTPLVQCTKHNCPIRVHWHVKLNYKEYWRVKISITNFNYRLNYTQWTLVAQHPN  323

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNN+TQVFSF YKPL+PY+S ND+GMFYG+KF+ND+LMEAGP GN+Q+E++L+KDK TFT
Sbjct  324  LNNITQVFSFAYKPLLPYKSANDSGMFYGVKFFNDILMEAGPDGNIQTELILQKDKNTFT  383

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
            LN+GWAFPR++YFNGDEC +P PD YP+LPNSA        P ++  L F++ + F
Sbjct  384  LNKGWAFPRKVYFNGDECMMPLPDDYPYLPNSA--------PKNVIGLSFVISAFF  431



>gb|AFW88100.1| hypothetical protein ZEAMMB73_767703 [Zea mays]
Length=493

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 182/219 (83%), Gaps = 6/219 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVK------SSDTKR  164
            TW VTCTYSQ L SRY +CCVSFSSFYN TIVPC  CACGC               D+KR
Sbjct  251  TWTVTCTYSQQLASRYPSCCVSFSSFYNSTIVPCARCACGCGGHGGHAGPGGCIEGDSKR  310

Query  165  LKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTL  344
              SAG+NTPRKD  ALLQCT HMCPIRVHWHVK+NYKDYWR KIA+TN+NY+MNYTQWTL
Sbjct  311  ALSAGVNTPRKDGQALLQCTPHMCPIRVHWHVKLNYKDYWRAKIAITNYNYRMNYTQWTL  370

Query  345  VAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
            VAQHPNL+NVT+VFSF YKPL PY SINDTGMFYG+KFYND LMEAGP GNVQSEVL++K
Sbjct  371  VAQHPNLDNVTEVFSFQYKPLQPYGSINDTGMFYGLKFYNDFLMEAGPFGNVQSEVLMRK  430

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            D  TFT + GWAFPR+IYFNGDECK+PPPD+YP+LPN+A
Sbjct  431  DARTFTFSMGWAFPRKIYFNGDECKMPPPDSYPYLPNAA  469



>ref|XP_004958243.1| PREDICTED: COBRA-like protein 6-like isoform X2 [Setaria italica]
Length=391

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 184/230 (80%), Gaps = 11/230 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKR------  164
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC HK CV+  DTKR      
Sbjct  145  TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCAKCACGCEHKTCVQG-DTKRPLAVTG  203

Query  165  ----LKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYT  332
                  +A     R   A LLQCT HMCP+RVHWHVK+NYK+YWR KIA+TNFNY+MNYT
Sbjct  204  KHEHGHAAAARGHRDREAPLLQCTTHMCPVRVHWHVKLNYKEYWRAKIAITNFNYRMNYT  263

Query  333  QWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEV  512
            QWTLVAQHPNL+N+T+VFSF+YKP+V Y SINDT MFYG+K++ND LM+AGP GNVQSEV
Sbjct  264  QWTLVAQHPNLDNITEVFSFDYKPVVAYGSINDTAMFYGLKYFNDHLMQAGPYGNVQSEV  323

Query  513  LLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS  662
            L++KD  TFT  QGWAFPR++YFNGDEC++PPPDAYP+LPN+A+    +S
Sbjct  324  LMRKDASTFTFRQGWAFPRKVYFNGDECQMPPPDAYPYLPNAALPATAAS  373



>gb|EMS46999.1| hypothetical protein TRIUR3_01700 [Triticum urartu]
Length=386

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 182/227 (80%), Gaps = 14/227 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS-DTKRL----  167
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC HK C +S  D+KRL    
Sbjct  139  TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCARCACGCEHKTCARSERDSKRLMPAS  198

Query  168  --KSAGINTP-------RKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYK  320
              KSA   T        R+  A LLQCT HMCP+RVHWHVK+NY DYWR K+ VTNF+Y+
Sbjct  199  SGKSAHAVTAALRGHVNRQSAAPLLQCTTHMCPVRVHWHVKLNYHDYWRAKVTVTNFDYR  258

Query  321  MNYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNV  500
             NYT WTLVAQHP+L+N+TQVFSF+YKP+V Y SINDT +FYGMKF+ND LMEAGP GNV
Sbjct  259  TNYTGWTLVAQHPHLDNITQVFSFDYKPVVSYGSINDTALFYGMKFFNDQLMEAGPYGNV  318

Query  501  QSEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            QSEVL++KD+ TFT  QGWAFPR+IYFNGDEC++PPPD+YP+LPNSA
Sbjct  319  QSEVLMRKDESTFTFRQGWAFPRKIYFNGDECRMPPPDSYPYLPNSA  365



>gb|EMT09067.1| COBRA-like protein 6 [Aegilops tauschii]
Length=447

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 180/226 (80%), Gaps = 13/226 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS-DTKRLKSAG  179
            TWNVTCTYSQ L S+Y TCCVSFSSFYN TIVPC  CACGC HK C +S  D+KRL SA 
Sbjct  202  TWNVTCTYSQHLASKYPTCCVSFSSFYNDTIVPCAKCACGCEHKTCARSEPDSKRLMSAS  261

Query  180  INTP------------RKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKM  323
              +             R+  A LLQCT HMCP+RVHWHVK+NY DYWR K+ VTNFNY+ 
Sbjct  262  GKSSAHAVTAVRGHVNRQSAAPLLQCTTHMCPVRVHWHVKLNYHDYWRAKVTVTNFNYRT  321

Query  324  NYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQ  503
            NYT WTLVAQHPNL+N+T+VFSF+YKP+V Y SINDT +FYGMKF+ND LMEAGP GNVQ
Sbjct  322  NYTGWTLVAQHPNLDNITEVFSFDYKPVVSYGSINDTALFYGMKFFNDQLMEAGPYGNVQ  381

Query  504  SEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            SEVL++KD  TFT  QGWAFPR+IYFNGDEC++PPPD+YP+LPNSA
Sbjct  382  SEVLMRKDASTFTFRQGWAFPRKIYFNGDECRMPPPDSYPYLPNSA  427



>ref|XP_010092075.1| hypothetical protein L484_007355 [Morus notabilis]
 gb|EXB50055.1| hypothetical protein L484_007355 [Morus notabilis]
Length=514

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQLL S+Y  CCVS SSFYN TI PC  CACGC  KN    SD+K      +
Sbjct  204  TWNVTCTYSQLLASQYPKCCVSLSSFYNSTITPCPTCACGCQDKNRCVESDSKLSSVVKL  263

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            +   KDNA LLQCT HMCPIRVHWHVK+NYK+YWR KIA+TNF+Y +NYTQWTLV +HPN
Sbjct  264  HKQTKDNAPLLQCTKHMCPIRVHWHVKLNYKEYWRAKIAITNFDYHLNYTQWTLVVEHPN  323

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSFNYKP+ PY+S NDTG+FYG+KFYND+LMEAGP GNVQSE++LKKD ++FT
Sbjct  324  LNNVTQVFSFNYKPIAPYKSKNDTGLFYGLKFYNDVLMEAGPDGNVQSEIILKKDVDSFT  383

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              +GWAFPR++YFNGDEC +PPPD+YP+LP+SA
Sbjct  384  FKEGWAFPRKVYFNGDECMMPPPDSYPYLPSSA  416



>ref|XP_007037621.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
 gb|EOY22122.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
Length=438

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ+L SRY TCCVS SSFYN T+ PC  C+CGC  +N   SSD++      +
Sbjct  204  TWNVTCTYSQILASRYPTCCVSMSSFYNSTVTPCPTCSCGCQSRNQCVSSDSEIRTVVAM  263

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            N        +++CTNHMCPIRVHWHVK+NYK+YWRVK+ +TNFNY+ NYTQWTLVAQHPN
Sbjct  264  NASTSQQTNVVRCTNHMCPIRVHWHVKLNYKEYWRVKMTITNFNYQKNYTQWTLVAQHPN  323

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNN+TQVFSF+YKPL PYQS NDTGMFYG+K+YND+LME+GP GNVQSE++L+KD  TFT
Sbjct  324  LNNITQVFSFDYKPLNPYQSTNDTGMFYGLKYYNDVLMESGPDGNVQSELILQKDMNTFT  383

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSS  665
              QGWAFPR+IYFNGDEC +PPPDAYP+LPNSA     +SS
Sbjct  384  FKQGWAFPRKIYFNGDECMMPPPDAYPYLPNSANSNLIASS  424



>ref|XP_004958242.1| PREDICTED: COBRA-like protein 6-like isoform X1 [Setaria italica]
Length=446

 Score =   340 bits (873),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 184/230 (80%), Gaps = 11/230 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRL-----  167
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC HK CV+  DTKR      
Sbjct  200  TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCAKCACGCEHKTCVQG-DTKRPLAVTG  258

Query  168  -----KSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYT  332
                  +A     R   A LLQCT HMCP+RVHWHVK+NYK+YWR KIA+TNFNY+MNYT
Sbjct  259  KHEHGHAAAARGHRDREAPLLQCTTHMCPVRVHWHVKLNYKEYWRAKIAITNFNYRMNYT  318

Query  333  QWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEV  512
            QWTLVAQHPNL+N+T+VFSF+YKP+V Y SINDT MFYG+K++ND LM+AGP GNVQSEV
Sbjct  319  QWTLVAQHPNLDNITEVFSFDYKPVVAYGSINDTAMFYGLKYFNDHLMQAGPYGNVQSEV  378

Query  513  LLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS  662
            L++KD  TFT  QGWAFPR++YFNGDEC++PPPDAYP+LPN+A+    +S
Sbjct  379  LMRKDASTFTFRQGWAFPRKVYFNGDECQMPPPDAYPYLPNAALPATAAS  428



>ref|NP_001105971.1| brittle stalk-2-like protein 7 precursor [Zea mays]
 gb|ABL59987.1| brittle stalk-2-like protein 7 [Zea mays]
 gb|ACR36489.1| unknown [Zea mays]
 tpg|DAA63524.1| TPA: brittle stalk-2-like protein 7 [Zea mays]
Length=447

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 180/222 (81%), Gaps = 10/222 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC HK CV+  D+KRL   G 
Sbjct  202  TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCAKCACGCEHKTCVQG-DSKRLAVTGK  260

Query  183  NTP---------RKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQ  335
            +           R   A LLQCT HMCP+RVHWHVK+NYK+YWR KIA+TNFNY MNYTQ
Sbjct  261  HAHTAAAVRGQHRDKEAPLLQCTTHMCPVRVHWHVKLNYKEYWRAKIAITNFNYHMNYTQ  320

Query  336  WTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL  515
            WTLVAQHPNL+N+T+VFSF YKP+V Y SINDT MFYG+K++ND LM+AGP GNVQSEVL
Sbjct  321  WTLVAQHPNLDNITEVFSFGYKPVVSYGSINDTAMFYGLKYFNDHLMQAGPYGNVQSEVL  380

Query  516  LKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            ++KD  TFT  QGWAFPR++YFNGDEC++PPPDAYP+LPNSA
Sbjct  381  MRKDASTFTFRQGWAFPRKVYFNGDECQMPPPDAYPYLPNSA  422



>ref|XP_010087345.1| hypothetical protein L484_012678 [Morus notabilis]
 gb|EXB28919.1| hypothetical protein L484_012678 [Morus notabilis]
Length=614

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 182/215 (85%), Gaps = 3/215 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN--CVKSSDTKRLKSA  176
            TWNVTCTYS+ L S+  +CCVS SSFY+  I+PC  CACGC + N  C+ S+ T  L+  
Sbjct  377  TWNVTCTYSKFLASKNPSCCVSLSSFYSSKIIPCPACACGCQNNNNTCIMSNST-LLQKP  435

Query  177  GINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQH  356
            GINTPRKD A LLQCT HMCP+RVHWH+K+NY+ YWRVKIA+TNF+++ NY+QWTLV QH
Sbjct  436  GINTPRKDLAPLLQCTKHMCPVRVHWHLKLNYEAYWRVKIAITNFDFRRNYSQWTLVVQH  495

Query  357  PNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKET  536
            PNLNNVTQVFSFNYKPL+PYQSINDTGMFYGMKF+ND LMEAGP GNVQSE+L++K+K T
Sbjct  496  PNLNNVTQVFSFNYKPLLPYQSINDTGMFYGMKFFNDYLMEAGPYGNVQSEMLMQKEKTT  555

Query  537  FTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            FTL QGW FPRR+YFNGDEC LPPPD YP LPNSA
Sbjct  556  FTLRQGWGFPRRVYFNGDECMLPPPDQYPFLPNSA  590



>tpg|DAA63525.1| TPA: hypothetical protein ZEAMMB73_009152 [Zea mays]
Length=449

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 180/222 (81%), Gaps = 10/222 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC HK CV+  D+KRL   G 
Sbjct  204  TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCAKCACGCEHKTCVQG-DSKRLAVTGK  262

Query  183  NTP---------RKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQ  335
            +           R   A LLQCT HMCP+RVHWHVK+NYK+YWR KIA+TNFNY MNYTQ
Sbjct  263  HAHTAAAVRGQHRDKEAPLLQCTTHMCPVRVHWHVKLNYKEYWRAKIAITNFNYHMNYTQ  322

Query  336  WTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL  515
            WTLVAQHPNL+N+T+VFSF YKP+V Y SINDT MFYG+K++ND LM+AGP GNVQSEVL
Sbjct  323  WTLVAQHPNLDNITEVFSFGYKPVVSYGSINDTAMFYGLKYFNDHLMQAGPYGNVQSEVL  382

Query  516  LKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            ++KD  TFT  QGWAFPR++YFNGDEC++PPPDAYP+LPNSA
Sbjct  383  MRKDASTFTFRQGWAFPRKVYFNGDECQMPPPDAYPYLPNSA  424



>gb|KHG18541.1| COBRA-like protein 4 [Gossypium arboreum]
Length=404

 Score =   336 bits (862),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 181/230 (79%), Gaps = 1/230 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTY+Q+L SRY +CCVS SSFYN TI PC  C+CGC + N   SSD +     G 
Sbjct  166  TWNVTCTYNQILASRYPSCCVSMSSFYNSTITPCPSCSCGCQNNNNCISSDAEIESVVGK  225

Query  183  NTPRKDNA-ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            N  R  N+ A+++CTNHMCPIRVHWHVK+NYK+YWRVK+ VTNFNY MNYTQWTLVAQHP
Sbjct  226  NRTRSRNSNAMIRCTNHMCPIRVHWHVKLNYKEYWRVKMTVTNFNYAMNYTQWTLVAQHP  285

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NL+N+TQVFSF YKPL+PY+  NDTGMFYG+KFYND+L EAG  GNVQSE++LKKD  TF
Sbjct  286  NLHNITQVFSFEYKPLLPYKYTNDTGMFYGLKFYNDVLKEAGADGNVQSELILKKDMSTF  345

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLF  689
            T  QGWAFPR+IYFNGDEC +P PD YP+LPNSA     S S  + FLL 
Sbjct  346  TFKQGWAFPRKIYFNGDECAMPAPDEYPYLPNSANSKLISISTMASFLLL  395



>ref|XP_002463158.1| hypothetical protein SORBIDRAFT_02g038740 [Sorghum bicolor]
 gb|EER99679.1| hypothetical protein SORBIDRAFT_02g038740 [Sorghum bicolor]
Length=446

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 178/220 (81%), Gaps = 10/220 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC HK CV+  D+KRL   G 
Sbjct  200  TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCAKCACGCEHKTCVQG-DSKRLAVTGK  258

Query  183  NTP---------RKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQ  335
            +           R   A LLQCT HMCP+RVHWHVK+NYK+YWR KIA+TNFNY MNYTQ
Sbjct  259  HEHAHAAAARGHRDKEAPLLQCTTHMCPVRVHWHVKLNYKEYWRAKIAITNFNYHMNYTQ  318

Query  336  WTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL  515
            WTLVAQHPNL+N+T+VFSF+YKP+V Y SINDT MFYG+K++ND LM+AGP GNVQSEVL
Sbjct  319  WTLVAQHPNLDNITEVFSFDYKPVVAYGSINDTAMFYGLKYFNDHLMQAGPYGNVQSEVL  378

Query  516  LKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPN  635
            ++KD  TFT  QGWAFPR++YFNGDEC++PPPD YP+LPN
Sbjct  379  MRKDASTFTFRQGWAFPRKVYFNGDECQMPPPDEYPYLPN  418



>ref|XP_002306058.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
 gb|EEE86569.1| phytochelatin synthetase-like family protein [Populus trichocarpa]
Length=433

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 183/233 (79%), Gaps = 0/233 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  200  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  259

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCP+RVHWHVK+NYK+YWRVKIA+TNFNY  NY+ WTLV QHPN
Sbjct  260  NTTRKDNSSLLQCTHHMCPVRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWTLVVQHPN  319

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  320  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  379

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
              QGWAFPR++YFNGDEC +PPPD YP LPNSA    + S   S  +  F+ +
Sbjct  380  FKQGWAFPRKVYFNGDECMVPPPDTYPFLPNSAHGSPHFSMLISTLIFLFVYI  432



>gb|ADE67012.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ WTLV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67017.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ WTLV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>ref|XP_011014071.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
Length=434

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  200  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  259

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCP+RVHWHVK+NYK+YWRVKIA+TNFNY  NY+ WTLV QHPN
Sbjct  260  NTTRKDNSSLLQCTHHMCPVRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWTLVVQHPN  319

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  320  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  379

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC LPPPD YP LPNSA
Sbjct  380  FKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  412



>gb|ADE67018.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67045.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67039.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWR+KIA+TNFNY  NY+ WTLV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRLKIAITNFNYMKNYSTWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67037.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67047.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWR+KIA+TNFNY  NY+ WTLV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRLKIAITNFNYMKNYSTWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67026.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67043.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67014.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67022.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67023.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67024.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67028.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67033.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67035.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67044.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67050.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67036.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67020.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67021.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67027.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67040.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67046.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWR+KIA+TNFNY  NY+ WTLV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRLKIAITNFNYMKNYSTWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRKVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67019.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67038.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67041.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67048.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67049.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67051.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWR+KIA+TNFNY  NY+ WTLV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRLKIAITNFNYMKNYSTWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRKVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67032.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRKVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67031.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWR+KIA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRLKIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67011.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67013.1| COBRA-like 4 protein [Populus tomentosa]
 gb|AFZ78567.1| COBRA-like protein [Populus tomentosa]
Length=432

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRV+IA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVEIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67025.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67029.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67030.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRKVYFNGDECMVPPPDTYPFLPNSA  410



>ref|XP_008240111.1| PREDICTED: COBRA-like protein 4 [Prunus mume]
Length=438

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 179/234 (76%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNV CTYSQLL SRY TCCVS SSFYN TI PC  CACGC  K     SD+K     G 
Sbjct  204  TWNVICTYSQLLASRYPTCCVSMSSFYNSTITPCPTCACGCRDKKKCIVSDSKLSSVVGT  263

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            +TP KDN  LLQCT HMCPIRVHWHVK NYK YWRVKI +TNFNY++NYTQWTLV +HPN
Sbjct  264  HTPTKDNTPLLQCTQHMCPIRVHWHVKTNYKQYWRVKITITNFNYQLNYTQWTLVVEHPN  323

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LN++T+VFSF YKPL PYQS NDTG+FYG+KFYNDLL EAGP GNVQSE++L+K+  TFT
Sbjct  324  LNHITEVFSFVYKPLTPYQSKNDTGLFYGIKFYNDLLKEAGPEGNVQSELILEKNANTFT  383

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMF-LLFFIVV  701
              +GW FPR++YFNGDEC +P PD +P LPN+A     +    ++F LL F+ +
Sbjct  384  FKEGWGFPRKVYFNGDECMMPQPDEFPGLPNAAHTNLITVPKLALFWLLMFLAL  437



>gb|ADE67015.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67016.1| COBRA-like 4 protein [Populus tomentosa]
 gb|ADE67034.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D++ L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSRILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWRVKIA+TNFNY  NY+ W+LV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYMKNYSTWSLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL  Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLTAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPRR+YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRRVYFNGDECMVPPPDTYPFLPNSA  410



>gb|ADE67042.1| COBRA-like 4 protein [Populus tomentosa]
Length=432

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNVTCTYSQ +  +  +CCVS SSFYNQ + PC  CACGC + +   + D+  L+    
Sbjct  198  TWNVTCTYSQFMARKNPSCCVSLSSFYNQILTPCPTCACGCQNNDTCVNGDSSILQLPVG  257

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            NT RKDN++LLQCT+HMCPIRVHWHVK+NYK+YWR+KIA+TNFNY  NY+ WTLV QHPN
Sbjct  258  NTTRKDNSSLLQCTHHMCPIRVHWHVKVNYKEYWRLKIAITNFNYMKNYSTWTLVVQHPN  317

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LNNVTQVFSF YKPL+ Y SINDTGMFYGMK YND+LMEAGP GN+QSEVLL+KD+ TFT
Sbjct  318  LNNVTQVFSFEYKPLIAYDSINDTGMFYGMKDYNDVLMEAGPLGNLQSEVLLQKDQNTFT  377

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
              QGWAFPR++YFNGDEC +PPPD YP LPNSA
Sbjct  378  FKQGWAFPRKVYFNGDECMVPPPDTYPFLPNSA  410



>ref|XP_006657931.1| PREDICTED: COBRA-like protein 6-like [Oryza brachyantha]
Length=449

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 179/224 (80%), Gaps = 13/224 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS-DTKRLKSAG  179
            TWNVTCTYSQ L S+Y +CCVSFSSFYN+TIVPC  CACGC HK CV+S  DTKRL   G
Sbjct  201  TWNVTCTYSQHLASKYPSCCVSFSSFYNETIVPCAKCACGCEHKPCVRSERDTKRLAVTG  260

Query  180  INTPRKDNA------------ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKM  323
                   N             ALLQCT HMCP+RVHWHVK+NYK+YWR KI + NFNY+M
Sbjct  261  KKHDDHANGRAHAGGASSSAAALLQCTTHMCPVRVHWHVKLNYKEYWRAKITIANFNYRM  320

Query  324  NYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQ  503
            NYT WTLVAQHPNL+N+T+VFSF+YKP+V Y SINDT MFYG+K++ND LMEAGP GNVQ
Sbjct  321  NYTGWTLVAQHPNLDNITEVFSFDYKPVVSYGSINDTAMFYGLKYFNDQLMEAGPHGNVQ  380

Query  504  SEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPN  635
            SEVL++KD  TFT +QGWAFPR++YFNGDEC++PPPD+YP+LPN
Sbjct  381  SEVLMRKDARTFTFSQGWAFPRKVYFNGDECQMPPPDSYPYLPN  424



>ref|XP_007210750.1| hypothetical protein PRUPE_ppa021191mg, partial [Prunus persica]
 gb|EMJ11949.1| hypothetical protein PRUPE_ppa021191mg, partial [Prunus persica]
Length=414

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 180/234 (77%), Gaps = 1/234 (0%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWNV CTYSQLL SRY TCCVS SSFYN TI PC  CACGC  K     SD+K     GI
Sbjct  180  TWNVICTYSQLLASRYPTCCVSMSSFYNSTITPCPTCACGCRDKKKCIVSDSKLSSVVGI  239

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
            +TP KDN  LLQCT HMCPIRVHWHVK NYK YWRVKI +TNFN+++NYTQWTLV +HPN
Sbjct  240  HTPTKDNTPLLQCTQHMCPIRVHWHVKTNYKQYWRVKITITNFNHRLNYTQWTLVVEHPN  299

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
            LN++T+VFSF YKPL PYQS NDTG+FYG+KFYNDLL EAGP GNVQSE++L+K+  TFT
Sbjct  300  LNHITEVFSFVYKPLTPYQSKNDTGLFYGIKFYNDLLKEAGPEGNVQSELILEKNANTFT  359

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSM-FLLFFIVV  701
              +GW FPR++YFNGDEC +P PD +P LPN+A     +    ++ +LL F+ +
Sbjct  360  FKEGWGFPRKVYFNGDECMMPQPDEFPGLPNAAHTNLITVPKLALSWLLMFLAL  413



>ref|XP_002514627.1| hypothetical protein RCOM_1468720 [Ricinus communis]
 gb|EEF47733.1| hypothetical protein RCOM_1468720 [Ricinus communis]
Length=1048

 Score =   347 bits (889),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 187/235 (80%), Gaps = 0/235 (0%)
 Frame = +3

Query  3     TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
             TWNVTCTYSQ+L S   TCCVS SSFYN TIV C  C+CGC +KN    S++  L  AG+
Sbjct  812   TWNVTCTYSQMLASPDPTCCVSMSSFYNSTIVSCPACSCGCQNKNNCVESNSNILSIAGV  871

Query  183   NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
             NTP  DN  LL CT HMCP+RVHWHVK+NYKDYWRVKIA+TNFNY +NYTQWTLV QHPN
Sbjct  872   NTPTTDNTLLLLCTQHMCPVRVHWHVKLNYKDYWRVKIAITNFNYGVNYTQWTLVVQHPN  931

Query  363   LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
             LNNVTQVFSF+Y P++PY S ND+GMFYG+KFYND+LMEAGP GNVQSE++LKKD  TFT
Sbjct  932   LNNVTQVFSFDYTPVLPYPSTNDSGMFYGIKFYNDVLMEAGPDGNVQSELILKKDMNTFT  991

Query  543   LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
              +QGWAFPR++YFNGDEC +PPPD YP+LPNSA   + + S     +L  +++ +
Sbjct  992   FHQGWAFPRKVYFNGDECVMPPPDEYPYLPNSAPANWLALSSLMPAILLVVIIRL  1046


 Score =   208 bits (530),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 123/188 (65%), Gaps = 28/188 (15%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TW VTCTYSQ+LVS+YSTCCVS SSFYN  I PC  CACGC ++ NCV  +D K      
Sbjct  205  TWIVTCTYSQMLVSKYSTCCVSLSSFYNSKITPCPSCACGCQNEHNCVHMNDPKISSVVE  264

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
             +TPR      L+CT HMCPIRVHWHVK NYK +W VKI +TNF+Y  NYTQWTLVAQHP
Sbjct  265  SDTPR------LRCTQHMCPIRVHWHVKANYKKHWLVKITITNFSYGKNYTQWTLVAQHP  318

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            N NN+T+++ F YKPL  Y S+N                     GNVQSE+LL KD   F
Sbjct  319  NFNNITKLYKFIYKPLTLYNSMN---------------------GNVQSEMLLGKDMNIF  357

Query  540  TLNQGWAF  563
            T  QGWAF
Sbjct  358  TFQQGWAF  365



>sp|Q6Z4G7.1|COBL6_ORYSJ RecName: Full=COBRA-like protein 6; AltName: Full=Protein BRITTLE 
CULM1-like 7; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAC83873.1| putative phytochelatin synthetase [Oryza sativa Japonica Group]
 gb|EAZ40581.1| hypothetical protein OsJ_25038 [Oryza sativa Japonica Group]
Length=451

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 187/252 (74%), Gaps = 18/252 (7%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKSS-DTKRLKSA  176
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC  HK CV+S  D KRL   
Sbjct  200  TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCAKCACGCDAHKPCVRSERDGKRLAVT  259

Query  177  GINTPRKDNA--------------ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFN  314
            G       NA               LLQCT HMCP+RVHWHVK+NY++YWR KI + NFN
Sbjct  260  GKKHDANANAHGRGNGVAAAAMAAPLLQCTTHMCPVRVHWHVKLNYREYWRAKITIVNFN  319

Query  315  YKMNYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSG  494
            Y+MNYT WTLVAQHPNL+N+T+VFSF+YKP+V Y SINDT MFYG+K++ND LMEAGP G
Sbjct  320  YRMNYTGWTLVAQHPNLDNITEVFSFDYKPVVSYGSINDTAMFYGLKYFNDQLMEAGPHG  379

Query  495  NVQSEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS--SSP  668
            NVQSEVL++KD  TFT  QGWAFPR++YFNGDEC++PPPD+YP+LPN+A     S   S 
Sbjct  380  NVQSEVLMRKDARTFTFRQGWAFPRKVYFNGDECQMPPPDSYPYLPNAAPPAAASLVGSA  439

Query  669  CSMFLLFFIVVS  704
             +M  L F +++
Sbjct  440  VAMAALVFFLMA  451



>ref|XP_002531001.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF31389.1| Protein COBRA precursor, putative [Ricinus communis]
Length=426

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 176/218 (81%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN--CVKSSDTKRLKSA  176
            TWNVTCTYSQ +  +   CCVSFSSFYNQ I  C  CACGC   N  CV + D+K  K  
Sbjct  198  TWNVTCTYSQFMARKNPNCCVSFSSFYNQEITSCPTCACGCQSNNNTCV-NRDSKIFKVV  256

Query  177  GINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQH  356
            G +  + +   LLQCT+HMCPIRVHWHVK+NYK+YWRVK+A+ NF+Y+MNY+ W+LV QH
Sbjct  257  GESKSKNETTPLLQCTHHMCPIRVHWHVKVNYKEYWRVKVAIVNFDYRMNYSLWSLVIQH  316

Query  357  PNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKET  536
            PNLNNVTQVFSFNY+PL+PY+SINDTG+F GMK+YND+LMEAGP GNVQSE+LL+KD+ T
Sbjct  317  PNLNNVTQVFSFNYQPLIPYKSINDTGLFCGMKYYNDVLMEAGPLGNVQSEILLQKDQNT  376

Query  537  FTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRG  650
            FT  QGWAFPR++YFNGDEC LPPPD YP LPNSA  G
Sbjct  377  FTFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSAHGG  414



>gb|KEH38143.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=442

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 175/219 (80%), Gaps = 4/219 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKS-AG  179
            +WNVTCTYSQ L S+  +CCVS S+FYN  +  C  CACGC +     + D+K LK  AG
Sbjct  203  SWNVTCTYSQFLASKNPSCCVSLSTFYNDQVTACPTCACGCQNNATCVTKDSKILKEVAG  262

Query  180  INTPRKDNAA---LLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
             N  RK + A   LLQCT H+CP+RVHWH+K NYKDYWRVKIA+ NF Y++NYTQW LV 
Sbjct  263  NNKTRKSDIAPKPLLQCTRHLCPVRVHWHIKDNYKDYWRVKIAIINFKYRLNYTQWGLVV  322

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPNL+NVTQV+SF Y PL+PY++INDTGMFYG+KFYNDL+MEAG  GNVQSEVL+KKDK
Sbjct  323  QHPNLSNVTQVYSFEYMPLLPYEAINDTGMFYGLKFYNDLIMEAGSKGNVQSEVLMKKDK  382

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
             TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA R
Sbjct  383  NTFTLKQGWAFPRRVYFNGDECMLPPPDSYPFLPNSARR  421



>gb|ABS88990.1| ch-cobra [Cunninghamia lanceolata]
Length=452

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 172/217 (79%), Gaps = 4/217 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC    T         ++ LK
Sbjct  211  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPVCTCGCQNNITQPGTCVEQGSQVLK  270

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            + GINTP K+ A L+QCT HMCPIR+HWHVK+NYK YWRVK+ VTNFNY+MNY+QW +VA
Sbjct  271  TPGINTPTKNFAPLIQCTPHMCPIRIHWHVKLNYKAYWRVKVTVTNFNYRMNYSQWNIVA  330

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSF+YKPL PY +INDT M +G+K+YND+LMEAGP GNVQSE+L +KD 
Sbjct  331  QHPNFDNITQLFSFDYKPLTPYGTINDTAMLWGVKYYNDMLMEAGPDGNVQSEILFQKDM  390

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            +TFT  QGWAFPRRIYFNGD+C LPPPDAYP LPN +
Sbjct  391  QTFTFKQGWAFPRRIYFNGDDCVLPPPDAYPWLPNRS  427



>gb|AFK33956.1| unknown [Lotus japonicus]
Length=454

 Score =   325 bits (834),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 184/238 (77%), Gaps = 7/238 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            +WNVTCTYSQ L  +  +CCVS SSFYN  +  C  CACGC + +   +SD+K L+    
Sbjct  214  SWNVTCTYSQFLAYKNPSCCVSLSSFYNDKVTACPTCACGCQNNDTCVTSDSKILQENTT  273

Query  183  NTPRKD--NAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQH  356
             T + D     LL+CT+H+C +RVHWH+K NYKDYWRVKIA+ NF+Y+MNYTQW+LV QH
Sbjct  274  KTHKTDITPKPLLRCTHHLCHVRVHWHIKENYKDYWRVKIAIINFDYRMNYTQWSLVVQH  333

Query  357  PNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKET  536
            PNLNNVTQV+SF Y PL+PYQ+INDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKDK T
Sbjct  334  PNLNNVTQVYSFEYLPLLPYQAINDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKDKNT  393

Query  537  FTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
            FTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA R      P ++ +  +++ + F
Sbjct  394  FTLKQGWAFPRRVYFNGDECMLPPPDSYPFLPNSAHR-----LPSTVLMAAYVIFTSF  446



>ref|XP_010031041.1| PREDICTED: COBRA-like protein 4 isoform X2 [Eucalyptus grandis]
Length=380

 Score =   322 bits (826),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 186/234 (79%), Gaps = 7/234 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWN+TCTYSQL+ S++  CCVS SSFYN TI PC  CACGC +KN CV+S+   +     
Sbjct  150  TWNITCTYSQLVASQHPRCCVSMSSFYNSTITPCPSCACGCQNKNTCVESAPNIQ----S  205

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            + TP  DN  +LQCT HMCPIRVHWHVK NYK+YWRVK+++ NF+Y +NY QWTLVAQHP
Sbjct  206  VVTPSIDNP-ILQCTQHMCPIRVHWHVKTNYKEYWRVKMSIINFSYFVNYNQWTLVAQHP  264

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF YKPLVPY+S+NDTGMFYG+KF+NDL+ EAGP GNVQSE++L+KD  TF
Sbjct  265  NLNNVTQVFSFVYKPLVPYKSMNDTGMFYGIKFFNDLITEAGPEGNVQSEIILQKDAFTF  324

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS-SSPCSMFLLFFIV  698
            TL +GWAFPR+IYFNG+EC +P PD YPHLPNSA    +  SS  ++  + F+V
Sbjct  325  TLKEGWAFPRKIYFNGEECTMPSPDQYPHLPNSAPGNLFPVSSGAALLAICFLV  378



>ref|XP_004488433.1| PREDICTED: COBRA-like protein 4-like isoform X1 [Cicer arietinum]
Length=453

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 182/240 (76%), Gaps = 7/240 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLK-SAG  179
            +WNVTCTYSQ L S+  +CCVS SSFYN  +  C  CACGC +     + D+K LK S G
Sbjct  214  SWNVTCTYSQFLASKNPSCCVSLSSFYNDQVTACPTCACGCQNNATCVTKDSKILKESDG  273

Query  180  INTPRKDNAA---LLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
             N  RK +     LLQCT+H+C +RVHWH+K NYKDYWRVKIA+ NFNY++N+TQW LV 
Sbjct  274  NNKTRKSDITPKPLLQCTHHLCHVRVHWHIKDNYKDYWRVKIAIINFNYRLNFTQWGLVV  333

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPNLNNVTQV+SF Y PL+PY++INDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKDK
Sbjct  334  QHPNLNNVTQVYSFEYMPLLPYEAINDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKDK  393

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
             TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA   Y      ++   + I  S F
Sbjct  394  NTFTLKQGWAFPRRVYFNGDECMLPPPDSYPFLPNSA---YSLPKSVTLIKAYVIFASFF  450



>ref|XP_008341798.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=432

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 182/236 (77%), Gaps = 4/236 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTC+YSQL   +Y +CCVS SSFYN TIV C  C CGC  K NC++S D+K L    
Sbjct  198  TWNVTCSYSQLQARKYPSCCVSLSSFYNSTIVHCPSCTCGCQDKRNCIQS-DSKMLSVVE  256

Query  180  INTPRKDNA-ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQH  356
             +  RK N   LLQCT HMCP+RVHWHV +NYK+YWRVK+++TNFNY+MNYT WTLV QH
Sbjct  257  DDAKRKGNGLPLLQCTRHMCPVRVHWHVMLNYKEYWRVKVSITNFNYQMNYTHWTLVMQH  316

Query  357  PNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKET  536
            PN NNVTQVFSF+YKPL+ Y SINDTGMFYGMKF+ND L++AG  G VQSE+LL+KDK T
Sbjct  317  PNFNNVTQVFSFDYKPLIAYSSINDTGMFYGMKFFNDRLVQAGEFGFVQSEMLLQKDKNT  376

Query  537  FTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS-SSPCSMFLLFFIVV  701
            FTL +GWAFPR++YFNGDEC+ PPPD YP LPNSA +   S S+  S F   FI +
Sbjct  377  FTLREGWAFPRKVYFNGDECQXPPPDVYPFLPNSAQKILLSFSALISXFFFLFIAI  432



>gb|ABK25470.1| unknown [Picea sitchensis]
Length=471

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 187/249 (75%), Gaps = 17/249 (7%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  + STCCVS SSFYN TI PC  CAC C    T  +CV S D+  LK
Sbjct  225  TWNVTCTYSQFLAQKSSTCCVSLSSFYNDTITPCPTCACACRNNVTQPSCVHS-DSPVLK  283

Query  171  SAGINTPRKDN--AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTL  344
              G   P  ++    LLQCT HMCP+RVHWHVK+NYKDYWRVKI VTNFNY+MNYT WTL
Sbjct  284  LPGPTNPITNSLQPPLLQCTRHMCPVRVHWHVKLNYKDYWRVKITVTNFNYRMNYTDWTL  343

Query  345  VAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
            VAQHPN +NVTQVFSFNYKPL PY SINDT MF+G K+YNDLLM+AGP G+VQSE+LL+K
Sbjct  344  VAQHPNFDNVTQVFSFNYKPLTPYGSINDTAMFWGQKYYNDLLMQAGPMGSVQSELLLRK  403

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMF-------L  683
            DK+TFT  QGWAFPRR+YFNGD+C +P PDAYP LP++A   + + +P S+F       L
Sbjct  404  DKQTFTFKQGWAFPRRLYFNGDQCVMPSPDAYPWLPSTA---HPAPAPPSLFAFILPLAL  460

Query  684  LFFIVVSIF  710
               IV S+F
Sbjct  461  ALAIVPSLF  469



>gb|KCW83758.1| hypothetical protein EUGRSUZ_B00629, partial [Eucalyptus grandis]
Length=410

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 186/234 (79%), Gaps = 7/234 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWN+TCTYSQL+ S++  CCVS SSFYN TI PC  CACGC +KN CV+S+   +     
Sbjct  180  TWNITCTYSQLVASQHPRCCVSMSSFYNSTITPCPSCACGCQNKNTCVESAPNIQ----S  235

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            + TP  DN  +LQCT HMCPIRVHWHVK NYK+YWRVK+++ NF+Y +NY QWTLVAQHP
Sbjct  236  VVTPSIDNP-ILQCTQHMCPIRVHWHVKTNYKEYWRVKMSIINFSYFVNYNQWTLVAQHP  294

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF YKPLVPY+S+NDTGMFYG+KF+NDL+ EAGP GNVQSE++L+KD  TF
Sbjct  295  NLNNVTQVFSFVYKPLVPYKSMNDTGMFYGIKFFNDLITEAGPEGNVQSEIILQKDAFTF  354

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS-SSPCSMFLLFFIV  698
            TL +GWAFPR+IYFNG+EC +P PD YPHLPNSA    +  SS  ++  + F+V
Sbjct  355  TLKEGWAFPRKIYFNGEECTMPSPDQYPHLPNSAPGNLFPVSSGAALLAICFLV  408



>ref|XP_010031033.1| PREDICTED: COBRA-like protein 4 isoform X1 [Eucalyptus grandis]
Length=434

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 186/234 (79%), Gaps = 7/234 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWN+TCTYSQL+ S++  CCVS SSFYN TI PC  CACGC +KN CV+S+   +     
Sbjct  204  TWNITCTYSQLVASQHPRCCVSMSSFYNSTITPCPSCACGCQNKNTCVESAPNIQ----S  259

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            + TP  DN  +LQCT HMCPIRVHWHVK NYK+YWRVK+++ NF+Y +NY QWTLVAQHP
Sbjct  260  VVTPSIDNP-ILQCTQHMCPIRVHWHVKTNYKEYWRVKMSIINFSYFVNYNQWTLVAQHP  318

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVTQVFSF YKPLVPY+S+NDTGMFYG+KF+NDL+ EAGP GNVQSE++L+KD  TF
Sbjct  319  NLNNVTQVFSFVYKPLVPYKSMNDTGMFYGIKFFNDLITEAGPEGNVQSEIILQKDAFTF  378

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS-SSPCSMFLLFFIV  698
            TL +GWAFPR+IYFNG+EC +P PD YPHLPNSA    +  SS  ++  + F+V
Sbjct  379  TLKEGWAFPRKIYFNGEECTMPSPDQYPHLPNSAPGNLFPVSSGAALLAICFLV  432



>ref|XP_006440800.1| hypothetical protein CICLE_v10023912mg [Citrus clementina]
 gb|ESR54040.1| hypothetical protein CICLE_v10023912mg [Citrus clementina]
Length=438

 Score =   322 bits (826),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 175/214 (82%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWNVTCTYSQ+L S+  TCCVS SSFYN TI PC  C+CGC +KN CVKS    R     
Sbjct  204  TWNVTCTYSQILASKNPTCCVSMSSFYNSTITPCPSCSCGCQNKNNCVKSDSDIRSVVGM  263

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NT     A LL CT HMCPIRVHWHVK+NYK YWRVK+++TNFNY++NYT+WTLV QHP
Sbjct  264  MNT-TTSVAPLLHCTQHMCPIRVHWHVKLNYKKYWRVKMSITNFNYQVNYTEWTLVVQHP  322

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVT+VFSFNYKPL+PY S NDTGMFYG+KF+ND+L+++GP GNVQSE++L+KD  TF
Sbjct  323  NLNNVTEVFSFNYKPLIPYDSTNDTGMFYGIKFFNDILLQSGPEGNVQSELILQKDMNTF  382

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR+IYFNGDEC +P P+ YP+LPNSA
Sbjct  383  TYKQGWAFPRKIYFNGDECSMPLPEDYPYLPNSA  416



>gb|KHN19596.1| COBRA-like protein 4 [Glycine soja]
Length=457

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 187/244 (77%), Gaps = 8/244 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            +WNVTCTYSQ L S+  +CCVS SSFY+  +  C  CACGC + N   + D+K L+    
Sbjct  214  SWNVTCTYSQFLASKNPSCCVSLSSFYSDKVTGCPPCACGCQNNNTCVTKDSKILQENAT  273

Query  183  NTPRKDNAAL-----LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            +  RK +  L     LQCT+H+C +RVHWH+K NYKDYWRVKIA+ NFNY++N+T W+LV
Sbjct  274  SPHRKSDITLTPKPLLQCTHHLCHVRVHWHLKDNYKDYWRVKIAIINFNYRLNFTDWSLV  333

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPNLNNVTQV+SF Y PL+PY+SINDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKD
Sbjct  334  VQHPNLNNVTQVYSFEYMPLLPYESINDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKD  393

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA--IRGYYSSSPCSMFLLFF-IV  698
            K TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA  +      +   +F LFF +V
Sbjct  394  KNTFTLKQGWAFPRRVYFNGDECMLPPPDSYPMLPNSAHKLPTITLMATYVVFTLFFHLV  453

Query  699  VSIF  710
            V++F
Sbjct  454  VTLF  457



>ref|XP_006477734.1| PREDICTED: COBRA-like protein 4-like, partial [Citrus sinensis]
Length=423

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 180/222 (81%), Gaps = 2/222 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWNVTCTYSQ+L S+  TCCVS SSFYN TI PC  C+CGC +KN CVKS    R     
Sbjct  189  TWNVTCTYSQILASKNPTCCVSMSSFYNSTITPCPSCSCGCQNKNNCVKSDSDIRSVVGM  248

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NT     A LL CT HMCPIRVHWHVK+NYK+YWRVK+++TNFNY++NYT+WTLV QHP
Sbjct  249  MNT-TTIVAPLLHCTQHMCPIRVHWHVKLNYKEYWRVKMSITNFNYQVNYTEWTLVVQHP  307

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVT+VFSF+YKPL+PY S NDTGMFYG+KF+N++L+++GP GNVQSE++L+KD  TF
Sbjct  308  NLNNVTEVFSFDYKPLIPYDSTNDTGMFYGIKFFNEILLQSGPEGNVQSELILQKDMNTF  367

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSS  665
            T  QGWAFPR+IYFNGDEC++P P+ YP+LPNSA     +SS
Sbjct  368  TFKQGWAFPRKIYFNGDECRMPLPEDYPYLPNSAHAKAIASS  409



>gb|KDO65676.1| hypothetical protein CISIN_1g038127mg [Citrus sinensis]
Length=438

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 175/214 (82%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-CVKSSDTKRLKSAG  179
            TWNVTCTYSQ+L S+  TCCVS SSFYN TI PC  C+CGC +KN CVKS    R     
Sbjct  204  TWNVTCTYSQILASKNPTCCVSMSSFYNSTITPCPSCSCGCQNKNNCVKSDSDIRSVVGM  263

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
            +NT     A LL CT HMCPIRVHWHVK+NYK YWRVK+++TNFNY++NYT+WTLV QHP
Sbjct  264  MNT-TTIVAPLLHCTQHMCPIRVHWHVKLNYKKYWRVKMSITNFNYQVNYTEWTLVVQHP  322

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            NLNNVT+VFSFNYKPL+PY S NDTGMFYG+KF+ND+L+++GP GNVQSE++L+KD  TF
Sbjct  323  NLNNVTEVFSFNYKPLIPYDSTNDTGMFYGIKFFNDILLQSGPEGNVQSELILQKDMNTF  382

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            T  QGWAFPR+IYFNGDEC +P P+ YP+LPNSA
Sbjct  383  TYKQGWAFPRKIYFNGDECSMPLPEDYPYLPNSA  416



>ref|XP_003528239.1| PREDICTED: COBRA-like protein 4-like [Glycine max]
Length=458

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 188/245 (77%), Gaps = 9/245 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            +WNVTCTYSQ L S+  +CCVS SSFY+  +  C  CACGC + N   + D+K L+    
Sbjct  214  SWNVTCTYSQFLASKNPSCCVSLSSFYSDKVTGCPPCACGCQNNNTCVTKDSKILQENAT  273

Query  183  NTPRKDNAAL-----LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            +  RK +  L     LQCT+H+C +RVHWH+K NYKDYWRVKIA+ NFNY++N+T W+LV
Sbjct  274  SPHRKSDITLTPKPLLQCTHHLCHVRVHWHLKDNYKDYWRVKIAIINFNYRLNFTDWSLV  333

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPNLNNVTQV+SF Y PL+PY+SINDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKD
Sbjct  334  VQHPNLNNVTQVYSFEYMPLLPYESINDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKD  393

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCS---MFLLFF-I  695
            K TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNS  +   + +  +   +F LFF +
Sbjct  394  KNTFTLKQGWAFPRRVYFNGDECMLPPPDSYPMLPNSGHKLPTTITLMATYVVFTLFFHL  453

Query  696  VVSIF  710
            VV++F
Sbjct  454  VVTLF  458



>ref|XP_007138375.1| hypothetical protein PHAVU_009G203200g [Phaseolus vulgaris]
 gb|ESW10369.1| hypothetical protein PHAVU_009G203200g [Phaseolus vulgaris]
Length=456

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 188/243 (77%), Gaps = 7/243 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            +WNVTCTYSQ L S+  +CCVS SSFY+  I  C  CACGC + +   + D+K LK    
Sbjct  214  SWNVTCTYSQFLASKNPSCCVSMSSFYSDKITGCPPCACGCQNNDTCVTRDSKILKENVT  273

Query  183  NTPRKDNAA---LLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQ  353
            +  RK +     LLQCT+H+C +RVHWH+K NY+DYWRVKIA+ NFNY++N+T W+LV Q
Sbjct  274  SPHRKSDITPKPLLQCTHHLCHVRVHWHLKDNYEDYWRVKIAIINFNYRLNFTDWSLVVQ  333

Query  354  HPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKE  533
            HPNLNNVTQV+SF Y PL+PY+SINDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKDK 
Sbjct  334  HPNLNNVTQVYSFEYMPLLPYESINDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKDKN  393

Query  534  TFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLF----FIVV  701
            TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA +   + +  + +++F     +VV
Sbjct  394  TFTLKQGWAFPRRVYFNGDECMLPPPDSYPMLPNSAQKPPTTITLMAAYVVFTLFLHLVV  453

Query  702  SIF  710
            ++F
Sbjct  454  TLF  456



>ref|XP_011087368.1| PREDICTED: protein COBRA-like isoform X2 [Sesamum indicum]
 ref|XP_011087369.1| PREDICTED: protein COBRA-like isoform X2 [Sesamum indicum]
Length=404

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 186/249 (75%), Gaps = 10/249 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC---THKNCVKSSDTKRLKS  173
            TWNVTC+YSQ L  +  TCCVS S+FYN TIV C  C+CGC   T        D+  + S
Sbjct  163  TWNVTCSYSQFLAQKTPTCCVSLSAFYNDTIVGCPTCSCGCKNITQPGTCVDPDSPHIAS  222

Query  174  AGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQ  353
               N+ + + A L+QCT+HMCP+R+HWHVK+NYK+YWRVKIA+TNFNY+MNYTQW LVAQ
Sbjct  223  VVSNSDKNNLAPLVQCTSHMCPVRIHWHVKLNYKEYWRVKIAITNFNYRMNYTQWNLVAQ  282

Query  354  HPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKE  533
            HPN +N+TQ+FSFNY+PL PY SINDT M +G+KFYNDLLM+AGP GNVQSE+L KKDK 
Sbjct  283  HPNFDNLTQIFSFNYEPLTPYGSINDTAMLWGVKFYNDLLMQAGPYGNVQSELLFKKDKT  342

Query  534  TFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIFC  713
            TFT ++GWAFPRRIYFNG+ C +PPPD+YP+LPN  +R      P SM  L  IV  +  
Sbjct  343  TFTFDKGWAFPRRIYFNGENCVMPPPDSYPYLPNYGVR-----LPISM--LHLIVTIMAS  395

Query  714  S*LLFSQLY  740
            S +L S L+
Sbjct  396  SVVLLSYLW  404



>ref|XP_009373789.1| PREDICTED: COBRA-like protein 4 [Pyrus x bretschneideri]
Length=432

 Score =   320 bits (819),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 183/236 (78%), Gaps = 5/236 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTC+YSQL   +Y +CCVS SSFYN TIV C  C+CGC  K NCV+S D+K L    
Sbjct  198  TWNVTCSYSQLRARKYPSCCVSLSSFYNSTIVHCPSCSCGCQDKRNCVQS-DSKMLSVVE  256

Query  180  INTPRKDNA-ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQH  356
             +  RK N   LLQCT HMCP+RVHWHV +NYK+YWRVK+ +TNFNY+MN+T WTLV QH
Sbjct  257  DDAKRKGNELPLLQCTRHMCPVRVHWHVMLNYKEYWRVKVTITNFNYRMNHTLWTLVMQH  316

Query  357  PNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKET  536
            PN NNVTQVF+F+YKPL+ Y SINDTGMFYG+KF+ND L++AG  G VQSE+LL+KDK T
Sbjct  317  PNFNNVTQVFNFDYKPLIAYSSINDTGMFYGLKFFNDRLVQAGEFGFVQSEMLLQKDKNT  376

Query  537  FTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA--IRGYYSSSPCSMFLLFFIV  698
            FTL +GWAFPR++YFNGDEC+LPPPD YP LPNSA  I   +S+   S F LF  +
Sbjct  377  FTLREGWAFPRKVYFNGDECQLPPPDVYPFLPNSAHEILLSFSALISSFFFLFIAI  432



>ref|XP_011087367.1| PREDICTED: protein COBRA-like isoform X1 [Sesamum indicum]
Length=454

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 186/249 (75%), Gaps = 10/249 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC---THKNCVKSSDTKRLKS  173
            TWNVTC+YSQ L  +  TCCVS S+FYN TIV C  C+CGC   T        D+  + S
Sbjct  213  TWNVTCSYSQFLAQKTPTCCVSLSAFYNDTIVGCPTCSCGCKNITQPGTCVDPDSPHIAS  272

Query  174  AGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQ  353
               N+ + + A L+QCT+HMCP+R+HWHVK+NYK+YWRVKIA+TNFNY+MNYTQW LVAQ
Sbjct  273  VVSNSDKNNLAPLVQCTSHMCPVRIHWHVKLNYKEYWRVKIAITNFNYRMNYTQWNLVAQ  332

Query  354  HPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKE  533
            HPN +N+TQ+FSFNY+PL PY SINDT M +G+KFYNDLLM+AGP GNVQSE+L KKDK 
Sbjct  333  HPNFDNLTQIFSFNYEPLTPYGSINDTAMLWGVKFYNDLLMQAGPYGNVQSELLFKKDKT  392

Query  534  TFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIFC  713
            TFT ++GWAFPRRIYFNG+ C +PPPD+YP+LPN  +R      P SM  L  IV  +  
Sbjct  393  TFTFDKGWAFPRRIYFNGENCVMPPPDSYPYLPNYGVR-----LPISM--LHLIVTIMAS  445

Query  714  S*LLFSQLY  740
            S +L S L+
Sbjct  446  SVVLLSYLW  454



>ref|XP_008379444.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=421

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 179/236 (76%), Gaps = 4/236 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-NCVKSSDTKRLKSAG  179
            TWNVTCTYSQLL  +Y +CCVS SSFYN T+VPC  C CGC  K NCV+S  +K + +  
Sbjct  186  TWNVTCTYSQLLAKKYPSCCVSLSSFYNSTVVPCPSCTCGCHDKSNCVQSG-SKIVSTVE  244

Query  180  INTPRKDNAALL-QCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQH  356
             +   K N   L QCT HMCP+RVHWHV +NY DYW VK+++TNFNY+MNYT WTLV QH
Sbjct  245  DDAXXKSNVQPLPQCTRHMCPVRVHWHVMLNYXDYWXVKVSITNFNYRMNYTLWTLVIQH  304

Query  357  PNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKET  536
            PN  NVTQVFSF+YKPLV Y SINDTGMFYG+KFYND LMEAG  G+VQ E+LLKKDK T
Sbjct  305  PNFINVTQVFSFDYKPLVAYDSINDTGMFYGLKFYNDHLMEAGKFGHVQXEMLLKKDKNT  364

Query  537  FTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSP-CSMFLLFFIVV  701
            FTL +GWAFPR++YFNGDE +LPPPD YP LPNSA     S SP  S F   FIV+
Sbjct  365  FTLREGWAFPRKVYFNGDEXQLPPPDVYPFLPNSAHETLLSFSPLISSFTFLFIVI  420



>ref|XP_004488434.1| PREDICTED: COBRA-like protein 4-like isoform X2 [Cicer arietinum]
Length=449

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/240 (63%), Positives = 178/240 (74%), Gaps = 11/240 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            +WNVTCTYSQ L S+  +CCVS SSFYN  +  C  CACGC    T+   +K SD     
Sbjct  214  SWNVTCTYSQFLASKNPSCCVSLSSFYNDQVTACPTCACGCQNNATYSKILKESDGNNKT  273

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
                 TP+     LLQCT+H+C +RVHWH+K NYKDYWRVKIA+ NFNY++N+TQW LV 
Sbjct  274  RKSDITPK----PLLQCTHHLCHVRVHWHIKDNYKDYWRVKIAIINFNYRLNFTQWGLVV  329

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPNLNNVTQV+SF Y PL+PY++INDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKDK
Sbjct  330  QHPNLNNVTQVYSFEYMPLLPYEAINDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKDK  389

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
             TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA   Y      ++   + I  S F
Sbjct  390  NTFTLKQGWAFPRRVYFNGDECMLPPPDSYPFLPNSA---YSLPKSVTLIKAYVIFASFF  446



>ref|XP_006578523.1| PREDICTED: COBRA-like protein 4-like isoform X2 [Glycine max]
Length=389

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 186/245 (76%), Gaps = 9/245 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            +WNVTCTYSQ L S+  +CCVS SSFY+  +  C  CACGC + +   + D+K L+    
Sbjct  145  SWNVTCTYSQFLASKNPSCCVSLSSFYSDKVTGCPPCACGCQNNDTCVTKDSKILQQNVT  204

Query  183  NTPRKDNAAL-----LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            +  +K +  L     LQCT+H+C +RVHWH+K NYKDYWRVKIA+ NFNY++N+T W+LV
Sbjct  205  SPHQKSDITLTPKPLLQCTHHLCHVRVHWHLKDNYKDYWRVKIAIINFNYRLNFTDWSLV  264

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPNLNNVTQV+SF Y PL+PY+S NDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKD
Sbjct  265  VQHPNLNNVTQVYSFEYMPLLPYESTNDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKD  324

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMF----LLFFI  695
            K TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA +   + +  + +    L F +
Sbjct  325  KNTFTLKQGWAFPRRVYFNGDECMLPPPDSYPMLPNSAHKLPTTITLMAAYVVFTLFFHL  384

Query  696  VVSIF  710
            VV++F
Sbjct  385  VVTLF  389



>emb|CDP21681.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   318 bits (814),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 171/220 (78%), Gaps = 5/220 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  +CCVS SSFYN TIVPC  C CGC    +H      +D   L 
Sbjct  212  TWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVPCPTCTCGCQNNGSHPGSCVDADAPHLA  271

Query  171  SAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            S   +  + +N A L+QCT+HMCPIRVHWHVK+NYK+YWRVK+ +TNFNY+MNY+QW LV
Sbjct  272  SVVSDHGKSNNLAPLIQCTSHMCPIRVHWHVKVNYKEYWRVKVTITNFNYRMNYSQWNLV  331

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+TQ+FSFN+KPL PYQ+INDT M +G+KFYND LMEAGP GNVQSE+L +KD
Sbjct  332  VQHPNFDNLTQIFSFNFKPLTPYQAINDTAMLFGIKFYNDFLMEAGPYGNVQSELLFRKD  391

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
            K TFT ++GWAFPRRIYFNGD C +PPPD+YP+LPN   R
Sbjct  392  KSTFTFDKGWAFPRRIYFNGDNCVMPPPDSYPYLPNGGSR  431



>ref|XP_010031023.1| PREDICTED: COBRA-like protein 1 [Eucalyptus grandis]
 gb|KCW83757.1| hypothetical protein EUGRSUZ_B00628 [Eucalyptus grandis]
Length=447

 Score =   317 bits (813),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 172/224 (77%), Gaps = 4/224 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN T+V C  C CGC    T       +D+  L 
Sbjct  206  TWNVTCTYSQFLAQKMPTCCVSLSSFYNDTVVNCPRCTCGCRNNATDSGSCIQADSPHLA  265

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S   +  +  NA LLQCT+HMCP+RVHWHVK+NYK++WRVKI +TNFNY+MN+TQW LV 
Sbjct  266  SVVSHPGKSANAPLLQCTSHMCPVRVHWHVKLNYKEFWRVKITITNFNYRMNFTQWNLVV  325

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYKPL PY  +NDT M +G+K+YNDLLMEAGPSGNVQSE+L  KDK
Sbjct  326  QHPNFDNLTQIFSFNYKPLTPYAGLNDTAMLWGVKYYNDLLMEAGPSGNVQSELLFWKDK  385

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS  662
             +FT ++GWAFPRRIYFNGD+C +PPPDAYP LPNS+ R   S+
Sbjct  386  SSFTFDKGWAFPRRIYFNGDDCVMPPPDAYPWLPNSSRRSVIST  429



>gb|KHN03079.1| COBRA-like protein 4 [Glycine soja]
Length=475

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 188/245 (77%), Gaps = 9/245 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            +WNVTCTYSQ L S+  +CCVS SSFY+  +  C  CACGC + +   + D+K L+    
Sbjct  231  SWNVTCTYSQFLASKNPSCCVSLSSFYSDKVTGCPPCACGCQNNDTCVTKDSKILQQNVT  290

Query  183  NTPRKDNAAL-----LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            +  +K +  L     LQCT+H+C +RVHWH+K NYKDYWRVKIA+ NFNY++N+T W+LV
Sbjct  291  SPHQKSDITLTPKPLLQCTHHLCHVRVHWHLKDNYKDYWRVKIAIINFNYRLNFTDWSLV  350

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPNLNNVTQV+SF Y PL+PY+S NDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKD
Sbjct  351  VQHPNLNNVTQVYSFEYMPLLPYESTNDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKD  410

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCS---MFLLFF-I  695
            K TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA +   + +  +   +F LFF +
Sbjct  411  KNTFTLKQGWAFPRRVYFNGDECMLPPPDSYPMLPNSAHKLPTTITLMAAYVVFTLFFHL  470

Query  696  VVSIF  710
            VV++F
Sbjct  471  VVTLF  475



>ref|XP_003522282.1| PREDICTED: COBRA-like protein 4-like isoform X1 [Glycine max]
Length=458

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 186/245 (76%), Gaps = 9/245 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            +WNVTCTYSQ L S+  +CCVS SSFY+  +  C  CACGC + +   + D+K L+    
Sbjct  214  SWNVTCTYSQFLASKNPSCCVSLSSFYSDKVTGCPPCACGCQNNDTCVTKDSKILQQNVT  273

Query  183  NTPRKDNAAL-----LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            +  +K +  L     LQCT+H+C +RVHWH+K NYKDYWRVKIA+ NFNY++N+T W+LV
Sbjct  274  SPHQKSDITLTPKPLLQCTHHLCHVRVHWHLKDNYKDYWRVKIAIINFNYRLNFTDWSLV  333

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPNLNNVTQV+SF Y PL+PY+S NDTGMFYG+K+YNDLLMEAGP GNVQSEVL+KKD
Sbjct  334  VQHPNLNNVTQVYSFEYMPLLPYESTNDTGMFYGLKYYNDLLMEAGPKGNVQSEVLMKKD  393

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMF----LLFFI  695
            K TFTL QGWAFPRR+YFNGDEC LPPPD+YP LPNSA +   + +  + +    L F +
Sbjct  394  KNTFTLKQGWAFPRRVYFNGDECMLPPPDSYPMLPNSAHKLPTTITLMAAYVVFTLFFHL  453

Query  696  VVSIF  710
            VV++F
Sbjct  454  VVTLF  458



>ref|XP_009122873.1| PREDICTED: COBRA-like protein 4 [Brassica rapa]
Length=409

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +3

Query  102  CQHCACGCTHKNCVKSSDTKRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDY  281
            C  CACGC +K     +D+K L   G+NTPRKDNA LLQCT+HMCP+RVHWHVK+NYKDY
Sbjct  207  CPSCACGCENKKSCVKADSKILTKKGLNTPRKDNAPLLQCTHHMCPVRVHWHVKVNYKDY  266

Query  282  WRVKIAVTNFNYKMNYTQWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFY  461
            WRVKIA+TNFNY+MN+T WTL  QHPNLNNVTQVFSF+YK + PY SINDTGMFYG KFY
Sbjct  267  WRVKIAITNFNYRMNHTLWTLAVQHPNLNNVTQVFSFDYKSVAPYGSINDTGMFYGTKFY  326

Query  462  NDLLMEAGPSGNVQSEVLLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            NDLLMEAGPSGNVQSEVLL+KD++TFT  QGWAFPR++YFNGDEC LPPPD+YP LPNSA
Sbjct  327  NDLLMEAGPSGNVQSEVLLQKDQKTFTFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA  386

Query  642  IRGYYSSSPCSMFLLFFIVVSIF  710
                 S    S+ +L  + +SI+
Sbjct  387  RGNLASFWILSLTILILMFISIW  409



>ref|XP_011085599.1| PREDICTED: protein COBRA [Sesamum indicum]
Length=453

 Score =   315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 173/220 (79%), Gaps = 5/220 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC    T      + D+  L 
Sbjct  211  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNLTQPGSCVNPDSPYLA  270

Query  171  SAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            S      ++++ A L+QCT+HMCPIRVHWHVK+NYKDYWRVK+ +TNFNY+MNYTQW LV
Sbjct  271  SVVAEQEKRNSYAPLVQCTSHMCPIRVHWHVKVNYKDYWRVKVTITNFNYRMNYTQWNLV  330

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+TQ+FSFNYKPL PY++INDT M +G++FYNDLLM+AGP GNVQSE+L +KD
Sbjct  331  VQHPNFDNLTQLFSFNYKPLNPYENINDTAMLWGVQFYNDLLMQAGPLGNVQSELLFQKD  390

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
            K TFT  +GW FPRRIYFNGD C +PPPDAYP+LPN+++R
Sbjct  391  KSTFTFEKGWGFPRRIYFNGDNCVMPPPDAYPYLPNASLR  430



>ref|XP_003562730.1| PREDICTED: COBRA-like protein 6 [Brachypodium distachyon]
Length=449

 Score =   315 bits (807),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 166/209 (79%), Gaps = 10/209 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKS-SDTKRLKSAG  179
            TWNVTCTYSQ L SRY TCCVSFSSFYN TIVPC  CACGC  K+CV+S  D+KRL  A 
Sbjct  202  TWNVTCTYSQHLASRYPTCCVSFSSFYNDTIVPCARCACGCGVKSCVRSPRDSKRLVPAA  261

Query  180  INTP---------RKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYT  332
             +           R+  A +LQCT HMCP+RVHWHVK+NY DYWR K+ VTNFNY MNYT
Sbjct  262  SSAHALGLRRGGNRESLAPVLQCTTHMCPVRVHWHVKLNYHDYWRAKVTVTNFNYAMNYT  321

Query  333  QWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEV  512
             WTLVAQHPNL+N+TQVFSF+YKP+V Y SINDT MFYGMKF+ND LMEAGP GNVQSEV
Sbjct  322  GWTLVAQHPNLDNITQVFSFDYKPVVSYGSINDTAMFYGMKFFNDQLMEAGPYGNVQSEV  381

Query  513  LLKKDKETFTLNQGWAFPRRIYFNGDECK  599
            L++KD  TFT  QGWAFPR+IYFNGDEC+
Sbjct  382  LMRKDASTFTFRQGWAFPRKIYFNGDECQ  410



>gb|ACF80833.1| unknown [Zea mays]
 tpg|DAA63523.1| TPA: hypothetical protein ZEAMMB73_829352 [Zea mays]
Length=260

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 172/223 (77%), Gaps = 10/223 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN---------CVKSSD  155
            TWNVTCTYSQ L  R  TCCVS SSFYN TIV C  C+CGC + N         CV+ S 
Sbjct  14   TWNVTCTYSQFLAQRSPTCCVSLSSFYNDTIVSCPACSCGCQNNNSSSTAAPGSCVEGSR  73

Query  156  TKRLKSAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYT  332
                 ++ +N P K++ A L+QCT+HMCP+RVHWHVK++YK+YWRVKI VTNFNY+MNY+
Sbjct  74   RSPYLASVVNDPSKNSLAPLVQCTSHMCPVRVHWHVKVSYKEYWRVKITVTNFNYRMNYS  133

Query  333  QWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEV  512
            QW LVAQHPN +N+T +FSFNY+PL PY  INDT M +G+K+YNDLLM AGP GNVQSE+
Sbjct  134  QWNLVAQHPNFDNLTTIFSFNYRPLNPYGVINDTAMLWGIKYYNDLLMTAGPDGNVQSEL  193

Query  513  LLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L +K+  TFT ++GWAFPRR+YFNGD C +PPPDAYP LPN+A
Sbjct  194  LFRKEPSTFTFHKGWAFPRRVYFNGDNCVMPPPDAYPWLPNAA  236



>gb|EAZ04638.1| hypothetical protein OsI_26786 [Oryza sativa Indica Group]
Length=499

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 186/278 (67%), Gaps = 44/278 (16%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC-THKNCVKS----------  149
            TWNVTCTYSQ L S+Y +CCVSFSSFYN TIVPC  CACGC  HK CV +          
Sbjct  222  TWNVTCTYSQHLASKYPSCCVSFSSFYNDTIVPCAKCACGCDAHKPCVGTYARRAAAAAA  281

Query  150  -----------------SDTKRLKSAGINTPRKDNA--------------ALLQCTNHMC  236
                              D KRL   G       NA               LLQCT HMC
Sbjct  282  DDDELTAFSRRDVCRSERDGKRLAVTGKKHDANANAHGRGNGVAAAAMAAPLLQCTTHMC  341

Query  237  PIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPNLNNVTQVFSFNYKPLVPY  416
            P+RVHWHVK+NY++YWR KI + NFNY+MNYT WTLVAQHPNL+N+T+VFSF+YKP+V Y
Sbjct  342  PVRVHWHVKLNYREYWRAKITIVNFNYRMNYTGWTLVAQHPNLDNITEVFSFDYKPVVSY  401

Query  417  QSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFTLNQGWAFPRRIYFNGDEC  596
             SINDT MFYG+K++ND LMEAGP GNVQSEVL++KD  TFT  QGWAFPR++YFNGDEC
Sbjct  402  GSINDTAMFYGLKYFNDQLMEAGPHGNVQSEVLMRKDARTFTFRQGWAFPRKVYFNGDEC  461

Query  597  KLPPPDAYPHLPNSAIRGYYS--SSPCSMFLLFFIVVS  704
            ++PPPD+YP+LPN+A     S   S  +M  L F +++
Sbjct  462  QMPPPDSYPYLPNAAPPAAASLVGSAVAMAALVFFLMA  499



>ref|XP_010522480.1| PREDICTED: protein COBRA [Tarenaya hassleriana]
Length=458

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 174/244 (71%), Gaps = 15/244 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS-----DTKRL  167
            TWNVTCTYSQ L  R  TCCVS SSFYN TIV C  CACGC +KN   S      DT  L
Sbjct  215  TWNVTCTYSQFLAQRTPTCCVSLSSFYNDTIVGCPTCACGCQNKNSTDSGGCVEPDTPHL  274

Query  168  KSAGINTPRKDNAA----LLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQ  335
             S  ++ P   +      LLQCT+HMCPIRVHWHVK NYK+YWRVKI+++NFNY+MNY+Q
Sbjct  275  ASV-VSPPTMKHGTVLPPLLQCTSHMCPIRVHWHVKQNYKEYWRVKISISNFNYRMNYSQ  333

Query  336  WTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL  515
            W LV QHPNL+NVTQ+FSFNYKPL PY  +NDT M +G+KFYND L EAGP GNVQSE+L
Sbjct  334  WNLVVQHPNLDNVTQIFSFNYKPLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEIL  393

Query  516  LKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS-----SSPCSMF  680
             +KDK TFT  +GWAFPRRIYFNGD C +PPPD YP LPN   R   S      S    F
Sbjct  394  FRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDTYPFLPNGVFRRAVSLVGPVISAVLSF  453

Query  681  LLFF  692
            L+FF
Sbjct  454  LVFF  457



>gb|KDP31373.1| hypothetical protein JCGZ_11749 [Jatropha curcas]
Length=457

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 179/242 (74%), Gaps = 10/242 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-------CVKSSDTK  161
            TWNVTCTYSQ L  +  TCCVS SSFYN+TIV C  CACGC +         CV + D+ 
Sbjct  215  TWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNSTTGAGAGTCV-NPDSP  273

Query  162  RLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
             L S  ++  + DN  L+QCT+HMCPIRVHWHVK+NYK+YWRVK+ VTNFNY+MNYTQW 
Sbjct  274  HLASV-VSPTKNDNTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYRMNYTQWN  332

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LV QHPN +N+TQ+FSF+YKPL PY  +NDT M +G++FYND L +AGP GNVQSE+L +
Sbjct  333  LVVQHPNFDNLTQIFSFHYKPLTPYDGLNDTAMLWGVQFYNDFLSQAGPLGNVQSELLFR  392

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS-SPCSMFLLFFIV  698
            KDK TFT  +GWAFPRR+YFNGD C +PPPDAYP LPN   R   S   P   FL++ ++
Sbjct  393  KDKSTFTFEKGWAFPRRVYFNGDNCVMPPPDAYPWLPNDGSRQLVSLFRPIMTFLVYIVI  452

Query  699  VS  704
            +S
Sbjct  453  IS  454



>ref|XP_010546210.1| PREDICTED: protein COBRA-like [Tarenaya hassleriana]
Length=455

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 173/241 (72%), Gaps = 9/241 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS------DTKR  164
            TWNVTCTYSQ L  R  TCCVS SSFYN TIV C  CACGC ++N  +S       D   
Sbjct  215  TWNVTCTYSQFLAQRTPTCCVSLSSFYNDTIVGCPTCACGCQNRNSSESGGGCVEPDMPH  274

Query  165  LKSAGINTPRKDNAAL---LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQ  335
            L+S       K    L   +QC++HMCPIRVHWHVK NYK+YWRVKI++TNFNY+MNYTQ
Sbjct  275  LESVVFPPTTKQGTVLPPLMQCSSHMCPIRVHWHVKQNYKEYWRVKISITNFNYRMNYTQ  334

Query  336  WTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL  515
            W LV QHPNL+N+TQ+FSFNYKPL PY  +NDT M +G+KF+ND L EAGP GNVQSE+L
Sbjct  335  WNLVVQHPNLDNITQIFSFNYKPLSPYAGLNDTAMLWGVKFFNDFLSEAGPLGNVQSEIL  394

Query  516  LKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFI  695
             +KDK  FT  +GWAFPRRIYFNGD C +PPPD+YP LPNS  R   S +  ++ +L F 
Sbjct  395  FRKDKSAFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNSGFRRAVSFAAAALSVLVFF  454

Query  696  V  698
             
Sbjct  455  A  455



>ref|XP_009763134.1| PREDICTED: protein COBRA [Nicotiana sylvestris]
Length=451

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 167/220 (76%), Gaps = 6/220 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCT-----HKNCVKSSDTKRL  167
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC        NCV S  T  L
Sbjct  210  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQTNGTQRGNCVDSK-TPHL  268

Query  168  KSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
             S   +  + +   L+QCTNHMCPIR+HWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV
Sbjct  269  ASVVSDHGKTNYVPLVQCTNHMCPIRIHWHVKVNYKEYWRVKITITNFNYRMNYTQWNLV  328

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+T +FSFNYK L PY +INDT M +G+KFYNDLLM+AGP GNVQSE+L +KD
Sbjct  329  VQHPNFDNLTTLFSFNYKSLTPYGAINDTAMLWGVKFYNDLLMQAGPLGNVQSELLFRKD  388

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
              TFT  +GWAFPRRIYFNGD C +PPPDAYP+LPNS  R
Sbjct  389  ASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNSGSR  428



>ref|XP_008230280.1| PREDICTED: COBRA-like protein 1 [Prunus mume]
Length=456

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 178/246 (72%), Gaps = 11/246 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN T+VPC  C+CGC    TH       D+  L 
Sbjct  215  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTVVPCPACSCGCQSNATHPGSCVEPDSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L++CTNHMCPIRVHWHVK+NYK+YWRVK+ VTNFNY+MNY+ W LV 
Sbjct  275  SVVSASSKNSYTPLVRCTNHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYRMNYSDWNLVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ FS+NYK + PY +INDT M +G+KFYNDLLM+AGP GNVQSE+L +KD+
Sbjct  335  QHPNFDNLTQSFSYNYKSITPYATINDTAMLWGLKFYNDLLMQAGPLGNVQSELLFRKDQ  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
             TFT ++GWAFPRRIYFNGD C +PPPDAYP LPNS  R Y S       LL  I+ S+ 
Sbjct  395  ATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSGFRQYTS-------LLTLIMTSLS  447

Query  711  CS*LLF  728
             + L++
Sbjct  448  TAALMY  453



>gb|KCW48930.1| hypothetical protein EUGRSUZ_K02543, partial [Eucalyptus grandis]
Length=418

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 177/234 (76%), Gaps = 2/234 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTH-KNCVKSSDTKRLKSAG  179
            +W VTCTYSQ++VS+  TCCVSFSSFYN  I PC  CACGC    NC+  S ++     G
Sbjct  180  SWYVTCTYSQMIVSKNPTCCVSFSSFYNPMITPCPSCACGCEGTANCI-GSRSQIQSVVG  238

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
                   +A LLQCTNHMCPIRVHWH K NYK+YWRVKI VT+FNY MNYTQWTL AQHP
Sbjct  239  SQPSIAGDAPLLQCTNHMCPIRVHWHFKANYKEYWRVKITVTSFNYGMNYTQWTLAAQHP  298

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            N NN+T+V+ F+YKPL  + S+NDTGMFYG+K+YNDLLM+AGP GNVQ+E++L+KDK TF
Sbjct  299  NFNNITRVYKFDYKPLNVFGSLNDTGMFYGIKYYNDLLMQAGPEGNVQTEMILRKDKSTF  358

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            TL+QGWAFPR++YF+GDEC +PPPD YP LP+ A      +     FL+  ++V
Sbjct  359  TLDQGWAFPRKVYFDGDECTMPPPDKYPSLPSIAPLNLSMALALPFFLILVLMV  412



>ref|XP_009147371.1| PREDICTED: COBRA-like protein 1 [Brassica rapa]
Length=455

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 178/240 (74%), Gaps = 6/240 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTH----KNCVKSSDTKRLK  170
            TWNVTCTYSQ L  R  TCCVS SSFYN TIVPC  C+CGC +     NCV S    R+ 
Sbjct  215  TWNVTCTYSQFLAQRTPTCCVSLSSFYNSTIVPCPTCSCGCRNTSQPGNCVDSKG-PRIA  273

Query  171  SAGINTPRKDNAA-LLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            S   NT +      L+QCTNHMCP+R+HWHVK+NYK YWRVK+ +TNFNY MNY+QW LV
Sbjct  274  SVVPNTGKSLYVPPLVQCTNHMCPVRIHWHVKVNYKAYWRVKVTITNFNYNMNYSQWNLV  333

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+TQ FSFNYKPL+PY SINDTG+ +G+KFYNDLLMEAGP GNVQSE+L +K+
Sbjct  334  VQHPNFDNLTQTFSFNYKPLIPYASINDTGILWGVKFYNDLLMEAGPYGNVQSELLFQKE  393

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
               FTL +GWAFPRRIYFNGD C +PPPD+YP LPN+A      S   ++ LL  +++ +
Sbjct  394  ASAFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTASNKPIGSLFAAISLLLTVLLHV  453



>ref|XP_011099166.1| PREDICTED: protein COBRA-like [Sesamum indicum]
Length=520

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 177/241 (73%), Gaps = 9/241 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-----NCVKSSDTKRL  167
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC +      +CV  +     
Sbjct  261  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNLTQPGSCVDPNSPYLA  320

Query  168  KSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
                 +      A L+QCT+HMCPIRVHWHVK+NYKDYWRVK+ +TNFNY+MNYT W LV
Sbjct  321  SVVSDHGKSNSLAPLVQCTSHMCPIRVHWHVKLNYKDYWRVKVTITNFNYRMNYTLWNLV  380

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+TQ+FSFNYKPL PYQ+INDT M +G+KFYNDLLM+AGP GNVQSE+L +KD
Sbjct  381  IQHPNFDNLTQIFSFNYKPLTPYQNINDTAMLWGVKFYNDLLMQAGPLGNVQSELLFQKD  440

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
            K TFT  +GWAFPRRIYFNGD C +PPPDAYP+LPN+++R   S     + L+  ++V  
Sbjct  441  KSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNASLRKNVS----MLMLMITLLVDK  496

Query  708  F  710
            F
Sbjct  497  F  497



>ref|XP_007215357.1| hypothetical protein PRUPE_ppa005522mg [Prunus persica]
 gb|EMJ16556.1| hypothetical protein PRUPE_ppa005522mg [Prunus persica]
Length=456

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 177/246 (72%), Gaps = 11/246 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L     TCCVS SSFYN T+VPC  C+CGC    TH       D+  L 
Sbjct  215  TWNVTCTYSQFLAQTTPTCCVSLSSFYNDTVVPCPACSCGCQSNATHPGSCVEPDSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L++CTNHMCPIRVHWHVK+NYK+YWRVK+ VTNFNY+MNY+ W LV 
Sbjct  275  SVVSASSKNSYMPLVRCTNHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYRMNYSDWNLVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ FSFNYK + PY +INDT M +G+KFYNDLLM+AGP GNVQSE+L +KD+
Sbjct  335  QHPNFDNLTQSFSFNYKSITPYATINDTAMLWGLKFYNDLLMQAGPLGNVQSELLFQKDQ  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
             TFT ++GWAFPRRIYFNGD C +PPPDAYP LPNS  R Y S       LL  I+ S+ 
Sbjct  395  ATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSGFRQYTS-------LLTLIMTSLS  447

Query  711  CS*LLF  728
             + L++
Sbjct  448  TAALMY  453



>gb|ACU20777.1| unknown [Glycine max]
Length=229

 Score =   305 bits (782),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 174/226 (77%), Gaps = 5/226 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK----NCVKSSDTKRLK  170
            TWN+TCTYSQ L  +  +CCVS SSFYN T+V C  C CGC +K    +CV   ++  L 
Sbjct  3    TWNITCTYSQFLAQKAPSCCVSLSSFYNDTVVNCPTCTCGCRNKTEPGSCVDP-NSPHLA  61

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +  N  L+QCT+HMCPIRVHWHVK+NYK+YWRVKI +TNFNY+MNY+QW LV 
Sbjct  62   SVVSASGKTANTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYRMNYSQWNLVV  121

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPNL+N+TQ+FSFNYK L PY+ +NDT M +G+KFYND L  AG  GNVQSE+LL+KDK
Sbjct  122  QHPNLDNITQLFSFNYKSLNPYEGLNDTSMLWGVKFYNDFLSSAGSLGNVQSEILLRKDK  181

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSP  668
             TFT ++GWAFPRRIYFNGD C +PPPDAYP LPN++ +  +SS+P
Sbjct  182  STFTFDRGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSKLVFSSAP  227



>emb|CAA07251.1| putative phytochelatin synthetase [Arabidopsis thaliana]
 dbj|BAB10641.1| phytochelatin synthetase [Arabidopsis thaliana]
Length=362

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 166/226 (73%), Gaps = 8/226 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  121  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLDPDTPHLA  180

Query  171  SAGINTPRKDNAAL---LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K    L   +QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NYTQW 
Sbjct  181  SV-VSPPTKKGTVLPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWN  239

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LVAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  240  LVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  299

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS  659
            KD+ TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN   R  +S
Sbjct  300  KDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGSRSQFS  345



>ref|XP_009600080.1| PREDICTED: protein COBRA [Nicotiana tomentosiformis]
Length=451

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 167/220 (76%), Gaps = 6/220 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCT-----HKNCVKSSDTKRL  167
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC        NCV S  T  L
Sbjct  210  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQSNGTQRGNCVDSK-TPHL  268

Query  168  KSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
             S   +  + +   L+QCTNHMCPIR+HWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV
Sbjct  269  ASVVSDHGKTNYVPLVQCTNHMCPIRIHWHVKVNYKEYWRVKITITNFNYRMNYTQWNLV  328

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+T +FSFNYK L PY +INDT M +G+KFYNDLLM+AGP GNVQSE+L +KD
Sbjct  329  VQHPNFDNLTTLFSFNYKSLTPYGAINDTAMLWGVKFYNDLLMQAGPLGNVQSELLFRKD  388

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
              TFT  +GWAFPRRIYFNGD C +PPPDAYP+LPN+  R
Sbjct  389  ASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNAGSR  428



>ref|XP_002531000.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF31388.1| Protein COBRA precursor, putative [Ricinus communis]
Length=456

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 177/246 (72%), Gaps = 7/246 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS----DTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  CACGC   + +       D   L 
Sbjct  212  TWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVPCPTCACGCQSNSSLSGGCVDPDAPHLA  271

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +   A L+QCT HMCP+R+HWHVK+NY++YWRVKI +TNFNY MNY+QW LV 
Sbjct  272  SVVSGSGKNSPAPLVQCTRHMCPVRIHWHVKLNYREYWRVKITITNFNYNMNYSQWNLVV  331

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYK L PY +INDT M +G++FYNDLLM+AGPSGNVQSE+L +KDK
Sbjct  332  QHPNFDNLTQIFSFNYKSLNPYAAINDTAMLWGVQFYNDLLMQAGPSGNVQSELLFQKDK  391

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
             TFT  +GWAFPRRIYFNGD C +PPPDAYP LPN+  R +   SP  +  +  +    F
Sbjct  392  TTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAGSRQF---SPPLVLTITLLSALAF  448

Query  711  CS*LLF  728
             + L+F
Sbjct  449  LNFLVF  454



>ref|XP_010032552.1| PREDICTED: protein COBRA-like [Eucalyptus grandis]
 gb|KCW51945.1| hypothetical protein EUGRSUZ_J01392 [Eucalyptus grandis]
Length=480

 Score =   313 bits (802),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 171/223 (77%), Gaps = 14/223 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-----NCVKSSD---T  158
            TWNVTC YSQ L  +  TCCVS SSFYN T+V C  CACGC +      +CV+ +     
Sbjct  242  TWNVTCAYSQFLAQKTPTCCVSLSSFYNDTVVSCPTCACGCQNNATQPGSCVEPNSPYLA  301

Query  159  KRLKSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQW  338
              + +AG N+P      L+QCT+HMCPIRVHWHVK+NYK+YWRVKI +TNFNY MNY+QW
Sbjct  302  SVVSNAGTNSP------LVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYNMNYSQW  355

Query  339  TLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLL  518
             LV QHPN +N+TQ FSFNYKPL PY +INDT M YG+KFYNDLLME GPSGNVQSE+L 
Sbjct  356  NLVVQHPNFDNLTQSFSFNYKPLTPYAAINDTAMLYGIKFYNDLLMEDGPSGNVQSELLF  415

Query  519  KKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
            +KD  TFT ++GWAFPRRIYFNGD C +PPPDAYP LPN++IR
Sbjct  416  RKDASTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPSLPNASIR  458



>ref|XP_009606717.1| PREDICTED: COBRA-like protein 1 [Nicotiana tomentosiformis]
Length=457

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/248 (59%), Positives = 183/248 (74%), Gaps = 11/248 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIV C  CACGC    T        D+  L 
Sbjct  215  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCACGCKNNITQPGTCVEQDSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            SA +++ + D + L++CT HMCPIRVHWH+K NYK+YWRVK+ + NFNY+MNY+QW LV 
Sbjct  275  SALVSSGKNDYSPLVRCTEHMCPIRVHWHIKTNYKEYWRVKLTIQNFNYRMNYSQWNLVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNY+PLV Y SINDT MF+G+KFYNDLLM+ GP GNVQSE++ +KDK
Sbjct  335  QHPNFDNLTQIFSFNYEPLVSYGSINDTAMFWGIKFYNDLLMQGGPFGNVQSEIIFQKDK  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              F+  +GWAFPRRIYFNGD C +PPPDAYP+LPN++ +    S+P  +  L  I+VS+ 
Sbjct  395  SKFSFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNASAQ----SAPTILHSLTAILVSLI  450

Query  711  CS*LLFSQ  734
               LL+S 
Sbjct  451  ---LLYSH  455



>ref|XP_009776823.1| PREDICTED: protein COBRA-like [Nicotiana sylvestris]
Length=452

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 171/226 (76%), Gaps = 7/226 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCT-----HKNCVKSSDTKRL  167
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC      H NCV   D   L
Sbjct  210  TWNVTCTYSQFLAQKTPTCCVSISSFYNDTIVPCPTCTCGCQKNGTQHGNCV-DQDEPHL  268

Query  168  KSAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTL  344
             S   +  +K+  A L+QCTNHMCPIR+HWHVK+NYK+YWRVK+ +TNFNY MNYTQW L
Sbjct  269  ASVVSDHGKKNTYAPLVQCTNHMCPIRIHWHVKLNYKEYWRVKVTITNFNYNMNYTQWNL  328

Query  345  VAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
            V QHPN +N+TQ+FSFNYK L PY +INDT M +GMKFYNDLLM+AGP GNVQSE+L +K
Sbjct  329  VVQHPNFDNLTQLFSFNYKSLTPYGAINDTAMLWGMKFYNDLLMQAGPLGNVQSELLFRK  388

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS  662
            D  TFT ++GWAFPRR+YFNGD C +PPPD+YP++PN+      SS
Sbjct  389  DLSTFTFDKGWAFPRRVYFNGDNCVMPPPDSYPYMPNAGTLWKVSS  434



>ref|XP_007037616.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 1 [Theobroma cacao]
 gb|EOY22117.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 1 [Theobroma cacao]
Length=475

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 170/236 (72%), Gaps = 4/236 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIV C  CACGC    T      S  +  L 
Sbjct  234  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVSCPTCACGCQNNITEPGSCVSERSPYLA  293

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            SA     +  N+ LLQCT+HMCP+RVHWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV 
Sbjct  294  SAVSGPGKSSNSPLLQCTSHMCPVRVHWHVKLNYKEYWRVKITITNFNYRMNYTQWNLVV  353

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSF+YK L PY  +NDT M +G+KFYNDLL EAGP GNVQSE+L +KD 
Sbjct  354  QHPNFDNLTQLFSFHYKSLTPYAGLNDTAMLWGVKFYNDLLSEAGPLGNVQSELLFQKDA  413

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
             TFT  +GWAFPRRIYFNGD C +PPPDAYP LPNS  R   S     M +L  IV
Sbjct  414  ATFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSGFRPVISLCQLVMTILASIV  469



>ref|XP_009782894.1| PREDICTED: protein COBRA-like [Nicotiana sylvestris]
Length=452

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 171/226 (76%), Gaps = 7/226 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCT-----HKNCVKSSDTKRL  167
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC      H NCV   D   L
Sbjct  210  TWNVTCTYSQFLAQKTPTCCVSISSFYNDTIVPCPTCTCGCQKNGTQHGNCV-DQDEPHL  268

Query  168  KSAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTL  344
             S   +  +K+  A L+QCTNHMCPIR+HWHVK+NYK+YWRVK+ +TNFNY MNYTQW L
Sbjct  269  ASVVSDHGKKNTYAPLVQCTNHMCPIRIHWHVKLNYKEYWRVKVTITNFNYNMNYTQWNL  328

Query  345  VAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
            V QHPN +N+TQ+FSFNYK L PY +INDT M +GMKFYNDLLM+AGP GNVQSE+L +K
Sbjct  329  VVQHPNFDNLTQLFSFNYKSLTPYGAINDTAMLWGMKFYNDLLMQAGPLGNVQSELLFRK  388

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS  662
            D  TFT ++GWAFPRR+YFNGD C +PPPD+YP++PN+      SS
Sbjct  389  DLSTFTFDKGWAFPRRVYFNGDNCVMPPPDSYPYMPNAGTLWKVSS  434



>emb|CDY43250.1| BnaC05g48430D [Brassica napus]
Length=457

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 179/241 (74%), Gaps = 15/241 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTH----KNCVKSSDTKRLK  170
            TWNVTCTYSQ L  R  TCCVS SSFYN TIVPC  C+CGC +     NCV   D+K  +
Sbjct  212  TWNVTCTYSQFLAQRTPTCCVSLSSFYNSTIVPCPTCSCGCRNTSQPGNCV---DSKGPR  268

Query  171  SAGINTPRKDNA----ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQW  338
             A +  P    +     L+QCTNHMCP+R+HWHVK+NYK YWRVK+ +TNFNY MNY+QW
Sbjct  269  IASVVVPNTGKSLYVPPLVQCTNHMCPVRIHWHVKVNYKAYWRVKVTITNFNYNMNYSQW  328

Query  339  TLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLL  518
             LV QHPN +N+TQ FSFNYKPL+PY SINDTG+ +G+KFYNDLLM+AGP GNVQSE+L 
Sbjct  329  NLVVQHPNFDNLTQTFSFNYKPLIPYASINDTGILWGVKFYNDLLMQAGPYGNVQSELLF  388

Query  519  KKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA----IRGYYSSSPCSMFLL  686
            +K+   FTL +GWAFPRRIYFNGD C +PPPD+YP LPN+A    I  ++++   S+ LL
Sbjct  389  QKEASAFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTASHKPISSWFAAILGSISLL  448

Query  687  F  689
             
Sbjct  449  L  449



>ref|XP_007037617.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 2 [Theobroma cacao]
 gb|EOY22118.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 2 [Theobroma cacao]
Length=456

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 170/236 (72%), Gaps = 4/236 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIV C  CACGC    T      S  +  L 
Sbjct  215  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVSCPTCACGCQNNITEPGSCVSERSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            SA     +  N+ LLQCT+HMCP+RVHWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV 
Sbjct  275  SAVSGPGKSSNSPLLQCTSHMCPVRVHWHVKLNYKEYWRVKITITNFNYRMNYTQWNLVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSF+YK L PY  +NDT M +G+KFYNDLL EAGP GNVQSE+L +KD 
Sbjct  335  QHPNFDNLTQLFSFHYKSLTPYAGLNDTAMLWGVKFYNDLLSEAGPLGNVQSELLFQKDA  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIV  698
             TFT  +GWAFPRRIYFNGD C +PPPDAYP LPNS  R   S     M +L  IV
Sbjct  395  ATFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSGFRPVISLCQLVMTILASIV  450



>gb|ABK25014.1| unknown [Picea sitchensis]
Length=458

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 182/249 (73%), Gaps = 12/249 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  +  +CCVS +SFYN TIVPC  C CGC    T       SD+  L 
Sbjct  218  TWNITCTYSQFLAQKTPSCCVSLTSFYNDTIVPCPACTCGCQNNITQPGTCVESDSPVLP  277

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S  +NT  K+ A L+QCT HMCPI++HWHVK+NYK+YWRVK+ +TNFNY+MNYTQW +V 
Sbjct  278  SL-LNTSPKNLAPLIQCTPHMCPIKIHWHVKLNYKEYWRVKVTITNFNYRMNYTQWNIVV  336

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +NVTQ+FSFNYKPL PY  INDT M +G+K+YND+LM+AG  GNVQSE+L +KDK
Sbjct  337  QHPNFDNVTQLFSFNYKPLTPYGKINDTAMLWGVKYYNDMLMQAGEMGNVQSELLFQKDK  396

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
            +TFT  QGW FPRR+YFNGD+C LPPPDAYP LPN       S SP  +  +F ++VS+ 
Sbjct  397  QTFTFKQGWGFPRRVYFNGDDCVLPPPDAYPWLPNG------SPSP-RVGKVFLLIVSLV  449

Query  711  CS*LLFSQL  737
             S  L + L
Sbjct  450  VSACLLAFL  458



>ref|XP_010039079.1| PREDICTED: COBRA-like protein 4 [Eucalyptus grandis]
Length=489

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 177/234 (76%), Gaps = 2/234 (1%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTH-KNCVKSSDTKRLKSAG  179
            +W VTCTYSQ++VS+  TCCVSFSSFYN  I PC  CACGC    NC+  S ++     G
Sbjct  251  SWYVTCTYSQMIVSKNPTCCVSFSSFYNPMITPCPSCACGCEGTANCI-GSRSQIQSVVG  309

Query  180  INTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHP  359
                   +A LLQCTNHMCPIRVHWH K NYK+YWRVKI VT+FNY MNYTQWTL AQHP
Sbjct  310  SQPSIAGDAPLLQCTNHMCPIRVHWHFKANYKEYWRVKITVTSFNYGMNYTQWTLAAQHP  369

Query  360  NLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETF  539
            N NN+T+V+ F+YKPL  + S+NDTGMFYG+K+YNDLLM+AGP GNVQ+E++L+KDK TF
Sbjct  370  NFNNITRVYKFDYKPLNVFGSLNDTGMFYGIKYYNDLLMQAGPEGNVQTEMILRKDKSTF  429

Query  540  TLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            TL+QGWAFPR++YF+GDEC +PPPD YP LP+ A      +     FL+  ++V
Sbjct  430  TLDQGWAFPRKVYFDGDECTMPPPDKYPSLPSIAPLNLSMALALPFFLILVLMV  483



>ref|XP_009395002.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis]
Length=457

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 179/238 (75%), Gaps = 6/238 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIV C  C CGC    T        D+  L 
Sbjct  218  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNATQPGSCVEGDSPYLA  277

Query  171  SAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            SA +N P K++   L+QCT+HMCP+RVHWHVK+NYK+YWRVKIA+TNFNY+MNYTQW LV
Sbjct  278  SA-VNGPGKNSFTPLVQCTSHMCPVRVHWHVKLNYKEYWRVKIAITNFNYRMNYTQWNLV  336

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPNL+N+TQ+FSFNYK L PY  INDT M +G+K+YNDLLMEAGP GNVQSE+L KKD
Sbjct  337  IQHPNLDNLTQLFSFNYKSLTPYGGINDTAMLWGVKYYNDLLMEAGPYGNVQSELLFKKD  396

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
              TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN+A +   +S+   +  L ++++
Sbjct  397  PSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAASQLMSTSTMTLLTALSWLLI  454



>ref|XP_008353506.1| PREDICTED: COBRA-like protein 1 isoform X1 [Malus domestica]
Length=457

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 174/237 (73%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ+L  +  TCCVS SSFYN TIVPC +C+CGC    TH       D+  L 
Sbjct  216  TWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPNCSCGCQRNATHPGSCVEPDSPYLA  275

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L++CT HMCPIRVHWHVK+NYK YWRVK+ VTNFNY+MNY+ W +V 
Sbjct  276  SVVSASNKNSYTPLVRCTAHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYSDWNMVV  335

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FS+NYK + PY +INDTGM +G+KFYND+LM+AGP GNVQSE+L +KD+
Sbjct  336  QHPNFDNLTQIFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSELLFQKDE  395

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
             TFT ++GWAFPRR+YFNGD C +PPPDAYP LPNS  R Y S     M  L  I V
Sbjct  396  ATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSGFRQYVSLLTLIMTCLSTIAV  452



>ref|XP_008341800.1| PREDICTED: COBRA-like protein 1 isoform X2 [Malus domestica]
Length=456

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 174/237 (73%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ+L  +  TCCVS SSFYN TIVPC +C+CGC    TH       D+  L 
Sbjct  215  TWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPNCSCGCQRNATHPGSCVEPDSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L++CT HMCPIRVHWHVK+NYK YWRVK+ VTNFNY+MNY+ W +V 
Sbjct  275  SVVSASNKNSYTPLVRCTAHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYSDWNMVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FS+NYK + PY +INDTGM +G+KFYND+LM+AGP GNVQSE+L +KD+
Sbjct  335  QHPNFDNLTQIFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSELLFQKDE  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
             TFT ++GWAFPRR+YFNGD C +PPPDAYP LPNS  R Y S     M  L  I V
Sbjct  395  ATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSGFRQYVSLLTLIMTCLSTIAV  451



>ref|XP_008341799.1| PREDICTED: COBRA-like protein 1 isoform X1 [Malus domestica]
Length=457

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 174/237 (73%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ+L  +  TCCVS SSFYN TIVPC +C+CGC    TH       D+  L 
Sbjct  216  TWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPNCSCGCQRNATHPGSCVEPDSPYLA  275

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L++CT HMCPIRVHWHVK+NYK YWRVK+ VTNFNY+MNY+ W +V 
Sbjct  276  SVVSASNKNSYTPLVRCTAHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYSDWNMVV  335

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FS+NYK + PY +INDTGM +G+KFYND+LM+AGP GNVQSE+L +KD+
Sbjct  336  QHPNFDNLTQIFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSELLFQKDE  395

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
             TFT ++GWAFPRR+YFNGD C +PPPDAYP LPNS  R Y S     M  L  I V
Sbjct  396  ATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSGFRQYVSLLTLIMTCLSTIAV  452



>ref|XP_008353507.1| PREDICTED: COBRA-like protein 1 isoform X2 [Malus domestica]
Length=456

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 174/237 (73%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ+L  +  TCCVS SSFYN TIVPC +C+CGC    TH       D+  L 
Sbjct  215  TWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPNCSCGCQRNATHPGSCVEPDSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L++CT HMCPIRVHWHVK+NYK YWRVK+ VTNFNY+MNY+ W +V 
Sbjct  275  SVVSASNKNSYTPLVRCTAHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYSDWNMVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FS+NYK + PY +INDTGM +G+KFYND+LM+AGP GNVQSE+L +KD+
Sbjct  335  QHPNFDNLTQIFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSELLFQKDE  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
             TFT ++GWAFPRR+YFNGD C +PPPDAYP LPNS  R Y S     M  L  I V
Sbjct  395  ATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSGFRQYVSLLTLIMTCLSTIAV  451



>ref|XP_010257980.1| PREDICTED: protein COBRA-like isoform X1 [Nelumbo nucifera]
Length=455

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 174/238 (73%), Gaps = 8/238 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC    T        ++  L 
Sbjct  215  TWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGSCVEGNSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            SA ++  +     L+QCTNHMCPIRVHWHVK+NYK+YWRVK+ +TNFNY+MNYTQW LV 
Sbjct  275  SA-LSAGKNSYVPLVQCTNHMCPIRVHWHVKLNYKEYWRVKVTITNFNYRMNYTQWNLVV  333

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYK L PY  +NDT M +G+KFYNDLLMEAGP GNVQSE+L +KDK
Sbjct  334  QHPNFDNLTQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDLLMEAGPLGNVQSELLFRKDK  393

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS-SSPCSMFL--LFFI  695
             TFT  +GWAFPRRIYFNGD C +PPPDAYP LPN++ R   S   P   FL  L F+
Sbjct  394  STFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASPRPMVSFLGPVVAFLASLLFL  451



>emb|CDY60470.1| BnaAnng16830D [Brassica napus]
Length=458

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 170/221 (77%), Gaps = 11/221 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTH----KNCVKSSDTKRLK  170
            TWNVTCTYSQ L  R  TCCVS SSFYN TIVPC  C+CGC +     NCV   D+K  +
Sbjct  213  TWNVTCTYSQFLAQRTPTCCVSLSSFYNSTIVPCPTCSCGCRNTSQPGNCV---DSKGPR  269

Query  171  SAGINTPRKDNA----ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQW  338
             A +  P    +     L+QCTNHMCP+R+HWHVK+NYK YWRVK+ +TNFNY MNY+QW
Sbjct  270  IASVVVPNTGKSLYVPPLVQCTNHMCPVRIHWHVKVNYKAYWRVKVTITNFNYNMNYSQW  329

Query  339  TLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLL  518
             LV QHPN +N+TQ FSFNYKPL+PY SINDTG+ +G+KFYNDLLM+AGP GNVQSE+L 
Sbjct  330  NLVVQHPNFDNLTQTFSFNYKPLIPYASINDTGILWGVKFYNDLLMQAGPYGNVQSELLF  389

Query  519  KKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            +K+   FTL +GWAFPRRIYFNGD C +PPPD+YP LPN+A
Sbjct  390  QKEASAFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTA  430



>ref|XP_006856414.1| hypothetical protein AMTR_s00047p00216760 [Amborella trichopoda]
 gb|ERN17881.1| hypothetical protein AMTR_s00047p00216760 [Amborella trichopoda]
Length=404

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 175/238 (74%), Gaps = 6/238 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS S+FYN+TIVPC  C CGC    T        D+  L+
Sbjct  163  TWNVTCTYSQFLSQKTPTCCVSLSAFYNETIVPCPTCTCGCQNNITQPGSCVEGDSPYLQ  222

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
             A  NT + + A L+QCTNHMCP+R+HWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV 
Sbjct  223  QAITNTGKNNYAPLVQCTNHMCPVRIHWHVKLNYKEYWRVKITITNFNYRMNYTQWNLVV  282

Query  351  QHPNLNNVTQVFSFNYKPLVPYQ-SINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
            QHPN +N+TQ+FSFNYK L PY  +INDT M +G+KFYNDLLMEAGP GNVQSE+L KKD
Sbjct  283  QHPNFDNLTQIFSFNYKSLTPYGPAINDTAMLWGVKFYNDLLMEAGPFGNVQSELLFKKD  342

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
              +FT  QGW  PRR+YFNGD C +PPPD+YP LPNS+     +  P +MF L  I +
Sbjct  343  -ASFTFKQGWGLPRRVYFNGDNCVMPPPDSYPWLPNSSPHLKMTKLPLAMFCLTTIAL  399



>ref|NP_568930.1| glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis 
thaliana]
 sp|Q94KT8.1|COBRA_ARATH RecName: Full=Protein COBRA; AltName: Full=Cell expansion protein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56072.1|AF319663_1 putative glycosylphosphatidylinositol-anchored protein [Arabidopsis 
thaliana]
 gb|AAM19781.1| AT5g60920/MSL3_40 [Arabidopsis thaliana]
 gb|AAN64510.1| At5g60920/MSL3_40 [Arabidopsis thaliana]
 gb|AED97397.1| glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis 
thaliana]
Length=456

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 166/226 (73%), Gaps = 8/226 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  215  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLDPDTPHLA  274

Query  171  SAGINTPRKDNAAL---LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K    L   +QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NYTQW 
Sbjct  275  SV-VSPPTKKGTVLPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWN  333

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LVAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  334  LVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  393

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS  659
            KD+ TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN   R  +S
Sbjct  394  KDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGSRSQFS  439



>gb|AAM62930.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=456

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 166/226 (73%), Gaps = 8/226 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  215  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLDPDTPHLA  274

Query  171  SAGINTPRKDNAAL---LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K    L   +QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NYTQW 
Sbjct  275  SV-VSPPTKKGTVLPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWN  333

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LVAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  334  LVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  393

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS  659
            KD+ TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN   R  +S
Sbjct  394  KDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGSRSQFS  439



>ref|XP_009616573.1| PREDICTED: protein COBRA-like [Nicotiana tomentosiformis]
Length=452

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 168/217 (77%), Gaps = 7/217 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCT-----HKNCVKSSDTKRL  167
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC      H NCV   D   L
Sbjct  210  TWNVTCTYSQFLAQKTPTCCVSISSFYNDTIVPCPTCTCGCQKNGTQHGNCV-DQDEPHL  268

Query  168  KSAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTL  344
             S   +  +K+  A L+QCTNHMCPIR+HWHVK+NYK+YWRVK+ +TNFNY MNYTQW L
Sbjct  269  ASVVSDHGKKNTYAPLVQCTNHMCPIRIHWHVKLNYKEYWRVKVTITNFNYNMNYTQWNL  328

Query  345  VAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
            V QHPN +N+TQ+FSFNYK L PY +INDT M +GMKFYNDLLM+AGP GNVQSE+L +K
Sbjct  329  VVQHPNFDNLTQLFSFNYKSLTPYGAINDTAMLWGMKFYNDLLMQAGPLGNVQSELLFRK  388

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPN  635
            D  TFT ++GWAFPRR+YFNGD C +PPPD+YP++PN
Sbjct  389  DLSTFTFDKGWAFPRRVYFNGDNCVMPPPDSYPYMPN  425



>ref|XP_002866404.1| hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42663.1| hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 172/241 (71%), Gaps = 11/241 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  215  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNKTESGACLDPDTPHLA  274

Query  171  SAGINTPRKDNAAL---LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K    L   +QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NYTQW 
Sbjct  275  SV-VSPPTKKGTVLPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWN  333

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LVAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  334  LVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  393

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR---GYYSSSPCSMFLLFF  692
            KD+ TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN   R    ++++    + + FF
Sbjct  394  KDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGFRLQFSFFAAVLLPVLIFFF  453

Query  693  I  695
             
Sbjct  454  F  454



>emb|CDY58691.1| BnaC07g49800D [Brassica napus]
Length=458

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 173/245 (71%), Gaps = 8/245 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  215  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNKTGSGACLDPDTPHLA  274

Query  171  SAGINTPRKDNA---ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  I+ P K       L+QCT H+CPIRVHWHVK NYK+YWRVKI +TNFNY++NY+QW 
Sbjct  275  SV-ISPPTKKGTILPPLVQCTRHLCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYSQWN  333

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            +VAQHPNL+N+TQ+FSFNYK L PY  +NDT M +GMKFYND L EAGP GNVQSE+L +
Sbjct  334  MVAQHPNLDNITQIFSFNYKSLSPYAGLNDTAMLWGMKFYNDFLSEAGPLGNVQSEILFR  393

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            KD+ TFT  +GWAFPRRIYFNGD C +PPPDAYP LPN   R  +S    ++ L   +V 
Sbjct  394  KDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPFLPNGGFRTEFSVFFSAVLLPVLLVF  453

Query  702  SIFCS  716
              F +
Sbjct  454  FFFSA  458



>ref|XP_010483748.1| PREDICTED: protein COBRA-like [Camelina sativa]
Length=409

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 171/240 (71%), Gaps = 10/240 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  168  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLDPDTPHLA  227

Query  171  SAGINTPRKDNA---ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K       L+QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NYTQW 
Sbjct  228  SV-VSPPTKKGVILPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWN  286

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LVAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  287  LVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  346

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMF--LLFFI  695
            KD  TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN   R  YS     +   L+FF+
Sbjct  347  KDLSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGFRPKYSFFAAVLLPVLVFFL  406



>ref|XP_009373790.1| PREDICTED: COBRA-like protein 1 isoform X1 [Pyrus x bretschneideri]
Length=457

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 172/237 (73%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ+L  +  TCCVS SSFYN TIVPC  C+CGC    TH       D+  L 
Sbjct  216  TWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPKCSCGCQRNATHPGSCVEPDSPYLA  275

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L++CT HMCPIRVHWHVK+NYK YWRVK+ VTNFNY+MNY+ W +V 
Sbjct  276  SVVSASNKNSYTPLVRCTKHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYSDWNMVV  335

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ FS+NYK + PY +INDTGM +G+KFYND+LM+AGP GNVQSE+L +KD+
Sbjct  336  QHPNFDNLTQSFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSELLFRKDE  395

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
             TFT ++GWAFPRR+YFNGD C +PPPDAYP LPNS  R Y S     M  L  I V
Sbjct  396  ATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSGFRQYVSLLTLIMTCLSTIAV  452



>ref|XP_006394554.1| hypothetical protein EUTSA_v10004178mg [Eutrema salsugineum]
 gb|ESQ31840.1| hypothetical protein EUTSA_v10004178mg [Eutrema salsugineum]
Length=458

 Score =   310 bits (795),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 171/242 (71%), Gaps = 13/242 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  215  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNKTESGACLDPDTPHLA  274

Query  171  SAGINTPRKDNA---ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K       L+QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NY+QW 
Sbjct  275  SV-VSPPTKKGTILPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYSQWN  333

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            +VAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  334  MVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  393

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSS-----SPCSMFLL  686
            KD+ TFT  +GWAFPRRIYFNGD C +PPPD YP LPN   R  +S       P  +FL 
Sbjct  394  KDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDTYPFLPNGGFRPVFSVFAAVFLPVLVFLF  453

Query  687  FF  692
            FF
Sbjct  454  FF  455



>ref|XP_010443903.1| PREDICTED: protein COBRA-like [Camelina sativa]
Length=456

 Score =   310 bits (795),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 171/240 (71%), Gaps = 10/240 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  215  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLDPDTPHLA  274

Query  171  SAGINTPRKDNA---ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K       L+QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NYTQW 
Sbjct  275  SV-VSPPTKKGVILPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWN  333

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LVAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  334  LVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  393

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMF--LLFFI  695
            KD  TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN   R  YS     +   L+FF+
Sbjct  394  KDLSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGFRPKYSFFAAVLLPVLVFFL  453



>ref|XP_010260542.1| PREDICTED: protein COBRA-like isoform X2 [Nelumbo nucifera]
Length=408

 Score =   309 bits (791),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 169/223 (76%), Gaps = 4/223 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC    T        D+  L 
Sbjct  169  TWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGSCVEGDSPYLA  228

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            SA  ++ +     L+QCTNHMCPIRVHWHVK+NYK+YWRVKI +TNFNY+MNYT+W LV 
Sbjct  229  SALSSSSKNSYTPLVQCTNHMCPIRVHWHVKLNYKEYWRVKITITNFNYRMNYTEWNLVV  288

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYK L PY +INDT M +G+KFYNDLLM+AGP GNVQSE+L +KDK
Sbjct  289  QHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLMQAGPLGNVQSELLFRKDK  348

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS  659
             TFT  +GWAFPRRIYFNGD C +PPPDAYP LPN++ R   S
Sbjct  349  STFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSRSVAS  391



>ref|XP_009373791.1| PREDICTED: COBRA-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=456

 Score =   310 bits (795),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 172/237 (73%), Gaps = 4/237 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ+L  +  TCCVS SSFYN TIVPC  C+CGC    TH       D+  L 
Sbjct  215  TWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPKCSCGCQRNATHPGSCVEPDSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L++CT HMCPIRVHWHVK+NYK YWRVK+ VTNFNY+MNY+ W +V 
Sbjct  275  SVVSASNKNSYTPLVRCTKHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYSDWNMVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ FS+NYK + PY +INDTGM +G+KFYND+LM+AGP GNVQSE+L +KD+
Sbjct  335  QHPNFDNLTQSFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSELLFRKDE  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
             TFT ++GWAFPRR+YFNGD C +PPPDAYP LPNS  R Y S     M  L  I V
Sbjct  395  ATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSGFRQYVSLLTLIMTCLSTIAV  451



>ref|XP_006338345.1| PREDICTED: protein COBRA-like [Solanum tuberosum]
Length=459

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 165/219 (75%), Gaps = 4/219 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC    T +      +T  L 
Sbjct  218  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQSNGTQRGSCVDPETPHLA  277

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S   +  + +   L+QCT HMCPIR+HWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV 
Sbjct  278  SVVSDHGKNNYVPLVQCTKHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMNYTQWNLVV  337

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+T +FSFNYK L PY SINDT M +G+KFYNDLLM+AGPSGNVQSE+L +KD 
Sbjct  338  QHPNFDNLTTLFSFNYKSLTPYGSINDTAMLWGVKFYNDLLMQAGPSGNVQSELLFRKDA  397

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
             TFT  +GWAFP RIYFNGD C +PPPDAYP+LPN+  R
Sbjct  398  STFTFEKGWAFPHRIYFNGDNCVMPPPDAYPYLPNAGSR  436



>gb|EYU34590.1| hypothetical protein MIMGU_mgv1a006245mg [Erythranthe guttata]
Length=451

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 181/243 (74%), Gaps = 9/243 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  +  +CCVS SSFYN TIVPC  C CGC    T+     + D+  L 
Sbjct  212  TWNITCTYSQFLAQKTPSCCVSLSSFYNDTIVPCPTCTCGCQNNLTNPGSCVNPDSPYLA  271

Query  171  SAGINTPRKDNAA-LLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            S      + +N A L+QCT+HMCP+RVHWHVK+NYKDYWRVK+ +TNFNY+MNY+QW LV
Sbjct  272  SVVSERGKSNNMAPLVQCTSHMCPVRVHWHVKLNYKDYWRVKVTITNFNYRMNYSQWNLV  331

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+TQ+FSFNYKPL PYQ+INDT M +G+KFYND L +AGP GNVQSE+L +KD
Sbjct  332  VQHPNFDNLTQLFSFNYKPLNPYQNINDTAMLWGVKFYNDFLNQAGPLGNVQSELLFRKD  391

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
            K TFT ++GW FPRRIYFNGD C +PPP+AYP+LPNS++R   S     + LL  ++ + 
Sbjct  392  KSTFTFDKGWGFPRRIYFNGDNCVMPPPEAYPYLPNSSLRKTVS----FLVLLIGLLTTF  447

Query  708  FCS  716
             C+
Sbjct  448  ACA  450



>ref|XP_004232141.1| PREDICTED: protein COBRA [Solanum lycopersicum]
Length=447

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 164/219 (75%), Gaps = 4/219 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC    T +      +T  L 
Sbjct  206  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQSNGTQRGSCVDPETPHLA  265

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S   +  + +   L+QCT HMCPIR+HWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV 
Sbjct  266  SVVSDHGKNNYVPLVQCTKHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMNYTQWNLVV  325

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+T +FSFNYK L PY SINDT M +G+KFYNDLLM+AGPSGNVQSE+L +KD 
Sbjct  326  QHPNFDNLTTLFSFNYKSLTPYGSINDTAMLWGVKFYNDLLMQAGPSGNVQSELLFRKDA  385

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
             TFT  +GWAFP RIYFNGD C +PPPDAYP LPN+  R
Sbjct  386  STFTFEKGWAFPHRIYFNGDNCVMPPPDAYPFLPNAGSR  424



>emb|CDY02184.1| BnaA03g39830D [Brassica napus]
Length=457

 Score =   310 bits (793),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 166/226 (73%), Gaps = 8/226 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  215  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNKTESGACLDPDTPHLA  274

Query  171  SAGINTPRKDNA---ALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K       L+QCT H+CPIRVHWHVK NYK+YWRVKI +TNFNY++NY+QW 
Sbjct  275  SV-VSPPTKKGTILPPLVQCTRHLCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYSQWN  333

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            +VAQHPNL+N+TQ+FSFNYK L PY  +NDT M +GMKFYND L EAGP GNVQSE+L +
Sbjct  334  MVAQHPNLDNITQIFSFNYKSLSPYAGLNDTAMLWGMKFYNDFLSEAGPLGNVQSEILFR  393

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS  659
            KD+ TFT  +GWAFPRRIYFNGD C +PPPDAYP LPN   R  +S
Sbjct  394  KDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPFLPNGGFRTEFS  439



>ref|XP_009151763.1| PREDICTED: COBRA-like protein 2 [Brassica rapa]
 emb|CDX86358.1| BnaA06g30750D [Brassica napus]
Length=436

 Score =   309 bits (791),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 172/236 (73%), Gaps = 5/236 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWN+TCTYSQ L  +  TCCVS S+FYN+TIVPC  C+CGC +  CV   D K       
Sbjct  205  TWNMTCTYSQFLAQKTPTCCVSLSAFYNKTIVPCPTCSCGCQNGTCV---DPKIASVVPA  261

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
             + + +   LLQCT HMCPIRVHWHVK NYK+YWRVK+ +TNFNY MNY+QW LV QHPN
Sbjct  262  LSGKNNLQPLLQCTQHMCPIRVHWHVKTNYKEYWRVKVTITNFNYNMNYSQWNLVVQHPN  321

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
             +N+TQ+FSFNYKPL PY  INDT M +G+KFYND L +AGP GNVQSE+L +KD  TFT
Sbjct  322  FDNITQLFSFNYKPLSPYSGINDTAMLWGIKFYNDFLSQAGPIGNVQSELLFQKDPSTFT  381

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
              +GWAFPRRIYFNGD C +PPPD+YP LPN+A     ++SP  + L+ F  V I 
Sbjct  382  FEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAASN--LATSPFIILLITFFSVLIL  435



>ref|XP_010456834.1| PREDICTED: protein COBRA [Camelina sativa]
Length=456

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 175/250 (70%), Gaps = 16/250 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  215  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLDPDTPHLA  274

Query  171  SAGINTPRKDNAAL---LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K    L   +QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NYTQW 
Sbjct  275  SV-VSPPTKKGVILPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWN  333

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LVAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  334  LVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  393

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            KD  TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN   R  +     S+F+   + V
Sbjct  394  KDLSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGFRPKF-----SVFVAVLLPV  448

Query  702  SIFCS*LLFS  731
             +F    LFS
Sbjct  449  LVF---FLFS  455



>ref|XP_002305390.1| phytochelatin synthetase family protein [Populus trichocarpa]
 gb|EEE85901.1| phytochelatin synthetase family protein [Populus trichocarpa]
Length=453

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 175/241 (73%), Gaps = 8/241 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-----CVKSSDTKRL  167
            TWNVTCTYSQ L  +  +CCVS SSFYN TIVPC  C CGC   N     CV   +   L
Sbjct  212  TWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVPCPKCTCGCQRNNSDSGGCVDP-NAPHL  270

Query  168  KSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
             S   +    +   L+QCT+HMCPIRVHWHVK+NYK YWRVK+ +TNFNY MNYTQW LV
Sbjct  271  ASVVSSLGNNNPMPLVQCTSHMCPIRVHWHVKLNYKQYWRVKVTITNFNYNMNYTQWNLV  330

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+TQ FSFNY+ L PY +INDT M +G+KFYNDLLM+AG SGNVQSE+L +KD
Sbjct  331  VQHPNFDNLTQSFSFNYQSLSPYSAINDTAMLWGVKFYNDLLMQAGRSGNVQSELLFRKD  390

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
            K TFT ++GWAFPRRIYFNGD C +PPPDAYP LPN++ R    +SP  + + FF V++ 
Sbjct  391  KSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSRQL--TSPLMLMIAFFSVLAF  448

Query  708  F  710
             
Sbjct  449  L  449



>ref|XP_010260537.1| PREDICTED: protein COBRA-like isoform X1 [Nelumbo nucifera]
Length=456

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 169/223 (76%), Gaps = 4/223 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC    T        D+  L 
Sbjct  217  TWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGSCVEGDSPYLA  276

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            SA  ++ +     L+QCTNHMCPIRVHWHVK+NYK+YWRVKI +TNFNY+MNYT+W LV 
Sbjct  277  SALSSSSKNSYTPLVQCTNHMCPIRVHWHVKLNYKEYWRVKITITNFNYRMNYTEWNLVV  336

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYK L PY +INDT M +G+KFYNDLLM+AGP GNVQSE+L +KDK
Sbjct  337  QHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLMQAGPLGNVQSELLFRKDK  396

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS  659
             TFT  +GWAFPRRIYFNGD C +PPPDAYP LPN++ R   S
Sbjct  397  STFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSRSVAS  439



>ref|XP_002264600.1| PREDICTED: protein COBRA [Vitis vinifera]
 emb|CBI15330.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 165/219 (75%), Gaps = 4/219 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIV C  C CGC    TH       +   L 
Sbjct  215  TWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVSCPTCTCGCQNNLTHPGSCVDPNNPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L+QCT+HMCPIRVHWHVK+NYKDYWRVKI +TNFNY+MNYTQW LV 
Sbjct  275  SVVEGSGKTSYQPLVQCTSHMCPIRVHWHVKLNYKDYWRVKITITNFNYRMNYTQWNLVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYK L PY +INDT M +G+KFYNDLL +AGP GNVQSE+L +KDK
Sbjct  335  QHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLSQAGPLGNVQSELLFRKDK  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
             TFT ++GWAFPRRIYFNGD C +PPPDAYP LPN++ R
Sbjct  395  ATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSR  433



>ref|XP_006655271.1| PREDICTED: COBRA-like protein 3-like [Oryza brachyantha]
Length=452

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 181/239 (76%), Gaps = 10/239 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS----DTKRLK  170
            TWNVTCTYSQ L  +  +CCVS SSFYN TIV C  C+CGC +      S    ++  L+
Sbjct  210  TWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNNKTAPGSCVNENSPYLQ  269

Query  171  SAGINTPRK-DNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            SA I+ P K     L+QCT+HMCPIR+HWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV
Sbjct  270  SA-IDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMNYTQWNLV  328

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQS-INDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
             QHPN +N+TQ+FSFNYKPL PY S INDT MF+G+KFYNDLLM+AGP GN QSE+LL+K
Sbjct  329  VQHPNFDNITQLFSFNYKPLTPYGSRINDTAMFWGVKFYNDLLMQAGPLGNAQSEILLRK  388

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            D   FT ++GWAFPRR+YFNGD C +PPPDAYP LPN++     +  P ++ LL F++V
Sbjct  389  DSMAFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASP---LTKQPLTISLLSFLIV  444



>ref|XP_006280281.1| hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
 gb|EOA13179.1| hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
Length=537

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 166/226 (73%), Gaps = 8/226 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWN+TCTYSQ L  R  TCCVS SSFYN+TIV C  CACGC    T        DT  L 
Sbjct  296  TWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLDPDTPHLA  355

Query  171  SAGINTPRKDNAAL---LQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWT  341
            S  ++ P K    L   +QCT HMCPIRVHWHVK NYK+YWRVKI +TNFNY++NYTQW 
Sbjct  356  SV-VSPPTKKGVILPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWN  414

Query  342  LVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLK  521
            LVAQHPNL+N+TQ+FSFNYK L PY  +NDT M +G+KFYND L EAGP GNVQSE+L +
Sbjct  415  LVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFR  474

Query  522  KDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYS  659
            KD  TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN A R  +S
Sbjct  475  KDLSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGAFRPKFS  520



>ref|XP_008240087.1| PREDICTED: protein COBRA-like isoform X1 [Prunus mume]
Length=456

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 181/252 (72%), Gaps = 15/252 (6%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHK-----NCVKSSDTKRL  167
            TWNVTCTYSQ L  +  TCCVS SSFYN+TIV C  CACGC +      +CV+ ++   L
Sbjct  215  TWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNNATDPGSCVEPNN-PYL  273

Query  168  KSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
             SA     +  NA L+QCT+HMCP+RVHWHVK+NYK+YWRVK+ +TNFNY+MNYT W LV
Sbjct  274  ASAVSGPGKSTNAPLVQCTSHMCPVRVHWHVKLNYKEYWRVKVTITNFNYRMNYTLWNLV  333

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+T++FSFNYK L PY  +NDT M +G+KFYNDLL +AGP GNVQSE+L +KD
Sbjct  334  VQHPNFDNLTKIFSFNYKSLTPYAGLNDTAMLWGVKFYNDLLTQAGPLGNVQSELLFRKD  393

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
              TFT  +GWAFPRRIYFNGD C +PPPDAYP LPN        SSP  +  +    V+I
Sbjct  394  ASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPN--------SSPKQVISILHPAVTI  445

Query  708  FCS*LLFSQLYA  743
            F S LLF   YA
Sbjct  446  FVS-LLFLLAYA  456



>ref|XP_004491893.1| PREDICTED: protein COBRA-like [Cicer arietinum]
Length=446

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 176/242 (73%), Gaps = 11/242 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS----DTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN+TIVPC  CACGC   +    S    +T  L 
Sbjct  206  TWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVPCPTCACGCQSNSSQSGSCIDRNTPHLA  265

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + + +   L+QCT+HMCPIR+HWHVK+NYK+YWRVK+ +TNFNY+MNY+ W LV 
Sbjct  266  SVVAGSGKNNFQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKVTITNFNYRMNYSDWNLVV  325

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYK L PY SINDT M +G+KFYND L  AGPSGNVQSE+L +KDK
Sbjct  326  QHPNFDNLTQLFSFNYKSLNPYGSINDTAMLWGVKFYNDFLNYAGPSGNVQSELLFRKDK  385

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFF--IVVS  704
             TFT ++GWAFPRRIYFNGD C +PPPDAYP LPN+  R        SMF L    +VV 
Sbjct  386  STFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNTGSR-----QEVSMFALVMASLVVL  440

Query  705  IF  710
            +F
Sbjct  441  VF  442



>ref|XP_009415817.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis]
Length=458

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 168/220 (76%), Gaps = 6/220 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIV C  C CGC    T        D+  L 
Sbjct  220  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNATQPGSCVEGDSPYLA  279

Query  171  SAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            S  IN P K++   L+QCT+HMCP+RVHWHVK+NYK+YWRVKIA+TNFNY+MNYTQW LV
Sbjct  280  SV-INGPGKNSFTPLVQCTSHMCPVRVHWHVKLNYKEYWRVKIAITNFNYRMNYTQWNLV  338

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPNL+N+TQ+FSFNYK L PY  INDT M +G+K+YND LMEAGP GNVQSE+L +KD
Sbjct  339  IQHPNLDNLTQLFSFNYKSLTPYGGINDTAMLWGVKYYNDFLMEAGPYGNVQSELLFRKD  398

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIR  647
              TFT  +GWAFPRR+YFNGD C +PPPD+YP LPN+A R
Sbjct  399  PSTFTFEKGWAFPRRVYFNGDNCVMPPPDSYPWLPNAATR  438



>emb|CAN68249.1| hypothetical protein VITISV_020126 [Vitis vinifera]
Length=469

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 178/255 (70%), Gaps = 12/255 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGC----THKNCVKSSDTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  C CGC    T        D+  L 
Sbjct  215  TWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGSCVEEDSPYLA  274

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + +     L+QCT HMCPIRVHWHVK++YK+YWRVK+ +TNFNY+MNYTQW LV 
Sbjct  275  SVVSGSGKNSYTPLVQCTKHMCPIRVHWHVKLSYKEYWRVKVTITNFNYRMNYTQWNLVV  334

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYK L PY +INDT M +G+KFYNDLL++AGP GNVQSE+L +KDK
Sbjct  335  QHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLVQAGPLGNVQSELLFRKDK  394

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
             TFT  +GWAFPRRIYFNGD C +PPPD+YP LPN+  R     +  S+  L  +++S  
Sbjct  395  STFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNATSR-----TSTSLLTLIMVLLSAL  449

Query  711  CS*LLFSQLYA*FFA  755
               LL++  Y  F  
Sbjct  450  ---LLYAHGYDNFIG  461



>gb|AFK45756.1| unknown [Lotus japonicus]
Length=448

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/253 (59%), Positives = 180/253 (71%), Gaps = 23/253 (9%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-----CVKSSDTKRL  167
            TWNVTCTYSQ L  +  TCCVS SSFYN TIVPC  CACGC   +     C+++ DT  L
Sbjct  209  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCACGCQSNSSRSGSCIEA-DTPHL  267

Query  168  KS----AGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQ  335
             S    +G NTP      L+QCT HMCP+R+HW VK+NYK+YWRVK+ +TNFNYKMNY++
Sbjct  268  ASVVAGSGKNTP------LVQCTRHMCPVRIHWRVKLNYKEYWRVKVTITNFNYKMNYSE  321

Query  336  WTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVL  515
            W LVAQHPN +N+TQ+FSFNYK L PY SINDT + +G+KFYND L EAGPSGNVQSE+L
Sbjct  322  WNLVAQHPNFDNLTQLFSFNYKSLTPYGSINDTALLWGVKFYNDFLNEAGPSGNVQSELL  381

Query  516  LKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFI  695
             +KDK TFT  +GWAFPRRIYFNGD C +P PDAYP LPN+  R   S       L   +
Sbjct  382  FRKDKSTFTFERGWAFPRRIYFNGDNCVMPSPDAYPWLPNAGSRQEVS-------LFALV  434

Query  696  VVSIFCS*LLFSQ  734
            + S+    L F+Q
Sbjct  435  MASLVAVVLCFAQ  447



>ref|NP_001105970.1| brittle stalk-2-like protein 6 precursor [Zea mays]
 gb|ABL59986.1| brittle stalk-2-like protein 6 [Zea mays]
 gb|ACF88416.1| unknown [Zea mays]
 gb|ACL53060.1| unknown [Zea mays]
 gb|ACN33712.1| unknown [Zea mays]
 tpg|DAA63522.1| TPA: brittle stalk-2-like protein 6 [Zea mays]
Length=460

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 172/223 (77%), Gaps = 10/223 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN---------CVKSSD  155
            TWNVTCTYSQ L  R  TCCVS SSFYN TIV C  C+CGC + N         CV+ S 
Sbjct  214  TWNVTCTYSQFLAQRSPTCCVSLSSFYNDTIVSCPACSCGCQNNNSSSTAAPGSCVEGSR  273

Query  156  TKRLKSAGINTPRKDN-AALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYT  332
                 ++ +N P K++ A L+QCT+HMCP+RVHWHVK++YK+YWRVKI VTNFNY+MNY+
Sbjct  274  RSPYLASVVNDPSKNSLAPLVQCTSHMCPVRVHWHVKVSYKEYWRVKITVTNFNYRMNYS  333

Query  333  QWTLVAQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEV  512
            QW LVAQHPN +N+T +FSFNY+PL PY  INDT M +G+K+YNDLLM AGP GNVQSE+
Sbjct  334  QWNLVAQHPNFDNLTTIFSFNYRPLNPYGVINDTAMLWGIKYYNDLLMTAGPDGNVQSEL  393

Query  513  LLKKDKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSA  641
            L +K+  TFT ++GWAFPRR+YFNGD C +PPPDAYP LPN+A
Sbjct  394  LFRKEPSTFTFHKGWAFPRRVYFNGDNCVMPPPDAYPWLPNAA  436



>ref|XP_003559376.1| PREDICTED: COBRA-like protein 3 [Brachypodium distachyon]
Length=456

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 180/239 (75%), Gaps = 10/239 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS----DTKRLK  170
            TWNVTCTYSQ L  +  +CCVS SSFYN TIV C  C+CGC + N    S    ++  L+
Sbjct  214  TWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNNNTRPGSCVNENSPYLQ  273

Query  171  SAGINTPRK-DNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            SA I+ P K     L+QCT+HMCPIR+HWHVK+NYKDYWRVK+ +TNFNY+MNYTQW LV
Sbjct  274  SA-IDGPGKYTGQPLVQCTSHMCPIRIHWHVKLNYKDYWRVKVTITNFNYRMNYTQWNLV  332

Query  348  AQHPNLNNVTQVFSFNYKPLVPY-QSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
             QHPN +N+T++FSFNYKPL PY   INDT MF+GMKFYNDLLM+AGP GN QSE+LLKK
Sbjct  333  VQHPNFDNITKLFSFNYKPLTPYGGGINDTAMFWGMKFYNDLLMQAGPLGNAQSEILLKK  392

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            D  TFT ++GWAFPRR+YFNGD C +P PDAYP LPN++     +  P ++ LL F ++
Sbjct  393  DSATFTFDKGWAFPRRVYFNGDNCVMPSPDAYPWLPNASP---LTKQPLTLPLLVFSIL  448



>gb|AFZ78568.1| COBRA-like protein [Populus tomentosa]
Length=453

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 175/241 (73%), Gaps = 8/241 (3%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKN-----CVKSSDTKRL  167
            TWNVTCTYSQ L  +  +CCVS SSFYN TIVPC  C+CGC   N     CV   +   L
Sbjct  212  TWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVPCPKCSCGCQRNNSDLGGCVDP-NAPHL  270

Query  168  KSAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
             S   +    +   L+QCT+HMCPIRVHWHVK+NYK YWRVK+ +TNFNY MNYTQW LV
Sbjct  271  ASVVSSLGNNNPMPLVQCTSHMCPIRVHWHVKLNYKQYWRVKVTITNFNYNMNYTQWNLV  330

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKD  527
             QHPN +N+TQ+F FNY+ L PY +INDT M +G+KFYNDLLM+AGPSGNVQSE+L +KD
Sbjct  331  VQHPNFDNLTQIFGFNYQSLSPYSAINDTAMLWGVKFYNDLLMQAGPSGNVQSELLFQKD  390

Query  528  KETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSI  707
              TFT ++GWAFPRRIYFNGD C +PPPDAYP LPN++ R    +SP  + + FF  ++ 
Sbjct  391  MSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSRQL--TSPHILMIAFFSALAF  448

Query  708  F  710
             
Sbjct  449  L  449



>emb|CDX85277.1| BnaC07g25880D [Brassica napus]
Length=436

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 172/233 (74%), Gaps = 4/233 (2%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSSDTKRLKSAGI  182
            TWN+TCTYSQ L  +  TCCVS S+FYN+TIVPC  C+CGC +  CV   D K       
Sbjct  205  TWNMTCTYSQFLAQKTPTCCVSLSAFYNKTIVPCPTCSCGCQNGTCV---DPKIASVVPA  261

Query  183  NTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVAQHPN  362
             + + +   LLQCT HMCPIRVHWHVK NYK+YWRVK+ +TNFNY MNY+QW LV QHPN
Sbjct  262  LSGKNNLQQLLQCTQHMCPIRVHWHVKTNYKEYWRVKVTITNFNYNMNYSQWNLVVQHPN  321

Query  363  LNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDKETFT  542
             +N+TQ+FSFNYKPL PY  INDT M +G+KFYND L +AGP GNVQSE+L +KD  TFT
Sbjct  322  FDNITQLFSFNYKPLSPYSGINDTAMLWGIKFYNDFLSQAGPIGNVQSELLFQKDPSTFT  381

Query  543  LNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
              +GWAFPRRIYFNGD C +PPPD+YP LPN+A   + +S+   + + FF V+
Sbjct  382  FEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAA-SNFATSTFIVLLITFFSVL  433



>ref|XP_007139433.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris]
 gb|ESW11427.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris]
Length=390

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 179/247 (72%), Gaps = 12/247 (5%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS----DTKRLK  170
            TWNVTC YSQ L  +  +CCVS SSFYN TIVPC  CACGC   + +  S     T  L 
Sbjct  150  TWNVTCQYSQFLAQKTPSCCVSLSSFYNDTIVPCPTCACGCQGNSSLSGSCVNSQTPHLA  209

Query  171  SAGINTPRKDNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLVA  350
            S    + + + + L+QCT+HMCP+R+HWHVK+NYK+YWRVK+ +TNFNY+MNY++W +V 
Sbjct  210  SVVSGSGKNNLSPLVQCTSHMCPVRIHWHVKVNYKEYWRVKVTITNFNYRMNYSEWNMVV  269

Query  351  QHPNLNNVTQVFSFNYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKKDK  530
            QHPN +N+TQ+FSFNYK L PY SINDT M +G+KFYND L +AGP+GNVQSE+L +KDK
Sbjct  270  QHPNFDNLTQLFSFNYKSLTPYGSINDTAMLWGVKFYNDFLSQAGPNGNVQSELLFRKDK  329

Query  531  ETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVVSIF  710
             TFT ++GWAFPRRIYFNGD C +PPPDAYP LPN+  R   S        LF +V++  
Sbjct  330  ATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAGSRQEVS--------LFALVIAYL  381

Query  711  CS*LLFS  731
             + + ++
Sbjct  382  VALVFYA  388



>ref|XP_006650604.1| PREDICTED: COBRA-like protein 3-like [Oryza brachyantha]
Length=453

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 180/239 (75%), Gaps = 10/239 (4%)
 Frame = +3

Query  3    TWNVTCTYSQLLVSRYSTCCVSFSSFYNQTIVPCQHCACGCTHKNCVKSS----DTKRLK  170
            TWNVTCTYSQ L  +  TCCVS SSFYN TIV C  C+CGC +      S    ++  L+
Sbjct  211  TWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCSCGCQNNRTSPGSCVNENSPYLQ  270

Query  171  SAGINTPRK-DNAALLQCTNHMCPIRVHWHVKINYKDYWRVKIAVTNFNYKMNYTQWTLV  347
            SA I+ P K     L+QCT+HMCPIR+HWHVK+NYK+YWRVKI +TNFNY+MNYTQW LV
Sbjct  271  SA-IDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMNYTQWNLV  329

Query  348  AQHPNLNNVTQVFSFNYKPLVPYQS-INDTGMFYGMKFYNDLLMEAGPSGNVQSEVLLKK  524
             QHPN +N+TQ+FSFNYKPL PY S INDT MF+G+KFYNDLLM+AGP GN QSE+LL+K
Sbjct  330  VQHPNFDNITQLFSFNYKPLTPYGSRINDTAMFWGVKFYNDLLMQAGPLGNAQSELLLRK  389

Query  525  DKETFTLNQGWAFPRRIYFNGDECKLPPPDAYPHLPNSAIRGYYSSSPCSMFLLFFIVV  701
            D   FT ++GWAFPRR+YFNGD C +PPPDAYP LPN++     +  P ++ LL F +V
Sbjct  390  DSVAFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASP---LTKQPLTLSLLAFWIV  445



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1863241968852