BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6414_g2_i1 len=793 path=[643:0-792]

Length=793
                                                                      Score     E

ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            399   3e-136   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            399   4e-136   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       399   5e-136   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       398   1e-135   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         397   3e-135   
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg             393   1e-133   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                390   1e-132   
gb|KHG09190.1|  Peroxidase 4                                            389   4e-132   
ref|XP_007017044.1|  Peroxidase 68                                      397   1e-131   
ref|XP_002319968.2|  peroxidase family protein                          387   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_008244108.1|  PREDICTED: peroxidase 4                            386   3e-131   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       386   4e-131   
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            385   1e-130   Vitis vinifera
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       385   1e-130   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       384   3e-130   
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       383   1e-129   
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       381   6e-129   
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       380   7e-129   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       379   3e-128   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       377   1e-127   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       376   4e-127   
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                       375   9e-127   
ref|XP_010087166.1|  Peroxidase 4                                       374   2e-126   
gb|AAR31106.1|  peroxidase precursor                                    374   3e-126   Quercus suber [cork oak]
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       374   3e-126   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         372   1e-125   
gb|AAR31108.1|  peroxidase precursor                                    372   2e-125   Quercus suber [cork oak]
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        372   2e-125   
dbj|BAA82306.1|  peroxidase                                             372   2e-125   Nicotiana tabacum [American tobacco]
gb|AAP76387.1|  class III peroxidase                                    372   3e-125   Gossypium hirsutum [American cotton]
gb|ACM47317.1|  peroxidase                                              370   6e-125   Capsicum annuum
ref|XP_007011229.1|  Peroxidase superfamily protein                     370   9e-125   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            370   1e-124   Vitis vinifera
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      369   2e-124   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    370   3e-124   
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       369   3e-124   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             368   4e-124   
emb|CDP04065.1|  unnamed protein product                                368   4e-124   
gb|KHG18057.1|  Peroxidase 52 -like protein                             368   5e-124   
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             368   5e-124   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       367   7e-124   
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      367   1e-123   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                       366   3e-123   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  365   4e-123   Ricinus communis
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      365   4e-123   
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       365   8e-123   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             365   9e-123   
gb|KHN46282.1|  Peroxidase 4                                            365   1e-122   
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                       365   1e-122   
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                364   1e-122   
gb|ACU24215.1|  unknown                                                 364   2e-122   Glycine max [soybeans]
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           364   2e-122   
ref|XP_011080818.1|  PREDICTED: uncharacterized protein LOC105163979    375   5e-122   
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             363   5e-122   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      362   7e-122   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            362   1e-121   
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           362   1e-121   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             362   2e-121   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      361   2e-121   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             361   2e-121   
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       361   3e-121   
ref|NP_196153.1|  peroxidase 52                                         361   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      361   3e-121   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      360   4e-121   
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       360   4e-121   
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       360   5e-121   
ref|XP_007219210.1|  hypothetical protein PRUPE_ppa017309mg             359   6e-121   
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       360   7e-121   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      360   8e-121   
gb|ACU17608.1|  unknown                                                 360   8e-121   Glycine max [soybeans]
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      360   9e-121   
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      359   2e-120   
gb|ABV24960.2|  putative secretory peroxidase                           359   2e-120   Catharanthus roseus [chatas]
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           359   2e-120   
emb|CAD67479.1|  peroxidase                                             358   2e-120   Asparagus officinalis
gb|AAL93151.1|AF485265_1  class III peroxidase                          358   2e-120   Gossypium hirsutum [American cotton]
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       359   3e-120   
gb|AIE12239.1|  peroxide                                                358   3e-120   
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      358   3e-120   
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    358   4e-120   
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                       359   4e-120   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      358   5e-120   
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                       358   5e-120   
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      357   6e-120   
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       357   8e-120   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       357   1e-119   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       357   1e-119   
gb|AFV07575.1|  putative peroxidase a2                                  354   2e-119   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           357   2e-119   
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       357   2e-119   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              357   2e-119   
gb|ACU23245.1|  unknown                                                 357   2e-119   Glycine max [soybeans]
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           356   3e-119   
gb|AFK41406.1|  unknown                                                 356   3e-119   
ref|XP_009402215.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    356   3e-119   
gb|KFK27367.1|  hypothetical protein AALP_AA8G373800                    355   5e-119   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       355   6e-119   
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     355   7e-119   
emb|CDP13933.1|  unnamed protein product                                355   8e-119   
ref|XP_008465298.1|  PREDICTED: peroxidase 4-like                       355   9e-119   
ref|XP_010931330.1|  PREDICTED: peroxidase 4-like                       354   1e-118   
gb|KHN44724.1|  Peroxidase 4                                            354   1e-118   
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    354   1e-118   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       354   2e-118   
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                       354   3e-118   
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             352   7e-118   
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      352   8e-118   
ref|XP_006401086.1|  hypothetical protein EUTSA_v10014097mg             352   1e-117   
emb|CAD67478.1|  peroxidase                                             350   2e-117   Asparagus officinalis
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010          352   2e-117   Sorghum bicolor [broomcorn]
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       350   5e-117   
emb|CDY32701.1|  BnaA02g07630D                                          350   8e-117   
ref|XP_004150606.1|  PREDICTED: peroxidase 4-like                       350   1e-116   
ref|XP_009126754.1|  PREDICTED: peroxidase 67                           350   1e-116   
emb|CDY02820.1|  BnaC02g10690D                                          350   1e-116   
gb|ACU23223.1|  unknown                                                 350   1e-116   Glycine max [soybeans]
ref|XP_008465299.1|  PREDICTED: peroxidase 4-like                       349   1e-116   
ref|XP_003615995.1|  Peroxidase                                         349   1e-116   
gb|EMS66985.1|  Peroxidase 4                                            349   1e-116   
gb|KHN48395.1|  Peroxidase 4                                            349   1e-116   
gb|ADN96693.1|  peroxidase 6                                            349   2e-116   
gb|AAP42508.1|  anionic peroxidase swpb3                                348   2e-116   Ipomoea batatas [batate]
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000          349   2e-116   Sorghum bicolor [broomcorn]
ref|XP_007146856.1|  hypothetical protein PHAVU_006G075900g             348   3e-116   
ref|XP_003551174.1|  PREDICTED: peroxidase 4-like                       348   3e-116   
ref|XP_003616748.1|  Peroxidase                                         348   4e-116   
dbj|BAJ97638.1|  predicted protein                                      348   4e-116   
emb|CDX98835.1|  BnaC09g50000D                                          348   5e-116   
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                    347   2e-115   
emb|CDY04948.1|  BnaAnng01300D                                          346   2e-115   
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           346   2e-115   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      346   2e-115   
ref|XP_003602462.1|  Peroxidase                                         346   3e-115   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                       346   3e-115   
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor     346   3e-115   Zea mays [maize]
emb|CDY14118.1|  BnaC02g02350D                                          345   7e-115   
gb|KHG17773.1|  Peroxidase 52 -like protein                             345   7e-115   
ref|XP_008463814.1|  PREDICTED: peroxidase 4-like                       345   9e-115   
gb|EPS67864.1|  hypothetical protein M569_06908                         344   1e-114   
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    344   1e-114   
ref|XP_002441703.1|  hypothetical protein SORBIDRAFT_08g000990          344   2e-114   Sorghum bicolor [broomcorn]
gb|ACN33662.1|  unknown                                                 343   2e-114   Zea mays [maize]
ref|XP_004150607.1|  PREDICTED: peroxidase 4-like                       344   2e-114   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      343   2e-114   
gb|AAX44001.2|  putative secretory peroxidase                           343   2e-114   Catharanthus roseus [chatas]
ref|XP_002489046.1|  hypothetical protein SORBIDRAFT_0246s002010        343   2e-114   Sorghum bicolor [broomcorn]
gb|AFK49101.1|  unknown                                                 343   2e-114   
ref|XP_004502855.1|  PREDICTED: peroxidase 52-like                      343   2e-114   
gb|KDO41520.1|  hypothetical protein CISIN_1g020615mg                   342   3e-114   
gb|KGN47223.1|  hypothetical protein Csa_6G216420                       343   3e-114   
emb|CDX70158.1|  BnaA10g25070D                                          343   3e-114   
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      343   4e-114   
gb|ACT35473.1|  peroxidase 52                                           342   4e-114   Brassica rapa
ref|XP_010685964.1|  PREDICTED: peroxidase 4-like                       342   5e-114   
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              342   5e-114   
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g             342   6e-114   Populus trichocarpa [western balsam poplar]
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    341   7e-114   Brassica rapa subsp. rapa
gb|AFK45898.1|  unknown                                                 342   8e-114   
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor                342   1e-113   
ref|NP_200648.1|  peroxidase                                            341   2e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02817.1|  BnaC02g10720D                                          340   3e-113   
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      340   4e-113   
ref|NP_001151940.1|  peroxidase 52 precursor                            340   8e-113   Zea mays [maize]
gb|AAB48184.1|  peroxidase precursor                                    339   1e-112   Linum usitatissimum
gb|EAY79693.1|  hypothetical protein OsI_34840                          339   1e-112   Oryza sativa Indica Group [Indian rice]
emb|CAD67477.1|  peroxidase                                             338   2e-112   Asparagus officinalis
ref|XP_003602461.1|  Peroxidase                                         338   3e-112   
gb|KHG25850.1|  Peroxidase 4                                            338   3e-112   
ref|XP_010256954.1|  PREDICTED: cationic peroxidase 1-like              338   3e-112   
ref|XP_003602463.1|  Peroxidase                                         338   4e-112   
ref|NP_001065971.1|  Os12g0112000                                       338   5e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004490701.1|  PREDICTED: peroxidase 4-like                       337   7e-112   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          337   8e-112   
ref|XP_007033589.1|  Peroxidase superfamily protein                     336   2e-111   
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                       335   3e-111   
ref|XP_009132056.1|  PREDICTED: peroxidase 68-like                      335   4e-111   
gb|ABO77632.1|  peroxidase                                              335   5e-111   Medicago truncatula
emb|CDX88673.1|  BnaA03g09760D                                          337   5e-111   
ref|XP_006662662.1|  PREDICTED: peroxidase 4-like                       334   1e-110   
gb|EPS59568.1|  hypothetical protein M569_15235                         333   1e-110   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          333   2e-110   
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        333   2e-110   Vitis vinifera
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              333   5e-110   
ref|NP_001169614.1|  uncharacterized protein LOC100383495 precursor     333   6e-110   Zea mays [maize]
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              332   6e-110   
ref|XP_010067586.1|  PREDICTED: peroxidase 4-like                       332   7e-110   
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              332   9e-110   
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              331   2e-109   
emb|CBI19220.3|  unnamed protein product                                332   2e-109   
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              331   3e-109   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          330   3e-109   
gb|AFR44628.1|  class III secretory peroxidase                          330   4e-109   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              329   7e-109   
ref|XP_010453676.1|  PREDICTED: peroxidase 67-like                      329   7e-109   
gb|ABR23054.1|  basic peroxidase swpb4                                  329   8e-109   Ipomoea batatas [batate]
ref|XP_006279655.1|  hypothetical protein CARUB_v10026803mg             329   8e-109   
ref|XP_010443567.1|  PREDICTED: peroxidase 67                           329   9e-109   
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              328   1e-108   
gb|ACJ11762.1|  class III peroxidase                                    328   1e-108   Gossypium hirsutum [American cotton]
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              328   3e-108   
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              327   4e-108   
emb|CAL25300.1|  properoxidase                                          327   4e-108   Picea abies
ref|XP_010483436.1|  PREDICTED: peroxidase 67-like                      327   5e-108   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              327   7e-108   
dbj|BAM28608.1|  putative peroxidase                                    327   7e-108   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   326   9e-108   
ref|XP_010067587.1|  PREDICTED: peroxidase 4-like                       327   9e-108   
dbj|BAM28609.1|  putative peroxidase                                    326   1e-107   
gb|ABK21858.1|  unknown                                                 326   2e-107   Picea sitchensis
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              325   3e-107   
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        325   3e-107   
ref|XP_007142064.1|  hypothetical protein PHAVU_008G249500g             325   3e-107   
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like              325   3e-107   
gb|AFK46186.1|  unknown                                                 325   5e-107   
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like              325   5e-107   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              324   6e-107   
gb|KHN29529.1|  Cationic peroxidase 1                                   324   7e-107   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              326   7e-107   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like              325   8e-107   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              324   1e-106   
ref|NP_001065566.1|  Os11g0112200                                       323   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              323   1e-106   
gb|ACU21377.1|  unknown                                                 321   1e-106   Glycine max [soybeans]
ref|XP_003577141.1|  PREDICTED: peroxidase 4-like                       324   1e-106   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              323   2e-106   
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    323   2e-106   Arachis hypogaea [goober]
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like              323   2e-106   
gb|ABR18139.1|  unknown                                                 323   2e-106   Picea sitchensis
ref|XP_004492537.1|  PREDICTED: cationic peroxidase 1-like              323   2e-106   
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              323   2e-106   
emb|CAH10840.1|  peroxidase                                             323   3e-106   Picea abies
dbj|BAM28607.1|  putative peroxidase                                    322   3e-106   
emb|CAA62597.1|  korean-radish isoperoxidase                            322   3e-106   Raphanus sativus
ref|XP_010683552.1|  PREDICTED: cationic peroxidase 1-like              322   5e-106   
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              322   6e-106   
gb|EPS58134.1|  anionic peroxidase swpb3                                322   6e-106   
ref|XP_003519284.1|  PREDICTED: peroxidase 4                            322   6e-106   
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              322   8e-106   
gb|KHN08835.1|  Peroxidase 4                                            322   9e-106   
ref|XP_003544922.1|  PREDICTED: peroxidase 4                            322   1e-105   
gb|AAB02554.1|  cationic peroxidase                                     321   1e-105   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              322   1e-105   
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              321   1e-105   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              321   1e-105   
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          321   1e-105   Sorghum bicolor [broomcorn]
ref|NP_200647.1|  peroxidase                                            321   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              320   2e-105   
gb|ACZ51443.1|  peroxidase protein                                      320   2e-105   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              320   3e-105   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      320   3e-105   
gb|AHL39176.1|  class III peroxidase                                    320   4e-105   
gb|AAM61588.1|  peroxidase                                              320   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792262.1|  PREDICTED: peroxidase 4-like                       328   4e-105   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             320   5e-105   
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                319   6e-105   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        319   7e-105   Vitis vinifera
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like              319   7e-105   Vitis vinifera
dbj|BAK06463.1|  predicted protein                                      319   7e-105   
gb|ABK25962.1|  unknown                                                 319   8e-105   Picea sitchensis
ref|XP_010683553.1|  PREDICTED: cationic peroxidase 1-like              319   8e-105   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              319   8e-105   
ref|XP_003577842.1|  PREDICTED: peroxidase 4                            319   9e-105   
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    319   1e-104   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              319   1e-104   
gb|KHN40655.1|  Cationic peroxidase 1                                   319   1e-104   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  317   1e-104   
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                      318   2e-104   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              317   4e-104   
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor     317   5e-104   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              317   5e-104   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like              318   5e-104   
gb|KHN48387.1|  Peroxidase 52                                           315   6e-104   
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              317   7e-104   
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              317   7e-104   
emb|CDP16309.1|  unnamed protein product                                316   1e-103   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              316   1e-103   
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like              316   1e-103   
emb|CAH10839.1|  peroxidase                                             315   2e-103   Picea abies
ref|XP_010067589.1|  PREDICTED: peroxidase P7-like isoform X1           316   2e-103   
gb|ACN42168.1|  peroxidase 1                                            315   2e-103   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              315   2e-103   
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                315   3e-103   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              314   4e-103   
ref|XP_010695716.1|  PREDICTED: peroxidase 4-like                       315   5e-103   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              314   5e-103   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      314   5e-103   
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                314   5e-103   
ref|NP_001054096.1|  Os04g0651000                                       314   6e-103   
ref|XP_009419858.1|  PREDICTED: cationic peroxidase 1-like              314   8e-103   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              313   9e-103   
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like              314   1e-102   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      313   1e-102   
ref|XP_002319407.1|  peroxidase family protein                          313   1e-102   
gb|AFW76354.1|  hypothetical protein ZEAMMB73_514205                    314   1e-102   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      313   1e-102   
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   313   1e-102   
ref|XP_003623567.1|  Peroxidase                                         313   1e-102   
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         313   2e-102   
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      313   2e-102   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                      317   2e-102   
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              313   3e-102   
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                313   3e-102   
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                       312   3e-102   
gb|ABK23423.1|  unknown                                                 312   4e-102   
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010          311   7e-102   
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      311   7e-102   
gb|AII99880.1|  peroxidase                                              311   7e-102   
gb|AFK43134.1|  unknown                                                 311   9e-102   
ref|XP_009371986.1|  PREDICTED: cationic peroxidase 1-like isofor...    311   1e-101   
gb|KDP25488.1|  hypothetical protein JCGZ_20644                         311   1e-101   
ref|XP_010067590.1|  PREDICTED: peroxidase P7-like isoform X2           311   1e-101   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             311   1e-101   
ref|XP_010067588.1|  PREDICTED: peroxidase 4-like                       311   1e-101   
ref|XP_010032327.1|  PREDICTED: peroxidase P7-like                      311   1e-101   
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             310   2e-101   
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                      310   2e-101   
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      310   2e-101   
ref|XP_010093550.1|  Cationic peroxidase 1                              310   2e-101   
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like              310   2e-101   
ref|XP_009419701.1|  PREDICTED: cationic peroxidase 1-like              310   3e-101   
emb|CDX80957.1|  BnaC03g02110D                                          310   3e-101   
emb|CAA59487.1|  peroxidase                                             310   4e-101   
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              310   4e-101   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              310   4e-101   
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...    309   5e-101   
ref|XP_009408893.1|  PREDICTED: peroxidase P7-like                      309   6e-101   
dbj|BAA77389.1|  peroxidase 3                                           309   8e-101   
ref|XP_009363835.1|  PREDICTED: peroxidase 4-like                       308   9e-101   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              308   9e-101   
ref|XP_003623564.1|  Peroxidase                                         308   1e-100   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                       309   1e-100   
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      308   1e-100   
ref|XP_009371985.1|  PREDICTED: cationic peroxidase 1-like isofor...    308   1e-100   
ref|XP_002461207.1|  hypothetical protein SORBIDRAFT_02g042840          308   2e-100   
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           307   2e-100   
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like              308   2e-100   
ref|XP_009369253.1|  PREDICTED: peroxidase 4-like                       307   3e-100   
emb|CDP08160.1|  unnamed protein product                                307   4e-100   
dbj|BAJ91992.1|  predicted protein                                      307   5e-100   
ref|XP_004965566.1|  PREDICTED: peroxidase 52-like                      308   5e-100   
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             306   5e-100   
ref|XP_006652927.1|  PREDICTED: peroxidase 2-like                       306   6e-100   
ref|NP_001057822.1|  Os06g0547400                                       306   8e-100   
ref|XP_006657042.1|  PREDICTED: peroxidase P7-like                      306   1e-99    
dbj|BAA77388.1|  peroxidase 2                                           306   1e-99    
ref|XP_002438530.1|  hypothetical protein SORBIDRAFT_10g021630          306   1e-99    
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       306   1e-99    
ref|NP_001046400.2|  Os02g0240100                                       306   1e-99    
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   305   2e-99    
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       305   2e-99    
ref|XP_003571919.1|  PREDICTED: peroxidase 70-like                      305   2e-99    
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1                305   3e-99    
ref|NP_001106040.1|  peroxidase 70 precursor                            305   3e-99    
gb|AAC05277.1|  peroxidase FLXPER4                                      304   3e-99    
dbj|BAK07852.1|  predicted protein                                      305   3e-99    
gb|KDP25492.1|  hypothetical protein JCGZ_20648                         305   3e-99    
ref|XP_010227239.1|  PREDICTED: peroxidase P7-like                      305   3e-99    
gb|EAY85148.1|  hypothetical protein OsI_06503                          305   4e-99    
emb|CAH10842.1|  peroxidase                                             305   4e-99    
ref|XP_010270787.1|  PREDICTED: lignin-forming anionic peroxidase...    304   4e-99    
ref|XP_002509738.1|  Lignin-forming anionic peroxidase precursor,...    305   4e-99    
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              304   4e-99    
ref|XP_010246463.1|  PREDICTED: peroxidase P7-like                      304   6e-99    
gb|AFK36869.1|  unknown                                                 301   6e-99    
gb|ACJ85500.1|  unknown                                                 301   6e-99    
ref|XP_004951344.1|  PREDICTED: peroxidase 70-like                      304   7e-99    
gb|EMT02760.1|  Peroxidase 4                                            302   7e-99    
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                303   7e-99    
emb|CAH10841.1|  peroxidase                                             303   1e-98    
gb|EMT13502.1|  Peroxidase 70                                           303   1e-98    
ref|XP_010689717.1|  PREDICTED: peroxidase P7-like                      303   1e-98    
ref|NP_001060627.1|  Os07g0677100                                       303   2e-98    
gb|EEC78144.1|  hypothetical protein OsI_17703                          303   2e-98    
emb|CAJ86184.1|  H0212B02.16                                            303   2e-98    
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       303   2e-98    
ref|XP_004951342.1|  PREDICTED: peroxidase 70-like                      303   2e-98    
ref|XP_007011212.1|  Peroxidase superfamily protein                     302   2e-98    
ref|XP_011070600.1|  PREDICTED: lignin-forming anionic peroxidase...    302   2e-98    
ref|XP_010270786.1|  PREDICTED: lignin-forming anionic peroxidase...    302   2e-98    
gb|EMT19352.1|  Peroxidase 70                                           301   3e-98    
emb|CBI19219.3|  unnamed protein product                                306   3e-98    
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                      302   3e-98    
dbj|BAJ96564.1|  predicted protein                                      302   4e-98    
ref|XP_008369411.1|  PREDICTED: peroxidase P7-like                      302   4e-98    
ref|XP_006658122.1|  PREDICTED: peroxidase 70-like                      301   4e-98    
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           301   5e-98    
gb|EPS58869.1|  peroxidase                                              301   5e-98    
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like              301   6e-98    
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                       301   6e-98    
ref|XP_006658123.1|  PREDICTED: peroxidase 2-like                       301   7e-98    
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      301   7e-98    
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       301   7e-98    
ref|XP_010066274.1|  PREDICTED: cationic peroxidase 1-like              301   8e-98    
ref|XP_002453592.1|  hypothetical protein SORBIDRAFT_04g008630          301   8e-98    
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g             301   9e-98    
ref|XP_011070596.1|  PREDICTED: lignin-forming anionic peroxidase...    301   1e-97    
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        301   1e-97    
gb|KGN45822.1|  hypothetical protein Csa_6G013940                       299   1e-97    
ref|XP_003601028.1|  Peroxidase                                         301   1e-97    
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             301   1e-97    
ref|XP_004303193.1|  PREDICTED: peroxidase 52-like                      301   1e-97    
ref|XP_002437129.1|  hypothetical protein SORBIDRAFT_10g021620          300   1e-97    
gb|KDP25489.1|  hypothetical protein JCGZ_20645                         300   1e-97    
ref|XP_004978383.1|  PREDICTED: peroxidase 4-like                       300   1e-97    
ref|XP_004965567.1|  PREDICTED: peroxidase 4-like                       301   1e-97    
ref|NP_001130666.1|  uncharacterized protein LOC100191769 precursor     301   1e-97    
ref|XP_009381204.1|  PREDICTED: peroxidase P7-like                      300   1e-97    
gb|AAC49819.1|  peroxidase                                              300   1e-97    
gb|ACF08095.1|  class III peroxidase                                    300   1e-97    
ref|XP_002448660.1|  hypothetical protein SORBIDRAFT_06g030940          300   1e-97    
gb|AAO13838.1|AF405326_1  peroxidase 2                                  298   2e-97    
gb|EMT19349.1|  Peroxidase 70                                           300   2e-97    
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1            300   2e-97    
ref|NP_001046401.1|  Os02g0240300                                       300   2e-97    
gb|EMS66092.1|  Peroxidase 52                                           301   2e-97    
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       300   2e-97    
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      300   2e-97    
ref|XP_004497330.1|  PREDICTED: cationic peroxidase 1-like              300   2e-97    
ref|XP_008645579.1|  PREDICTED: peroxidase P7-like                      300   2e-97    
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             300   2e-97    
ref|XP_008385017.1|  PREDICTED: cationic peroxidase 1-like              300   3e-97    
ref|XP_011070595.1|  PREDICTED: lignin-forming anionic peroxidase...    300   3e-97    
dbj|BAC83101.1|  putative peroxidase precursor                          300   3e-97    
ref|NP_001167809.1|  hypothetical protein precursor                     300   3e-97    
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                      300   3e-97    
gb|ACU82387.2|  peroxidase 1                                            300   3e-97    
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    300   3e-97    
ref|NP_001147216.1|  LOC100280824 precursor                             299   4e-97    
gb|EEC82680.1|  hypothetical protein OsI_27324                          299   4e-97    
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      299   4e-97    
gb|EAZ01280.1|  hypothetical protein OsI_23303                          300   4e-97    
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440          299   5e-97    
gb|AFW86738.1|  peroxidase 52 isoform 1                                 298   6e-97    
ref|NP_001060626.1|  Os07g0676900                                       299   7e-97    
ref|XP_004140410.1|  PREDICTED: lignin-forming anionic peroxidase...    298   7e-97    
dbj|BAJ90940.1|  predicted protein                                      299   8e-97    
dbj|BAM05634.1|  peroxidase 2                                           299   8e-97    
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      298   1e-96    
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...    298   1e-96    
gb|AAW52720.1|  peroxidase 6                                            298   1e-96    
dbj|BAM05635.1|  peroxidase 2                                           299   1e-96    
gb|EMT26113.1|  Peroxidase 4                                            298   1e-96    
ref|XP_008668773.1|  PREDICTED: peroxidase 2-like                       298   1e-96    
ref|XP_004967085.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P...    298   1e-96    
gb|EMT19350.1|  Peroxidase 70                                           298   1e-96    
ref|XP_004977056.1|  PREDICTED: peroxidase 4-like                       298   1e-96    
gb|ACF08094.1|  class III peroxidase                                    298   1e-96    
ref|XP_010695664.1|  PREDICTED: peroxidase P7-like                      298   1e-96    
ref|XP_010270789.1|  PREDICTED: lignin-forming anionic peroxidase...    298   1e-96    
gb|EMT02792.1|  Peroxidase 52                                           298   2e-96    
gb|AAX53172.1|  peroxidase                                              298   2e-96    
ref|XP_006370761.1|  Peroxidase 4 precursor family protein              298   2e-96    
dbj|BAM05637.1|  peroxidase 2                                           298   2e-96    
gb|EMS50650.1|  Peroxidase 70                                           298   2e-96    
emb|CAA71493.1|  peroxidase                                             297   2e-96    
ref|XP_003596716.1|  Peroxidase                                         297   2e-96    
dbj|BAK03433.1|  predicted protein                                      298   2e-96    
ref|XP_007132831.1|  hypothetical protein PHAVU_011G128200g             297   2e-96    
gb|ACG40622.1|  peroxidase 2 precursor                                  298   2e-96    
ref|XP_002437128.1|  hypothetical protein SORBIDRAFT_10g021610          297   2e-96    
ref|XP_008374993.1|  PREDICTED: peroxidase 4-like                       297   3e-96    
ref|XP_002438534.1|  hypothetical protein SORBIDRAFT_10g021650          297   3e-96    
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...    297   3e-96    
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             297   4e-96    
ref|XP_009403503.1|  PREDICTED: peroxidase P7-like                      297   4e-96    
ref|XP_010689732.1|  PREDICTED: peroxidase P7-like                      296   4e-96    
dbj|BAD54117.1|  putative bacterial-induced peroxidase precursor        297   4e-96    
ref|XP_004297785.1|  PREDICTED: lignin-forming anionic peroxidase...    297   5e-96    
ref|XP_003596717.1|  Peroxidase                                         296   5e-96    
ref|XP_002299006.2|  hypothetical protein POPTR_0001s46290g             296   5e-96    
ref|XP_008374518.1|  PREDICTED: peroxidase P7-like isoform X2           296   6e-96    
ref|XP_010925617.1|  PREDICTED: peroxidase P7-like                      296   6e-96    
ref|XP_010654887.1|  PREDICTED: lignin-forming anionic peroxidase...    297   6e-96    
gb|AFK42570.1|  unknown                                                 296   6e-96    
ref|XP_002269266.1|  PREDICTED: lignin-forming anionic peroxidase...    296   7e-96    
ref|XP_010228647.1|  PREDICTED: peroxidase 2-like                       296   7e-96    
ref|XP_011038117.1|  PREDICTED: lignin-forming anionic peroxidase...    296   8e-96    
gb|EAY85151.1|  hypothetical protein OsI_06506                          296   8e-96    
ref|XP_009603345.1|  PREDICTED: lignin-forming anionic peroxidase...    296   8e-96    
ref|XP_002461208.1|  hypothetical protein SORBIDRAFT_02g042850          296   8e-96    
ref|XP_011013621.1|  PREDICTED: lignin-forming anionic peroxidase...    296   1e-95    
ref|XP_008374548.1|  PREDICTED: peroxidase 4-like isoform X2            296   1e-95    
ref|NP_001057821.2|  Os06g0547100                                       297   1e-95    
ref|XP_010066439.1|  PREDICTED: cationic peroxidase 1-like              296   1e-95    
ref|XP_002269145.1|  PREDICTED: lignin-forming anionic peroxidase       296   1e-95    
gb|KHG00581.1|  hypothetical protein F383_17561                         306   1e-95    
gb|ACF82414.1|  unknown                                                 296   1e-95    
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      295   1e-95    
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              295   1e-95    
ref|XP_002269169.1|  PREDICTED: lignin-forming anionic peroxidase       296   2e-95    
gb|KHN46100.1|  Cationic peroxidase 1                                   294   2e-95    
gb|EMT19353.1|  Peroxidase 70                                           295   2e-95    
ref|XP_007045349.1|  Lignin-forming anionic peroxidase                  295   2e-95    
dbj|BAD97435.1|  peroxidase                                             295   2e-95    
ref|XP_010264469.1|  PREDICTED: peroxidase 2-like                       295   2e-95    
emb|CAN80097.1|  hypothetical protein VITISV_011206                     295   2e-95    
ref|XP_002320417.1|  peroxidase family protein                          295   3e-95    
ref|XP_008350979.1|  PREDICTED: lignin-forming anionic peroxidase...    295   3e-95    
emb|CBI19221.3|  unnamed protein product                                299   3e-95    
ref|XP_002521866.1|  Lignin-forming anionic peroxidase precursor,...    295   3e-95    



>ref|XP_008384729.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=327

 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 191/235 (81%), Positives = 208/235 (89%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSKSCPK+  TVKSVVKSAV+KEKRMGASLLRLHFHDCFV GCDGS+LL
Sbjct  26   GSSSAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLL  85

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPNNNSVRGF V+D IKS VEK CPGVVSCADI+ IA+RDSV +LGGP
Sbjct  86   DDTSSFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGP  145

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTASLSAANSGVIPPPTATLN L+TRF+  GLS RD+VALSGAHTIG+A
Sbjct  146  SWEVKLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR R+YNETNID+SFA+TRQ TCP   GSGDNNLAPLD  T   FD  Y+K
Sbjct  206  RCTTFRARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFK  260



>ref|XP_008384730.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=323

 Score =   399 bits (1024),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 191/235 (81%), Positives = 208/235 (89%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSKSCPK+  TVKSVVKSAV+KEKRMGASLLRLHFHDCFV GCDGS+LL
Sbjct  22   GSSSAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPNNNSVRGF V+D IKS VEK CPGVVSCADI+ IA+RDSV +LGGP
Sbjct  82   DDTSSFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTASLSAANSGVIPPPTATLN L+TRF+  GLS RD+VALSGAHTIG+A
Sbjct  142  SWEVKLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQA  201

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR R+YNETNID+SFA+TRQ TCP   GSGDNNLAPLD  T   FD  Y+K
Sbjct  202  RCTTFRARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFK  256



>ref|XP_009369543.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   399 bits (1024),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 191/235 (81%), Positives = 207/235 (88%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSKSCPK+  TVKSVVKSAV+KEKRMGASLLRLHFHDCFV GCDGS+LL
Sbjct  26   GSSSAQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLL  85

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPNNNS RGF V+D IKS VEK CPGVVSCADI+ IA+RDSV +LGGP
Sbjct  86   DDTSSFTGEKTAGPNNNSARGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGP  145

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTASLSAANSGVIPPPTATLN L+TRF+  GLS RD+VALSGAHTIG+A
Sbjct  146  SWEVKLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFA+TRQ TCP   GSGDNNLAPLD  T   FD  Y+K
Sbjct  206  RCTTFRARIYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFK  260



>ref|XP_006468162.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
 gb|KDO41521.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=323

 Score =   398 bits (1022),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/235 (80%), Positives = 209/235 (89%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G +SAQLSTNFYSK+CPKLL TVKS V+SAV+KE+RMGASLLRLHFHDCFV GCDGSILL
Sbjct  22   GKSSAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKT+GPN NS RGF V+D IKS VEKVCPGVVSCADI+ IAAR SV +LGGP
Sbjct  82   DDTSSFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRDSKTASL+AANSGVIPPPT+TL+NLI RFQ KGLSA+DMVALSGAHTIG+A
Sbjct  142  SWNVKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQA  201

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYNE+NI+SSFAK R+  CP  TGSGDNNLAPLDF++   FDN YYK
Sbjct  202  RCVAFRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYK  256



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score =   397 bits (1019),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/235 (80%), Positives = 210/235 (89%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLST FYSKSCPKL  TVK VV  A++KE+RMGASL+RL FHDCFV+GCDGSILL
Sbjct  27   GSSSAQLSTGFYSKSCPKLFETVKPVVADAISKERRMGASLVRLFFHDCFVKGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            +DT+SFTGE+TAGPNNNSVRGFNVI++IK+ VEKVCPGVVSCADI+ IAARDS V LGGP
Sbjct  87   EDTASFTGEQTAGPNNNSVRGFNVINNIKAKVEKVCPGVVSCADILAIAARDSTVTLGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW VKLGRRDSKTAS SAANSGVIPPPT+TL+NLI RF+ KGLSARDMVALSGAHTIG+A
Sbjct  147  NWAVKLGRRDSKTASFSAANSGVIPPPTSTLSNLINRFKAKGLSARDMVALSGAHTIGQA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC +FR RIYNETNIDSSFA TRQ+ CP  TGSGDNNLAPLD +T   FDNNY+K
Sbjct  207  RCVIFRNRIYNETNIDSSFASTRQRNCPRATGSGDNNLAPLDVQTPNAFDNNYFK  261



>ref|XP_007205551.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
 gb|EMJ06750.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
Length=325

 Score =   393 bits (1009),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 190/235 (81%), Positives = 207/235 (88%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSKSCPK+   VKSVV+SAVNKEKRMGASLLRLHFHDCFV GCDGSILL
Sbjct  23   GSSSAQLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSILL  82

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PNNNSVRGF V+D+IKS VEK CPGVVSCADI+ IAARDSV +LGGP
Sbjct  83   DDTSSFTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPGVVSCADILAIAARDSVKILGGP  142

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRDSKTASL+AANSGVIPPPT+TL+ L TRFQ  GL+ RD+VALSGAHTIG+A
Sbjct  143  SWNVKLGRRDSKTASLAAANSGVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGQA  202

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFAK RQ  CPS  GSGDNNLAPLD +T   FD  Y+K
Sbjct  203  RCTSFRARIYNETNIDASFAKARQSKCPSTVGSGDNNLAPLDVQTPNTFDTAYFK  257



>gb|EYU46002.1| hypothetical protein MIMGU_mgv1a009759mg [Erythranthe guttata]
Length=332

 Score =   390 bits (1003),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 206/235 (88%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G +SAQL+ ++Y K+CPK+  TV+S VKSA+ KEKRMGASL+RLHFHDCFVQGCD S+LL
Sbjct  31   GPSSAQLTEDYYKKTCPKVFDTVESAVKSAIKKEKRMGASLIRLHFHDCFVQGCDASVLL  90

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PNNNS+RGFNV+D IKS VE VCPGVVSCADI+ IAARDSV +LGGP
Sbjct  91   DDTSSFTGEKTAAPNNNSIRGFNVVDDIKSKVESVCPGVVSCADILAIAARDSVSILGGP  150

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VK+GRRDSKTASL+AANSGVIPPPT+TLNNL+ RFQ +GLS +DMVALSGAHTIG+A
Sbjct  151  EWDVKVGRRDSKTASLAAANSGVIPPPTSTLNNLVNRFQARGLSTKDMVALSGAHTIGQA  210

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC++FR RIYNETNID+SFA+ RQ  CP  TGSGDNNLA LD K+  FFDN YYK
Sbjct  211  RCSLFRTRIYNETNIDASFARKRQDNCPRTTGSGDNNLASLDVKSPTFFDNAYYK  265



>gb|KHG09190.1| Peroxidase 4 [Gossypium arboreum]
Length=322

 Score =   389 bits (998),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 208/233 (89%), Gaps = 0/233 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S+ AQLST+FYSKSCPK+L+TV+SVVKSAV+KEKRMGASL+RL FHDCFV+GCDGSILLD
Sbjct  22   SSYAQLSTSFYSKSCPKVLSTVESVVKSAVSKEKRMGASLVRLFFHDCFVKGCDGSILLD  81

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSF GEKTA PNNNSVRGFNV+D IK+ VEKVCPGVVSCADI+ +AARDSVV+LGGP 
Sbjct  82   DTSSFRGEKTAAPNNNSVRGFNVVDDIKAKVEKVCPGVVSCADILALAARDSVVILGGPG  141

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VKLGRRDSKTAS +AANSGVIPPPTATL+ LI RFQ +GLSA+DMVALSGAHTIGKAR
Sbjct  142  WDVKLGRRDSKTASFAAANSGVIPPPTATLSQLINRFQARGLSAKDMVALSGAHTIGKAR  201

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            C +FR RIYNETNID+SFAK RQ +CP  +GSGDNNLAPLD  T   FD  Y+
Sbjct  202  CVLFRDRIYNETNIDASFAKARQSSCPRTSGSGDNNLAPLDVATPNSFDLKYF  254



>ref|XP_007017044.1| Peroxidase 68 [Theobroma cacao]
 gb|EOY34663.1| Peroxidase 68 [Theobroma cacao]
Length=592

 Score =   397 bits (1020),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/234 (81%), Positives = 210/234 (90%), Gaps = 0/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            STSAQLSTNFYSKSCPK+ +TVKS V+SAV+KE+RMGASL+RL FHDCFV GCDGSILLD
Sbjct  26   STSAQLSTNFYSKSCPKVFSTVKSAVQSAVSKERRMGASLVRLFFHDCFVNGCDGSILLD  85

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSF GEKTAGPNNNSVRGFNV+D IK+ VEKVCPGVVSCADIV IAARDSVV+LGGP+
Sbjct  86   DTSSFKGEKTAGPNNNSVRGFNVVDDIKAKVEKVCPGVVSCADIVAIAARDSVVILGGPD  145

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VKLGRRDSKTAS SAANSGVIPPPT+TL+ LI RFQ +GLSA+DMVALSGAHTIGKAR
Sbjct  146  WDVKLGRRDSKTASFSAANSGVIPPPTSTLSQLINRFQARGLSAKDMVALSGAHTIGKAR  205

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            C +FR RIYNETNIDSSFAK R+ +CP  +GSGDNNLAPLD  T   FD NY++
Sbjct  206  CILFRARIYNETNIDSSFAKARRSSCPRTSGSGDNNLAPLDIGTPDSFDTNYFQ  259


 Score =   332 bits (850),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +2

Query  161  SVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFTGEKTAGPNNNSVRGFNV  340
            S VKSAV+KE RMGASL+RL FHDCFV GCDGSILLDDTSSF GEKTA PNNNSVRGF+V
Sbjct  314  SSVKSAVSKEPRMGASLVRLFFHDCFVNGCDGSILLDDTSSFIGEKTAAPNNNSVRGFHV  373

Query  341  IDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVKLGRRDSKTASLSAA-NSGV  517
            +D IKS VEKVCPG+VSCADI+ IAARDSVVLLGGP W VKLGRRDSKTA+ +AA N G 
Sbjct  374  VDDIKSEVEKVCPGIVSCADILAIAARDSVVLLGGPGWEVKLGRRDSKTANFTAAKNGGF  433

Query  518  IPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVFRRRIYNETNIDSSFAKTR  697
            IP PT+ L+ LI+ F+ +GLSA+DMVALSGAHTIGKARCTVFR RIYNE NIDSSFA+TR
Sbjct  434  IPSPTSNLSALISSFRVQGLSAKDMVALSGAHTIGKARCTVFRSRIYNEANIDSSFAETR  493

Query  698  QQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            ++ CPS +GSGD+NLAPLD +T   FD  Y++
Sbjct  494  RRNCPSASGSGDDNLAPLDVRTPDCFDKKYFQ  525



>ref|XP_002319968.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE95891.2| peroxidase family protein [Populus trichocarpa]
 gb|AHL39178.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   387 bits (994),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 205/233 (88%), Gaps = 0/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            +SAQLSTNFYSKSCPK+   VKSVV+SAV+KE+RMGASL+RL FHDCFV+GCDGSILL+D
Sbjct  26   SSAQLSTNFYSKSCPKVFGAVKSVVQSAVSKERRMGASLVRLFFHDCFVRGCDGSILLED  85

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSFTGE+TAGPNNNSVRGFNV+  IKS VEKVCPG+VSCADIV IAARDS V+LGGP W
Sbjct  86   TSSFTGEQTAGPNNNSVRGFNVVAKIKSQVEKVCPGIVSCADIVAIAARDSTVILGGPFW  145

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            NVKLGRRDSKTASLSAANSGVIPPPT+TL+NLI RF +KGLS +DMVALSG+HTIG+ARC
Sbjct  146  NVKLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFNSKGLSVKDMVALSGSHTIGQARC  205

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR RIYNETNIDSSFA TRQ+ CP     GDN LAPLD +T   FDN YYK
Sbjct  206  TSFRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTSFDNKYYK  258



>ref|XP_008244108.1| PREDICTED: peroxidase 4 [Prunus mume]
Length=325

 Score =   386 bits (992),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/235 (79%), Positives = 203/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSKSCPK+   VKSVV+SAVN+EKRMGASLLRLHFHDCFV GCDGSILL
Sbjct  23   GSSSAQLSTNFYSKSCPKVFHAVKSVVQSAVNREKRMGASLLRLHFHDCFVNGCDGSILL  82

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTAGPNN SVRGF V+D IKS VEK CPG+VSCADI+ I ARDSV +LGG 
Sbjct  83   DDTSSFKGEKTAGPNNKSVRGFEVVDKIKSQVEKTCPGIVSCADILAITARDSVKILGGS  142

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRDSKTAS +AANSGV+PPPT+TL+NL TRFQ  GL+ RD+VALSGAHTIGKA
Sbjct  143  SWNVKLGRRDSKTASFTAANSGVLPPPTSTLSNLKTRFQAVGLNERDLVALSGAHTIGKA  202

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFAK RQ  CPS  GSGDNNLAPLD +T   FD  Y+K
Sbjct  203  RCTSFRLRIYNETNIDASFAKVRQSKCPSTAGSGDNNLAPLDVQTPDTFDTAYFK  257



>ref|XP_004294746.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   386 bits (992),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 208/235 (89%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G +SAQLSTNFYS SCPKL  TVKSVV+SA++ E R+GASLLRLHFHDCFV GCDGS+LL
Sbjct  26   GRSSAQLSTNFYSGSCPKLFTTVKSVVQSAISNENRIGASLLRLHFHDCFVNGCDGSVLL  85

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPNNNS+RGF+V+D IK+ VEK CPGVVSCADIVTIAARDSVV+LGGP
Sbjct  86   DDTSSFTGEKTAGPNNNSLRGFDVVDKIKTKVEKACPGVVSCADIVTIAARDSVVILGGP  145

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VKLGRRD+KT +L+AANSGVIP PT  L++LIT+FQ +GLS  DMVALSGAHTIGKA
Sbjct  146  SWSVKLGRRDAKTTTLAAANSGVIPAPTNDLSDLITKFQAQGLSTTDMVALSGAHTIGKA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCTVFR RIYNETNID+SFAKTRQ  CPS +GSGDNNLAPLD +T   FD  Y++
Sbjct  206  RCTVFRDRIYNETNIDASFAKTRQNNCPSTSGSGDNNLAPLDTQTTNAFDPKYFQ  260



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   385 bits (989),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 209/235 (89%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSK+CPK+  TVKS V+SAV+KE+RMGASLLRL FHDCFV GCD S+LL
Sbjct  21   GSSSAQLSTNFYSKTCPKVFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGE+TA PN NS+RG NVID+IKS VE VCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  81   DDTSSFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VKLGRRDSKTASLS AN+  IPPPT++L+NLI++FQ +GLS RDMVALSGAHTIG+A
Sbjct  141  DWDVKLGRRDSKTASLSGANNN-IPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNIDSSFAKTRQ +CPS +GSGDNNLAPLD +T   FDN YYK
Sbjct  200  RCTSFRARIYNETNIDSSFAKTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYK  254



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   385 bits (988),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 206/235 (88%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS SAQLSTNFYSKSCP +L+T KSVV+SAV+KE+RMGASLLRL FHDCFV GCDGSILL
Sbjct  22   GSASAQLSTNFYSKSCPNVLSTAKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTAGPN NSVRG+NVID IKS VE  CPGVVSCADIV IAARDSVVLLGGP
Sbjct  82   DDTSSFQGEKTAGPNQNSVRGYNVIDQIKSKVESACPGVVSCADIVAIAARDSVVLLGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRD++TASLS ANSGVIPPPT+TL+NLI+RF+ +GLS RDMVALSG+HTIG+A
Sbjct  142  SWEVKLGRRDARTASLSRANSGVIPPPTSTLSNLISRFKAQGLSTRDMVALSGSHTIGQA  201

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYN++NIDSSF+KTRQ  CP   GSGDNNL+PLD ++   FDN Y+K
Sbjct  202  RCISFRPRIYNDSNIDSSFSKTRQGKCPRTAGSGDNNLSPLDLQSPTAFDNAYFK  256



>ref|XP_008354764.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=327

 Score =   384 bits (987),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 203/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLSTNFYSKSCP++   VKSVVKSAV+KEKRMGASLLRLHFHDCFV GCDGS+LL
Sbjct  26   GNSSAQLSTNFYSKSCPQVFDAVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLL  85

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PNNNS RGF V+D IKS VEK CPGVVSCADI+ IA+RDSV +LGGP
Sbjct  86   DDTSSFTGEKTALPNNNSXRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGP  145

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTASLSAANSGV+PPPTATLN L TRF+  GLS RD+VALSGAHTIG+A
Sbjct  146  SWEVKLGRRDSKTASLSAANSGVLPPPTATLNELTTRFRAVGLSQRDLVALSGAHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFA+TRQ TCP   GSGD+NLAP D  T   FD  Y+K
Sbjct  206  RCTTFRARIYNETNIDASFARTRQNTCPRTAGSGDDNLAPFDITTPNTFDTAYFK  260



>ref|XP_011021038.1| PREDICTED: peroxidase 4-like [Populus euphratica]
Length=325

 Score =   383 bits (983),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 205/233 (88%), Gaps = 0/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            +SA+LSTNFYSKSCPK+   VKSVV+SAV+KE+RMGASL+RL FHDCFV+GCDGSILL+D
Sbjct  26   SSAKLSTNFYSKSCPKVFGVVKSVVQSAVSKERRMGASLVRLFFHDCFVKGCDGSILLED  85

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSFTGE+TA PNNNSVRGFNV+  IKS VEKVCPGVVSCADIV IAARDS V+LGGP W
Sbjct  86   TSSFTGEQTARPNNNSVRGFNVVAKIKSRVEKVCPGVVSCADIVAIAARDSTVILGGPFW  145

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            NVKLGRRDSKTASLSAANSGVIPPPT+TL+NLI RF++KGLS +DMVALSG+HTIG+ARC
Sbjct  146  NVKLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFKSKGLSVKDMVALSGSHTIGQARC  205

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR RIYNETNIDSSFA TRQ+ CP     GDN LAPLD +T   FDN YYK
Sbjct  206  TSFRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTAFDNKYYK  258



>ref|XP_009354386.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   381 bits (978),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 202/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G + A+LSTNFYSKSCP++   VKSVVKSAV+K+KRMGASLLRLHFHDCFV GCDGS+LL
Sbjct  26   GKSHAKLSTNFYSKSCPQVFDAVKSVVKSAVSKDKRMGASLLRLHFHDCFVNGCDGSLLL  85

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PNNNS+RGF V+D IKS VEK CPGVVSCADI+ IA+RDSV +LGGP
Sbjct  86   DDTSSFTGEKTALPNNNSLRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGP  145

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTASLSAANSGVIPPPTATLN L TRF+  GLS RD+VALSGAHTIG+A
Sbjct  146  SWEVKLGRRDSKTASLSAANSGVIPPPTATLNELTTRFRAVGLSQRDLVALSGAHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFA+TRQ TCP   G GD+NLAPLD  T   FD  Y+K
Sbjct  206  RCTTFRARIYNETNIDASFARTRQNTCPRTAGHGDDNLAPLDITTPNTFDTAYFK  260



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   380 bits (977),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/235 (77%), Positives = 204/235 (87%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS SAQLSTNFYSKSCP +L+TVKSVV+SAV+KE+RMGASLLRL FHDCFV GCDGSILL
Sbjct  22   GSASAQLSTNFYSKSCPNVLSTVKSVVRSAVSKERRMGASLLRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTAGPNN S+RG+NVID IKS VE  CPGVVSCADIV IAARDSVVLLGGP
Sbjct  82   DDTSSFQGEKTAGPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRD++TAS S ANSG +PPPT+TL+NL + FQ +GLS RDMVALSG+HTIG+A
Sbjct  142  SWEVKLGRRDARTASFSLANSGALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQA  201

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYN++NIDSSF+KTRQ+ CPS  GSGD NLAPLD ++   FDN Y+K
Sbjct  202  RCISFRSRIYNDSNIDSSFSKTRQRKCPSTVGSGDQNLAPLDLQSPTAFDNAYFK  256



>ref|XP_008810563.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=319

 Score =   379 bits (972),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/235 (77%), Positives = 204/235 (87%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GSTSAQLSTN+Y+ SCPK+ + VK VV+SA+ KEKRMGASLLRL FHDCFVQGCDGSILL
Sbjct  19   GSTSAQLSTNYYASSCPKVFSAVKPVVQSAIAKEKRMGASLLRLFFHDCFVQGCDGSILL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTA PNNNSVRGF+V+DSIK+AVEKVCPGVVSCADI+ I ARDSVV+LGGP
Sbjct  79   DDTSSFQGEKTATPNNNSVRGFDVVDSIKAAVEKVCPGVVSCADILAITARDSVVILGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVKLGRRDS TAS S AN+  IPPP ++L+NLI++F  +GLS +DMVALSG HTIG+A
Sbjct  139  NWNVKLGRRDSTTASFSGANNN-IPPPNSSLSNLISKFSAQGLSTKDMVALSGGHTIGQA  197

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  +YN+T+IDSSFAKTRQ  CPS  GSGDNNLAPLD +T   FDNNYYK
Sbjct  198  RCTNFRAHVYNDTDIDSSFAKTRQMNCPSTAGSGDNNLAPLDLQTPTCFDNNYYK  252



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 203/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS SAQLSTNFYSK+CP +  TVKS V+SA++KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  21   GSCSAQLSTNFYSKTCPNVFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSILL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF+V+D IKS VEKVCPGVVSCADI+ IAARDSVV+LGG 
Sbjct  81   DDTSSFTGEKNANPNRNSARGFDVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGT  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRDSKTAS SAAN+  IPPPT+ LNNLI+ FQ+KGLS +DMVALSG HTIG+A
Sbjct  141  SWNVKLGRRDSKTASQSAANNN-IPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNE+NI+SSFAKTRQ  CPS +GSGDNNLAPLD +T   FDNNY+K
Sbjct  200  RCTNFRARIYNESNIESSFAKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFK  254



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   376 bits (965),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/235 (75%), Positives = 206/235 (88%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSKSCP +  TVKS V SA++KE+RMGASLLRL FHDCFV GCDGSIL+
Sbjct  20   GSSSAQLSTNFYSKSCPNVFTTVKSAVGSAISKERRMGASLLRLFFHDCFVNGCDGSILV  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEK A PN NSVRGFNV+D IKS VEKVCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  80   DDTSNFTGEKNAAPNRNSVRGFNVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRD++TAS +AAN+  IPPPT++L+NLI+ FQ+KGLS +DMVALSG+HTIG+A
Sbjct  140  SWKVKLGRRDARTASQAAANTS-IPPPTSSLSNLISSFQSKGLSTKDMVALSGSHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNE+NID SFAK RQ+ CP+ +GSGDNNLAPLD +T   FDNNY+K
Sbjct  199  RCTSFRTRIYNESNIDGSFAKARQRKCPATSGSGDNNLAPLDLQTPTAFDNNYFK  253



>ref|XP_011080738.1| PREDICTED: peroxidase 4-like [Sesamum indicum]
Length=329

 Score =   375 bits (964),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 190/236 (81%), Positives = 204/236 (86%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLST+FY KSCP + + V SVVKSAV KEKRMGASLLRLHFHDCFVQGCDGSILL
Sbjct  27   GSSSAQLSTDFYEKSCPNVFSVVNSVVKSAVQKEKRMGASLLRLHFHDCFVQGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPN NSVRG+ VIDSIKS VE  CPGV+SCADIV IAARDSVVLLGGP
Sbjct  87   DDTSSFTGEKTAGPNINSVRGYEVIDSIKSKVEATCPGVISCADIVAIAARDSVVLLGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W VK+GRRDSKTASLSAAN+G +PPPT+TL NLI RFQ KGLS +DMV LSGAH+IG+A
Sbjct  147  TWEVKVGRRDSKTASLSAANNGQLPPPTSTLTNLINRFQAKGLSTKDMVVLSGAHSIGQA  206

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCTVFR RIYNET NIDSSFAK RQ  CP   GSGDNNLAPLD KT  FFDN Y+K
Sbjct  207  RCTVFRDRIYNETSNIDSSFAKLRQGNCPRTNGSGDNNLAPLDLKTPTFFDNAYFK  262



>ref|XP_010087166.1| Peroxidase 4 [Morus notabilis]
 gb|EXB28405.1| Peroxidase 4 [Morus notabilis]
Length=326

 Score =   374 bits (960),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 199/234 (85%), Gaps = 0/234 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS SAQL   FY KSCPK+ ATVKSVVK+A++KE R+GASLLRLHFHDCFV GCDGSILL
Sbjct  25   GSCSAQLYPGFYHKSCPKVFATVKSVVKTAISKENRIGASLLRLHFHDCFVNGCDGSILL  84

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTAGPNNNS RGF V+D IK+ VE+VCPGVVSCADI+ IAARDSV +LGGP
Sbjct  85   DDTSSFRGEKTAGPNNNSARGFGVVDKIKAEVEQVCPGVVSCADILAIAARDSVAILGGP  144

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             + VK+GRRDSKTAS SAANSGVIPPPT+TL+NLI RF+N+GLSA DMVALSG HTIGKA
Sbjct  145  YYEVKVGRRDSKTASFSAANSGVIPPPTSTLSNLINRFKNRGLSALDMVALSGGHTIGKA  204

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RC VFR+RIYNETNIDSSFAK RQ  CP    SGDNN+A LD  T   FDN+Y+
Sbjct  205  RCRVFRKRIYNETNIDSSFAKARQSKCPRNAPSGDNNVADLDVATPNSFDNHYF  258



>gb|AAR31106.1| peroxidase precursor [Quercus suber]
Length=330

 Score =   374 bits (960),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/236 (75%), Positives = 201/236 (85%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SA+LSTNFY KSCPK+ +TV+SVV SA++K+ R GASLLRLHFHDCFV GCDGS+LL
Sbjct  27   GNSSAKLSTNFYYKSCPKVFSTVQSVVHSAISKQPRQGASLLRLHFHDCFVNGCDGSVLL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +FTGEKTAGPN  S+RGF  +D IKS VEK CPGVVSCADI+ IAARDSV +LGGP
Sbjct  87   DDTPTFTGEKTAGPNKGSIRGFEFVDEIKSKVEKECPGVVSCADILAIAARDSVKILGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRDSKTASL AANSGVIPPPT+TL+NLI RF+ KGLS +DMVALSGAHTIG+A
Sbjct  147  KWDVKLGRRDSKTASLKAANSGVIPPPTSTLSNLINRFKAKGLSTKDMVALSGAHTIGQA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTG-SGDNNLAPLDFKTQAFFDNNYYK  793
            RCTVFR RIY + NIDSSFAKTRQ TCP  TG  GDN +APLD +T   FDN YYK
Sbjct  207  RCTVFRDRIYKDKNIDSSFAKTRQNTCPKTTGLPGDNKIAPLDLQTPTAFDNYYYK  262



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   374 bits (959),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 207/235 (88%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSK+CP L +TV+ V++SA++ EKRMGAS+LRL FHDCFV GCDGS+LL
Sbjct  20   GSSSAQLSTNFYSKTCPNLFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLLL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PN NS RGF+VID IK+AVEK CPGVVSCADI+ I+ARDSVVLLGGP
Sbjct  80   DDTSSFTGEKTANPNRNSARGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVKLGRRD++TASLS AN+  IPPPT++L+NLI++F  +GLSA +MVALSGAHTIG+A
Sbjct  140  NWNVKLGRRDARTASLSGANNN-IPPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYN+TNID SFAKTR+  CPS +G+GDNNLAPLD +T   FDN+Y+K
Sbjct  199  RCTSFRARIYNDTNIDGSFAKTRRSNCPSTSGNGDNNLAPLDLQTPTSFDNDYFK  253



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   372 bits (955),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 203/234 (87%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            +T+AQLST+FYSKSCP L +T+K VV+SA+NKEKRMGASL+RL FHDCFV GCDGS+LLD
Sbjct  26   TTNAQLSTSFYSKSCPNLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVLLD  85

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEKTA PN NS RGF VIDSIKSAVEK CPGVVSCADI+ +AARDS V+LGGP 
Sbjct  86   DTSSFTGEKTALPNRNSARGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGGPT  145

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNVKLGRRD++TASLSAAN+G IPPPT+ LN LI+RF   GLS RD+VAL+G+HTIG+AR
Sbjct  146  WNVKLGRRDARTASLSAANNG-IPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQAR  204

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYNETNID+SFA+TR+  CP   G+GDNNLAPLD +T   FDNNY+K
Sbjct  205  CTSFRARIYNETNIDNSFAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFK  258



>gb|AAR31108.1| peroxidase precursor [Quercus suber]
Length=330

 Score =   372 bits (955),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/236 (75%), Positives = 200/236 (85%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SA+LSTNFYSKSCPK+ +TV+SVV SAV+K+ R GASLLRLHFHDCFV GCDGSILL
Sbjct  27   GNSSAKLSTNFYSKSCPKVFSTVQSVVHSAVSKQPRQGASLLRLHFHDCFVNGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +FTGEKTA PNN S+R F V+D IKS VEK CPGVVSCADI+ IAARDSV +LGGP
Sbjct  87   DDTPTFTGEKTARPNNGSIRAFEVVDEIKSKVEKECPGVVSCADILAIAARDSVKILGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRDSKTAS SAANSGVIPPPT+TL NLI RF+ KGLS +DMVALSGAHT+G+A
Sbjct  147  KWDVKLGRRDSKTASFSAANSGVIPPPTSTLGNLINRFKAKGLSTKDMVALSGAHTVGQA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTG-SGDNNLAPLDFKTQAFFDNNYYK  793
            RCTVFR RIY + NIDSSFAKTRQ  CP  TG  GDN +APLD +T   FDN YYK
Sbjct  207  RCTVFRDRIYKDKNIDSSFAKTRQNKCPKTTGLPGDNKIAPLDLQTPTAFDNYYYK  262



>gb|KEH34419.1| anionic peroxidase swpb3 protein [Medicago truncatula]
Length=320

 Score =   372 bits (954),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 200/235 (85%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLS NFYSK CPK+  TV+SVVK+AV KE R+GASLLRLHFHDCFV GCDGSILL
Sbjct  19   GTSSAQLSENFYSKKCPKVFKTVQSVVKTAVAKENRIGASLLRLHFHDCFVDGCDGSILL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTAGPNNNSVRG+ VID+IKS VE +CPGVVSCADIV I ARDSVV+LGGP
Sbjct  79   DDTSSFKGEKTAGPNNNSVRGYEVIDAIKSKVEAICPGVVSCADIVAITARDSVVILGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W VK+GRRDSKTA+ +AAN+GVIP PT+ L  LI+ F+ +GLS +DMVALSGAHTIG+A
Sbjct  139  FWKVKVGRRDSKTANFTAANTGVIPAPTSNLTTLISTFKAQGLSVKDMVALSGAHTIGRA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN++NIDS+FAK RQ+ CP  TGSGDNNLA LD +T   FDNNYYK
Sbjct  199  RCTSFRGHIYNDSNIDSTFAKIRQKNCPRTTGSGDNNLANLDLRTPTHFDNNYYK  253



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   372 bits (954),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 201/236 (85%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLST FYSKSCPKL  TVKS V+SA+NKE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  20   GSSSAQLSTGFYSKSCPKLYQTVKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF VID+IKSAVEKVCPGVVSCADI+ + ARDSVV+LGGP
Sbjct  80   DDTSSFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVKLGRRDS+TAS SAANSG IPP T+ LN LI+ F   GLS +DMVALSGAHTIG+A
Sbjct  140  NWNVKLGRRDSRTASQSAANSG-IPPATSNLNRLISSFSAVGLSTKDMVALSGAHTIGQA  198

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET N+D+SFA+TRQ  CP  +GSGDNNLAPLD +T   FDNNY+K
Sbjct  199  RCTSFRARIYNETNNLDASFARTRQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFK  254



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   372 bits (954),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 202/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GST+AQLSTNFYSKSCP LL+TVKS V SA+NKE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  30   GSTNAQLSTNFYSKSCPNLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLL  89

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF+V+D+IKSAVE VCPGVVSCADI+ IAARDSV +LGGP
Sbjct  90   DDTSSFTGEKNANPNRNSSRGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVEILGGP  149

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W VKLGRRD+++AS SAAN+G IPPPT+ LN L +RF   GLS RD+VALSGAHTIG+A
Sbjct  150  KWAVKLGRRDARSASQSAANNG-IPPPTSNLNRLTSRFNALGLSTRDLVALSGAHTIGQA  208

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNE+NID+SFA+TRQ+ CP  TGSGDNNLAPLD +T   FDNNY+K
Sbjct  209  RCTSFRARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFK  263



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score =   370 bits (951),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 199/235 (85%), Gaps = 2/235 (1%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S+SAQLSTNFYSKSCPKL  TVKS V+SA+N+E RMGASLLRL FHDCFV GCDGS+LLD
Sbjct  24   SSSAQLSTNFYSKSCPKLFQTVKSTVQSAINRETRMGASLLRLFFHDCFVNGCDGSLLLD  83

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A PN NSVRGF VID+IKSAVEK CPGVVSCADI+ I ARDSVV+LGGPN
Sbjct  84   DTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPN  143

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNVKLGRRD++TAS  AANS  IPPPT+ LN LI+ F   GLS  DMVALSGAHTIG+AR
Sbjct  144  WNVKLGRRDARTASQGAANSS-IPPPTSNLNQLISSFSAVGLSTTDMVALSGAHTIGQAR  202

Query  632  CTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYNET NIDSSFA TRQ+ CP  +GSGDNNLAPLD +T   FDNNY+K
Sbjct  203  CTSFRARIYNETNNIDSSFATTRQRNCPRNSGSGDNNLAPLDLQTPTKFDNNYFK  257



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score =   370 bits (949),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 199/231 (86%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQLSTN+YSK+CPKL  TVKS V SA+ KE RMGASLLRL FHDCFV GCDGS+LLDDTS
Sbjct  25   AQLSTNYYSKTCPKLFPTVKSTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGEK A PN NS RGF+V+D+IKSAVE VCPGVVSCADI+TIAARDSV +LGGPNW+V
Sbjct  85   SFTGEKNAAPNRNSARGFDVVDNIKSAVEDVCPGVVSCADILTIAARDSVAILGGPNWDV  144

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRD++TAS +AAN+  IPPPT+ LN LI+RF   GLS RDMVALSG+HTIG ARCT 
Sbjct  145  KLGRRDARTASQAAANNS-IPPPTSNLNRLISRFNALGLSTRDMVALSGSHTIGLARCTS  203

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNE+NIDSSFA+TRQ+ CP  TGSGDNNLAPLD +T  FFDNNY+K
Sbjct  204  FRPRIYNESNIDSSFAQTRQRNCPRTTGSGDNNLAPLDIQTPTFFDNNYFK  254



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score =   370 bits (949),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 201/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS++AQLST++YS+SCPKL  TVKS VKSAV KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  21   GSSTAQLSTDYYSQSCPKLFPTVKSAVKSAVAKEARMGASLLRLFFHDCFVNGCDGSVLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEK A PN NSVRGF+V+D IKS VE  CPGVVSCAD++ IAARDSVV+LGGP
Sbjct  81   DDTSSFIGEKNAAPNANSVRGFDVVDDIKSKVETACPGVVSCADVLAIAARDSVVILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRD++TAS +AAN+  IPPPT+ LN LI+RFQ  GLS RD+VAL+G+HTIG+A
Sbjct  141  SWNVKLGRRDARTASQAAANNS-IPPPTSNLNQLISRFQALGLSTRDLVALAGSHTIGQA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFAKTRQ  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  200  RCTSFRARIYNETNIDNSFAKTRQSNCPRASGSGDNNLAPLDLQTPTAFENNYYK  254



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score =   369 bits (948),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/236 (76%), Positives = 201/236 (85%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSKSCPKL  T+KS V+SA+NKE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  21   GSSSAQLSTNFYSKSCPKLYQTIKSTVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NSVRGF VID+IKSAVEK CPG+VSCADI+ + ARDSVV+LGGP
Sbjct  81   DDTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGIVSCADILAVTARDSVVILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVKLGRRD++TAS  AANS  IP PT  LN LI+ F   GLS +DMVALSGAHTIG+A
Sbjct  141  NWNVKLGRRDARTASQGAANSS-IPAPTFNLNRLISSFSAVGLSTKDMVALSGAHTIGQA  199

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET NIDS+FA+TRQ +CP  +GSGDNNLAPLD +T + FDNNY+K
Sbjct  200  RCTTFRARIYNETNNIDSTFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFK  255



>ref|XP_009384773.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578} [Musa 
acuminata subsp. malaccensis]
Length=356

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 203/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G TSAQLST+FYS SCPKL +TVK VV+SA++KEKR+GAS+LRL FHDCFV GCDGS+LL
Sbjct  55   GGTSAQLSTSFYSSSCPKLFSTVKPVVQSAISKEKRLGASVLRLFFHDCFVLGCDGSVLL  114

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +FTGEKTA PNNNS+RGF VID IK+AVEK CPGVVSCADI+ +AARDSVV+LGGP
Sbjct  115  DDTPTFTGEKTAKPNNNSIRGFEVIDQIKTAVEKACPGVVSCADILAVAARDSVVILGGP  174

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW+VKLGRRDS+ AS+S AN   IPPPT++L+NLI++F  KGLS +DMVALSG+HTIG A
Sbjct  175  NWDVKLGRRDSRRASISKANKQ-IPPPTSSLSNLISKFSAKGLSTKDMVALSGSHTIGLA  233

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+TNID+SFAK RQ  CPS +GSGDNNLAPLD +T   FDNNYYK
Sbjct  234  RCTSFRGHIYNDTNIDASFAKKRQANCPSASGSGDNNLAPLDLQTPTAFDNNYYK  288



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score =   369 bits (947),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 199/233 (85%), Gaps = 1/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            T AQLSTNFYSK+CP +  TVKS V++A+NKE RMGASLLRL FHDCFV GCDGSILLDD
Sbjct  33   TDAQLSTNFYSKTCPNVFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSILLDD  92

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TS+FTGEK A PN NS RGF+V+D+IKSAVEKVCPGVVSCAD++ I ARDS V+LGGP+W
Sbjct  93   TSTFTGEKNAAPNKNSARGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPSW  152

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            NVK+GRRD++TAS +AAN+  IPPPT+ LNNLI+ FQN GLS RDMVALSG+HTIG+ARC
Sbjct  153  NVKVGRRDARTASQAAANNS-IPPPTSNLNNLISFFQNVGLSTRDMVALSGSHTIGQARC  211

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR RIYNETN+DSS AKTRQ  CP   GSGDNNLAPLD +T   FDNNYYK
Sbjct  212  TNFRTRIYNETNLDSSLAKTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYK  264



>ref|XP_007141708.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
 gb|ESW13702.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
Length=320

 Score =   368 bits (945),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  +A L TNFYS SCPKLL TVK  V+SA++KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  20   GGANATLYTNFYSSSCPKLLDTVKCAVESAISKETRMGASLLRLFFHDCFVNGCDGSILL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF+VID IKSAVE+VCPGVVSCADI+ IAARDSV +LGGP
Sbjct  80   DDTSSFTGEKNARPNKNSARGFDVIDKIKSAVEEVCPGVVSCADILAIAARDSVHILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRDS+TAS SAAN+G IPPPT+ +N LI+RF + GLS +D+VALSGAHTIG+A
Sbjct  140  SWNVKLGRRDSRTASQSAANNG-IPPPTSNVNQLISRFNSLGLSPKDLVALSGAHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNIDSSFA  RQ TCP  +GSGDNNLAPLD  T  FFDN+Y+K
Sbjct  199  RCTTFRARIYNETNIDSSFAHIRQSTCPPNSGSGDNNLAPLDLATPTFFDNHYFK  253



>emb|CDP04065.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   368 bits (944),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 199/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLST+FYSKSCPK+L T++S V+SAV+KE+RMGASL+RL FHDCFVQGCD SILLDDT
Sbjct  18   SAQLSTSFYSKSCPKVLGTIRSEVQSAVSKERRMGASLVRLFFHDCFVQGCDASILLDDT  77

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            SSF GEKTA PN NSVRGF VID+IK  VEKVCPGVVSCADIV IAARDS+V+LGGP+W+
Sbjct  78   SSFKGEKTAFPNINSVRGFGVIDNIKEKVEKVCPGVVSCADIVAIAARDSIVILGGPSWD  137

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            VKLGRRDSKTASLS ANSG +P P +TL NLI RFQ  GLSA+DMVALSGAHTIG+ARCT
Sbjct  138  VKLGRRDSKTASLSQANSGRLPGPASTLANLINRFQAVGLSAKDMVALSGAHTIGQARCT  197

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR RIYNET ID+SFAKTR+  CP+  G GDNNLAPLD +T   FD  Y++
Sbjct  198  NFRTRIYNETKIDTSFAKTRRSQCPATVGRGDNNLAPLDLQTPTGFDTKYFQ  249



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 201/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GST+AQLSTNFYSKSCPKLL+TVKS V SA+NKE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  22   GSTNAQLSTNFYSKSCPKLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF+V+D+IKSAVE VCPGVVSCADI+ I ARDSV +LGGP
Sbjct  82   DDTSSFTGEKNAIPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAITARDSVEILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W VKLGRRD+++AS SAAN+G IP PT+ LN L +RF   GLS RD+VALSGAHTIG+A
Sbjct  142  KWAVKLGRRDARSASQSAANNG-IPAPTSNLNQLTSRFNALGLSTRDLVALSGAHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNE+NID+SFA+TRQ+ CP  TGSGDNNLAPLD +T   FDNNY+K
Sbjct  201  RCTSFRARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFK  255



>ref|XP_007205544.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
 gb|EMJ06743.1| hypothetical protein PRUPE_ppa008590mg [Prunus persica]
Length=326

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/236 (75%), Positives = 203/236 (86%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SA+LST FYSKSCPK+   VKSVV+SAV+KEKRMGASLLRLHFHDCFV GCDGS+LL
Sbjct  23   GSSSAKLSTKFYSKSCPKVFNAVKSVVQSAVHKEKRMGASLLRLHFHDCFVHGCDGSLLL  82

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PNNNS+RGF V+D IKS VEK CPGVVSCADI+ IAARDSV +LGGP
Sbjct  83   DDTSSFTGEKTASPNNNSLRGFKVVDKIKSQVEKTCPGVVSCADILAIAARDSVKILGGP  142

Query  449  NWNVKLGRRDSKTASLSAAN-SGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGK  625
            +W+VKLGRRDSKTAS  AAN SGV+P PT+TL+ L TRFQ  GL+ RD+VALSGAHTIGK
Sbjct  143  SWHVKLGRRDSKTASFFAANRSGVLPSPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGK  202

Query  626  ARCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            A+C+ FR RIYN+TNID+SFAK RQ+ CPS  GSGDN+LAPLD +T   FD  Y+K
Sbjct  203  AQCSSFRDRIYNDTNIDASFAKARQRKCPSTVGSGDNHLAPLDVQTPNTFDTAYFK  258



>ref|XP_010921101.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   367 bits (943),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 206/235 (88%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTN+YSK+CP L + VK V++SA++ EKRMGAS+LRL FHDCFV GCDGS+LL
Sbjct  20   GSSSAQLSTNYYSKTCPNLFSAVKPVIESAISSEKRMGASILRLFFHDCFVNGCDGSLLL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA  N NSVRGF+VID IK+AVE+ CPGVVSCADI+ +AARDSVV+LGGP
Sbjct  80   DDTSSFTGEKTANANRNSVRGFDVIDKIKTAVEEACPGVVSCADILAVAARDSVVILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW+VKLGRRD++TASLSAAN+  IPPPT++L+NLI++F  +GLS  +MVAL+GAHTIG+A
Sbjct  140  NWDVKLGRRDARTASLSAANNN-IPPPTSSLSNLISKFSAQGLSTDEMVALAGAHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+T+I+SSFAKTRQ  CPS +G+GDNNLAPLD +T   FDNNYYK
Sbjct  199  RCTSFRAHIYNDTDINSSFAKTRQANCPSTSGNGDNNLAPLDLQTPTVFDNNYYK  253



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   367 bits (941),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 199/234 (85%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            +TSAQLSTNFYS SCP+L +TVKS V+SA+ KE RMGASLLRLHFHDCFV GCDGS+LLD
Sbjct  20   TTSAQLSTNFYSSSCPRLFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLLLD  79

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A PN NS RGF+V+D+IKSAVE VCPGVVSCADI+ IAARDSVV LGGP+
Sbjct  80   DTSSFTGEKNAAPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLGGPS  139

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNVKLGRRD++TAS +AAN+  IPPPT  LN LI+ F   GLS RD+VALSG+HTIG+AR
Sbjct  140  WNVKLGRRDARTASQAAANNN-IPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQAR  198

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYNETN+DSS A+TR+  CP  +GSGDNNLAPLD +T   FDNNY+K
Sbjct  199  CTSFRPRIYNETNLDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFK  252



>ref|XP_010922691.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   366 bits (939),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 203/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GSTSAQLSTNFY+ SCP++ + VK VV++A+ KE+RMGASLLRL FHDCFVQGCDGSILL
Sbjct  20   GSTSAQLSTNFYASSCPQVFSAVKPVVQAAIAKEQRMGASLLRLFFHDCFVQGCDGSILL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GEKTA PNNNSVRGF+V+D+IK+AVEKVCPGVVSCADI+ I +RDSVV+LGGP
Sbjct  80   DDTPTFMGEKTAVPNNNSVRGFDVVDNIKAAVEKVCPGVVSCADILAITSRDSVVILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW+VKLGRRDS TAS S AN+  IPPP ++L+NLI++F  +GLS +DMVALSG HTIG+A
Sbjct  140  NWDVKLGRRDSTTASFSGANNN-IPPPNSSLSNLISKFAAQGLSTKDMVALSGGHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR  IYN+T+IDSSFAKTRQ  CPS +GSGDNNLAPLD +T   FDN+YYK
Sbjct  199  RCLNFRAHIYNDTDIDSSFAKTRQMNCPSTSGSGDNNLAPLDLQTPTCFDNDYYK  253



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   365 bits (938),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 203/233 (87%), Gaps = 3/233 (1%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            ++AQLSTNFYSKSCP L +TVK VV+SA+N+EKRMGASL+RL FHDCFV GCDGSILLDD
Sbjct  22   SNAQLSTNFYSKSCPNLFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSILLDD  81

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSFTGE+TA PN NSVRGF VIDSIKSAVEK CPGVVSCADI+ IAARDS  +LGGP+W
Sbjct  82   TSSFTGEQTAVPNRNSVRGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGPSW  141

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            NVKLGRRD++TASLSAAN+G IP PT+ LN LI+RF   GLS RD+VALSGAHTIG+ARC
Sbjct  142  NVKLGRRDARTASLSAANNG-IPAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQARC  200

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR RIYN+TNIDSSFA+TR+  CPS TG GDNNLAPLD +T   FDNNY+K
Sbjct  201  TNFRTRIYNDTNIDSSFAQTRRSNCPS-TG-GDNNLAPLDLQTPTSFDNNYFK  251



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score =   365 bits (938),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/236 (76%), Positives = 200/236 (85%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLST+FYSKSCPKL  TVKS V+SA+ KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  21   GSSSAQLSTSFYSKSCPKLYQTVKSTVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NSVRGF VID+IKSAVEK CPGVVSCADI+ + ARDSVV+LGGP
Sbjct  81   DDTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAVTARDSVVILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVKLGRRD++TAS  AANS  IP PT  LN LI+ F   GLS +DMVALSG+HTIG+A
Sbjct  141  NWNVKLGRRDARTASQGAANSS-IPAPTFNLNRLISSFSAVGLSTKDMVALSGSHTIGQA  199

Query  629  RCTVFRRRIYNETN-IDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETN IDSSFA+TRQ +CP  +GSGDNNLAPLD +T + FDNNY+K
Sbjct  200  RCTTFRARIYNETNSIDSSFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFK  255



>ref|XP_010045401.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score =   365 bits (937),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 200/235 (85%), Gaps = 2/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS SAQLSTNFYSKSCP  L+TVKSVV+SAV+KE+RMGASLLRL FHDCFV GCDGSILL
Sbjct  22   GSASAQLSTNFYSKSCPNGLSTVKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTA PNN S+RG+NVID IKS VE  CPGVVSCADIV IAARDSVVLLGGP
Sbjct  82   DDTSSFQGEKTARPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRD++TAS S ANSG +PPPT+TL+NLI+ FQ +GLS RDMVALSG+HTIG+A
Sbjct  142  SWEVKLGRRDARTASFSLANSGALPPPTSTLSNLISLFQAQGLSTRDMVALSGSHTIGQA  201

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN++NIDS+F KTRQ  CP   GSGDNN APLD ++   FDN Y+K
Sbjct  202  RCTSFRPHIYNDSNIDSAFRKTRQGQCP--FGSGDNNPAPLDLRSPTAFDNAYFK  254



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   365 bits (936),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV+S VKSAVN E RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSTSCPNLLSTVQSAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IKSAVEK CPGVVSCADI+ IAARDSVV+LGGPNWNV
Sbjct  88   SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  148  KVGRRDARTASQAAANSN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTN  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA TRQ+TCP  TGSGD NLAPLD  T A FDNNY+K
Sbjct  207  FRARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFK  257



>gb|KHN46282.1| Peroxidase 4 [Glycine soja]
Length=330

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 200/234 (85%), Gaps = 0/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ++SA LS NFYSK+CP +  TVKSVVKSAV KE R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  30   TSSATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLD  89

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT +F GEKTA  NNNSVRG+ +ID IKS VEK+CPGVVSCADI+ IA+RDSVVLLGGP 
Sbjct  90   DTPTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPF  149

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNV+LGRRDS++A+ +AAN+GVIPPPT+ L NLITRFQ++GLSARDMVALSGAHT GKAR
Sbjct  150  WNVRLGRRDSRSANFTAANTGVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKAR  209

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYN+TNID +FA  RQ+ CP   G+GDNNLA LDF+T   FDNNY+K
Sbjct  210  CTSFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFK  263



>ref|XP_003538328.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=329

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 200/234 (85%), Gaps = 0/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ++SA LS NFYSK+CP +  TVKSVVKSAV KE R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  29   TSSATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLD  88

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT +F GEKTA  NNNSVRG+ +ID IKS VEK+CPGVVSCADI+ IA+RDSVVLLGGP 
Sbjct  89   DTPTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPF  148

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNV+LGRRDS++A+ +AAN+GVIPPPT+ L NLITRFQ++GLSARDMVALSGAHT GKAR
Sbjct  149  WNVRLGRRDSRSANFTAANTGVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKAR  208

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYN+TNID +FA  RQ+ CP   G+GDNNLA LDF+T   FDNNY+K
Sbjct  209  CTSFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFK  262



>gb|EYU20115.1| hypothetical protein MIMGU_mgv1a025851mg [Erythranthe guttata]
Length=318

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 203/235 (86%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLST++YSKSCP L  TVK+VV+SA+  E RMGASLLRL FHDCFV GCDGSILL
Sbjct  16   GSSSAQLSTDYYSKSCPNLFTTVKTVVRSAIQNEARMGASLLRLFFHDCFVNGCDGSILL  75

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PN NSVRGFN++D+IKSAVEKVCP VVSCADI+ +A+RDSVV+LGGP
Sbjct  76   DDTSSFTGEKTALPNRNSVRGFNIVDNIKSAVEKVCPNVVSCADILAVASRDSVVILGGP  135

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDS+TASL+AAN+  IPPPT+ LN LI+ F + GLS +D+V LSG+HTIG+A
Sbjct  136  DWKVKLGRRDSRTASLAAANNS-IPPPTSNLNTLISSFNSLGLSTKDLVVLSGSHTIGQA  194

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETN+D+SFA+TR+  CP   G+GDNNLAPLD +T A FDNNY+K
Sbjct  195  RCTSFRARIYNETNLDASFAQTRRGNCPRAAGAGDNNLAPLDVQTPANFDNNYFK  249



>gb|ACU24215.1| unknown [Glycine max]
Length=329

 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 200/234 (85%), Gaps = 0/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ++SA LS NFYSK+CP +  TVKSVVKSAV KE R+GAS++RL FHDCFVQGCDGSILLD
Sbjct  29   TSSATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLD  88

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT +F GEKTA  NNNSVRG+ +ID IKS VEK+CPGVVSCADI+ IA+RDSVVLLGGP 
Sbjct  89   DTPTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPF  148

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNV+LGRRDS++A+ +AAN+GVIPPPT+ L NLITRFQ++GLSARDMVALSGAHT GKAR
Sbjct  149  WNVRLGRRDSRSANFTAANTGVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKAR  208

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYN+TNID +FA  RQ+ CP   G+GDNNLA LDF+T   FDNNY+K
Sbjct  209  CTSFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFK  262



>ref|XP_011008654.1| PREDICTED: peroxidase P7 [Populus euphratica]
Length=322

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS++AQLST+FYSKSCP L +TVK VV+SA+NKE R+GAS+LRL FHDCFV GCDGS+LL
Sbjct  22   GSSNAQLSTDFYSKSCPHLFSTVKPVVQSAINKEARIGASILRLFFHDCFVNGCDGSLLL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF VID+IKSAVEK CPGVVSCAD++ IAARDS V+LGGP
Sbjct  82   DDTSSFTGEKNAAPNRNSARGFEVIDNIKSAVEKACPGVVSCADVLAIAARDSTVILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD++TAS +AAN+  IPPPT+ LN LI+RF   GLS RDMVALSG+HTIG+A
Sbjct  142  QWNVKLGRRDARTASQAAANNS-IPPPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET IDSS A+TR+  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  201  RCTNFRARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYK  255



>ref|XP_011080818.1| PREDICTED: uncharacterized protein LOC105163979 [Sesamum indicum]
Length=700

 Score =   375 bits (964),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = +2

Query  152  TVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFTGEKTAGPNNNSVRG  331
            T  SVVK A+ KEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF GEKTAGPNNNSVRG
Sbjct  420  TGSSVVKDAIAKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFRGEKTAGPNNNSVRG  479

Query  332  FNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVKLGRRDSKTASLSAANS  511
            F+V+D IKS VE VCPGVVSC+DI+ IAARDSVVLLGGPNWNVKLGRRDSKTASLSAANS
Sbjct  480  FDVVDDIKSEVESVCPGVVSCSDILAIAARDSVVLLGGPNWNVKLGRRDSKTASLSAANS  539

Query  512  GVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVFRRRIYNETNIDSSFAK  691
            GVIPPPT+TLNNL+ RFQ +GLS +DMV LSGAHTIG+ARCT+FR R+YNETNID+SFA+
Sbjct  540  GVIPPPTSTLNNLVNRFQARGLSTKDMVVLSGAHTIGQARCTLFRDRVYNETNIDTSFAR  599

Query  692  TRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            TRQ  CP  +GSGDNNLAPLD K+  FFDN+YYK
Sbjct  600  TRQTNCPRNSGSGDNNLAPLDHKSPTFFDNSYYK  633


 Score =   315 bits (807),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 187/232 (81%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            +AQLSTN YS SCP+ L T+K+ V  AV KE+RM ASLLRLHFHDCFV GCD S+LLDDT
Sbjct  139  TAQLSTNHYSTSCPRALFTIKAGVLKAVAKERRMAASLLRLHFHDCFVNGCDASVLLDDT  198

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            SSFTGEKTAGPNNNS+RGF VIDSIKS +E +CPGVVSCADI+ ++ARDSV  +GGP W 
Sbjct  199  SSFTGEKTAGPNNNSLRGFEVIDSIKSELESLCPGVVSCADILAVSARDSVAAVGGPFWA  258

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V LGRRDS TASL AAN+  IP P   L++LI+ F NKG SA++MVALSGAHTIG+ARC 
Sbjct  259  VPLGRRDSTTASLDAANTD-IPSPVMDLSDLISAFSNKGFSAKEMVALSGAHTIGQARCV  317

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            VFR RIYNE+NI +SFA + +  CPS +GS D++L+P+D  T   FDN+Y+K
Sbjct  318  VFRDRIYNESNIFASFATSLKSNCPS-SGS-DDSLSPIDATTPGSFDNSYFK  367



>ref|XP_006288218.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
 gb|EOA21116.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
Length=324

 Score =   363 bits (932),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 199/231 (86%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFY+ SCP LL+TV++ VKSAVN E+RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYATSCPNLLSTVQAAVKSAVNSERRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IKSAVEK CPGVVSCADI+ IAARDSVV+LGGPNWNV
Sbjct  88   SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  148  KVGRRDARTASQAAANSN-IPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTS  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA TRQ+TCP  TGSGD NLAPLD  T A FDNNY+K
Sbjct  207  FRARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFK  257



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   362 bits (930),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 176/236 (75%), Positives = 199/236 (84%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLST FYSKSCPKL  TVKS V+SA+ KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  20   GNSSAQLSTGFYSKSCPKLYQTVKSAVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF VID+IKSAVEKVCPGVVSCADI+ + ARDSVV+LGGP
Sbjct  80   DDTSSFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVKLGRRD++TAS +AAN   IPPPT+ LN LI+ F   GLS +DMVALSGAHTIG+A
Sbjct  140  NWNVKLGRRDARTASQAAANRS-IPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQA  198

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET N+D+SFA+TRQ  CP  +GSGDN+LAPLD +T   FDNNY+K
Sbjct  199  RCTTFRARIYNETNNLDASFARTRQSNCPRSSGSGDNSLAPLDLQTPNKFDNNYFK  254



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score =   362 bits (929),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLSTNFY  SCP L ++VKS V+SA++KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  20   GSANAQLSTNFYYHSCPNLFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF VID+IKSAVEKVCPGVVSCADI+ IAARDSV +LGGP
Sbjct  80   DDTSSFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD++TAS SAAN+G IP PT+ LN LI+RF   GLS +D+VALSG HTIG+A
Sbjct  140  TWNVKLGRRDARTASQSAANNG-IPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNI+++FA+TRQQ+CP  +GSGDNNLAPLD +T   FDN Y+K
Sbjct  199  RCTNFRARIYNETNIETAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFK  253



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score =   362 bits (929),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 197/235 (84%), Gaps = 2/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQL+T FYSKSCPKL  TVKSVV SA+ KE RMGASLLRL FHDCFV GCDGS+ L
Sbjct  18   GSSSAQLTTGFYSKSCPKLYETVKSVVHSAIQKETRMGASLLRLFFHDCFVNGCDGSLFL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEK A PN NS RGF VID IKSAVEKVCPGVVSCADI+ + ARDSVV+LGGP
Sbjct  78   DDTSTFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW+VKLGRRD++TAS +AANS  IPPPT+ LN LI+ F   GLS +DMVALSGAHTIG+A
Sbjct  138  NWDVKLGRRDARTASQAAANSS-IPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQA  196

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNET N+DSS AKTRQ  CP  +GSGDNNLAPLD +T  +FDN+Y+
Sbjct  197  RCTSFRARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYF  251



>ref|XP_006376028.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|ERP53825.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|AHL39175.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   362 bits (928),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS++AQLS +FYSKSCP LL+TVK VV+SA+NKE RMGAS+LRL FHDCFV GCDGS+LL
Sbjct  22   GSSNAQLSIDFYSKSCPHLLSTVKPVVQSAINKEARMGASILRLFFHDCFVNGCDGSLLL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF VID+IKSAVEK CPGVVSCADI+ IAARDS V+LGGP
Sbjct  82   DDTSSFTGEKNAAPNKNSARGFEVIDNIKSAVEKACPGVVSCADILAIAARDSTVILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRD++TAS +AAN+  IP PT+ LN LI+RF   GLS RDMVALSG+HTIG+A
Sbjct  142  EWDVKLGRRDARTASQAAANNS-IPRPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET IDSS A+TR+  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  201  RCTNFRARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYK  255



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS++AQL+TNFYSKSCP LL TV SVV+SA+NKE RMGASLLRL FHDCFV GCDGSILL
Sbjct  22   GSSNAQLTTNFYSKSCPNLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PN+ SVRGF VID IKSAVEK CPGVVSCADI+TI ARDSVV+LGGP
Sbjct  82   DDTSSFTGEKTALPNSGSVRGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD++TAS +AAN+  IP P  +L+ L++ F N+GLS  DMVAL+G HTIG+A
Sbjct  142  TWNVKLGRRDARTASRTAANNN-IPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNE+NID+SFAKTRQ  CP  + SG NNLAPLD +T   FDN YYK
Sbjct  201  RCTSFRTRIYNESNIDASFAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYK  255



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  +AQLSTNFY  SCPKLL+TVKS ++SA++KE R+GASLLRL FHDCFV GCDGSILL
Sbjct  20   GCANAQLSTNFYYTSCPKLLSTVKSSMQSAISKETRIGASLLRLFFHDCFVNGCDGSILL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RG+ VIDSIKSAVEKVCPGVVSCADI+ IAARDSV +LGGP
Sbjct  80   DDTSSFTGEKNANPNRNSARGYEVIDSIKSAVEKVCPGVVSCADILAIAARDSVGILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRD++TAS SAANS  IPPPT+ LN LI++F   GLS +DMVALSG HTIG++
Sbjct  140  TWDVKLGRRDARTASQSAANSA-IPPPTSNLNQLISKFSAVGLSTKDMVALSGGHTIGQS  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNE+NID+SFA+TRQ +CP  +GSGDNNLAPLD +T   FDN Y+K
Sbjct  199  RCTSFRARIYNESNIDTSFARTRQSSCPRTSGSGDNNLAPLDLQTPTSFDNYYFK  253



>ref|XP_004172441.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFY K+CPKLL TV++ + SAV KE RMGASLLRLHFHDCFV GCDGSILL
Sbjct  15   GSSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILL  74

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            +DT +FTGE+TA PNN SVRGF+VI+SIK  VEK+CPGVVSCADI+T++ARDSVV+LGGP
Sbjct  75   EDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGP  134

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTAS S   +G IPPPT+TL+ LI RF  KGLS RD+VALSGAHTIG+A
Sbjct  135  SWKVKLGRRDSKTASFSDV-TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQA  193

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  F+ RIYNETNID SFA+ RQ+TCP  T  GD+N APLDFKT   FDN YYK
Sbjct  194  RCLFFKNRIYNETNIDESFAEERQRTCP--TNGGDDNRAPLDFKTPKLFDNYYYK  246



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score =   361 bits (927),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV++ VKSAVN E RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNV
Sbjct  88   SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  148  KVGRRDARTASQAAANSN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTN  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA TRQ+TCP  +GSGD NLAPLD  T A FDNNY+K
Sbjct  207  FRARIYNETNINAAFATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFK  257



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 196/234 (84%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            +T+AQLST FYS SCPKL +TVKS V SA+ KE RMGASLLRLHFHDCFV GCDGS+LLD
Sbjct  20   TTNAQLSTKFYSSSCPKLFSTVKSTVHSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLD  79

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A PN NS RGFNV+D IKSAVE  CPGVVSCADI+ IAAR+SV +LGGP+
Sbjct  80   DTSSFTGEKNAVPNKNSARGFNVVDKIKSAVENACPGVVSCADILAIAARESVTVLGGPS  139

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VKLGRRD++TAS +AAN+  IPPPT  LN L++ F   GLS RD+VALSG+HTIG+AR
Sbjct  140  WDVKLGRRDTRTASQAAANNS-IPPPTRNLNQLVSTFNALGLSTRDLVALSGSHTIGQAR  198

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYNETN+DSS A+TRQ  CP  +GSGDNNLAPLD K+  FFDN+Y+K
Sbjct  199  CTTFRPRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTFFDNSYFK  252



>ref|XP_009363847.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
 ref|XP_009363901.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 196/234 (84%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            +T+AQLST FYS SCPKL +TVKS V+SA+ KE RMGASLLRLHFHDCFV GCDGS+LLD
Sbjct  20   TTNAQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLD  79

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A PN NS RGFNV+D IK AVE VCPGVVSCADI+ IAARDSV +LGGP+
Sbjct  80   DTSSFTGEKNAVPNKNSARGFNVVDKIKFAVENVCPGVVSCADILAIAARDSVTILGGPS  139

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VKLGRRD++TAS +AAN+  IPPPT  LN LI+ F   GLS RD+VALSG+HTIG+AR
Sbjct  140  WDVKLGRRDTRTASQAAANNS-IPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQAR  198

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR R+YNETN+DSS AKTRQ  CP  +GSGDNNLAPLD K+   FDN+Y+K
Sbjct  199  CTTFRPRVYNETNLDSSLAKTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFK  252



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 196/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GST+AQLSTNFY+ +C  LL TVKSVV+SAV+KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  19   GSTNAQLSTNFYANTCKNLLPTVKSVVQSAVSKEARMGASLLRLFFHDCFVNGCDGSVLL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF VID+IKSAVEK CPG VSCADI+ I ARDSVVLLGGP
Sbjct  79   DDTSSFTGEKNAVPNRNSARGFEVIDNIKSAVEKACPGAVSCADILAITARDSVVLLGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDS+TAS SAANSG IPPPT+ LN L +RF   GLS +D+VAL+G HTIG+A
Sbjct  139  SWEVKLGRRDSRTASQSAANSG-IPPPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQA  197

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYNETNID+SFA+TRQ  CP   G+GDNNLAPLD +T   FDNNY+K
Sbjct  198  RCTSFRAHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTSFDNNYFK  252



>gb|KGN47222.1| hypothetical protein Csa_6G216410 [Cucumis sativus]
Length=302

 Score =   360 bits (923),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFY K+CPKLL TV++ + SAV KE RMGASLLRLHFHDCFV GCDGSILL
Sbjct  4    GSSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILL  63

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            +DT +FTGE+TA PNN SVRGF+VI+SIK  VEK+CPGVVSCADI+T++ARDSVV+LGGP
Sbjct  64   EDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGP  123

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTAS S   +G IPPPT+TL+ LI RF  KGLS RD+VALSGAHTIG+A
Sbjct  124  SWKVKLGRRDSKTASFSDV-TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQA  182

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  F+ RIYNETNID SFA+ RQ+TCP  T  GD+N APLDF+T   FDN YYK
Sbjct  183  RCLFFKNRIYNETNIDESFAEERQRTCP--TNGGDDNRAPLDFRTPKLFDNYYYK  235



>ref|XP_007219210.1| hypothetical protein PRUPE_ppa017309mg, partial [Prunus persica]
 gb|EMJ20409.1| hypothetical protein PRUPE_ppa017309mg, partial [Prunus persica]
Length=291

 Score =   359 bits (921),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 200/233 (86%), Gaps = 1/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            ++AQLSTNFYS SCP++ +TV+S V+SA+ KE R+GASLLRLHFHDCFV GCDGS+LLDD
Sbjct  21   SNAQLSTNFYSSSCPRVFSTVRSTVQSAIRKEARIGASLLRLHFHDCFVNGCDGSLLLDD  80

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSFTGEK A PN NS RGF+V+D+IKSAVE VCPGVVSCADI+ IA+RDSV +LGGP+W
Sbjct  81   TSSFTGEKNAVPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIASRDSVAILGGPSW  140

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            NVK+GRRD++TAS +AAN+G IPPPT+ LN LI+RF   GLS RD+VALSG+HTIG++RC
Sbjct  141  NVKVGRRDARTASQAAANNG-IPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRC  199

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
              FR RIYNETN+DSSFA+TR+  CP   GSGDNNLAPLD +T   FDNNY+K
Sbjct  200  IQFRPRIYNETNLDSSFAQTRRSNCPRAAGSGDNNLAPLDLQTPTAFDNNYFK  252



>ref|XP_004149366.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFY K+CPKLL TV++ + SAV KE RMGASLLRLHFHDCFV GCDGSILL
Sbjct  15   GSSSAQLSTNFYYKTCPKLLNTVRAGIHSAVAKEARMGASLLRLHFHDCFVNGCDGSILL  74

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            +DT +FTGE+TA PNN SVRGF+VI+SIK  VEK+CPGVVSCADI+T++ARDSVV+LGGP
Sbjct  75   EDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGP  134

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTAS S   +G IPPPT+TL+ LI RF  KGLS RD+VALSGAHTIG+A
Sbjct  135  SWKVKLGRRDSKTASFSDV-TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQA  193

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  F+ RIYNETNID SFA+ RQ+TCP  T  GD+N APLDF+T   FDN YYK
Sbjct  194  RCLFFKNRIYNETNIDESFAEERQRTCP--TNGGDDNRAPLDFRTPKLFDNYYYK  246



>ref|XP_009606349.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   360 bits (923),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 196/235 (83%), Gaps = 2/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQL+T FYSKSCPKL  TVKSVV SAV KE RMGASLLRL FHDCFV GCDGS+ L
Sbjct  18   GSSSAQLTTGFYSKSCPKLYETVKSVVHSAVQKETRMGASLLRLFFHDCFVNGCDGSLFL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DD S+FTGEK A PN NS RGF VID IKSAVEKVCPGVVSCADI+ + ARDSVV+LGGP
Sbjct  78   DDISTFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW+VKLGRRD++TAS +AANS  IPPPT+ LN LI+ F   GLS +DMVALSGAHTIG+A
Sbjct  138  NWDVKLGRRDARTASQAAANSS-IPPPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQA  196

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNET N+DSS AKTRQ  CP  +GSGDNNLAPLD +T  +FDN+Y+
Sbjct  197  RCTSFRARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYF  251



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score =   360 bits (923),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLSTNFY  SCP L ++VKS V+SA++KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  20   GSANAQLSTNFYYHSCPNLFSSVKSAVQSAISKETRMGASLLRLFFHDCFVNGCDGSILL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF VID+IKSAVEKVCPGVVSCADI+ IAARDSV +LGGP
Sbjct  80   DDTSSFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD++TAS SAAN+G IP PT+ LN LI+RF   GLS +D+VALSG HTIG+A
Sbjct  140  TWNVKLGRRDARTASQSAANNG-IPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNI ++FA+TRQQ+CP  +GSGDNNLAPLD +T   FDN Y+K
Sbjct  199  RCTNFRARIYNETNIGTAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFK  253



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   360 bits (923),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 196/234 (84%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            +T+AQLST FYS SCPKL +TVKS V+SA+ KE R GASLLRLHFHDCFV GCDGS+LLD
Sbjct  20   TTNAQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRTGASLLRLHFHDCFVNGCDGSLLLD  79

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A PN NS RGFNV+D IKSAVE VCPGVVSCADI+ IAARDSV +LGGP+
Sbjct  80   DTSSFTGEKNAVPNKNSARGFNVVDKIKSAVENVCPGVVSCADILAIAARDSVTILGGPS  139

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VKLGRRD++TAS +AAN+  IPPPT  LN LI+ F   GLS RD+VALSG+HTIG+AR
Sbjct  140  WDVKLGRRDTRTASQAAANNS-IPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQAR  198

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYNETN+DSS A+TRQ  CP  +GSGDNNLAPLD K+   FDN+Y+K
Sbjct  199  CTTFRPRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFK  252



>ref|XP_010491069.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 195/231 (84%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV++ VKSAV  E RMG S+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNV
Sbjct  88   SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG+ARCT 
Sbjct  148  KVGRRDARTASQAAANSN-IPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQARCTS  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA TRQ+TCP  TGSGD NLAPLD  T A FDNNY+K
Sbjct  207  FRARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFK  257



>gb|ABV24960.2| putative secretory peroxidase [Catharanthus roseus]
Length=330

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 200/234 (85%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S S QLS+ FYSK+CP++  TV+  V+SAV+KEKRMGASLLRLHFHDCFVQGCDGSILLD
Sbjct  31   SCSGQLSSEFYSKTCPQVYNTVRKGVESAVSKEKRMGASLLRLHFHDCFVQGCDGSILLD  90

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSS  GEKTAGPN  SVRGF+V+D+IKS VEKVCPGVVSCADI+ IAARDSVV LGGP+
Sbjct  91   DTSSLRGEKTAGPNVGSVRGFDVVDNIKSDVEKVCPGVVSCADILAIAARDSVVALGGPS  150

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VK+GRRDSKTASLS ANS  IPPPT+ L NLI+ FQ  GLSA+DMV LSG+HTIG+AR
Sbjct  151  WKVKVGRRDSKTASLSGANS-RIPPPTSNLRNLISSFQAVGLSAKDMVVLSGSHTIGQAR  209

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CTVFR RIYNE+NI++SFA+TRQ  CP  TG+GDN+LAPLD ++   FD NYYK
Sbjct  210  CTVFRARIYNESNIETSFARTRQGNCPLPTGNGDNSLAPLDLQSPNGFDINYYK  263



>ref|XP_011076613.1| PREDICTED: peroxidase P7 [Sesamum indicum]
Length=321

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S+SAQLS +FYSKSCP L ATVKSVV SAV  E RMGASLLRL FHDCFV GCDGSILLD
Sbjct  22   SSSAQLSPDFYSKSCPNLFATVKSVVHSAVQNEARMGASLLRLFFHDCFVNGCDGSILLD  81

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A PN NS RGF+V+D IKSAVEK CPGVVSCAD++ IAARDSVV+LGGP+
Sbjct  82   DTSSFTGEKGAVPNRNSARGFDVVDQIKSAVEKACPGVVSCADVLAIAARDSVVILGGPD  141

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNVKLGRRD+KTAS +AAN+G IPPPT+ LN LI+RF   GLS +D+VALSG+HTIG+AR
Sbjct  142  WNVKLGRRDAKTASRAAANNG-IPPPTSNLNALISRFNALGLSTKDLVALSGSHTIGQAR  200

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYNE+N+D+S A+TR+  CP  +G GDNNLAPLD +T   FDNNY+K
Sbjct  201  CTSFRARIYNESNLDTSLAQTRKGNCPRASGVGDNNLAPLDLQTPTNFDNNYFK  254



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 200/234 (85%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ++SAQL+ NFYS SCP L  T+KSVV+SA++ EKRMGASLLRL FHDCFV GCDGS+LLD
Sbjct  21   ASSAQLTPNFYSSSCPTLFPTIKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLLLD  80

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A PN  SVRGF+VID IK+AVE+ CPGVVSCADI+ + ARDSVVLLGGP 
Sbjct  81   DTSSFTGEKNAIPNKGSVRGFDVIDKIKTAVEQACPGVVSCADILAVTARDSVVLLGGPT  140

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNVKLGRRDS+TAS S AN+  IPPPT++L+NLI++F  +GLSA++MVAL GAHTIG+AR
Sbjct  141  WNVKLGRRDSRTASQSGANNN-IPPPTSSLSNLISKFSAQGLSAKEMVALVGAHTIGQAR  199

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR  +YN+T+ID++FAKTRQ  CPS +GSGDNNLAPLD +T   FDNNY+K
Sbjct  200  CTNFRAHVYNDTDIDATFAKTRQSNCPSTSGSGDNNLAPLDLQTPVAFDNNYFK  253



>gb|AAL93151.1|AF485265_1 class III peroxidase [Gossypium hirsutum]
Length=320

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQLSTNFYSKSCPK+L+TV+ VV++AV+KE+R+GASLLRL FHDCFV GCDGS+LLDDTS
Sbjct  23   AQLSTNFYSKSCPKVLSTVELVVETAVSKEQRLGASLLRLFFHDCFVNGCDGSVLLDDTS  82

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+TA PNN S+RGF V+D IK+ VEKVCPGVVSCADI+ IAARDSVV+LGGP+W+V
Sbjct  83   SFTGEQTATPNNGSLRGFEVVDEIKAKVEKVCPGVVSCADILAIAARDSVVILGGPDWDV  142

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRDSKTAS S ANSGV+P  +A L+ LI+ FQ +GLS +DMVALSGAHTIGKARC V
Sbjct  143  KLGRRDSKTASFSDANSGVLPLGSANLSQLISLFQAQGLSTKDMVALSGAHTIGKARCLV  202

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYN+T ID+SFAKTR+ +CP   GSGDNNLAPLD  T   FD+ Y++
Sbjct  203  FRNRIYNDTIIDTSFAKTRRSSCPRTRGSGDNNLAPLDLATPNSFDSKYFE  253



>ref|XP_011080739.1| PREDICTED: peroxidase 4-like [Sesamum indicum]
Length=328

 Score =   359 bits (921),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 193/235 (82%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+S  LST+FY KSCP + + VKSVVKSAV +EKRMGASLLRLHFHDCFVQGCD SILL
Sbjct  27   GSSSTHLSTDFYDKSCPTVFSIVKSVVKSAVMEEKRMGASLLRLHFHDCFVQGCDASILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GEKTAG NNNSVRG+ VID IKS VE VCPG+VSCADIVTIAARDSVV LGGP
Sbjct  87   DDTPTFKGEKTAGGNNNSVRGYEVIDHIKSKVEAVCPGIVSCADIVTIAARDSVVFLGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW V +GRRDSKTASL AANSGV+P P + L+ LI +FQ++GLS  D+VALSG HTIGKA
Sbjct  147  NWKVTVGRRDSKTASLEAANSGVLPGPDSNLSTLIQKFQDQGLSPTDLVALSGTHTIGKA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC VFR RIYN+T ID+SFAK RQ+ CP  +G GD+N APLD KT   FD  Y+K
Sbjct  207  RCVVFRERIYNDTIIDASFAKKRQRRCPRNSGLGDDNFAPLDNKTPKIFDTAYFK  261



>gb|AIE12239.1| peroxide [Momordica charantia]
Length=324

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 197/235 (84%), Gaps = 2/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLST FYSK+CP LL+TV++ V+SA+ KE R+GASLLRLHFHDCFV GCDGSILL
Sbjct  26   GSSSAQLSTTFYSKTCPNLLSTVRAGVRSAIAKEARIGASLLRLHFHDCFVNGCDGSILL  85

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GE+TA PNN SVRGF+VI  IKS+VEKVCP VVSCADI+T+ +RDSVV+LGGP
Sbjct  86   DDTPTFMGEQTAPPNNRSVRGFDVIKDIKSSVEKVCPSVVSCADILTLTSRDSVVILGGP  145

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKT S SAA+SGVIPPPT+TL+NLI RF   GLS +DMVALSGAHTIG+A
Sbjct  146  SWEVKLGRRDSKTVSFSAASSGVIPPPTSTLSNLINRFNAVGLSTKDMVALSGAHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYNE+NID+SFAK RQ+ CP     GD+NLAPLD  T   FDN YYK
Sbjct  206  RCVSFRNRIYNESNIDASFAKLRQRNCPRS--GGDDNLAPLDVVTPKLFDNYYYK  258



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 197/234 (84%), Gaps = 1/234 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+++AQLSTNFYS SCP LL+TVKSVV+SAVN E RMGASLLRL FHDCFV GCDGS+LL
Sbjct  23   GNSNAQLSTNFYSSSCPNLLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVLL  82

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN  S+RGF+V+D IK+AVEK CPGVVSCADI+ I+ARDSVV+LGGP
Sbjct  83   DDTSSFTGEKNAFPNAGSLRGFDVVDQIKTAVEKACPGVVSCADILAISARDSVVILGGP  142

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD+ TAS SAAN+  IP PTA+L+ LI  F ++GLS  DMVALSGAHTIG+A
Sbjct  143  TWNVKLGRRDATTASQSAANTN-IPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIGQA  201

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNE+NID+SFAKTRQ  CPS + SG NNLAPLD +T   FDN YY
Sbjct  202  RCTTFRTRIYNESNIDASFAKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYY  255



>gb|KFK24955.1| hypothetical protein AALP_AA8G047500 [Arabis alpina]
Length=324

 Score =   358 bits (919),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 196/231 (85%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV++ VKSAV  E RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSTSCPNLLSTVQTAVKSAVKSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IK+AVEK CPGVVSCAD++ IAARDSVV LGGPNWNV
Sbjct  88   SFTGEQNAAPNRNSARGFNVIDNIKAAVEKACPGVVSCADVLAIAARDSVVALGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  148  KVGRRDARTASQAAANSN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTN  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA TRQ+TCP  TGSGD NLAPLD  T A FDNNY+K
Sbjct  207  FRTRIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVATPASFDNNYFK  257



>ref|XP_004978553.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=355

 Score =   359 bits (922),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 196/234 (84%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ++SAQLST FYS SCP + + VKSVV+SA++KEKRMGAS++RL FHDCFVQGCDGS+LLD
Sbjct  56   TSSAQLSTGFYSSSCPGVYSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDGSLLLD  115

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT SF GEK A PNN SVRGF VID+IKSAVEKVCPGVVSCADI+ IAARDSVV+LGGPN
Sbjct  116  DTPSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPN  175

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNVK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG AR
Sbjct  176  WNVKVGRRDSMTASFSGANNS-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLAR  234

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR  +YNETNID + A+TRQ  CPS +G+GDNNLAPLD +T   F+NNYYK
Sbjct  235  CTNFRAHVYNETNIDGALARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENNYYK  288



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   358 bits (918),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 195/231 (84%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV++ VKSAV  E RMG S+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNV
Sbjct  88   SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  148  KVGRRDARTASQAAANSN-IPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTS  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA TRQ+TCP  TGSGD NLAPLD  T A FDNNY+K
Sbjct  207  FRARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFK  257



>ref|XP_004977588.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=321

 Score =   358 bits (918),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLST FYS SCP + + VKSVV+SA++KEKRMGAS++RL FHDCFVQGCD S+LL
Sbjct  21   GTSSAQLSTGFYSSSCPGVSSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDASLLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEK A PNN SVRGF VID+IKSAVEKVCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  81   DDTPSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG A
Sbjct  141  NWNVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  +YNETNID +FA+TRQ  CPS +G+GDNNLAPLD +T   F+NNYY+
Sbjct  200  RCTNFRAHVYNETNIDGAFARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENNYYR  254



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   357 bits (917),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
             ++SAQLSTNFYS SCP++ + V+S V+SA+  E R+GASLLRLHFHDCFV GCDGS+LL
Sbjct  19   ATSSAQLSTNFYSSSCPRVFSAVRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLLL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF+V+D+IKSAVE VCPGVVSCADI+ IAARDSV +LGGP
Sbjct  79   DDTSSFTGEKNAVPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVAILGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRD++TAS +AAN+  IPPPT+ LN LI+RF   GLS RD+VALSG+HTIG++
Sbjct  139  SWNVKLGRRDARTASQAAANNN-IPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQS  197

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYNETN+DSSFA+TR+  CP  +GSGDNNLAPLD +T   FDNNY+K
Sbjct  198  RCIQFRPRIYNETNLDSSFAQTRRSNCPRASGSGDNNLAPLDLQTPTAFDNNYFK  252



>ref|XP_004307713.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=323

 Score =   357 bits (917),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 199/235 (85%), Gaps = 2/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+++AQLS+NFYSKSCP+L + VKS V+ A+  E RMGAS+LRLHFHDCFV GCDGS+LL
Sbjct  21   GTSTAQLSSNFYSKSCPRLFSIVKSTVQPAIRNEPRMGASILRLHFHDCFVNGCDGSVLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEK A PN NS+RGFNVID+IKSAVE VCPGVVSCADI+ I ARDSV +LGGP
Sbjct  81   DDTANFTGEKNAVPNKNSLRGFNVIDNIKSAVENVCPGVVSCADILAITARDSVAILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRD++TAS +AAN+  IPPPT+ LN LI+RF   GLS +DMVALSG+HTIG+A
Sbjct  141  SWNVKLGRRDARTASQAAANNS-IPPPTSNLNQLISRFNALGLSTKDMVALSGSHTIGQA  199

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR R+YNET N+DSS A+TRQ  CP  TGSGDNNLAPLD ++   FDNNYY
Sbjct  200  RCTSFRARVYNETNNLDSSLAQTRQSNCPRTTGSGDNNLAPLDLQSPTAFDNNYY  254



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   357 bits (916),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = +2

Query  107  LSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF  286
            L TNFY  SCPKL  TVK  V+SA++KE RMGASLLRL FHDCFV GCDGSILLDDTSSF
Sbjct  30   LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  89

Query  287  TGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVKL  466
            TGEK AGPN NS RGF VID IKSAVEKVCPGVVSCADI+ IAARDSV +LGGP W+VKL
Sbjct  90   TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILGGPTWDVKL  149

Query  467  GRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVFR  646
            GRRDS+TAS SAAN+  IP PT+ LN LI+RF   GLS +D+VALSG HTIG+ARCT FR
Sbjct  150  GRRDSRTASQSAANND-IPRPTSNLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFR  208

Query  647  RRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             RIYNETNIDSSFA+ RQ  CP  +GSGDNNLAP+DF T  FFDN+Y+K
Sbjct  209  ARIYNETNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPRFFDNHYFK  257



>ref|XP_008244444.1| PREDICTED: peroxidase 4-like [Prunus mume]
Length=322

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 199/235 (85%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFYSKSCPK+   VKSVV+SAV KEKR+GASLLRLHFHDCFV+GCDGS+LL
Sbjct  23   GSSSAQLSTNFYSKSCPKVFHAVKSVVRSAVKKEKRIGASLLRLHFHDCFVKGCDGSVLL  82

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PNNNS+RGF V+D IKS VEK CPGVVSCADI+ IAARDSV +LGGP
Sbjct  83   DDTSSFTGEKTAAPNNNSLRGFKVVDKIKSKVEKRCPGVVSCADILAIAARDSVKILGGP  142

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTASL+AAN   +P PT+TL+ L T F+  GL+ RD+VALSGAHTIGKA
Sbjct  143  SWKVKLGRRDSKTASLAAANRS-LPAPTSTLSQLKTGFRAVGLNERDLVALSGAHTIGKA  201

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            +CT FR RIYNETNID+SFAK RQ+ CP    +GDNNLAPLD +T   FD  Y+K
Sbjct  202  KCTSFRVRIYNETNIDASFAKARQRKCPRT--AGDNNLAPLDVQTPHTFDTAYFK  254



>gb|AFV07575.1| putative peroxidase a2 [Solanum tuberosum]
Length=257

 Score =   354 bits (908),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 194/232 (84%), Gaps = 2/232 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLST+FYSKSCPKL  TVKS V+SA+ KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  21   GSSSAQLSTSFYSKSCPKLYQTVKSTVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NSVRGF VID+IKSAVEK CPGVVSCADI+ + ARDSVV+LGGP
Sbjct  81   DDTSSFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAVTARDSVVILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVKLGRRD++TAS  AANS  IP PT  LN LI+ F   GLS +DMVALSG+HTIG+A
Sbjct  141  NWNVKLGRRDARTASQGAANSS-IPAPTFNLNRLISSFSAVGLSTKDMVALSGSHTIGQA  199

Query  629  RCTVFRRRIYNETN-IDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDN  781
            RCT FR RIYNETN IDSSFA+ RQ +CP  +GSGDN LAPLD +T + FDN
Sbjct  200  RCTTFRARIYNETNSIDSSFARARQNSCPRNSGSGDNXLAPLDLQTPSKFDN  251



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 194/231 (84%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+T FYS SCP LL+TV++ VKSAV  E RMG S+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTTFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNV
Sbjct  88   SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  148  KVGRRDARTASQAAANSN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTS  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA TRQ+TCP  TGSGD NLAPLD  T A FDNNY+K
Sbjct  207  FRARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFK  257



>ref|XP_006595847.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=326

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = +2

Query  107  LSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF  286
            L TNFY  SCPKL  TVK  V+SA++KE RMGASLLRL FHDCFV GCDGSILLDDTSSF
Sbjct  32   LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  287  TGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVKL  466
            TGEK AGPN NS RGF VID IKSAVEKVCPGVVSCADI+ IAARDSV +L GP W+VKL
Sbjct  92   TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  467  GRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVFR  646
            GRRDS+TAS SAAN+G IP PT+ LN LI+RF   GLS +D+VALSG HTIG+ARCT FR
Sbjct  152  GRRDSRTASQSAANNG-IPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFR  210

Query  647  RRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             RIYNE+NIDSSFA+ RQ  CP  +GSGDNNLAP+DF T  FFDN+Y+K
Sbjct  211  ARIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFK  259



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 196/231 (85%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+ NFYS SCP LL+TV+S VKSAVN E RMGAS++RL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTPNFYSTSCPNLLSTVQSAVKSAVNSEARMGASIVRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IK+AVEK CPGVVSCADI+ IAARDSVV+LGGPNW V
Sbjct  88   SFTGEQNANPNRNSARGFNVIDNIKAAVEKACPGVVSCADILAIAARDSVVVLGGPNWTV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  148  KVGRRDARTASQAAANSN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTS  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA TRQ+TCP  +GSGD NLAPLD  T A FDNNY+K
Sbjct  207  FRTRIYNETNINAAFATTRQRTCPRTSGSGDGNLAPLDVTTAASFDNNYFK  257



>gb|ACU23245.1| unknown [Glycine max]
Length=326

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = +2

Query  107  LSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF  286
            L TNFY  SCPKL  TVK  V+SA++KE RMGASLLRL FHDCFV GCDGSILLDDTSSF
Sbjct  32   LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  287  TGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVKL  466
            TGEK AGPN NS RGF VID IKSAVEKVCPGVVSCADI+ IAARDSV +L GP W+VKL
Sbjct  92   TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  467  GRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVFR  646
            GRRDS+TAS SAAN+G IP PT+ LN LI+RF   GLS +D+VALSG HTIG+ARCT FR
Sbjct  152  GRRDSRTASQSAANNG-IPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFR  210

Query  647  RRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             RIYNE+NIDSSFA+ RQ  CP  +GSGDNNLAP+DF T  FFDN+Y+K
Sbjct  211  ARIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFK  259



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 197/234 (84%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            +  AQL+TNFYS SCP LL+TV+S ++SAVN+E R GAS+LRL FHDCFV GCDGSILLD
Sbjct  25   TVEAQLTTNFYSSSCPNLLSTVRSAMQSAVNREARAGASILRLFFHDCFVNGCDGSILLD  84

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTS+FTGEK A PN NS RGF+VID+IK+AVE+ CPGVVSCADI+ +AARD VVLLGGPN
Sbjct  85   DTSNFTGEKNANPNRNSARGFDVIDNIKTAVERACPGVVSCADILAVAARDGVVLLGGPN  144

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            WNVKLGRRD++TAS S ANS  IP PT++L+ LI+ F N GLS RDMVALSG HTIG+AR
Sbjct  145  WNVKLGRRDARTASQSGANSN-IPAPTSSLSQLISSFGNVGLSTRDMVALSGGHTIGQAR  203

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR RIYNETNI+S+FA TRQQTCP   GSGD NLAPLD +T A F+N+Y+K
Sbjct  204  CTSFRTRIYNETNINSAFATTRQQTCPRTAGSGDGNLAPLDIQTPANFNNDYFK  257



>gb|AFK41406.1| unknown [Lotus japonicus]
Length=322

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 201/236 (85%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLSTNFYS SCPKL +TVKS V+SA++KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  21   GSANAQLSTNFYSSSCPKLFSTVKSSVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF+VID+IKSAVE  CPGVVSCADI+ I+ARDSVV LGGP
Sbjct  81   DDTSSFTGEKNANPNRNSARGFDVIDNIKSAVEAACPGVVSCADILAISARDSVVSLGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVK+GRRD+KTAS SAAN+G IP PT++L+ L +RF   GLS++D+VALSGAHTIG+A
Sbjct  141  TWNVKVGRRDAKTASQSAANTG-IPAPTSSLSQLTSRFSALGLSSKDLVALSGAHTIGQA  199

Query  629  RCTVFRRRIYNETN-IDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET+ I+SSFA +R+  CPS +GSGDNNLAPLD +T   FDNNY+K
Sbjct  200  RCTSFRARIYNETSTIESSFATSRKSNCPSTSGSGDNNLAPLDLQTPTSFDNNYFK  255



>ref|XP_009402215.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=320

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GST+A+LST+FYS SCP+L +TVKSVV+SA++KEKR+GAS+LRL FHDCFV GCD S+LL
Sbjct  19   GSTAAELSTSFYSSSCPRLSSTVKSVVRSAISKEKRLGASILRLFFHDCFVLGCDASVLL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GEKTA PNNNS+RGF VID IK+AVEK CPGVVSCADI+ +A+RDSVV+LGGP
Sbjct  79   DDTPTFQGEKTAKPNNNSLRGFEVIDQIKNAVEKACPGVVSCADILAVASRDSVVILGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRDS+ AS S AN   IPPPT +L+ LI++F  KGLS +DMVALSGAHTIG+A
Sbjct  139  YWDVKLGRRDSRKASFSKANKD-IPPPTLSLSKLISKFSAKGLSTKDMVALSGAHTIGQA  197

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR  IYN+TNID SFAKTR+  CP  TGSGDNNLAPLD +T   FDN+YY
Sbjct  198  RCTSFRGHIYNDTNIDVSFAKTRRSNCPRTTGSGDNNLAPLDLRTPTHFDNSYY  251



>gb|KFK27367.1| hypothetical protein AALP_AA8G373800 [Arabis alpina]
Length=325

 Score =   355 bits (912),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL ++FY +SCP L   V+ VV+ AV +E+RM ASLLRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLDSDFYRESCPSLFPAVRRVVQRAVARERRMAASLLRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SF GEKTAGPNNNSVRGF VID IKS VE++CPGVVSCADI+ I ARDSV LLGGP W+V
Sbjct  88   SFVGEKTAGPNNNSVRGFEVIDRIKSRVERLCPGVVSCADILAITARDSVRLLGGPGWSV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRDS TASLSAANSGVIPPPT+TLNNLI RF+ +GLS RD+VALSGAHTIG+A+C  
Sbjct  148  KLGRRDSTTASLSAANSGVIPPPTSTLNNLINRFRAQGLSQRDLVALSGAHTIGQAKCAT  207

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNE+NID +FA ++Q +CP+ +GSGDNN A LD ++   FD NYY+
Sbjct  208  FRNRIYNESNIDLTFALSKQSSCPASSGSGDNNQATLDLRSPGRFDLNYYR  258



>ref|XP_004500341.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=326

 Score =   355 bits (912),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQL  NFY K CP +  TV++VVKSAV+KE+R+GASLLRL FHDCFV GCDGSILL
Sbjct  25   GTSSAQLDENFYCKKCPNVFDTVETVVKSAVSKEQRIGASLLRLFFHDCFVDGCDGSILL  84

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTA PNNNS RGF VID+IKS +E +CPGVVSCADI+ IA+RDSVV+LGGP
Sbjct  85   DDTSSFKGEKTAAPNNNSARGFEVIDAIKSKLEAICPGVVSCADILAIASRDSVVILGGP  144

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVK+GRRDS+TA+  AAN+GV+P P + L  LI+ F+ +GLS +DMVALSGAHTIG+A
Sbjct  145  FWNVKVGRRDSRTANFIAANTGVLPSPASNLTKLISTFKAQGLSVKDMVALSGAHTIGEA  204

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYNE NIDS+FAK RQ+ CPS  G+GDNNLA LD +T   FDNNYYK
Sbjct  205  RCTSFRNHIYNENNIDSTFAKIRQRKCPSTVGTGDNNLANLDLQTPTHFDNNYYK  259



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score =   355 bits (911),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLSTNFY  SCP L +TVKS V+SA++KE RMGASLLR  FHDCFV GCDGSILL
Sbjct  20   GSANAQLSTNFYYHSCPNLFSTVKSTVQSAISKETRMGASLLRPFFHDCFVNGCDGSILL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RG+ VID+IKSAVEK CPGVVSCADI+ IAARDSV +LGGP
Sbjct  80   DDTSSFTGEKNANPNRNSARGYEVIDNIKSAVEKACPGVVSCADILAIAARDSVQILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVK+GRRD++TAS SAAN+G IPPPT+ LN LI+RF   GLS +D+VALSG HTIG+A
Sbjct  140  SWNVKVGRRDARTASQSAANNG-IPPPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNE+NID++FA+ RQQ+CP  +GSGDNNLA LD +T   FDN Y+K
Sbjct  199  RCTNFRARIYNESNIDTAFARARQQSCPRTSGSGDNNLATLDLQTPTEFDNYYFK  253



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   355 bits (910),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 197/236 (83%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GSTSAQLSTNFY  SCP L +TVKS V+SA++KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  20   GSTSAQLSTNFYYHSCPNLFSTVKSTVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEK A PN NS RGF V+D+IKSAVE+ CPGVVSCAD++ IAARDSV +LGGP
Sbjct  80   DDTSSFRGEKRAAPNFNSARGFEVVDNIKSAVERACPGVVSCADVLAIAARDSVEILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRD++TAS +AAN+  IPPPT  LN LI+RF   GLSARD+VALSG+HTIG A
Sbjct  140  RWDVKLGRRDARTASQAAANNS-IPPPTTNLNALISRFSAVGLSARDLVALSGSHTIGLA  198

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET N+DSS A+TRQ  CPS +GSGDNNLAPLD +T   FDNNY+K
Sbjct  199  RCTNFRARIYNETNNLDSSLARTRQSNCPSVSGSGDNNLAPLDLQTPTNFDNNYFK  254



>ref|XP_008465298.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=324

 Score =   355 bits (910),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 196/235 (83%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLSTNFY KSCPKLL TV++ + +AV KE RMGASLLRLHFHDCFV GCDGSILL
Sbjct  26   GSSSAQLSTNFYYKSCPKLLNTVRAGIHAAVAKEARMGASLLRLHFHDCFVNGCDGSILL  85

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            +DT +FTGE+TA PNN SVRGF+VI+SIK  VEK+CPGVVSCADI+T++ARD+VV+LGGP
Sbjct  86   EDTPTFTGEQTAAPNNRSVRGFDVIESIKKNVEKICPGVVSCADILTLSARDAVVVLGGP  145

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTAS S   +G IPPPT+TL+ LI RF  KGLS RD+VALSGAHTIG+A
Sbjct  146  SWKVKLGRRDSKTASFSDV-TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQA  204

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  F+ RIYNETNID SFA+ RQ+ CP  T  GD+N APLD +T   FDN YYK
Sbjct  205  RCLFFKNRIYNETNIDESFAEERQRICP--TNGGDDNRAPLDLRTPKLFDNYYYK  257



>ref|XP_010931330.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=319

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 193/230 (84%), Gaps = 1/230 (0%)
 Frame = +2

Query  104  QLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  283
             L+ +FY+KSCPKL +TVK VV++A+ KEKRMGASLLRL FHDCFVQGCD SILLDDT +
Sbjct  24   HLTPDFYAKSCPKLFSTVKPVVQAAIAKEKRMGASLLRLVFHDCFVQGCDASILLDDTPT  83

Query  284  FTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVK  463
            F GEKTA PNNNSVRGF+VID IK+AVEKVCPGVVSCADI+ I ARDSVV+LGGP W VK
Sbjct  84   FRGEKTAAPNNNSVRGFDVIDKIKAAVEKVCPGVVSCADILEITARDSVVILGGPFWEVK  143

Query  464  LGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVF  643
            LGRRDS TAS S AN   IPPPT++L+NLI +F  +GLS +DMVALSGAHTIGKARC  F
Sbjct  144  LGRRDSTTASFSLANQN-IPPPTSSLSNLINKFAAQGLSTKDMVALSGAHTIGKARCINF  202

Query  644  RRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            R RIYNET+I+S+FAK RQ  CP   GSGDNNLAPLD +T  +FDN+YY+
Sbjct  203  RNRIYNETDINSAFAKKRQANCPKTAGSGDNNLAPLDVQTPTYFDNDYYQ  252



>gb|KHN44724.1| Peroxidase 4 [Glycine soja]
Length=318

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = +2

Query  107  LSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSF  286
            L TNFY  SCPKL  TVK  V+SA++KE RMGASLLRL FHDCFV GCDGSILLDDTSSF
Sbjct  24   LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  83

Query  287  TGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVKL  466
            TGEK AGPN NS RGF VID IKSAVEKVCPGVVSCADI+ IAARDSV +L GP W+VKL
Sbjct  84   TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  143

Query  467  GRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVFR  646
            GRRDS+TAS SAAN+G IP PT+ LN LI+RF   GLS +D+VALSG HTIG+ARCT FR
Sbjct  144  GRRDSRTASQSAANNG-IPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFR  202

Query  647  RRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             RIYNE+NIDSSFA+ RQ  CP  +GSGDNNLAP++F T  FFDN+Y+K
Sbjct  203  ARIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPINFATPTFFDNHYFK  251



>ref|XP_009410536.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=321

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  113  TNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSSFTG  292
            T++YS SCP L +TV  VV+SA++KEKRMGASLLRL FHDCFV GCDGSILLDDTS FTG
Sbjct  29   TSYYSSSCPDLFSTVSGVVQSAISKEKRMGASLLRLFFHDCFVNGCDGSILLDDTSGFTG  88

Query  293  EKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVKLGR  472
            EKTA PN NSVRGF+V+D IK+AVEKVCPGVVSCADI+ IAARDSV  LGG +WNVKLGR
Sbjct  89   EKTANPNQNSVRGFDVVDDIKTAVEKVCPGVVSCADILAIAARDSVATLGGRSWNVKLGR  148

Query  473  RDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVFRRR  652
            RDS TASLSAAN+  IPPP+++L+NLI++F ++GLS +D+VALSGAHTIG+ARC  FR  
Sbjct  149  RDSTTASLSAANNN-IPPPSSSLSNLISKFSDQGLSTKDLVALSGAHTIGQARCISFRAH  207

Query  653  IYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            IY +TNIDS FA TRQ  CPS  GSGDNNLAPLD +T   FDNNYYK
Sbjct  208  IYTDTNIDSGFANTRQSNCPSTAGSGDNNLAPLDLQTPTTFDNNYYK  254



>ref|XP_006470332.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=320

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 195/234 (83%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ST+AQLSTNFY+ +C  LL TVKSVV+SA++KE RMGASLLRL FHDCFV GCDGS+LLD
Sbjct  21   STNAQLSTNFYANTCKNLLPTVKSVVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLD  80

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A  N NS RGF VID+IKSAVEK CPGVVSCADI+ I ARDSVV+LGGP+
Sbjct  81   DTSSFTGEKNANANRNSARGFQVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPS  140

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VKLGRRD++TASLSAANSG IP PT+ LN L +RF   GLS +D+VAL+G HTIG+AR
Sbjct  141  WRVKLGRRDARTASLSAANSG-IPAPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQAR  199

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR  IYNETNID+SFA+TRQ  CP   G+GDNNLAPLD +T   FDNNY+K
Sbjct  200  CTSFRAHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTCFDNNYFK  253



>ref|XP_004978554.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=331

 Score =   354 bits (908),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 195/234 (83%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S+SAQLST FYS SCP +   VKSVV++A+ +E+RMGAS+LRL FHDCFVQGCD S+LLD
Sbjct  32   SSSAQLSTGFYSYSCPGVYDAVKSVVQAAIAREQRMGASILRLFFHDCFVQGCDASLLLD  91

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSF GEK A PNN SVRGF VID+IKSAVEKVCPGVVSCADI+ IAARDSVV+LGGPN
Sbjct  92   DTSSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPN  151

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+AR
Sbjct  152  WDVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQAR  210

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR  +YN+TNID +FA+TRQ  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  211  CTNFRAHVYNDTNIDGAFARTRQSACPRTSGSGDNNLAPLDLQTPTAFENNYYK  264



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score =   352 bits (904),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 196/231 (85%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV++ VKSAV+ + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSSSCPNLLSTVQTAVKSAVSSQNRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IKSAVEK CPGVVSCADI+ IAARDSVV+LGGPNWNV
Sbjct  88   SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVILGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  148  KLGRRDARTASQAAANSN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTN  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  + A FDN+Y+K
Sbjct  207  FRARVYNETNINAAFATLRQRSCPRTAGSGDGNLAPLDVNSAASFDNSYFK  257



>ref|XP_010552918.1| PREDICTED: peroxidase P7-like [Tarenaya hassleriana]
Length=319

 Score =   352 bits (903),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 194/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+   QL+TNFY+ SCPKL+ TV+SV++SAV +E R+GAS+LRL FHDCFV GCDGSILL
Sbjct  19   GNVEGQLTTNFYASSCPKLIPTVRSVMQSAVKREARIGASILRLFFHDCFVNGCDGSILL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK AGPN NSVRGF+VID+IK+A EK CPG+VSCADI+ IAARD VVLLGGP
Sbjct  79   DDTSSFTGEKNAGPNRNSVRGFDVIDNIKTAAEKACPGIVSCADILAIAARDGVVLLGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDS+TAS SAAN   IP PT  L+ L++ F N GLSARDMVALSG HTIG+A
Sbjct  139  SWEVKLGRRDSRTASQSAANRD-IPAPTFNLSRLVSSFSNVGLSARDMVALSGGHTIGQA  197

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNE NI+S+FA TRQ+ CP   GSGD NLAPLD +T   FDNNY+K
Sbjct  198  RCTTFRARIYNEKNINSAFAATRQRNCPRTNGSGDGNLAPLDIQTPTKFDNNYFK  252



>ref|XP_006401086.1| hypothetical protein EUTSA_v10014097mg [Eutrema salsugineum]
 gb|ESQ42539.1| hypothetical protein EUTSA_v10014097mg [Eutrema salsugineum]
Length=326

 Score =   352 bits (902),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 192/235 (82%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G + A+LS +FYS+SCP L   V+ VV+ AV KE+RM ASLLRL FHDCFV GCDGSILL
Sbjct  25   GYSEAKLSRDFYSESCPSLFPAVRRVVQHAVAKERRMAASLLRLFFHDCFVNGCDGSILL  84

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTAGPNNNSVRGF VID IKS VE++CPGVVSCADI+ I ARDSV+LLGGP
Sbjct  85   DDTSSFVGEKTAGPNNNSVRGFEVIDRIKSKVERLCPGVVSCADILAITARDSVLLLGGP  144

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W VKLGRRDS  AS S ANSGVIPPPT+TLNNLI RF+ KGLS RDMVALSGAHTIG+A
Sbjct  145  KWGVKLGRRDSTKASFSDANSGVIPPPTSTLNNLINRFKAKGLSTRDMVALSGAHTIGQA  204

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RI+N +NID SFA +RQ +CP+ +GSGDNN A LD ++   FD +YYK
Sbjct  205  RCVTFRNRIHNASNIDLSFALSRQMSCPAASGSGDNNEAALDPRSPGRFDLSYYK  259



>emb|CAD67478.1| peroxidase [Asparagus officinalis]
Length=301

 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SA LSTNFYS SCPK+ +T+K V++SA+ KEKRMGAS+LRL FHDCFV GCDGSILL
Sbjct  1    GSSSAHLSTNFYSSSCPKVFSTIKPVLQSAIAKEKRMGASILRLFFHDCFVNGCDGSILL  60

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
             DT++F GE+ AGPNN SVRGF VID IK+AVE  CPGVVSCADI+ +AARDSVV+LGGP
Sbjct  61   ADTANFRGEQHAGPNNGSVRGFKVIDKIKTAVENACPGVVSCADILAVAARDSVVILGGP  120

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRD++TAS + AN+  IPPPT++L+NLI++F  +GLS +DMVALSGAHTIG+A
Sbjct  121  DWKVKLGRRDARTASATLANNN-IPPPTSSLSNLISKFAAQGLSTKDMVALSGAHTIGQA  179

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+ +ID+SFA  RQ+ CP ++GSGD NLAPLD +T   FDNNYYK
Sbjct  180  RCTSFRGHIYNDADIDASFASLRQKICPRKSGSGDTNLAPLDLQTPTAFDNNYYK  234



>ref|XP_002450133.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
 gb|EES09121.1| hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
Length=328

 Score =   352 bits (902),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLST FYS SCP +   VKSV+KSA+  EKRMGAS++RL FHDCFVQGCD S+LL
Sbjct  28   GTSSAQLSTGFYSYSCPGVYGAVKSVMKSAIANEKRMGASIVRLFFHDCFVQGCDASLLL  87

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++F GEK A PNN SVRGF VID++KSAVEKVCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  88   DDTATFQGEKMATPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGP  147

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+A
Sbjct  148  SWDVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+T+I+S+FAKTRQ  CPS +G+GDNNLAPLD +T   F+NNYYK
Sbjct  207  RCTNFRAHIYNDTDINSAFAKTRQSGCPSTSGAGDNNLAPLDLQTPTVFENNYYK  261



>ref|XP_006361306.1| PREDICTED: peroxidase 4-like [Solanum tuberosum]
Length=319

 Score =   350 bits (898),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 195/235 (83%), Gaps = 2/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQL+T FYSKSCPKL  TVKSVV SA+ KE RMGASLLRL FHDCFV GCDGS+ L
Sbjct  18   GSSSAQLTTGFYSKSCPKLYETVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLFL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEK A PN NS RGF VID+IKSAVEKVCPGVVSCADI+ + ARDSVV+LGGP
Sbjct  78   DDTSTFTGEKRAQPNFNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW+VKLGRRD++TAS  AAN+  IP PT+ LN LI+ F   GLS +DMVALSGAHTIG+A
Sbjct  138  NWDVKLGRRDARTASQGAANNS-IPTPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQA  196

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNET N+D+S A+TRQ  CP  +GSGDNNLAPLD +T   FDN+Y+
Sbjct  197  RCTSFRGRIYNETKNMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYF  251



>emb|CDY32701.1| BnaA02g07630D [Brassica napus]
Length=326

 Score =   350 bits (898),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            T AQLS++FY++SCP L   V+ V++ AV KE+RM ASLLRL FHDCFV GCDGSILLDD
Sbjct  27   TQAQLSSDFYAESCPSLFPAVRRVMQRAVAKERRMAASLLRLFFHDCFVNGCDGSILLDD  86

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSF GEKTAGPNNNSVRGF VID IKS VEK+CPGVVSCADIV I+ARDSV+LLGGP W
Sbjct  87   TSSFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRW  146

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDSK A  SAANSGVIP P +TL NLI RF+ +GLS RDMVALSGAHTIG+A C
Sbjct  147  SVKLGRRDSKKAGFSAANSGVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQANC  206

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
              FR RIYNE+NID SFA +R++ CP+ +GSGDN  APLD  +   FD++YY
Sbjct  207  LTFRNRIYNESNIDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYY  258



>ref|XP_004150606.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
 ref|XP_004171847.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
 gb|KGN47221.1| hypothetical protein Csa_6G213910 [Cucumis sativus]
Length=325

 Score =   350 bits (897),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 193/226 (85%), Gaps = 2/226 (1%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQLS +FYS +CPKLL+ ++S V+SA+ KE R+GASLLRLHFHDCFV GCDGSILLDDT+
Sbjct  30   AQLSVSFYSNTCPKLLSVIRSGVQSAITKEARIGASLLRLHFHDCFVNGCDGSILLDDTA  89

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            +F GE+TA PNN SVRGF+VI +IKS +EKVCPGVVSCADI+T+AARDSV +LGGP W V
Sbjct  90   TFRGEQTAPPNNRSVRGFDVIKAIKSNIEKVCPGVVSCADILTLAARDSVNILGGPTWEV  149

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRDSKTAS SAA+SG+IPPPT+TL+NLI RF   GLSA+DMVALSGAHTIG+ARC  
Sbjct  150  KLGRRDSKTASFSAASSGIIPPPTSTLSNLINRFNVVGLSAKDMVALSGAHTIGQARCVT  209

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFD  778
            FR RIYNE+NID SFAK RQ++CP     GD+NLAPLDF T  FFD
Sbjct  210  FRNRIYNESNIDVSFAKLRQRSCPRS--GGDDNLAPLDFTTPKFFD  253



>ref|XP_009126754.1| PREDICTED: peroxidase 67 [Brassica rapa]
Length=326

 Score =   350 bits (897),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            T AQLS++FY++SCP L   V+ V++ AV KE+RM ASLLRL FHDCF+ GCDGSILLDD
Sbjct  27   TQAQLSSDFYAESCPSLFPAVRRVMQRAVAKERRMAASLLRLFFHDCFINGCDGSILLDD  86

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSF GEKTAGPNNNSVRGF VID IKS VEK+CPGVVSCADIV I+ARDSV+LLGGP W
Sbjct  87   TSSFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRW  146

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDSK A  SAANSGVIP P +TL NLI RF+ +GLS RDMVALSGAHTIG+A C
Sbjct  147  SVKLGRRDSKKAGFSAANSGVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQANC  206

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
              FR RIYNE+NID SFA +R++ CP+ +GSGDN  APLD  +   FD++YY
Sbjct  207  LTFRNRIYNESNIDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYY  258



>emb|CDY02820.1| BnaC02g10690D [Brassica napus]
Length=326

 Score =   350 bits (897),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            T AQLS++FY++SCP L   V+ V++ AV KE+RM ASLLRL FHDCF+ GCDGSILLDD
Sbjct  27   THAQLSSDFYAESCPSLFPAVRGVMQRAVAKERRMAASLLRLFFHDCFINGCDGSILLDD  86

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSF GEKTAGPNNNSVRGF VID IKS VEK+CPGVVSCADIV I+ARDSV+LLGGP W
Sbjct  87   TSSFRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRW  146

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDSK A  SAANSGVIP P +TL NLI RF+ +GLS RDMVALSGAHTIG+A C
Sbjct  147  SVKLGRRDSKKAGFSAANSGVIPSPFSTLKNLINRFKAQGLSVRDMVALSGAHTIGQANC  206

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
              FR RIYNE+NID SFA +R++ CP+ +GSGDN  APLD  +   FD++YY
Sbjct  207  LTFRNRIYNESNIDLSFALSRRKNCPATSGSGDNKKAPLDIGSPTRFDHSYY  258



>gb|ACU23223.1| unknown [Glycine max]
Length=328

 Score =   350 bits (897),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 201/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SA LS NFYSK+CP +  TVKSVVKSAV +E R+GAS++RL FHDCFVQGCDGSILL
Sbjct  27   GTSSANLSKNFYSKTCPNVFNTVKSVVKSAVVREPRIGASIVRLFFHDCFVQGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GEKTA  NNNSVRGF VID+IKS VEK+CPGVVSCADI+ IA+RDSVVLLGGP
Sbjct  87   DDTPTFQGEKTAAANNNSVRGFEVIDAIKSEVEKICPGVVSCADILDIASRDSVVLLGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS+TA+ +AAN+GVIPPPT+ L NLITRF+++GLSARDMVALSGAHT GKA
Sbjct  147  FWKVRLGRRDSRTANFTAANTGVIPPPTSNLTNLITRFRDQGLSARDMVALSGAHTFGKA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYN+TNID +FA  RQ+ CP   G+GDNNLA LDF+T   FDNNY+K
Sbjct  207  RCTSFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFK  261



>ref|XP_008465299.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=326

 Score =   349 bits (896),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 195/230 (85%), Gaps = 2/230 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLS +FYSK+CPKLL+ V+S V+SA+ KE R+GASLLRLHFHDCFV GCDGSILL
Sbjct  27   GTSSAQLSVSFYSKTCPKLLSIVRSGVQSAIAKEARIGASLLRLHFHDCFVNGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++F GE+TA PNN SVRGF+VI +IKS VEKVCPGVVSCADI+T+ ARDSV +LGGP
Sbjct  87   DDTATFRGEQTAPPNNRSVRGFDVIKAIKSNVEKVCPGVVSCADILTLTARDSVNILGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTAS SAA+SGVIPPPT+TL+NLI RF   GLSA+DMVALSGAHTIG A
Sbjct  147  SWEVKLGRRDSKTASFSAASSGVIPPPTSTLSNLINRFNAVGLSAKDMVALSGAHTIGLA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFD  778
            RC  FR RIYNE+NID SFAK RQ++CP     GD+NLAPLD  T   FD
Sbjct  207  RCVTFRNRIYNESNIDVSFAKLRQRSCPRS--GGDDNLAPLDVATPKLFD  254



>ref|XP_003615995.1| Peroxidase [Medicago truncatula]
 gb|AES98953.1| class III peroxidase [Medicago truncatula]
Length=326

 Score =   349 bits (896),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 192/232 (83%), Gaps = 1/232 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            +QLS NFY+K CP +   V SVV SAV +E RMG SLLRLHFHDCFV GCDGS+LLDDT 
Sbjct  28   SQLSENFYAKKCPNVFKAVNSVVHSAVAREPRMGGSLLRLHFHDCFVNGCDGSVLLDDTP  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            S  GEKTA PN +S+RGF VID+IKS VE VCPGVVSCADIV IAARDSVV LGGP W V
Sbjct  88   SNKGEKTALPNKDSLRGFEVIDAIKSKVESVCPGVVSCADIVAIAARDSVVNLGGPFWKV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRDSKTASL+ ANSGVIPPP +TLNNLI RF+ +GLS +DMVALSGAHTIGKARCTV
Sbjct  148  KLGRRDSKTASLNDANSGVIPPPFSTLNNLINRFKAQGLSTKDMVALSGAHTIGKARCTV  207

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGS-GDNNLAPLDFKTQAFFDNNYYK  793
            +R RIYN+TNIDS FAK+RQ+ CP ++G+  DNN+A LDFKT   FDN YYK
Sbjct  208  YRDRIYNDTNIDSLFAKSRQRNCPRKSGTIKDNNVAVLDFKTPNHFDNLYYK  259



>gb|EMS66985.1| Peroxidase 4 [Triticum urartu]
Length=321

 Score =   349 bits (896),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 188/235 (80%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLST FYS SCP  L  V SVV+SAV KE RMGAS+LRL FHDCFVQGCDGS+LL
Sbjct  21   GGASAQLSTGFYSSSCPGALGAVASVVQSAVAKEPRMGASILRLFFHDCFVQGCDGSLLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEKTA PNN SVRGF VID+IK AVE +CPGVVSCAD++ IAARDSVV LGGP
Sbjct  81   DDTPSFQGEKTAMPNNGSVRGFEVIDAIKVAVENICPGVVSCADVLAIAARDSVVALGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSG+HTIG+A
Sbjct  141  NWAVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYNET+IDS FA TRQ  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  200  RCTNFRAHIYNETDIDSGFAGTRQSGCPPNSGSGDNNLAPLDLQTPIAFENNYYK  254



>gb|KHN48395.1| Peroxidase 4 [Glycine soja]
Length=328

 Score =   349 bits (896),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 201/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SA LS NFYSK+CP +  TVKSVVKSAV +E R+GAS++RL FHDCFVQGCDGSILL
Sbjct  27   GTSSANLSKNFYSKTCPNVFNTVKSVVKSAVVREPRIGASIVRLFFHDCFVQGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GEKTA  NNNSVRGF VID+IKS VEK+CPGVVSCADI+ IA+RDSVVLLGGP
Sbjct  87   DDTPTFQGEKTAAANNNSVRGFEVIDAIKSEVEKICPGVVSCADILDIASRDSVVLLGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS+TA+ +AAN+GVIPPPT+ L NLITRF+++GLSARDMVALSGAHT GKA
Sbjct  147  FWKVRLGRRDSRTANFTAANTGVIPPPTSNLTNLITRFRDQGLSARDMVALSGAHTFGKA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYN+TNID +FA  RQ+ CP   G+GDNNLA LDF+T   FDNNY+K
Sbjct  207  RCTSFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFK  261



>gb|ADN96693.1| peroxidase 6 [Rubia cordifolia]
Length=321

 Score =   349 bits (895),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 194/233 (83%), Gaps = 2/233 (1%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            TSAQLS N+Y  +CPKL +TVKS V+SA+ KE RMGASLLRL FHDCFV GCDGSILLDD
Sbjct  22   TSAQLSENYYYSACPKLYSTVKSTVQSAIAKETRMGASLLRLFFHDCFVNGCDGSILLDD  81

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSFTGEK A PN NS RGF V+D IK+AVEKVCPGVVSCADI+ IAA DSV +LGGP+W
Sbjct  82   TSSFTGEKKAAPNVNSARGFEVVDDIKAAVEKVCPGVVSCADILAIAAHDSVEILGGPSW  141

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            NVKLGRRD++TAS +AAN   IPPPT  LN LI+RF + GLSA+D+VALSG+HTIG+ARC
Sbjct  142  NVKLGRRDARTASQAAANQ-TIPPPTTNLNGLISRFNSFGLSAKDLVALSGSHTIGQARC  200

Query  635  TVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            T FR RIYNET N+D+S A+TRQ  CP  TGSGDNNLAPLD +T   FDN+Y+
Sbjct  201  TNFRARIYNETNNLDTSLARTRQGNCPRATGSGDNNLAPLDLETPTRFDNHYF  253



>gb|AAP42508.1| anionic peroxidase swpb3 [Ipomoea batatas]
Length=320

 Score =   348 bits (894),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 189/231 (82%), Gaps = 1/231 (0%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLS  FYSKSCPKL  TV SVV+SA+ KE RMGASLLRL FHDCFV GCDGSILLDDT
Sbjct  23   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  82

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            SSFTGEK A PN  S RGF VID IKSAVEKVCPGVVSCADI+ IA+RDS V LGGP+WN
Sbjct  83   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  142

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            VKLGRRD++TAS +AAN+  IP PT+ LN LI+ F   GLS  DMV LSG+HTIG+ARCT
Sbjct  143  VKLGRRDARTASQAAANNS-IPAPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  201

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
             FR RIYNE+NIDSSFA++R+  CP  +GSGDNNLAPLD +T   FDNNYY
Sbjct  202  NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYY  252



>ref|XP_002450132.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
 gb|EES09120.1| hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
Length=331

 Score =   349 bits (895),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 196/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLST+FYS SCP +  +VKS ++SA+  E+RMGAS++RL FHDCFVQGCD S+LL
Sbjct  31   GTSSAQLSTSFYSSSCPGVYDSVKSAIQSAIATEQRMGASIVRLFFHDCFVQGCDASLLL  90

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+SF GEK A PNN SVRGF VID++KSAVEKVCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  91   DDTASFQGEKMATPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGP  150

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+A
Sbjct  151  SWDVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  209

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  +YN+TNID +FA+TRQ  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  210  RCTNFRAHVYNDTNIDGTFARTRQSGCPRTSGSGDNNLAPLDLQTPTVFENNYYK  264



>ref|XP_007146856.1| hypothetical protein PHAVU_006G075900g [Phaseolus vulgaris]
 gb|ESW18850.1| hypothetical protein PHAVU_006G075900g [Phaseolus vulgaris]
Length=331

 Score =   348 bits (894),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 192/233 (82%), Gaps = 0/233 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ++SAQLS NFYSK+CP +  TVK+VVKSAV KE R+GAS+LRL FHDCFV GCDGS+LLD
Sbjct  31   TSSAQLSNNFYSKTCPNVFNTVKAVVKSAVAKEPRIGASILRLFFHDCFVDGCDGSLLLD  90

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT S  GEKTA  NNNSVRGF VID IKS VEK+CPGVVSCADI+TIA+RDSVVLLGGP 
Sbjct  91   DTPSLLGEKTAAANNNSVRGFEVIDGIKSRVEKLCPGVVSCADILTIASRDSVVLLGGPF  150

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VK+GRRDS+TA+ SAANSGVIPPPT+ L NLI  F+ +GLSA+DMVALSGAHTIGKAR
Sbjct  151  WKVKVGRRDSRTANFSAANSGVIPPPTSNLTNLIKTFEAQGLSAKDMVALSGAHTIGKAR  210

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            C  FR  IYN +NI+  FA  RQ+ CP  +G+GDNNLA LD +T   FDNNY+
Sbjct  211  CASFRDHIYNGSNIERRFALARQRKCPRTSGTGDNNLAVLDLRTSKHFDNNYF  263



>ref|XP_003551174.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=328

 Score =   348 bits (894),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 201/235 (86%), Gaps = 0/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SA LS NFYSK+CP +  TVKSVVKSAV +E R+GAS++RL FHDCFVQGCDGSILL
Sbjct  27   GTSSANLSKNFYSKTCPNVFNTVKSVVKSAVVREPRIGASIVRLFFHDCFVQGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GEKTA  NNNSVRGF VID+IKS VEK+CPGVVSCADI+ +A+RDSVVLLGGP
Sbjct  87   DDTPTFQGEKTAAANNNSVRGFEVIDAIKSEVEKICPGVVSCADILDLASRDSVVLLGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS+TA+ +AAN+GVIPPPT+ L NLITRF+++GLSARDMVALSGAHT GKA
Sbjct  147  FWKVRLGRRDSRTANFTAANTGVIPPPTSNLTNLITRFRDQGLSARDMVALSGAHTFGKA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYN+TNID +FA  RQ+ CP   G+GDNNLA LDF+T   FDNNY+K
Sbjct  207  RCTSFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFK  261



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score =   348 bits (893),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 192/235 (82%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +A LS ++Y  SCPKL  TVK  V+SA++KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  25   GSANANLSKDYYYSSCPKLFETVKCEVQSAISKETRMGASLLRLFFHDCFVNGCDGSILL  84

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PN NS RGF VID IKSAVEKVCPG VSCADI+TI ARDSV +LGGP
Sbjct  85   DDTSSFTGEKTANPNKNSARGFEVIDKIKSAVEKVCPGAVSCADILTITARDSVEILGGP  144

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRD++TAS SAAN+  IP PT++LN LI+RF   GLS +D+VALSG HTIG+A
Sbjct  145  TWDVKLGRRDARTASKSAANND-IPAPTSSLNQLISRFNALGLSTKDLVALSGGHTIGQA  203

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN++NID+SFA+TRQ  CP  +GSGDNNLAPLD  T   FDN+Y+K
Sbjct  204  RCTTFRAHIYNDSNIDTSFARTRQSGCPKTSGSGDNNLAPLDLATPTSFDNHYFK  258



>dbj|BAJ97638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   348 bits (892),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 188/235 (80%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLST FYS SCP  L  V SVV+SAV  E RMGAS+LRL FHDCFVQGCDGS+LL
Sbjct  20   GGASAQLSTGFYSSSCPGALGAVASVVQSAVANEPRMGASILRLFFHDCFVQGCDGSLLL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+SF GEK A PNN SVRGF VID+IK AVEK+CPGVVSCAD++ IAARDSVV LGGP
Sbjct  80   DDTASFQGEKMATPNNGSVRGFEVIDAIKVAVEKICPGVVSCADVLAIAARDSVVALGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSG+HTIG+A
Sbjct  140  NWAVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  +YNETNIDS FA TR+  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  199  RCTNFRAHVYNETNIDSGFAGTRRSGCPPNSGSGDNNLAPLDLQTPTAFENNYYK  253



>emb|CDX98835.1| BnaC09g50000D [Brassica napus]
Length=325

 Score =   348 bits (892),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 194/231 (84%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV+S VKSAV+ + R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  29   AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IK+AVE  CPGVVSCADI+ IAARDSVVLLGGPNWNV
Sbjct  89   SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AANS  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  149  KVGRRDARTASQAAANSN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTN  207

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  +  FFDN+Y+K
Sbjct  208  FRTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANFFDNSYFK  258



>gb|AFW64595.1| hypothetical protein ZEAMMB73_885092 [Zea mays]
Length=333

 Score =   347 bits (889),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 193/236 (82%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLST FYS SCP +   VKSVV+SAV  E+RMGAS++RL FHDCFVQGCD S+LL
Sbjct  32   GTSSAQLSTGFYSSSCPGVYDAVKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLLL  91

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEK A PNN SVRGF VID++KSAVEKVCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  92   DDTPSFQGEKMANPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGP  151

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+A
Sbjct  152  TWDVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  210

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTG-SGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  +YN+TNID SFA+TRQ  CP  +G SGDNNLAPLD +T   F+NNYYK
Sbjct  211  RCTNFRAHVYNDTNIDGSFARTRQSGCPRSSGSSGDNNLAPLDLQTPTVFENNYYK  266



>emb|CDY04948.1| BnaAnng01300D [Brassica napus]
Length=324

 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 192/231 (83%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TVKS VKSAV+ + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ AGPN NS RGF VID+IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNV
Sbjct  88   SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD+KTAS +AANS  IP P+ +L+ LI+ F   GLS RDMVALSGAHTIG++RC  
Sbjct  148  KVGRRDAKTASQAAANSN-IPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVN  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  +   FDN+Y+K
Sbjct  207  FRARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFK  257



>ref|XP_009125598.1| PREDICTED: peroxidase P7 [Brassica rapa]
Length=324

 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 192/231 (83%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TVKS VKSAV+ + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ AGPN NS RGF VID+IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNV
Sbjct  88   SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD+KTAS +AANS  IP P+ +L+ LI+ F   GLS RDMVALSGAHTIG++RC  
Sbjct  148  KVGRRDAKTASQAAANSN-IPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVN  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  +   FDN+Y+K
Sbjct  207  FRARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFK  257



>ref|XP_004240883.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=319

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 194/235 (83%), Gaps = 2/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQL+T FYSKSCPKL  TVKSVV SA+ KE RMGASLLRL FHDCFV GCDGS+ L
Sbjct  18   GSSSAQLTTGFYSKSCPKLYQTVKSVVNSAIQKETRMGASLLRLFFHDCFVNGCDGSLFL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEK A PN NS RGF VID+IKSAVEKVC GVVSCADI+ + ARDSVV+LGGP
Sbjct  78   DDTSTFTGEKRAQPNFNSARGFEVIDNIKSAVEKVCLGVVSCADILAVTARDSVVILGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW+VKLGRRD++TAS  AAN+  IP PT+ LN LI+ F   GLS +DMVALSGAHTIG+A
Sbjct  138  NWDVKLGRRDARTASQGAANNS-IPTPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQA  196

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNET N+D+S A+TRQ  CP  +GSGDNNLAPLD +T   FDN+Y+
Sbjct  197  RCTSFRGRIYNETKNMDASLARTRQNNCPRASGSGDNNLAPLDLQTPTRFDNHYF  251



>ref|XP_003602462.1| Peroxidase [Medicago truncatula]
 gb|AES72713.1| class III peroxidase [Medicago truncatula]
Length=322

 Score =   346 bits (887),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 194/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLSTNFYSK+CPKL + V+  V+SA++KE R+GAS+LRL FHDCFV GCDGSILL
Sbjct  22   GSVNAQLSTNFYSKTCPKLSSIVQRQVQSAISKEARIGASILRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEK A PN NSVRGF+VID+IK+AVE VCPGVVSCADI+ IAA DSV +LGGP
Sbjct  82   DDTSNFTGEKNALPNKNSVRGFDVIDNIKTAVENVCPGVVSCADILAIAATDSVAILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD+ TAS S AN+  IP PT+ LN L + F+N GLS +D+VALSGAHTIG+A
Sbjct  142  TWNVKLGRRDATTASQSDANTA-IPRPTSNLNILTSMFKNVGLSTKDLVALSGAHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFA TRQ  CP  +GSGDNNLAPLD  T   FDN YY+
Sbjct  201  RCTTFRVRIYNETNIDTSFASTRQSNCPKTSGSGDNNLAPLDLHTPTSFDNCYYR  255



>ref|XP_004491048.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=323

 Score =   346 bits (887),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 192/235 (82%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +A LS ++Y  SCPKLL TVK  V+SA++KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  22   GSVNATLSKDYYYSSCPKLLDTVKCTVESAISKEPRMGASLLRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+F GEK A PN NS RGF VID IKSAVE+VCPGV+SCADIVTIAARDSV +LGGP
Sbjct  82   DDTSNFFGEKNAIPNKNSARGFEVIDKIKSAVEEVCPGVISCADIVTIAARDSVEILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VKLGRRDS+TAS SAAN+G IP PT+ LN LI+RF   GLS +D+VAL G+HTIG+A
Sbjct  142  SWDVKLGRRDSRTASRSAANNG-IPAPTSNLNQLISRFSALGLSTKDLVALFGSHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYNE+NID+SFA TRQ  CP   GSGDNNLAPLD  T   FDN+Y+K
Sbjct  201  RCTTFRGHIYNESNIDTSFANTRQTECPKSRGSGDNNLAPLDLTTSTSFDNHYFK  255



>ref|NP_001131000.1| uncharacterized protein LOC100192105 precursor [Zea mays]
 gb|ACF79421.1| unknown [Zea mays]
 gb|ACL53914.1| unknown [Zea mays]
Length=320

 Score =   346 bits (887),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 196/236 (83%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLST FYS SCP +   VKSV++SA+ +EKRMGAS+LRL FHDCFVQGCD S+LL
Sbjct  18   GTSSAQLSTGFYSYSCPGVYGAVKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEK A PNN SVRGF VID++KSAVEK+CPGVVSCADI+ IAARDSVV+LGGP
Sbjct  78   DDTPSFQGEKMANPNNGSVRGFEVIDAVKSAVEKLCPGVVSCADILAIAARDSVVILGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+A
Sbjct  138  TWDVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGS-GDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+T+ID++FA+TRQ  CPS +G+ GDNNLAPLD +T   F+NNYY+
Sbjct  197  RCTNFRAHIYNDTDIDAAFARTRQSGCPSTSGAGGDNNLAPLDLQTPTVFENNYYR  252



>emb|CDY14118.1| BnaC02g02350D [Brassica napus]
Length=324

 Score =   345 bits (884),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 191/231 (83%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TVKS VKSAV+ + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  28   AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ AGPN NS RGF VID+IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNV
Sbjct  88   SFTGEQNAGPNRNSARGFTVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD+KTAS +AANS  IP P  +L+ LI+ F   GLS RDMVALSGAHTIG++RC  
Sbjct  148  KVGRRDAKTASQAAANSN-IPAPNMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVN  206

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  +   FDN+Y+K
Sbjct  207  FRARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFK  257



>gb|KHG17773.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=325

 Score =   345 bits (885),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 194/236 (82%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G T+A+LSTNFYSKSCP LL TVK +V SA+ KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  23   GRTNAKLSTNFYSKSCPNLLPTVKFIVHSAIMKEARMGASLLRLFFHDCFVNGCDGSILL  82

Query  269  DD-TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGG  445
            DD  SSF GEK A PN NS RGFNV+D IKSAVE VCPG+VSCADI+ I+ARDSV +LGG
Sbjct  83   DDDISSFIGEKNAAPNRNSARGFNVVDDIKSAVEIVCPGLVSCADILAISARDSVTILGG  142

Query  446  PNWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGK  625
            P W+VKLGRRD++TAS +AAN+  IP P++ LN LI+ F   GL+ RD+VALSG HTIG+
Sbjct  143  PYWDVKLGRRDARTASQAAANNN-IPSPSSNLNQLISGFNAHGLAPRDLVALSGGHTIGQ  201

Query  626  ARCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            ARCT FR R+YNE+NID SFA+TRQ+ CP +TGSGDNNLAPLD  T  +FDN+Y+K
Sbjct  202  ARCTTFRARVYNESNIDPSFARTRQRNCPRETGSGDNNLAPLDIHTPTYFDNSYFK  257



>ref|XP_008463814.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=325

 Score =   345 bits (884),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/234 (71%), Positives = 187/234 (80%), Gaps = 3/234 (1%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ++SA LS NFY KSCPKLL+ V++ V+SAV KE RMGASLLRLHFHDCFV GCDGSILLD
Sbjct  28   ASSAHLSPNFYHKSCPKLLSVVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILLD  87

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT +F GE+TA PNN SVRGFNVI SIK  +EK+CP VVSCADI+T++ARDSVV LGGP+
Sbjct  88   DTPTFLGEQTAAPNNRSVRGFNVIASIKEKIEKICPDVVSCADILTLSARDSVVALGGPS  147

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VKLGRRDSKTAS S   SG IPPPT+TL  LI RF  KGLS +D+VALSGAHTIGK R
Sbjct  148  WKVKLGRRDSKTASFSDV-SGAIPPPTSTLPTLINRFSTKGLSPKDLVALSGAHTIGKPR  206

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            C  F+ RIYNETNID SFAK RQ+ CP     GD N +P DF+T   FDNNYYK
Sbjct  207  CLFFKNRIYNETNIDKSFAKERQRNCPRN--GGDENRSPFDFRTPNLFDNNYYK  258



>gb|EPS67864.1| hypothetical protein M569_06908, partial [Genlisea aurea]
Length=312

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 195/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLST+FYS SCPKL +TV+SVV SA+  E RMGASLLRL FHDCFV GCDGSILL
Sbjct  10   GVCSAQLSTDFYSNSCPKLYSTVRSVVDSAIQAEARMGASLLRLFFHDCFVNGCDGSILL  69

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            D T++ TGEK A PN NSVRGF+V+D IKSAVE VCPGVVSCAD++ I ARDSV +LGGP
Sbjct  70   DSTATITGEKGALPNANSVRGFDVVDRIKSAVESVCPGVVSCADVLAITARDSVEILGGP  129

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVK+GRRDSKTASLSAAN+G IPPPT++L  L++R+   GLS +D+VALSGAHTIG+A
Sbjct  130  SWNVKVGRRDSKTASLSAANNG-IPPPTSSLATLVSRYNALGLSQKDLVALSGAHTIGQA  188

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET++++SFA+ R+  CP   G GDNNLAPLD +T   FDN+Y++
Sbjct  189  RCTTFRARIYNETDVEASFAQLRRNGCPRSAGVGDNNLAPLDVQTPTRFDNDYFR  243



>ref|XP_009403860.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS SAQLST FYS SCP L +TVK VV SA++ E+RMGASLLRL FHDCFV GCD S+LL
Sbjct  16   GSASAQLSTGFYSSSCPSLSSTVKPVVHSAISSEQRMGASLLRLFFHDCFVNGCDASLLL  75

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEKTA PN NSVRGF+VID IK+AVEK CPGVVSCADI+ I ARD+V +LGGP
Sbjct  76   DDTSNFTGEKTATPNQNSVRGFDVIDKIKTAVEKACPGVVSCADILAITARDAVAILGGP  135

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW+VKLGRRD+KTASLS AN+  IPPP+++L+NLI++F  +GLS +DMVAL+GAHTIG+A
Sbjct  136  NWDVKLGRRDAKTASLSGANNN-IPPPSSSLSNLISKFSAQGLSRQDMVALAGAHTIGQA  194

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYN+TNIDSS A TRQ  CPS +GSGD NLAPLD +T   FDN+Y+K
Sbjct  195  RCISFRSRIYNDTNIDSSLATTRQSNCPSTSGSGDGNLAPLDLQTPTTFDNDYFK  249



>ref|XP_002441703.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
 gb|EES15541.1| hypothetical protein SORBIDRAFT_08g000990 [Sorghum bicolor]
Length=328

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 194/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQL T+FYS SCP +   V+SV+++A+ +E+RMGAS+LRL FHDCFVQGCD S+LL
Sbjct  28   GTSSAQLCTSFYSHSCPGVYDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLL  87

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEK A PNN S RGF VID+IKSAV+KVCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  88   DDTPSFQGEKMANPNNGSARGFEVIDAIKSAVDKVCPGVVSCADILAIAARDSVVILGGP  147

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VK+GRRDS+TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG A
Sbjct  148  SWDVKVGRRDSRTASFSGANNN-IPPPTSGLVNLTSLFAAQGLSQKDMVALSGAHTIGLA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+TNID SFA++RQ  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  207  RCTNFRAHIYNDTNIDGSFARSRQSVCPRTSGSGDNNLAPLDLQTPTVFENNYYK  261



>gb|ACN33662.1| unknown [Zea mays]
Length=320

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/236 (69%), Positives = 196/236 (83%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLST FYS SCP +   VKSV++SA+ +EKRMGAS+LRL FHDCFVQGCD S+LL
Sbjct  18   GTSSAQLSTGFYSYSCPGVYGAVKSVMQSAIAREKRMGASILRLFFHDCFVQGCDASLLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEK A PNN SVRGF VID++KSAVEK+CPGVVSCADI+ IAARDSVV+LGGP
Sbjct  78   DDTPSFQGEKMANPNNGSVRGFEVIDAVKSAVEKLCPGVVSCADILAIAARDSVVILGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+A
Sbjct  138  TWDVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGS-GDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+T+ID++FA+TRQ  CPS +G+ GD+NLAPLD +T   F+NNYY+
Sbjct  197  RCTNFRAHIYNDTDIDAAFARTRQSGCPSTSGAGGDSNLAPLDLQTPTVFENNYYR  252



>ref|XP_004150607.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=326

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 188/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SA LS NFY  +CP LL+ V++ V+SAV KE RMGASLLRLHFHDCFV GCDGSILL
Sbjct  28   GTSSAHLSPNFYHNTCPNLLSLVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILL  87

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GE+TA PNN SVRGFNVI +IK  +EK+CPGVVSCADI+T++ARDSVV LGGP
Sbjct  88   DDTPTFLGEQTAAPNNRSVRGFNVIANIKEKIEKICPGVVSCADILTLSARDSVVALGGP  147

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTAS S   +G IPPPT+TL  LI RF  KGLS +D+VALSGAHTIGKA
Sbjct  148  SWKVKLGRRDSKTASFSDV-TGAIPPPTSTLATLINRFNTKGLSPKDLVALSGAHTIGKA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  F+ RIYNETNID SFAK RQ+ CP     GD+N  P DF+T   FDNNYYK
Sbjct  207  RCLFFKNRIYNETNIDKSFAKKRQKNCPRN--GGDDNRTPFDFRTPNLFDNNYYK  259



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 194/233 (83%), Gaps = 3/233 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            S QLST FYS SCP LL+TVKS V+SAV+ E RMGAS+LRL FHDCFV GCDGSILLDDT
Sbjct  25   SGQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDT  84

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            SSFTGEK A PN NS RGF+VID+IK+AVEK CPGVVSCADI+ IAARDSVVLLGGP+WN
Sbjct  85   SSFTGEKNANPNRNSARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWN  144

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            VKLGRRDS TAS S AN+  IP PT++L+ L +RF   GLS+ D+VALSG HTIG+ARCT
Sbjct  145  VKLGRRDSTTASQSQANND-IPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCT  203

Query  638  VFRRRIY-NETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR RIY N +NI+SSFA+TRQ  CP+ +G+GDNNLAPLDF T   FDNNYYK
Sbjct  204  TFRSRIYSNSSNIESSFARTRQSNCPNTSGTGDNNLAPLDF-TPTSFDNNYYK  255



>gb|AAX44001.2| putative secretory peroxidase [Catharanthus roseus]
Length=318

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 195/236 (83%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLST++YSKSCP +  TVKS V SA+ KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  17   GSSSAQLSTDYYSKSCPNVFNTVKSQVHSAILKEARMGASLLRLFFHDCFVNGCDGSILL  76

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF V+D+IKSAVE VCPGVVSCADI+ IAARDSV +LGGP
Sbjct  77   DDTSSFTGEKRAAPNFNSARGFEVVDNIKSAVENVCPGVVSCADILAIAARDSVQILGGP  136

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRD+ TAS +AAN+  IPPPT+ LN L++RF   GLS  D+VALSG+HTIG+A
Sbjct  137  SWNVKLGRRDATTASQAAANNS-IPPPTSNLNALVSRFNALGLSTNDLVALSGSHTIGQA  195

Query  629  RCTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNET N+D++ A+TR+  CP  +GS DNNLAPLD +T   FDNNYYK
Sbjct  196  RCTNFRARIYNETNNLDAALAQTRRSNCPRPSGSRDNNLAPLDLQTPRAFDNNYYK  251



>ref|XP_002489046.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
 gb|EES20431.1| hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
Length=320

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 194/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++ AQLST FYS SCP L + VK VV+SA++ EKR+GAS++RL FHDCFVQGCD S+LL
Sbjct  20   GTSWAQLSTGFYSSSCPGLYSAVKPVVQSAIDSEKRVGASIVRLFFHDCFVQGCDASLLL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++F GEK A PNN SVRGF VID+ KSAVE VCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  80   DDTATFQGEKMATPNNGSVRGFEVIDAAKSAVENVCPGVVSCADILAIAARDSVVILGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+A
Sbjct  140  SWDVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+TN+D +FA+TRQ  CPS +G+GDNNLAPLD +T   F+N+YYK
Sbjct  199  RCTNFRDHIYNDTNVDGAFARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENDYYK  253



>gb|AFK49101.1| unknown [Lotus japonicus]
Length=305

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 194/236 (82%), Gaps = 2/236 (1%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S SAQLS NFY K CP +   VKSVV SAV KE RMG SLLRL FHDCFV GCDGS+LLD
Sbjct  28   SNSAQLSENFYVKKCPSVFNAVKSVVHSAVAKEARMGGSLLRLFFHDCFVNGCDGSVLLD  87

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSF GEKTA PN+NS+RGF+VID+IKS VE VCPGVVSCAD+V IAARDSV +LGGP 
Sbjct  88   DTSSFKGEKTAPPNSNSLRGFDVIDAIKSKVEAVCPGVVSCADVVAIAARDSVAILGGPY  147

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VKLGRRDSKTAS +AANSGVIP P ++L++LI++FQ +GLS +DMVALSGAHTIGKA+
Sbjct  148  WKVKLGRRDSKTASFNAANSGVIPSPFSSLSDLISKFQAQGLSTKDMVALSGAHTIGKAK  207

Query  632  CTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGS-GDNNLAPLDFKTQAFFDNNYYK  793
            C+ FR+ +YNET NI+S FAK RQ+ CP  +G+  DNN+A LDFKT   FDN YYK
Sbjct  208  CSTFRQHVYNETNNINSLFAKARQRNCPRTSGTIRDNNVAVLDFKTPNQFDNLYYK  263



>ref|XP_004502855.1| PREDICTED: peroxidase 52-like [Cicer arietinum]
Length=322

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLS NFYS SC +L +TVKS ++SA++KE R+GAS+LRL FHDCFV GCDGSILL
Sbjct  22   GSANAQLSENFYSSSCSQLSSTVKSTMQSAISKEARIGASILRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF VID+IK+AVEKVCPG+VSCADI+ IAA+DSV +LGGP
Sbjct  82   DDTSSFTGEKNANPNRNSARGFEVIDNIKTAVEKVCPGIVSCADILAIAAKDSVEILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVK+GRRD+KTAS SAAN+G IP P+++L  L +RF   GLS +D+VALSGAHTIG+A
Sbjct  142  TWNVKVGRRDAKTASQSAANTG-IPAPSSSLTQLTSRFSALGLSTKDLVALSGAHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFA TR+ +CPS +GSGDNNLAPLD +T   FDNNY+K
Sbjct  201  RCTNFRARIYNETNIDTSFATTRKSSCPSTSGSGDNNLAPLDLQTPTSFDNNYFK  255



>gb|KDO41520.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=298

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 187/235 (80%), Gaps = 25/235 (11%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G +SAQLSTNFYSK+CPKLL TVKS V+SAV+KE+RMGASLLRLHFHDCFV GCDGSILL
Sbjct  22   GKSSAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKT+GPN NS RGF V+D IKS                          LGGP
Sbjct  82   DDTSSFTGEKTSGPNINSARGFEVVDDIKSK-------------------------LGGP  116

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRDSKTASL+AANSGVIPPPT+TL+NLI RFQ KGLSA+DMVALSGAHTIG+A
Sbjct  117  SWNVKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQA  176

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYNE+NI+SSFAK R+  CP  TGSGDNNLAPLDF++   FDN YYK
Sbjct  177  RCVAFRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYK  231



>gb|KGN47223.1| hypothetical protein Csa_6G216420 [Cucumis sativus]
Length=311

 Score =   343 bits (879),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 188/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SA LS NFY  +CP LL+ V++ V+SAV KE RMGASLLRLHFHDCFV GCDGSILL
Sbjct  13   GTSSAHLSPNFYHNTCPNLLSLVRAGVRSAVAKEARMGASLLRLHFHDCFVNGCDGSILL  72

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +F GE+TA PNN SVRGFNVI +IK  +EK+CPGVVSCADI+T++ARDSVV LGGP
Sbjct  73   DDTPTFLGEQTAAPNNRSVRGFNVIANIKEKIEKICPGVVSCADILTLSARDSVVALGGP  132

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VKLGRRDSKTAS S   +G IPPPT+TL  LI RF  KGLS +D+VALSGAHTIGKA
Sbjct  133  SWKVKLGRRDSKTASFSDV-TGAIPPPTSTLATLINRFNTKGLSPKDLVALSGAHTIGKA  191

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  F+ RIYNETNID SFAK RQ+ CP     GD+N  P DF+T   FDNNYYK
Sbjct  192  RCLFFKNRIYNETNIDKSFAKKRQKNCPRN--GGDDNRTPFDFRTPNLFDNNYYK  244



>emb|CDX70158.1| BnaA10g25070D [Brassica napus]
Length=325

 Score =   343 bits (880),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 193/231 (84%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV+S VKSAV+ + R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  29   AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IK+AVE  CPGVVSCADI+ IAARDSVVLLGGPNWNV
Sbjct  89   SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AAN+  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  149  KVGRRDARTASQAAANNN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTN  207

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  +   FDN+Y+K
Sbjct  208  FRTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFK  258



>ref|XP_009122142.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Brassica rapa]
Length=325

 Score =   343 bits (879),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 193/231 (84%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV+S VKSAV+ + R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  29   AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IK+AVE  CPGVVSCADI+ IAARDSVVLLGGPNWNV
Sbjct  89   SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AAN+  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  149  KVGRRDARTASQAAANNN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTN  207

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  +   FDN+Y+K
Sbjct  208  FRTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFK  258



>gb|ACT35473.1| peroxidase 52, partial [Brassica rapa]
Length=306

 Score =   342 bits (877),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 193/231 (84%), Gaps = 1/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TV+S VKSAV+ + R GAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  10   AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  69

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGE+ A PN NS RGFNVID+IK+AVE  CPGVVSCADI+ IAARDSVVLLGGPNWNV
Sbjct  70   SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  129

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD++TAS +AAN+  IP PT++L+ LI+ F   GLS RDMVALSGAHTIG++RCT 
Sbjct  130  KVGRRDARTASQAAANNN-IPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTN  188

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  +   FDN+Y+K
Sbjct  189  FRTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFK  239



>ref|XP_010685964.1| PREDICTED: peroxidase 4-like [Beta vulgaris subsp. vulgaris]
Length=319

 Score =   342 bits (878),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 176/236 (75%), Positives = 200/236 (85%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GSTSAQLS NFYSKSCPKL  TVKSVV+SAV KE RMGASLLRL FHDCFV GCDGSILL
Sbjct  18   GSTSAQLSPNFYSKSCPKLFGTVKSVVRSAVAKESRMGASLLRLFFHDCFVNGCDGSILL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEK+A PN NS RGFNVID+IKS VE+VCPGVVSCADI+ I ARDSV +LGGP
Sbjct  78   DDTSSFRGEKSAAPNLNSARGFNVIDAIKSKVEQVCPGVVSCADILAITARDSVAILGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NWNVKLGRRDSKTA+ +AAN+G+  PP+++L++LI+RFQ  GLSA+DMVALSGAHTIG+A
Sbjct  138  NWNVKLGRRDSKTANQAAANNGIP-PPSSSLSSLISRFQAHGLSAKDMVALSGAHTIGQA  196

Query  629  RCTVFRRRIYNETN-IDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR  +YNET+ ID+SFA TRQ+ CP   G GDNNLAPLD +T   FDN Y+K
Sbjct  197  RCITFRSHVYNETSTIDASFASTRQRNCPRTNGQGDNNLAPLDSQTPTTFDNKYFK  252



>ref|XP_008782619.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=320

 Score =   342 bits (878),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            TSAQLS  FY  SCPK L+T++S VK+AV KE+RMGASLLRLHFHDCFVQGCDGS+LLDD
Sbjct  23   TSAQLSPTFYDTSCPKALSTIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDD  82

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TS+FTGEKTAGPNNNS+RGF+VID+IKS VE VC   VSCADI+ +AARDSVV LGGP+W
Sbjct  83   TSTFTGEKTAGPNNNSIRGFDVIDTIKSRVEAVCKQTVSCADILAVAARDSVVALGGPSW  142

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
             V+LGRRDS TASLS ANS +  P T+ L+ LI+ F  KGL+  DMVALSGAHTIG+ARC
Sbjct  143  TVQLGRRDSTTASLSLANSDIPSPITSDLSALISAFSKKGLATSDMVALSGAHTIGQARC  202

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR RIYNETNIDSSFA + Q  CP     GD+NLAPLD  T   FDN YY+
Sbjct  203  TSFRNRIYNETNIDSSFATSLQSNCP--VSGGDSNLAPLDVSTPTIFDNFYYR  253



>ref|XP_002319967.2| hypothetical protein POPTR_0013s15240g [Populus trichocarpa]
 gb|EEE95890.2| hypothetical protein POPTR_0013s15240g [Populus trichocarpa]
 gb|AHL39177.1| class III peroxidase [Populus trichocarpa]
Length=326

 Score =   342 bits (878),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 195/234 (83%), Gaps = 3/234 (1%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S+SA LST+FY KSCP+L  TVKSVV+SA+ KE+RMGASL+RL FHDCFV+GCD SILL+
Sbjct  29   SSSAHLSTDFYDKSCPQLFGTVKSVVQSAIAKERRMGASLVRLFFHDCFVKGCDASILLE  88

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT++F GE+ AGPNNNSVRG+NV+  IKS +EKVCPG+VSCADIV IAARDS VLLGGP 
Sbjct  89   DTATFKGEQGAGPNNNSVRGYNVVAKIKSKLEKVCPGIVSCADIVVIAARDSTVLLGGPY  148

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VKLGRRDSKTA+++AA S  +P  T+T++ LI RF++KGLSA DMVALSG+HTIG+ +
Sbjct  149  WKVKLGRRDSKTANMNAA-SKSLPSDTSTVSQLIKRFKSKGLSATDMVALSGSHTIGQTK  207

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            C  FR RIYNETNID SFA  RQ+ CP  T  GD+NLAPLDF+T   FDNNYYK
Sbjct  208  CKTFRARIYNETNIDKSFATMRQKMCPLTT--GDDNLAPLDFQTPNVFDNNYYK  259



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score =   341 bits (875),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 190/230 (83%), Gaps = 1/230 (0%)
 Frame = +2

Query  104  QLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  283
            QL+TNFYS SCP LL+TVKS VKSAV+ + RMGAS+LRL FHDCFV GCDGSILLDDTSS
Sbjct  1    QLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSS  60

Query  284  FTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVK  463
            FTGE+ AGPN NS RGF VI+ IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNVK
Sbjct  61   FTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVK  120

Query  464  LGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVF  643
            +GRRD+KTAS +AANS  IP P+ +L+ LI+ F   GLS RDMVALSGAHTIG++RC  F
Sbjct  121  VGRRDAKTASQAAANSN-IPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  179

Query  644  RRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            R R+YNETNI+++FA  RQ++CP   GSGD NLAPLD  +   FDN+Y+K
Sbjct  180  RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFK  229



>gb|AFK45898.1| unknown [Lotus japonicus]
Length=330

 Score =   342 bits (878),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 194/236 (82%), Gaps = 2/236 (1%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S SAQLS NFY K CP +   VKSVV SAV KE RMG SLLRL FHDCFV GCDGS+LLD
Sbjct  28   SNSAQLSENFYVKKCPSVFNAVKSVVHSAVAKEARMGGSLLRLFFHDCFVNGCDGSVLLD  87

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSF GEKTA PN+NS+RGF+VID+IKS VE VCPGVVSCAD+V IAARDSV +LGGP 
Sbjct  88   DTSSFKGEKTAPPNSNSLRGFDVIDAIKSKVEAVCPGVVSCADVVAIAARDSVAILGGPY  147

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VKLGRRDSKTAS +AANSGVIP P ++L++LI++FQ +GLS +DMVALSGAHTIGKA+
Sbjct  148  WKVKLGRRDSKTASFNAANSGVIPSPFSSLSDLISKFQAQGLSTKDMVALSGAHTIGKAK  207

Query  632  CTVFRRRIYNET-NIDSSFAKTRQQTCPSQTGS-GDNNLAPLDFKTQAFFDNNYYK  793
            C+ FR+ +YNET NI+S FAK RQ+ CP  +G+  DNN+A LDFKT   FDN YYK
Sbjct  208  CSTFRQHVYNETNNINSLFAKARQRNCPRTSGTIRDNNVAVLDFKTPNQFDNLYYK  263



>tpe|CAH69372.1| TPA: class III peroxidase 130 precursor [Oryza sativa Japonica 
Group]
 gb|ABA91159.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ00524.1| hypothetical protein OsI_22542 [Oryza sativa Indica Group]
 gb|EAZ17186.1| hypothetical protein OsJ_32693 [Oryza sativa Japonica Group]
 dbj|BAH01350.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   342 bits (876),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 192/235 (82%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G +SAQLS +FYS SCP +   VK  ++SA+  EKR+GAS++RL FHDCFVQGCD S+LL
Sbjct  24   GGSSAQLSPSFYSYSCPGVFDAVKCGMQSAIANEKRIGASIVRLFFHDCFVQGCDASLLL  83

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+SFTGEK A PNN SVRGF VID+IKSAVE +CPGVVSCADI+ IAARDSV +LGGP
Sbjct  84   DDTASFTGEKMANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGP  143

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VK+GRRDS+TASLS AN+  IPPPT+ L NL + F  +GLS +DMVALSG+HTIG+A
Sbjct  144  SWDVKVGRRDSRTASLSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQA  202

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYNETNIDS FA +RQ  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  203  RCTNFRAHIYNETNIDSGFAMSRQSGCPRSSGSGDNNLAPLDLQTPTVFENNYYK  257



>ref|NP_200648.1| peroxidase [Arabidopsis thaliana]
 sp|Q9LVL1.1|PER68_ARATH RecName: Full=Peroxidase 68; Short=Atperox P68; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA96931.1| peroxidase [Arabidopsis thaliana]
 dbj|BAC42892.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAP40354.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED97048.1| peroxidase [Arabidopsis thaliana]
Length=325

 Score =   341 bits (875),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 188/230 (82%), Gaps = 0/230 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL T+FYS SCP LL TV+ VV+  V KE+R+ ASLLRL FHDCFV GCD SILLDDT 
Sbjct  28   AQLRTDFYSDSCPSLLPTVRRVVQREVAKERRIAASLLRLFFHDCFVNGCDASILLDDTR  87

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SF GEKTAGPNNNSVRG+ VID+IKS VE++CPGVVSCADI+ I ARDSV+L+GG  W+V
Sbjct  88   SFLGEKTAGPNNNSVRGYEVIDAIKSRVERLCPGVVSCADILAITARDSVLLMGGRGWSV  147

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRDS TAS S ANSGV+PPPT+TL+NLI  F+  GLS RDMVALSGAHTIG+ARC  
Sbjct  148  KLGRRDSITASFSTANSGVLPPPTSTLDNLINLFRANGLSPRDMVALSGAHTIGQARCVT  207

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            FR RIYN TNID SFA +R+++CP+ TGSGDNN A LD +T   FD +Y+
Sbjct  208  FRSRIYNSTNIDLSFALSRRRSCPAATGSGDNNAAILDLRTPEKFDGSYF  257



>emb|CDY02817.1| BnaC02g10720D [Brassica napus]
Length=320

 Score =   340 bits (873),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 187/229 (82%), Gaps = 0/229 (0%)
 Frame = +2

Query  104  QLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  283
             LS++FY++SCP L   V+ V++ AV KE+RM ASLLRL FHDCF+ GCDGSILLDDTSS
Sbjct  24   HLSSDFYAESCPSLFPAVRGVMQRAVAKERRMAASLLRLFFHDCFINGCDGSILLDDTSS  83

Query  284  FTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVK  463
            F GEKTAGPNNNSVRGF VID IKS VEK+CPGVVSCADIV I+ARDSV+LLGGP W+VK
Sbjct  84   FRGEKTAGPNNNSVRGFEVIDKIKSRVEKLCPGVVSCADIVAISARDSVLLLGGPRWSVK  143

Query  464  LGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVF  643
            LGRRDSK A  +AANSGVIP P +TL  LI RF+ +GLS RDMVALSGAHTIG+A C  F
Sbjct  144  LGRRDSKKAGFTAANSGVIPSPFSTLKTLINRFKAQGLSVRDMVALSGAHTIGQANCLTF  203

Query  644  RRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            R RIYNE+NID SFA +R++ CP+ +GSGDN  APLD  +   FD++YY
Sbjct  204  RNRIYNESNIDLSFALSRRKHCPATSGSGDNKKAPLDIGSPTRFDHSYY  252



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score =   340 bits (873),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 193/236 (82%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SAQLST FYS SCP LL+TVKS V+SAV+ E RMGAS+LRL FHDCFV GCDGSILL
Sbjct  22   GNVSAQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLXFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK+A PN NS RGF+VID+IK+AVE  CPGVVSCADI+ IAARDSVV LGGP
Sbjct  82   DDTSSFTGEKSANPNRNSARGFDVIDNIKTAVENACPGVVSCADILAIAARDSVVFLGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNVKLGRRDS TAS S AN+  IP P ++L+ L +RF   GLS  D+VALSG HTIG+A
Sbjct  142  SWNVKLGRRDSTTASQSQANND-IPGPNSSLSQLSSRFSALGLSNTDLVALSGGHTIGQA  200

Query  629  RCTVFRRRIY-NETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIY N +NI+S FA+TRQ  CP+ +GSGDNNLAPLD +T   FDNNY+K
Sbjct  201  RCTTFRSRIYSNSSNIESLFARTRQSNCPNTSGSGDNNLAPLDLQTPNSFDNNYFK  256



>ref|NP_001151940.1| peroxidase 52 precursor [Zea mays]
 gb|ACG45093.1| peroxidase 52 precursor [Zea mays]
Length=334

 Score =   340 bits (872),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 168/237 (71%), Positives = 192/237 (81%), Gaps = 3/237 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G++SAQLST FYS SCP +   VKSVV+SAV  E+RMGAS++RL FHDCFVQGCD S+LL
Sbjct  32   GTSSAQLSTGFYSSSCPGVYDAVKSVVQSAVASEQRMGASIVRLFFHDCFVQGCDASLLL  91

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEK A PNN SVRGF VID++KSAVEKVCPGVVSCADI+ IAARDSVV+LGGP
Sbjct  92   DDTPSFQGEKMANPNNGSVRGFEVIDAVKSAVEKVCPGVVSCADILAIAARDSVVILGGP  151

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VK+GRRDS TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+A
Sbjct  152  TWDVKVGRRDSTTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQA  210

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCP--SQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  +YN+TNID SFA+TRQ  CP  S   SGDNNLAPLD +T   FDNNYYK
Sbjct  211  RCTNFRAHVYNDTNIDGSFARTRQSGCPRSSSGSSGDNNLAPLDLQTPTVFDNNYYK  267



>gb|AAB48184.1| peroxidase precursor [Linum usitatissimum]
Length=323

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/234 (69%), Positives = 187/234 (80%), Gaps = 0/234 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G    QLST+FYS+SCP L+ TV+  V+SAV+KE R+ ASLLRLHFHDCFV GCDGSILL
Sbjct  22   GKCWGQLSTDFYSESCPMLMDTVRCEVESAVDKETRIAASLLRLHFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            +DT SFTGE+TA PNN SVRG+ VI+ IKS VE+VCPGVVSCADIV IAARDS V+ GG 
Sbjct  82   EDTDSFTGEQTAAPNNGSVRGYYVIEDIKSKVEQVCPGVVSCADIVAIAARDSTVIAGGQ  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VK+GRRDSKTAS +AANSGV+P PT++LN LI  F ++GLSA DMV LSG+HTIG A
Sbjct  142  SWEVKVGRRDSKTASFNAANSGVLPAPTSSLNELIKSFGDQGLSANDMVVLSGSHTIGVA  201

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RC  FR RIYNETNID SFA   ++ CP    SGD+NLAPLD KT   FDNNYY
Sbjct  202  RCVSFRDRIYNETNIDPSFASQSEENCPLAPNSGDDNLAPLDLKTPTSFDNNYY  255



>gb|EAY79693.1| hypothetical protein OsI_34840 [Oryza sativa Indica Group]
Length=329

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 192/235 (82%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G + AQLS +FYS SCP +   VK  ++SA+ +EKR+GAS++RL FHDCFVQGCD S+LL
Sbjct  29   GGSWAQLSPSFYSFSCPGVFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLLL  88

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+SFTGEKTA PNN SVRGF VID+IKSAVE +CPGVVSCADI+ IAARDSV +LGGP
Sbjct  89   DDTASFTGEKTANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGP  148

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VK+GRRDS+TASLS AN+  IPPPT+ L NL + F  +GLS +DMVALSG+HTIG+A
Sbjct  149  SWDVKVGRRDSRTASLSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQA  207

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYNETNIDS FA  RQ  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  208  RCTNFRAHIYNETNIDSGFAMRRQSGCPRNSGSGDNNLAPLDLQTPTVFENNYYK  262



>emb|CAD67477.1| peroxidase [Asparagus officinalis]
Length=315

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 189/234 (81%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S++AQLST FYS SCP +  T+K V++ A+ KEKRMGAS+LRL FHDCFV GCDGSILL 
Sbjct  16   SSNAQLSTTFYSNSCPNVFTTIKPVLQHAIEKEKRMGASILRLFFHDCFVNGCDGSILLA  75

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT  F GE+ A PNN S RGF VID IK+AVEK CPGVVSCADI+ IAARDSVV+LGGPN
Sbjct  76   DTPHFVGEQHANPNNRSARGFKVIDRIKTAVEKACPGVVSCADILAIAARDSVVILGGPN  135

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VKLGRRDS+TA+ +AAN+  IPPPT++L NL + F  KGLS +DMVALSGAHTIG+AR
Sbjct  136  WDVKLGRRDSRTANKTAANNE-IPPPTSSLANLTSLFAAKGLSTKDMVALSGAHTIGQAR  194

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR  IYN+++ID SFA  R+  CP Q+GSGD NLAPLD +T   FDNNYY+
Sbjct  195  CTSFRSHIYNDSDIDPSFATLRKSNCPKQSGSGDMNLAPLDLQTPTTFDNNYYR  248



>ref|XP_003602461.1| Peroxidase [Medicago truncatula]
 gb|AES72712.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score =   338 bits (867),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLSTNFYSK+CPKL  TVKS +++A++KE RMGAS+LRL FHDCFV GCDGSILL
Sbjct  22   GSANAQLSTNFYSKTCPKLSTTVKSTLQTAISKEARMGASILRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF+VID+IK+AVE VCPGVVSCADI+ IAA DSV +LGGP
Sbjct  82   DDTSSFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD+KTAS SAAN+  IP PT+ LN L + F   GLS++D+V LSGAHTIG+A
Sbjct  142  TWNVKLGRRDAKTASQSAANTA-IPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNI+++FA TRQ  CP  +GSGDNNLAPLD +T + FDNNY+K
Sbjct  201  RCTNFRARIYNETNINAAFASTRQSNCPKASGSGDNNLAPLDLQTPSSFDNNYFK  255



>gb|KHG25850.1| Peroxidase 4 [Gossypium arboreum]
Length=323

 Score =   338 bits (867),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 196/233 (84%), Gaps = 1/233 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S++AQLST++YSKSCP L +TVK  V SA+ KE RMGASLLRL FHDCFV GCDGS+LLD
Sbjct  24   SSNAQLSTDYYSKSCPNLFSTVKFTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLD  83

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTSSFTGEK A PN NS RGF+VID IKSAVE VCPGVVSCADI+ IAARDSV LLGGPN
Sbjct  84   DTSSFTGEKNAVPNRNSARGFDVIDDIKSAVENVCPGVVSCADILAIAARDSVKLLGGPN  143

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VKLGRRD+++AS +AAN+G IP PT+ LN LI+RF   GLS RD+VALSGAHTIG+AR
Sbjct  144  WDVKLGRRDARSASRAAANNG-IPAPTSNLNRLISRFNALGLSTRDLVALSGAHTIGQAR  202

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            CT FR RIYNE+NID SFAKT+Q  CP  +GSGDNNLAPLD +T  +FDN Y+
Sbjct  203  CTSFRARIYNESNIDLSFAKTKQSNCPRSSGSGDNNLAPLDIQTPTYFDNKYF  255



>ref|XP_010256954.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=323

 Score =   338 bits (867),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 191/234 (82%), Gaps = 3/234 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SAQLS+ +YS SCP+ L+T+KS V SAV KE+RMGASLLRLHFHDCFV GCDGSILL
Sbjct  25   GTASAQLSSTYYSTSCPEALSTIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDGSILL  84

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+SFTGEKTA PN NS+RGF+VID+IKS VE VC GVVSCADI+ +AARDSVV LGGP
Sbjct  85   DDTTSFTGEKTATPNANSLRGFDVIDTIKSQVESVCAGVVSCADILAVAARDSVVALGGP  144

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRD+ TASLSAANS  IP PT  L+ LI+ F NKG +A++MVALSGAHTIG+A
Sbjct  145  TWTVQLGRRDATTASLSAANSD-IPAPTLDLSGLISAFSNKGFTAKEMVALSGAHTIGQA  203

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNETNI+SSFA + +  CPS    GDNNL+PLD  +   FDN Y+
Sbjct  204  RCTSFRDRIYNETNINSSFATSLKSKCPS--AGGDNNLSPLDATSATTFDNAYF  255



>ref|XP_003602463.1| Peroxidase [Medicago truncatula]
 gb|AES72714.1| horseradish peroxidase-like protein [Medicago truncatula]
Length=322

 Score =   338 bits (866),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 196/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLST+FYS SCPKL +TV+S V+SA++ E RMGAS+LRL FHDCFV GCDGSILL
Sbjct  22   GSANAQLSTSFYSSSCPKLSSTVQSTVQSAISNEARMGASILRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEK A PN NS RGF+VID+IK+AVE VCPGVVSCADI+ IAA DSV +LGGP
Sbjct  82   DDTSNFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD+KTAS SAAN+  IP PT+ LN L + F   GLS++D+V LSGAHTIG+A
Sbjct  142  TWNVKLGRRDAKTASQSAANTA-IPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID+SFA TRQ  CP+ +GSGDNNLAPLD +T   FDNNY+K
Sbjct  201  RCTTFRARIYNETNIDTSFASTRQSNCPNTSGSGDNNLAPLDLQTPTSFDNNYFK  255



>ref|NP_001065971.1| Os12g0112000 [Oryza sativa Japonica Group]
 tpe|CAH69377.1| TPA: class III peroxidase 135 precursor [Oryza sativa Japonica 
Group]
 gb|ABA96259.1| Peroxidase 52 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28990.1| Os12g0112000 [Oryza sativa Japonica Group]
 gb|EAZ19424.1| hypothetical protein OsJ_34981 [Oryza sativa Japonica Group]
 dbj|BAG91443.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK99332.1| peroxidase [Oryza sativa Japonica Group]
Length=327

 Score =   338 bits (866),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 191/235 (81%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G + AQLS +FYS SCP +   VK  ++SA+ +EKR+GAS++RL FHDCFVQGCD S+LL
Sbjct  27   GGSWAQLSPSFYSYSCPGVFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLLL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+SFTGEKTA PNN SVRGF VID+IKSAVE +CPGVVSCADI+ IAARDSV +LGGP
Sbjct  87   DDTASFTGEKTANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VK+GRRDS+TASLS AN+  IPPPT+ L NL + F  + LS +DMVALSG+HTIG+A
Sbjct  147  SWDVKVGRRDSRTASLSGANNN-IPPPTSGLANLTSLFAAQALSQKDMVALSGSHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYNETNIDS FA  RQ  CP  +GSGDNNLAPLD +T   F+NNYYK
Sbjct  206  RCTNFRAHIYNETNIDSGFAMRRQSGCPRNSGSGDNNLAPLDLQTPTVFENNYYK  260



>ref|XP_004490701.1| PREDICTED: peroxidase 4-like [Cicer arietinum]
Length=335

 Score =   337 bits (865),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 187/236 (79%), Gaps = 1/236 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+  A+LS N Y K CP +   + SVV SAV KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  33   GNCCAELSENLYVKKCPNVFNAINSVVHSAVAKEPRMGASLLRLFFHDCFVNGCDGSVLL  92

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSS  GEK AGPN +S+RGF VID+IKS VE +CPGVVSCADI+ I ARDSVV LGGP
Sbjct  93   DDTSSIKGEKNAGPNKDSLRGFEVIDAIKSKVEALCPGVVSCADILAITARDSVVNLGGP  152

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W VKLGRRDSK AS + ANSGVIPPP +TL NLI+RFQ +GLS +DMVALSGAHTIGKA
Sbjct  153  YWKVKLGRRDSKRASFNDANSGVIPPPFSTLKNLISRFQAQGLSTKDMVALSGAHTIGKA  212

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGS-GDNNLAPLDFKTQAFFDNNYYK  793
            RC V+R  IYN+TNIDS FAK+R++ CP  +GS  DNN+A LDFKT   FDN YYK
Sbjct  213  RCIVYRDHIYNDTNIDSLFAKSRKRNCPRTSGSIKDNNVAVLDFKTPNHFDNLYYK  268



>ref|XP_006843744.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
 gb|ERN05419.1| hypothetical protein AMTR_s00007p00229000 [Amborella trichopoda]
Length=318

 Score =   337 bits (864),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/234 (68%), Positives = 187/234 (80%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S+ AQL+ ++Y+ SCPK L T++S VKSA++ +KR+GA LLRL FHDCFV GCDGS+LLD
Sbjct  19   SSYAQLTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLD  78

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTS+F GEK A PN NS RGFN++D+IKSAVEK CPGVVSCAD + +AARDSVVLLGGP+
Sbjct  79   DTSTFIGEKNAAPNRNSARGFNIVDNIKSAVEKACPGVVSCADTLAVAARDSVVLLGGPD  138

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VKLGRRD++TAS +AAN+  IPPPT  LN LI  F N+GLS +DMVALSG HTIG AR
Sbjct  139  WQVKLGRRDARTASQAAANNS-IPPPTFNLNQLINSFANQGLSQKDMVALSGGHTIGVAR  197

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            C   R RIYNETNID SFAKTRQ  CP   GSGDNN+ PLD +T   FDN Y+K
Sbjct  198  CINIRNRIYNETNIDPSFAKTRQSNCPRTAGSGDNNVNPLDLQTPTAFDNKYFK  251



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 192/232 (83%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLS+NFY+ +CP+ LAT+KS V SAV+KE RMGASLLRLHFHDCFV GCD SILLDDT
Sbjct  27   SAQLSSNFYATTCPRALATIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASILLDDT  86

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            ++ TGEKTAGPNNNSVRG+ VID+IKS +E +CP VVSCADIV +AARDSVV LGGP+W+
Sbjct  87   ANITGEKTAGPNNNSVRGYEVIDTIKSQLESLCPAVVSCADIVAVAARDSVVALGGPSWS  146

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V LGRRDS TASL+AANS  IP PT +L+ LI+ F NKG +A++MVALSG+HTIG+ARCT
Sbjct  147  VLLGRRDSTTASLNAANSN-IPAPTLSLSGLISAFSNKGFTAKEMVALSGSHTIGQARCT  205

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR RIYNET ID SFA + +  CPS TG GDNNL+PLD  +   FDN YYK
Sbjct  206  TFRSRIYNETTIDPSFATSLRANCPS-TG-GDNNLSPLDTTSPTSFDNAYYK  255



>ref|XP_006664870.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=323

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 188/233 (81%), Gaps = 1/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            +SAQLS +FYS SCP +L  VK  ++SA+ +EKR+GAS++RL FHDCFVQGCD S+LLDD
Sbjct  25   SSAQLSASFYSYSCPGVLDVVKGGMQSAIAQEKRIGASIVRLFFHDCFVQGCDASLLLDD  84

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            T SF GEKTA PNN SVRGF VID+IKSAVE +CP VVSCADI+ IAARDSV +LGGP+W
Sbjct  85   TPSFQGEKTATPNNGSVRGFEVIDAIKSAVETICPAVVSCADILAIAARDSVAILGGPSW  144

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDS+TAS S AN+  IPPPT+ L NL + F  +GLS  DMVALSG+HTIG+ARC
Sbjct  145  DVKLGRRDSRTASFSGANNN-IPPPTSGLANLTSFFAAQGLSQTDMVALSGSHTIGQARC  203

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR  IYNETNID  FA  RQ  CPS +GSGD+NLAPLD +T   F+NNYYK
Sbjct  204  TNFRAHIYNETNIDGGFAMMRQSGCPSTSGSGDSNLAPLDLQTPTVFENNYYK  256



>ref|XP_009132056.1| PREDICTED: peroxidase 68-like [Brassica rapa]
Length=324

 Score =   335 bits (860),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 191/234 (82%), Gaps = 1/234 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            + AQLS++FY +SCP L   V+  V+ AV +E+RM ASLLRL FHDCFV GCDGSILLDD
Sbjct  24   SHAQLSSDFYKESCPSLFYAVRREVQRAVTRERRMAASLLRLFFHDCFVNGCDGSILLDD  83

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSS  GEKTAGPNNNSVRGF+V+D IKS VE++CPGVVSCADI+ I ARDSV+LL GP W
Sbjct  84   TSSSMGEKTAGPNNNSVRGFDVVDKIKSRVERLCPGVVSCADILAIIARDSVLLLDGPGW  143

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDS TAS + ANSGVIPPPT+TL+NLI RF+ +GLS+RDMVALSGAHTIG+ARC
Sbjct  144  SVKLGRRDSTTASFTTANSGVIPPPTSTLDNLINRFRAQGLSSRDMVALSGAHTIGQARC  203

Query  635  TVFRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
              FR RIYNE+ NI+ SFA +RQ++C + +GS DNN A LD  +   FD NYY+
Sbjct  204  VTFRDRIYNESNNIELSFALSRQRSCSAASGSSDNNEATLDIHSPGRFDLNYYR  257



>gb|ABO77632.1| peroxidase [Medicago truncatula]
Length=322

 Score =   335 bits (859),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 196/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS +AQLSTNFYSK+CPKL  TVKS +++A++KE RMGAS+LRL FHDCFV GCDGSILL
Sbjct  22   GSANAQLSTNFYSKTCPKLSTTVKSTLQTAISKEARMGASILRLFFHDCFVNGCDGSILL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK A PN NS RGF+VID+IK+AVE VCPGVVSCADI+ IAA DSV +LGGP
Sbjct  82   DDTSSFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             WNVKLGRRD+KTAS SAAN+  IP PT+ LN L + F   GLS++D+V LSGAHTIG+A
Sbjct  142  TWNVKLGRRDAKTASQSAANTA-IPAPTSNLNTLTSMFSAVGLSSKDLVTLSGAHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNI+++ A TRQ  CP  +GSGDNNLAPLD +T + FDNNY+K
Sbjct  201  RCTNFRARIYNETNINAAXASTRQSNCPKASGSGDNNLAPLDLQTPSSFDNNYFK  255



>emb|CDX88673.1| BnaA03g09760D [Brassica napus]
Length=366

 Score =   337 bits (863),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 190/232 (82%), Gaps = 1/232 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQLS++FY +SCP L   V+  V+ AV +E+RM ASLLRL FHDCFV GCDGSILLDDTS
Sbjct  26   AQLSSDFYKESCPSLFYAVRREVQRAVTRERRMAASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            S  GEKTAGPNNNSVRGF+V+D IKS VE++CPGVVSCADI+ I ARDSV+LL GP W+V
Sbjct  86   SSMGEKTAGPNNNSVRGFDVVDKIKSRVERLCPGVVSCADILAIIARDSVLLLDGPGWSV  145

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRDS TAS + ANSGVIPPPT+TL+NLI RF+ +GLS+RDMVALSGAHTIG+ARC  
Sbjct  146  KLGRRDSTTASFTTANSGVIPPPTSTLDNLINRFRAQGLSSRDMVALSGAHTIGQARCVT  205

Query  641  FRRRIYNET-NIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNE+ NI+ SFA +RQ++C + +GS DNN A LD  +   FD NYY+
Sbjct  206  FRDRIYNESNNIELSFALSRQRSCSAASGSSDNNEATLDIHSPGRFDLNYYR  257



>ref|XP_006662662.1| PREDICTED: peroxidase 4-like [Oryza brachyantha]
Length=324

 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 187/235 (80%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G +S QLS +FYS SCP +   VK  ++SA+ +EKR+GAS++RL FHDCFVQGCD S+LL
Sbjct  24   GGSSVQLSESFYSYSCPGVFDAVKGGMQSAIAQEKRIGASIVRLFFHDCFVQGCDASLLL  83

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEKTA PNN SVRGF VID+IKSAVE +CP VVSCADI+ IAARDSV +LGGP
Sbjct  84   DDTPSFQGEKTATPNNGSVRGFEVIDAIKSAVETICPAVVSCADILAIAARDSVAILGGP  143

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VKLGRRDS+TAS S AN+  IPPPT+ L NL + F  +GLS  DMVALSG+HTIG+A
Sbjct  144  SWDVKLGRRDSRTASFSGANNN-IPPPTSGLANLTSFFAAQGLSQTDMVALSGSHTIGQA  202

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYNETNID  FA  RQ  CPS +GSGD+NLAPLD +T   F+NNYYK
Sbjct  203  RCTNFRAHIYNETNIDVGFAMMRQSGCPSTSGSGDSNLAPLDLQTPTVFENNYYK  257



>gb|EPS59568.1| hypothetical protein M569_15235, partial [Genlisea aurea]
Length=314

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLS ++Y  SCP L ATV+SVV+SAV  E R+GASLLRL FHDCFV GCDGS+LL
Sbjct  14   GSSSAQLSVDYYCDSCPDLFATVRSVVESAVQAEARIGASLLRLFFHDCFVNGCDGSVLL  73

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT SF GEK A PN NS RGF+V+D IKSAVE VCPGVVSCADI+ +A+RDSV +LGGP
Sbjct  74   DDTPSFRGEKGALPNLNSARGFDVVDRIKSAVENVCPGVVSCADILAVASRDSVGILGGP  133

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VKLGRRD++TAS++AAN+  IPPPT+ LN LI+ F +KGLS  D+V LSG+HTIG+A
Sbjct  134  SWDVKLGRRDARTASITAANTS-IPPPTSNLNALISSFSSKGLSLNDLVVLSGSHTIGQA  192

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNI   FA+ R+  CP   G GD NLAPLD +T   FDNNYYK
Sbjct  193  RCTSFRTRIYNETNIAQDFAQLRRNGCPRPAGVGDGNLAPLDLQTPTRFDNNYYK  247



>ref|XP_006843746.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
 gb|ERN05421.1| hypothetical protein AMTR_s00007p00230210 [Amborella trichopoda]
Length=318

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 187/234 (80%), Gaps = 1/234 (0%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S+ AQL+ ++Y+ SCPK L T++S VKSA++ +KR+GA LLRL FHDCFV GCDGS+LLD
Sbjct  19   SSYAQLTPHYYAYSCPKALPTIRSAVKSAISNDKRVGAQLLRLFFHDCFVNGCDGSLLLD  78

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTS+F GEK A PN NS RGFN++D+IKSAVEK CPGVVSCAD + +AARDSVVLLGGP+
Sbjct  79   DTSTFIGEKNAQPNRNSARGFNIVDNIKSAVEKACPGVVSCADTLAVAARDSVVLLGGPD  138

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W VKLGRRD++TAS +AAN+  IPPPT  LN LI  F N+GLS +DMVALSG HT+G AR
Sbjct  139  WQVKLGRRDARTASQAAANNS-IPPPTFNLNQLINSFANQGLSQKDMVALSGGHTLGVAR  197

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            C   R RIYNETNID SFAKTRQ  CP   GSGDNN+ PL+ +T   FDN Y+K
Sbjct  198  CINIRDRIYNETNIDPSFAKTRQSNCPRTAGSGDNNVNPLELQTPTAFDNKYFK  251



>ref|XP_002285723.1| PREDICTED: cationic peroxidase 1 isoform X1 [Vitis vinifera]
Length=317

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 193/235 (82%), Gaps = 4/235 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G   AQLS+NFY+ SCPK L+T+++ V +AV KE+RMGASLLRLHFHDCFV GCD SILL
Sbjct  18   GMAHAQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+SFTGEKTAGPN +SVRG+ VID+IKS VE +CPGVVSCADIV +AARDSVV LGGP
Sbjct  78   DDTASFTGEKTAGPNKDSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W ++LGRRDS TASLS ANS  +P P + L+ LI+RF NKG + ++MVALSG HTIGKA
Sbjct  138  TWTLQLGRRDSTTASLSTANSD-LPGPASDLSTLISRFSNKGFTTKEMVALSGTHTIGKA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID++FA ++Q+ CPS TG GDNNL+ LD +T   FDN Y++
Sbjct  197  RCTSFRSRIYNETNIDAAFATSKQKICPS-TG-GDNNLSDLD-ETTTVFDNVYFR  248



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   333 bits (854),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 196/235 (83%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLS+ FY+K+CP  L+T+KS V SAVN E+RMGASLLRLHFHDCFVQGCD S+LL
Sbjct  44   GIVSAQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLL  103

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPN  S+RGF+VID+IKS VE +CPGVVSCADI+ +AARDSVV LGG 
Sbjct  104  DDTSSFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGT  163

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS TASLS+ANS  +P PT++L+ LI+ F NKG S++++VALSG+HTIG+A
Sbjct  164  TWTVQLGRRDSTTASLSSANSD-LPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQA  222

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            +C+ FR RIYN+TNIDSSFAK+ Q  CPS TG GD+NLAPLD  +   FDN Y+K
Sbjct  223  QCSSFRTRIYNDTNIDSSFAKSLQGNCPS-TG-GDSNLAPLDTTSPNTFDNAYFK  275



>ref|NP_001169614.1| uncharacterized protein LOC100383495 precursor [Zea mays]
 gb|ACN34270.1| unknown [Zea mays]
Length=332

 Score =   333 bits (853),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 191/237 (81%), Gaps = 4/237 (2%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            ++SAQLST FYS SCP +   V+SV+++A+ +E+RMGAS+LRL FHDCFVQGCD S+LLD
Sbjct  30   TSSAQLSTGFYSHSCPGVHDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLLD  89

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DT SF GEK A PNN SVRGF VID+IKSAV+K CPGVVSCADI+ IAARDSVV LGGPN
Sbjct  90   DTPSFQGEKMAKPNNGSVRGFEVIDAIKSAVDKACPGVVSCADILAIAARDSVVTLGGPN  149

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W+VKLGRRDS+TAS S AN+  IPPPT+ L NL + F  +GLS +DMVALSGAHTIG+AR
Sbjct  150  WDVKLGRRDSRTASFSGANNN-IPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQAR  208

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGS---GDNNLAPLDFKTQAFFDNNYYK  793
            CT FR  +YN+TNID +FA+ R+  CP+   S   GDNNLAPLD +T   F+N+YY+
Sbjct  209  CTNFRAHVYNDTNIDGAFARARRSVCPAAASSGSGGDNNLAPLDLQTPTVFENDYYR  265



>ref|XP_010653358.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=325

 Score =   332 bits (852),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 185/234 (79%), Gaps = 3/234 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQL+TNFY+K+CP  L+ +KS V SAV  E RMGASLLRLHFHDCFV GCD SILL
Sbjct  27   GMASAQLTTNFYAKTCPNALSIIKSAVNSAVKSEARMGASLLRLHFHDCFVNGCDASILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEKTAGPN NSVRG+ V+D+IKS +E  CPGVVSCADI+ +AARDSVV L GP
Sbjct  87   DDTSNFTGEKTAGPNANSVRGYEVVDTIKSQLEASCPGVVSCADILAVAARDSVVALRGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V+LGRRDS TASLSAANS  IP PT  L+ LI+ F NKG +AR+MVALSG+HTIG+A
Sbjct  147  SWMVRLGRRDSTTASLSAANSN-IPAPTLNLSGLISAFTNKGFNAREMVALSGSHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNE NID+SF  + Q  CPS    GDN L+PLD +T   FDN YY
Sbjct  206  RCTTFRTRIYNEANIDASFKTSLQANCPSS--GGDNTLSPLDTQTPTTFDNAYY  257



>ref|XP_010067586.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=322

 Score =   332 bits (851),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 190/234 (81%), Gaps = 1/234 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G T AQLST+FY+K+CPKL  TVK +V++A+  E RMGASLLRL FHDCFV GCDGS LL
Sbjct  22   GGTRAQLSTDFYAKTCPKLFPTVKKIVRAAIANETRMGASLLRLFFHDCFVNGCDGSNLL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +FTGEK A PN NS+RGF+V+D IKSAVEKVCP +VSCAD++ I ARDSV +LGGP
Sbjct  82   DDTPTFTGEKNAMPNQNSLRGFDVVDRIKSAVEKVCPSIVSCADLLAIIARDSVGILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRD++TAS +AAN+  IPPPT  L+ LI+ FQN+GLS +D+VAL G HTIG+A
Sbjct  142  MWDVKLGRRDARTASQAAANNS-IPPPTNNLSALISSFQNQGLSLKDLVALYGGHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNE+N+DSSFA+  +  CP  TG GDNNLA LDF++   FDN+YY
Sbjct  201  RCTNFRARIYNESNLDSSFARVAKSNCPRVTGVGDNNLAGLDFQSATSFDNSYY  254



>ref|XP_010264472.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=325

 Score =   332 bits (851),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 191/235 (81%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLS+ +Y  SCPK  +T+KS V +AV KEKRMGASLLRLHFHDCFV GCDGSILL
Sbjct  27   GMVSAQLSSTYYDTSCPKAFSTIKSGVTAAVAKEKRMGASLLRLHFHDCFVNGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA  N NSVRGF+VID+IKS VE VCPGVVSCADI+ +AARDSVV LGGP
Sbjct  87   DDTSSFTGEKTATANANSVRGFDVIDTIKSKVESVCPGVVSCADILAVAARDSVVALGGP  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V+LGRRD+ TASLSAANS  IP PT  L++L + F  KGL+A++MVALSGAHTIG+A
Sbjct  147  SWTVQLGRRDATTASLSAANSD-IPAPTLDLSDLTSAFSKKGLTAKEMVALSGAHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNI+SS A + +  CPS TG GD+NL+PLD  +   FDN Y+K
Sbjct  206  RCTSFRSRIYNETNINSSLATSLKSNCPS-TG-GDSNLSPLDATSPTAFDNAYFK  258



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   331 bits (848),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 193/235 (82%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLS+ FY K+CP  L+T+KS V SAVN E+RMGASLLRLHFHDCFVQGCD S+LL
Sbjct  18   GIVSAQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSF GEKTAGPN  S+RGFNVID+IKS VE +CPGVVSCADI+ +AARDSVV LGGP
Sbjct  78   DDTSSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS TASLS+ANS  +P PT++L+ LI+ F NKG S++++VALSG+HTIG+A
Sbjct  138  TWTVQLGRRDSTTASLSSANSD-LPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            +C+ FR RIYN+TNIDSSFAK+ Q  CPS TG G + LAPLD  +   FDN Y+K
Sbjct  197  QCSSFRTRIYNDTNIDSSFAKSLQGNCPS-TGGG-STLAPLDTTSPNTFDNAYFK  249



>emb|CBI19220.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 193/235 (82%), Gaps = 4/235 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G   AQLS+NFY+ SCPK L+T+++ V +AV KE+RMGASLLRLHFHDCFV GCD SILL
Sbjct  18   GMAHAQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+SFTGEKTAGPN +SVRG+ VID+IKS VE +CPGVVSCADIV +AARDSVV LGGP
Sbjct  78   DDTASFTGEKTAGPNKDSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W ++LGRRDS TASLS ANS  +P P + L+ LI+RF NKG + ++MVALSG HTIGKA
Sbjct  138  TWTLQLGRRDSTTASLSTANSD-LPGPASDLSTLISRFSNKGFTTKEMVALSGTHTIGKA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNID++FA ++Q+ CPS TG GDNNL+ LD +T   FDN Y++
Sbjct  197  RCTSFRSRIYNETNIDAAFATSKQKICPS-TG-GDNNLSDLD-ETTTVFDNVYFR  248



>ref|XP_010653359.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=326

 Score =   331 bits (848),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/234 (69%), Positives = 185/234 (79%), Gaps = 3/234 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQL+TN+YS SCP  L+ +KS V +AVN E RMGASLLRLHFHDCFV GCD SILL
Sbjct  28   GMASAQLTTNYYSSSCPNALSIIKSAVNTAVNNEARMGASLLRLHFHDCFVNGCDASILL  87

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEKTA PN NSVRGF+VID+IKS VE  CPGVVSCADI+ + ARDSVV LGGP
Sbjct  88   DDTSNFTGEKTAVPNANSVRGFDVIDTIKSQVESSCPGVVSCADILAVVARDSVVALGGP  147

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V+LGRRDS TASLS ANS  IP PT  L+ LI+ F NKG SA +MVALSG+HTIG+A
Sbjct  148  SWTVRLGRRDSTTASLSTANSD-IPAPTLNLSGLISSFSNKGFSANEMVALSGSHTIGQA  206

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR R+YNETNID+SF  + Q  CPS    GDNNL+PLD K+   FDN Y+
Sbjct  207  RCTNFRDRLYNETNIDASFQSSLQANCPSS--GGDNNLSPLDTKSPTTFDNAYF  258



>ref|XP_006842420.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
 gb|ERN04095.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
Length=315

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 186/231 (81%), Gaps = 3/231 (1%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQLS+ FY+ SCP  L+T+++ V+SAVN E RMGASLLRLHFHDCFV GCDGS+LLDD +
Sbjct  21   AQLSSTFYNSSCPNALSTIQTAVRSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDNA  80

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            +FTGEKTA PNNNSVRGF V+D+IKS +E +CPGVVSCADI+ +AARDSVV+LGGP W V
Sbjct  81   TFTGEKTARPNNNSVRGFEVVDNIKSQLESLCPGVVSCADILAVAARDSVVVLGGPTWTV  140

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
             LGRRDS TASLS ANS  IP P+ +L+ LIT F NKGLS+ +MVALSG+HTIG+ARCT 
Sbjct  141  LLGRRDSTTASLSTANSD-IPAPSLSLSGLITSFSNKGLSSSEMVALSGSHTIGQARCTT  199

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR  IYNETNIDS++A + +  CP     GDNNL+PLD  +   FDN YYK
Sbjct  200  FRTHIYNETNIDSTYATSLKSNCPFS--GGDNNLSPLDVTSPTVFDNAYYK  248



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/234 (69%), Positives = 192/234 (82%), Gaps = 3/234 (1%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S   QLS  FY+KSCP +L+TVKS VK AV KE RMGASLLRLHFHDCFV GCDGSILLD
Sbjct  19   SAYGQLSPTFYAKSCPNVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSILLD  78

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            D+S+ TGEKTA PN NS RGF+VID+IKS VE VC GVVSCADI+TIAARDSVV LGGP+
Sbjct  79   DSSTLTGEKTAVPNANSARGFDVIDNIKSQVEAVCSGVVSCADILTIAARDSVVELGGPS  138

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W V LGRRDS+TASLS AN+  IPPPT++L NL+++FQ +GLS +DMVAL+G HTIG+AR
Sbjct  139  WAVPLGRRDSRTASLSGANNN-IPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTIGQAR  197

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR  IYN+TNID+++A + +  CP +TGS DNN++PLD  T   FDNNY+K
Sbjct  198  CTSFRAHIYNDTNIDTTYANSLKAKCP-RTGS-DNNISPLDVVTPTSFDNNYFK  249



>ref|XP_010066394.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   329 bits (844),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 189/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SAQLS+ FYSKSCP  L T+KS V SAV+ E RMGASLLRLHFHDCFV GCD SILL
Sbjct  21   GTASAQLSSTFYSKSCPSALRTIKSGVSSAVSSEARMGASLLRLHFHDCFVNGCDASILL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEKTAG NNNS+RG+ VID+IKS +E  CPGVVSCADI+ IAARDSVV LGGP
Sbjct  81   DDTTNFTGEKTAGANNNSIRGYEVIDTIKSHLESSCPGVVSCADILAIAARDSVVALGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TASL+ ANS  IP PT +L++LIT F NKG +A++MVALSG+HTIG+A
Sbjct  141  SWTVLLGRRDSTTASLTDANSD-IPAPTLSLSDLITSFSNKGFTAKEMVALSGSHTIGQA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR R+YNE +I+++FA +    CPS    GDNNL+PLD  +  +FDN Y+K
Sbjct  200  RCTSFRTRLYNENDINATFATSLNANCPSS--GGDNNLSPLDTTSPTYFDNAYFK  252



>ref|XP_010453676.1| PREDICTED: peroxidase 67-like [Camelina sativa]
Length=324

 Score =   329 bits (844),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 193/233 (83%), Gaps = 0/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            + AQL++++Y +SCP L   V+ VV+ AV +E RMGASLLRL FHDCFV GCDGSILLDD
Sbjct  25   SEAQLNSDYYKESCPTLFYVVRRVVRRAVAREPRMGASLLRLFFHDCFVNGCDGSILLDD  84

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            T+SF GEKTAGP+NNSVRGF VID IKS VE +CPG+VSCAD++ IAARDSV+LLGGP W
Sbjct  85   TTSFVGEKTAGPSNNSVRGFEVIDKIKSTVESLCPGIVSCADLLAIAARDSVLLLGGPGW  144

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDS TA+ +AANSGVIP P +TL+NLI RF+ +GLS RDMVALSGAHTIGKA+C
Sbjct  145  SVKLGRRDSMTANFAAANSGVIPSPISTLSNLINRFKAQGLSTRDMVALSGAHTIGKAKC  204

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
              FR RIYNE+NI+ SFA +R++ CP+  GSGD+ +A LD ++   FD++YYK
Sbjct  205  ATFRNRIYNESNINPSFAMSRRERCPAANGSGDDKVADLDIRSPKMFDHSYYK  257



>gb|ABR23054.1| basic peroxidase swpb4 [Ipomoea batatas]
Length=320

 Score =   329 bits (844),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 188/231 (81%), Gaps = 1/231 (0%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLS  FYSKSCPKL  TV SVV+SA+ KE RMGASLLRL FHDCFV GCDGSILLDDT
Sbjct  23   SAQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDT  82

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            SSFTGEK A PN  S RGF VID IKSAVEKVCPGVVSCADI+ IA+RDS V LGGP+WN
Sbjct  83   SSFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWN  142

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            VKLGRRD++ AS +AAN+  IP PT+ LN LI+ F   GLS  DMV LSG+HTIG+ARCT
Sbjct  143  VKLGRRDARAASQAAANNS-IPAPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCT  201

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
             FR RIYNE+NIDSSFA++R+  CP  +GSGDNNLAPLD +T   FDNNYY
Sbjct  202  NFRARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYY  252



>ref|XP_006279655.1| hypothetical protein CARUB_v10026803mg [Capsella rubella]
 gb|EOA12553.1| hypothetical protein CARUB_v10026803mg [Capsella rubella]
Length=316

 Score =   329 bits (844),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 190/233 (82%), Gaps = 0/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            + AQL+++FY +SCP L   V+ VV  AV +E RMGASLLRL FHDCFV GCDGS+LLDD
Sbjct  17   SEAQLNSDFYKESCPSLFHVVRRVVHRAVAREPRMGASLLRLFFHDCFVNGCDGSLLLDD  76

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            T SF GEKTAGP+NNSVRG+ VID IK  VEK+CPG+VSCADI+ I ARDSV+LLGGP W
Sbjct  77   TPSFLGEKTAGPSNNSVRGYEVIDKIKFKVEKICPGIVSCADILAITARDSVLLLGGPGW  136

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDS TA+ +AANSGVIP P +TLNNLI RF+ +GLS RDMV LSGAHTIGKA+C
Sbjct  137  SVKLGRRDSTTANFAAANSGVIPSPASTLNNLINRFRAQGLSTRDMVVLSGAHTIGKAKC  196

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
              FR RIYNE+NI+ SFA +R+++CP+  GSGDN +A LD ++   FD++YYK
Sbjct  197  VTFRNRIYNESNINPSFAMSRRKSCPAANGSGDNKVANLDVRSPEMFDHSYYK  249



>ref|XP_010443567.1| PREDICTED: peroxidase 67 [Camelina sativa]
Length=324

 Score =   329 bits (844),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 192/233 (82%), Gaps = 0/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            + AQL++++Y +SCP L   V+ VV+ AV +E RMGASLLRL FHDCFV GCDGSILLDD
Sbjct  25   SEAQLNSDYYKESCPTLFYVVRRVVRRAVAREPRMGASLLRLFFHDCFVNGCDGSILLDD  84

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            T SF GEKTAGP+NNSVRGF VID IKS VE +CPG+VSCAD++ IAARDSV+LLGGP W
Sbjct  85   TPSFVGEKTAGPSNNSVRGFEVIDKIKSTVESLCPGIVSCADLLAIAARDSVLLLGGPGW  144

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDS TA+ +AANSGVIP P +TL+NLI RF+ +GLS RDMVALSGAHTIGKA+C
Sbjct  145  SVKLGRRDSTTANFAAANSGVIPSPISTLSNLINRFKAQGLSTRDMVALSGAHTIGKAKC  204

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
              FR RIYNE+NI+ SFA +R++ CP+  GSGDN +A LD ++   FD++YYK
Sbjct  205  ATFRNRIYNESNINPSFAMSRREKCPAANGSGDNKVADLDIRSPNMFDHSYYK  257



>ref|XP_006664869.1| PREDICTED: cationic peroxidase 1-like [Oryza brachyantha]
Length=317

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 186/232 (80%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLS NFY KSCP  L+T+++ V+SA+ KE RMGASLLRLHFHDCFV+GCDGS+LLDDT
Sbjct  22   SAQLSANFYDKSCPNALSTIRTAVRSAITKENRMGASLLRLHFHDCFVKGCDGSVLLDDT  81

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
             +FTGEKTA PNNNS+RGF+VID+IK+ +E +CP VVSCADI+ +AARDSVV LGGP W 
Sbjct  82   PTFTGEKTAAPNNNSLRGFDVIDNIKAQIEGICPQVVSCADILAVAARDSVVALGGPTWV  141

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V+LGRRDS TASL AAN+  IP PT  L +L   F NKGLSA DM+ALSGAHTIG+ARC 
Sbjct  142  VQLGRRDSTTASLDAANND-IPAPTLDLGDLNKSFSNKGLSATDMIALSGAHTIGQARCV  200

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR RIY+ETNIDSS A + +  CP+ T  GDNN++PLD  T   FDN YYK
Sbjct  201  NFRNRIYSETNIDSSLATSLKSNCPNTT--GDNNISPLDASTPYVFDNFYYK  250



>gb|ACJ11762.1| class III peroxidase [Gossypium hirsutum]
Length=323

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 187/232 (81%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            +AQLS+ FYS +CP+ L+T+KS V SAV+ E RMGASL RLHFHDCFV GCDGSILLDDT
Sbjct  28   TAQLSSTFYSTTCPRALSTIKSAVNSAVSNEARMGASLPRLHFHDCFVNGCDGSILLDDT  87

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            ++ TGEKTA PN+NS RGF VID+IKS VE +CPGVVSCADIV +AARDSVV LGGP+W 
Sbjct  88   ANMTGEKTAVPNSNSARGFEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPSWI  147

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V LGRRDS TASLSAANS  IP PT  L+ LIT F NKG +A++MVALSG+HTIG+ARCT
Sbjct  148  VLLGRRDSTTASLSAANSN-IPAPTLNLSGLITAFSNKGFTAKEMVALSGSHTIGQARCT  206

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR RIYNETNIDS+FA + +  CPS    GDN+L+PLD  +   FDN Y+K
Sbjct  207  TFRTRIYNETNIDSTFATSLRANCPSN--GGDNSLSPLDTTSSTSFDNAYFK  256



>ref|XP_009622973.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=320

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 191/232 (82%), Gaps = 3/232 (1%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            +SAQLS+++Y KSCPK + T+K  V +AV KE RMGASLLRLHFHDCFV GCDGS+LLDD
Sbjct  24   SSAQLSSDYYEKSCPKAIYTIKDAVTNAVAKEHRMGASLLRLHFHDCFVNGCDGSVLLDD  83

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TS FTGEKTA PN+NS+RGF++ID+IKS VEK+CPG+VSCADI+ IAARDSV +LGGP+W
Sbjct  84   TSDFTGEKTAKPNSNSLRGFDLIDTIKSQVEKLCPGIVSCADIIAIAARDSVAILGGPSW  143

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
             V+LGRRDS TASLS+ANS  IP P   L +LIT F NKG +A++MVAL+GAHTIG+A+C
Sbjct  144  TVQLGRRDSTTASLSSANSD-IPSPLMDLTDLITNFANKGFTAKEMVALAGAHTIGQAQC  202

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            T FR R+YNET IDSS A + +  CPS TG GD++L+ LD  T A FDN+Y+
Sbjct  203  TTFRERVYNETTIDSSLATSLKSNCPS-TG-GDDSLSALDAATPAIFDNHYF  252



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score =   327 bits (839),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 191/234 (82%), Gaps = 3/234 (1%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S++  LS NFYS SCP +L+ +K+ V SAV+ E RMGASLLRLHFHDCFV GCD S+LLD
Sbjct  19   SSAQSLSANFYSSSCPNVLSVIKTAVNSAVSSEARMGASLLRLHFHDCFVNGCDASVLLD  78

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTS+FTGEKTAGPN+ S+RGF+VID+IK+ VE  C G+VSCADI+ +AARDSVV LGGP+
Sbjct  79   DTSNFTGEKTAGPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGPS  138

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W V LGRRDS TASLSAANS  +P PT++L+ LI+ F NKGL+AR+MVALSG+HTIG+AR
Sbjct  139  WTVLLGRRDSTTASLSAANSN-LPGPTSSLSALISSFSNKGLTAREMVALSGSHTIGQAR  197

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            CT FR R+YNE NI++SFA T +  CP Q+G GDNNL+PLD  +   FDN YYK
Sbjct  198  CTTFRTRLYNEANINASFATTVKANCP-QSG-GDNNLSPLDITSPTSFDNAYYK  249



>emb|CAL25300.1| properoxidase [Picea abies]
Length=310

 Score =   327 bits (838),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 185/229 (81%), Gaps = 1/229 (0%)
 Frame = +2

Query  104  QLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  283
            QLS+ FY++SCP  L+ VK+ V+ AV  EKRMGASLLRLHFHDCFV GCDGS+LLDD+S+
Sbjct  15   QLSSTFYAQSCPTALSVVKAAVRQAVANEKRMGASLLRLHFHDCFVNGCDGSVLLDDSST  74

Query  284  FTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVK  463
             TGEKTA PN NS RGF+VID+IKS VEK C GVVSCADI+ I+ARDSVV LGGP+W V 
Sbjct  75   ITGEKTANPNANSARGFDVIDTIKSNVEKACSGVVSCADILAISARDSVVELGGPSWTVM  134

Query  464  LGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVF  643
            LGRRDS TAS + AN+  IPPPT++L+NLI+ FQ +GLS ++MVALSG HTIG+ARC  F
Sbjct  135  LGRRDSTTASKNGANNN-IPPPTSSLSNLISLFQAQGLSTKEMVALSGGHTIGQARCVNF  193

Query  644  RRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            R  IYNETNIDS+++ + Q  CPS  GSGD+NL+PLD+ T   FD NYY
Sbjct  194  RAHIYNETNIDSTYSTSLQSKCPSTAGSGDSNLSPLDYVTPTAFDKNYY  242



>ref|XP_010483436.1| PREDICTED: peroxidase 67-like [Camelina sativa]
Length=320

 Score =   327 bits (839),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            +QL++++Y +SCP L   V+ V++ AV +E RMGASLLRL FHDCFV GCDGSILLDDT 
Sbjct  23   SQLNSDYYKESCPTLFYVVRRVLRRAVAREPRMGASLLRLFFHDCFVNGCDGSILLDDTP  82

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SF GEKTAGP+NNSVRGF VID IKS VE +CPG+VSCAD++ IAARDSV+LLGGP W+V
Sbjct  83   SFLGEKTAGPSNNSVRGFEVIDKIKSTVESLCPGIVSCADLLAIAARDSVLLLGGPGWSV  142

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            KLGRRDS TA+ +AANSGVIP P +TL+NLI RF+ +GLS RDMVALSGAHTIGKA+C+ 
Sbjct  143  KLGRRDSTTANFAAANSGVIPSPISTLSNLINRFEAQGLSTRDMVALSGAHTIGKAKCST  202

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNE+NI+ SFA +R++ CP+  GSGD  +A LD ++   FD++YYK
Sbjct  203  FRNRIYNESNINPSFAMSRRERCPAANGSGDTKVADLDIRSPKMFDHSYYK  253



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score =   327 bits (837),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 188/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLS+ FYS SCPK LAT+KS V SAV+ E RMGASLLRLHFHDCFV GCD S+LL
Sbjct  19   GIASAQLSSTFYSSSCPKALATIKSAVDSAVSSEARMGASLLRLHFHDCFVNGCDASVLL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEKTAG N NS+RGF+V+D+IKS +E +CPGV SC+DI+ +AARDSVV LGGP
Sbjct  79   DDTANFTGEKTAGANANSLRGFDVVDTIKSQLESLCPGVFSCSDILAVAARDSVVALGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V+LGRRDS TASLSAAN+  IP PT  L+ L+T F NKG +A+++VALSG+HTIG+A
Sbjct  139  SWTVQLGRRDSTTASLSAANTN-IPAPTLNLSALLTSFSNKGFNAKELVALSGSHTIGQA  197

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR R+YNE NIDSSFA + +  CPS    GD NL+PLD  T   FDN Y+K
Sbjct  198  RCTTFRARLYNEANIDSSFATSLKANCPSS--GGDANLSPLDVTTPNKFDNAYFK  250



>dbj|BAM28608.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   327 bits (837),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 188/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SAQLS+ +Y  SCPK L+T++S V SA+ KE RMGASLLRLHFHDCFV GCDGS+LL
Sbjct  18   GAASAQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEKTA PN NS+RGF+VID+IK++VE VCPGVVSCADI+ + ARDSVV LGG 
Sbjct  78   DDTANFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQ  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TASLSAAN+  IP PT  L+ LI+ F NKGL+  +MVALSGAHTIG A
Sbjct  138  SWTVLLGRRDSTTASLSAANAN-IPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNIDSS+A + ++TCP  T  G NN APLD  +   FDN Y+K
Sbjct  197  RCTTFRSRIYNETNIDSSYATSLKKTCP--TSGGGNNTAPLDTTSPYTFDNAYFK  249



>ref|XP_004242492.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=314

 Score =   326 bits (836),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 189/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SA LS+++Y KSCPK + T+K+ V +AV  E+RMGASLLRLHFHDCFV GCD S+LL
Sbjct  16   GICSADLSSDYYEKSCPKAMYTIKNAVANAVTNERRMGASLLRLHFHDCFVNGCDASVLL  75

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT+ FTGEK+A PN+NS+RGF+VID IKS +EK+CPG+VSCADI+ +AARDSVVLLGGP
Sbjct  76   DDTTDFTGEKSAKPNSNSIRGFDVIDKIKSQIEKLCPGIVSCADIIAVAARDSVVLLGGP  135

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V+LGRRDS TASL  ANS  IP P+  LN+LIT F NKG +A++MVALSG HTIGKA
Sbjct  136  SWTVELGRRDSTTASLDTANSD-IPSPSLDLNDLITNFANKGFTAKEMVALSGGHTIGKA  194

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            +CT FR R+YNETNIDSS A + +  CPS TG GD+ L+ LD  T   FDN++YK
Sbjct  195  QCTTFRARVYNETNIDSSLATSLKSNCPS-TG-GDDTLSSLDATTPVLFDNHFYK  247



>ref|XP_010067587.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=322

 Score =   327 bits (837),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 187/234 (80%), Gaps = 1/234 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G TSAQLS   Y+++CP+L  TVKS+V++ + KE RMGASLLRL FHDCFV GCDGS LL
Sbjct  22   GGTSAQLSIYHYAETCPQLCPTVKSIVQAEIAKEARMGASLLRLFFHDCFVNGCDGSNLL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +FTGEK A PN NS+RGF V+D IK+AVE VCPGVVSCAD++ I +RD+V +LGGP
Sbjct  82   DDTPTFTGEKNAAPNRNSLRGFEVVDKIKAAVENVCPGVVSCADLLAIISRDAVEILGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRD++TAS +AAN+  IPPPT +LN LI+ FQN GLS +D+VAL GAHT+G+A
Sbjct  142  GWDVKLGRRDARTASQAAANNS-IPPPTDSLNALISGFQNHGLSQKDLVALYGAHTVGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNE+NIDSSFA+  +  CPS  G GDNNL  LDF++   FDN YY
Sbjct  201  RCTNFRARIYNESNIDSSFAEAMKSNCPSVAGVGDNNLDGLDFQSATSFDNTYY  254



>dbj|BAM28609.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 188/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SAQLS+ +Y  SCPK L+T++S V SA+ KE RMGASLLRLHFHDCFV GCDGS+LL
Sbjct  18   GAASAQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEKTA PN NS+RGF+VID+IK++VE VCPGVVSCADI+ + ARDSVV LGG 
Sbjct  78   DDTANFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQ  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TASLSAAN+  IP PT  L+ LI+ F NKGL+  +MVALSGAHTIG A
Sbjct  138  SWTVLLGRRDSTTASLSAANAN-IPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNIDSS+A + ++TCP  T  G NN APLD  +   FDN Y+K
Sbjct  197  RCTTFRSRIYNETNIDSSYATSLKKTCP--TSGGGNNTAPLDTTSPYTFDNAYFK  249



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 182/230 (79%), Gaps = 3/230 (1%)
 Frame = +2

Query  104  QLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  283
            QL   FY  SCP   + V SVV  AV KEKRMGASLLRLHFHDCFV GCDGSILLDDTS+
Sbjct  33   QLCPRFYDISCPSAFSIVNSVVTQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTST  92

Query  284  FTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVK  463
            F GEKTA PN NSVRGF VID+IK+ VE  CPGVVSCADIV IAARD+VV LGGP W V 
Sbjct  93   FQGEKTAVPNKNSVRGFEVIDAIKTQVEAACPGVVSCADIVAIAARDAVVQLGGPTWLVL  152

Query  464  LGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVF  643
            LGRRDS TASLSAANS  +PPP + L+ LI+ FQ+ GLS RD+VALSG+HTIG+ARCT F
Sbjct  153  LGRRDSTTASLSAANSN-LPPPASNLSALISSFQSHGLSIRDLVALSGSHTIGQARCTNF  211

Query  644  RRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            R RI++E+NID SFA+ RQ  CPS TG GD+NLAPLD  T   FDNNYYK
Sbjct  212  RNRIHSESNIDLSFARARQANCPS-TG-GDDNLAPLDLLTPTTFDNNYYK  259



>ref|XP_010041648.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   325 bits (834),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 191/235 (81%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SA+LS+ FY  SCP  L T+KS V SAV+ E RMGASLLRLHFHDCFV GCD SILL
Sbjct  21   GTASARLSSTFYFTSCPSALHTIKSGVNSAVSSEARMGASLLRLHFHDCFVNGCDASILL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEKTAG N+NS+RG+ VID+IKS +E  CPGVVSCADI+ +AARDS+V LGGP
Sbjct  81   DDTTNFTGEKTAGANDNSIRGYEVIDTIKSQLESSCPGVVSCADILAVAARDSIVALGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TASLSAANS  IP PT +L++LIT F NKG +A++MVALSG+HTIG+A
Sbjct  141  SWRVLLGRRDSTTASLSAANSD-IPAPTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT F+ R+YNE++I+S+FA + ++ CPS    GDNNL+PLD  +  +FDN Y+K
Sbjct  200  RCTTFQTRLYNESDINSTFATSLKENCPSS--GGDNNLSPLDTTSPTYFDNAYFK  252



>ref|XP_010664359.1| PREDICTED: cationic peroxidase 1 isoform X3 [Vitis vinifera]
Length=316

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 188/234 (80%), Gaps = 4/234 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G   AQLS+NFY+ SCPK L+T+++ V +AV KE+RMGASLLRLHFHDCFV GCD SILL
Sbjct  18   GMAHAQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEKTAGPNNNSVRG++VID+IKS +E +CPGVVSCADIV +AARDSVV LGGP
Sbjct  78   DDTANFTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS TAS S ANS  +P PT+ L+ LI+ F NKG + ++MV LSG HTIGKA
Sbjct  138  TWTVQLGRRDSTTASFSTANSD-LPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            +C+ FR RIYNETNID++FA ++Q  CPS    GD NL+ LD +T   FDN Y+
Sbjct  197  QCSKFRDRIYNETNIDATFATSKQAICPSS--GGDENLSDLD-ETTTVFDNVYF  247



>ref|XP_007142064.1| hypothetical protein PHAVU_008G249500g [Phaseolus vulgaris]
 gb|AAD37428.1|AF149278_1 peroxidase 3 precursor [Phaseolus vulgaris]
 gb|ESW14058.1| hypothetical protein PHAVU_008G249500g [Phaseolus vulgaris]
Length=324

 Score =   325 bits (834),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 187/237 (79%), Gaps = 5/237 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLS NFY+K CPK+L  VKSVV+SAV KE RMGASLLRL FHDCFV GCDGS+LL
Sbjct  24   GSSSAQLSENFYAKKCPKVLYAVKSVVQSAVAKEPRMGASLLRLFFHDCFVNGCDGSVLL  83

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            D  SS   EKTA PN+ S+RG+ VID+IKS VE +CPG+VSCADIV IAARDSV +LGGP
Sbjct  84   DGPSS---EKTAPPNDKSLRGYEVIDAIKSKVEALCPGIVSCADIVAIAARDSVNILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W VKLGRRDS T     A+SG +P P ++L+ LI+ F+++GLSA+DMVALSGAHTIGKA
Sbjct  141  FWKVKLGRRDSSTGFFQLASSGALPSPASSLDTLISSFKDQGLSAKDMVALSGAHTIGKA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCP--SQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC V+  RIYNE NI+S FAK RQ+ CP  S     DNN+APL+FKT   FDNNYYK
Sbjct  201  RCAVYGSRIYNEKNIESLFAKARQKNCPRNSNGTPKDNNVAPLEFKTPNHFDNNYYK  257



>ref|XP_004492538.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=317

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 188/234 (80%), Gaps = 3/234 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  +AQLS++FY+ +CP +L+T+K+ +  AVN E RMGASLLRLHFHDCFVQGCDGS+LL
Sbjct  19   GIVTAQLSSDFYATTCPDVLSTIKTQIDLAVNDEPRMGASLLRLHFHDCFVQGCDGSVLL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK+AGPN NS+RGF+VID+IKS VE +CP VVSCADI+++AARDSVV LGGP
Sbjct  79   DDTSSFTGEKSAGPNANSLRGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V+LGRRDS TASL +AN+  +P PT+ L NLIT F  KG + ++MVALSG+HTIG+A
Sbjct  139  SWTVQLGRRDSTTASLDSANTN-LPGPTSDLTNLITAFDKKGFTTQEMVALSGSHTIGQA  197

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
             C  FR RIYNE NID +FA + Q  CP  T  GDNNL+PLD  T   FDN+YY
Sbjct  198  SCRFFRSRIYNEDNIDPTFAASLQANCP--TSGGDNNLSPLDTTTPDTFDNSYY  249



>gb|AFK46186.1| unknown [Lotus japonicus]
Length=316

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 188/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLS+ FY+K+CP +LAT+K+ V  AV KE RMGASLLRLHFHDCFVQGCD SILL
Sbjct  18   GIGSAQLSSTFYAKTCPLVLATIKTQVNLAVAKEARMGASLLRLHFHDCFVQGCDASILL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPN NSVRG++VID+IKS VE +CPGVVSCADIV +AARDSVV LGG 
Sbjct  78   DDTSSFTGEKTAGPNANSVRGYDVIDTIKSKVESLCPGVVSCADIVAVAARDSVVALGGF  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TASLS+ANS  +P P++ L+ L T F NKG + R+MVALSG+HTIG+A
Sbjct  138  SWAVPLGRRDSTTASLSSANS-ELPGPSSNLDGLNTAFSNKGFTTREMVALSGSHTIGQA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYNETNIDS+FAK  Q  CP     GD+NL+PLD  +   FD+ YY+
Sbjct  197  RCLFFRTRIYNETNIDSTFAKNLQGNCPFN--GGDSNLSPLDTTSPTTFDDGYYR  249



>ref|XP_009775239.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=320

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 192/233 (82%), Gaps = 3/233 (1%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            +SA+LS ++Y KSCPK + T+K+ V +AV KE+RMGASLLRLHFHDCFV GCD SILLDD
Sbjct  24   SSARLSADYYEKSCPKAIYTIKNAVTNAVAKERRMGASLLRLHFHDCFVNGCDASILLDD  83

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TS FTGEKTA PN+NS+RGF++ID+IKS VEK+CPG+VSCADI+ IAARDSV +LGG  W
Sbjct  84   TSDFTGEKTAKPNSNSLRGFDLIDTIKSQVEKLCPGIVSCADIIAIAARDSVEILGGSTW  143

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            NV LGRRDS TASLS+ANS  IP P   L++LIT+F NKG +A++MVAL+GAHTIG+A+C
Sbjct  144  NVLLGRRDSTTASLSSANSD-IPSPLMDLSDLITKFDNKGFTAKEMVALAGAHTIGQAQC  202

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR R+YNET IDSS A + +  CPS TG GD++L+ LD  T A FDN+Y+K
Sbjct  203  TTFRERVYNETTIDSSLATSLKSNCPS-TG-GDDSLSALDAATPAIFDNHYFK  253



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 192/235 (82%), Gaps = 4/235 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G +SA+L++NFYS +CP +L+ +K+ V SA++KE RMGASLLRLHFHDCFV GCD S+LL
Sbjct  17   GMSSAELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLL  76

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PN+ S+RGF+VID+IK+ VE  C GVVSCADI+ +AARDSVV LGGP
Sbjct  77   DDTSSFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGP  136

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNV LGRRDS TASLSAAN+  IP PT  L++LI+ F NKG ++R+MVALSG+HTIG+A
Sbjct  137  SWNVLLGRRDSTTASLSAANND-IPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQA  195

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR R+YNETNI+SSF  T +  CP Q G GDNNL+PLD    + FDN YYK
Sbjct  196  RCTTFRDRLYNETNINSSFGTTIKANCP-QNG-GDNNLSPLDTSPTS-FDNVYYK  247



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score =   324 bits (831),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 194/235 (83%), Gaps = 5/235 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLS+ FY+K+CP  L+T+KS V SAVN E+RMGASLLRLHFHDCF  GCD S+LL
Sbjct  18   GIVSAQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCF--GCDASVLL  75

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPN  S+RGF+VID+IKS VE +CPGVVSCADI+ +AARDSVV LGG 
Sbjct  76   DDTSSFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGT  135

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS TASLS+ANS  +P PT++L+ LI+ F NKG S++++VALSG+HTIG+A
Sbjct  136  TWTVQLGRRDSTTASLSSANSD-LPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQA  194

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            +C+ FR RIYN+TNIDSSFAK+ Q  CPS TG GD+NLAPLD  +   FDN Y+K
Sbjct  195  QCSSFRTRIYNDTNIDSSFAKSLQGNCPS-TG-GDSNLAPLDTTSPNTFDNAYFK  247



>ref|XP_010685963.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=365

 Score =   326 bits (835),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 188/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+  AQLS N+Y+K+CPK L+T+++ V+ AV+ E+RMGASLLRLHFHDCFV GCD SILL
Sbjct  67   GTAQAQLSANYYAKTCPKALSTIQNAVRKAVSAERRMGASLLRLHFHDCFVNGCDASILL  126

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            +DTS+FTGE+TAG N  S+RG+ V+DSIKS VE VCPGVVSCADI+ +AARDSVV LGGP
Sbjct  127  NDTSTFTGEQTAGANAGSLRGYTVVDSIKSQVESVCPGVVSCADILAVAARDSVVSLGGP  186

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS TASLS ANS  IP PT  L+ L++ F +KGL+A++MVAL+GAHTIG+A
Sbjct  187  TWQVQLGRRDSTTASLSTANSD-IPSPTMDLSGLLSSFSDKGLTAKEMVALAGAHTIGQA  245

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC VFR R+YNE+NID+SF  + +  CPS    GDNNL PLD  T   FDN Y+K
Sbjct  246  RCVVFRNRVYNESNIDASFVTSVKTNCPSS--GGDNNLTPLDSTTPVAFDNGYFK  298



>ref|XP_010683551.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=343

 Score =   325 bits (833),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 186/235 (79%), Gaps = 4/235 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SAQLS NFYS SCP  L+T++S V+SAVN E RMGASLLRLHFHDCFV GCDGS+LL
Sbjct  22   GAASAQLSPNFYSSSCPNALSTIQSAVQSAVNNESRMGASLLRLHFHDCFVNGCDGSLLL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEKTA PN NSVRGF VID+IKS VE VC GVVSCADI+ +AARDSVV LGGP
Sbjct  82   DDTANFTGEKTAIPNLNSVRGFEVIDTIKSQVENVCAGVVSCADILAVAARDSVVALGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TA++SAAN+ ++P PT  +  LIT F   G + +D+VALSGAHTIG+A
Sbjct  142  SWTVLLGRRDSTTANISAANA-ILPAPTLNITQLITLFSGLGFTNQDLVALSGAHTIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNI+S+FA + Q  CPS    GDNN +PLD KT   FDN Y+ 
Sbjct  201  RCTTFRSRIYNETNINSTFATSLQANCPSS--GGDNNTSPLD-KTPTTFDNTYFN  252



>ref|XP_010041464.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 185/232 (80%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLS+ FYS SCP  L+T+KS V SAV  E RMGASLLRLHFHDCFV GCD S+LLDDT
Sbjct  24   SAQLSSTFYSTSCPSALSTIKSGVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDT  83

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            ++FTGEK AGPN NS+RGFNVID+IKS +E  CPG+VSCAD++T+AARDSVV LGGP+W 
Sbjct  84   ANFTGEKNAGPNANSLRGFNVIDTIKSQLESACPGIVSCADLLTVAARDSVVALGGPSWT  143

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V LGRRDS TAS SAANS  IP  T +L+ LIT F NKG +A++MVALSG+HTIG+ARCT
Sbjct  144  VPLGRRDSTTASQSAANSN-IPAFTLSLSGLITAFSNKGFTAKEMVALSGSHTIGQARCT  202

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR R+YNE NI+++FA + +  CPS    GDNNL+PLD  +   FDN Y+K
Sbjct  203  TFRTRLYNENNINATFATSLKANCPSS--GGDNNLSPLDTTSPTSFDNAYFK  252



>ref|NP_001065566.1| Os11g0112200 [Oryza sativa Japonica Group]
 tpe|CAH69373.1| TPA: class III peroxidase 131 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27411.1| Os11g0112200 [Oryza sativa Japonica Group]
Length=317

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 183/232 (79%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLS NFY KSCP  L+T+++ V+SAV KE RMGASLLRLHFHDCFV GCDGS+LLDDT
Sbjct  22   SAQLSANFYDKSCPNALSTIRTAVRSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDT  81

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
             +FTGEKTA PNNNS+RGF+VID+IK+ VE +CP VVSCADI+ +AARDSV  LGGP W 
Sbjct  82   PTFTGEKTAAPNNNSLRGFDVIDNIKAQVEGICPQVVSCADILAVAARDSVFALGGPTWV  141

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V+LGRRDS TASL  AN+  IP PT  L +L   F NKGLSA DM+ALSGAHTIG+ARC 
Sbjct  142  VQLGRRDSTTASLDTANND-IPAPTLDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCV  200

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR RIY+ETNID+S A + +  CP+ T  GDNN++PLD  T   FDN YYK
Sbjct  201  NFRNRIYSETNIDTSLATSLKSNCPNTT--GDNNISPLDASTPYTFDNFYYK  250



>ref|XP_010041557.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 185/235 (79%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SAQLS+ FYS SCP  L+T+KS V SAV  E RMGASLLRLHFHDCFV GCD S+LL
Sbjct  21   GTASAQLSSTFYSTSCPSALSTIKSAVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEK A PN NS+RGF+VID+IKS +E  CPGVVSCAD++T+AARDSVV LGGP
Sbjct  81   DDTANFTGEKNATPNANSLRGFDVIDTIKSQLESACPGVVSCADLLTVAARDSVVALGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TAS SAANS  IP PT  L+ LIT F NKG + ++MVALSG+HTIG+A
Sbjct  141  SWTVPLGRRDSTTASQSAANSN-IPAPTLNLSGLITAFSNKGFTTKEMVALSGSHTIGQA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR R+YNE NI+++FA + +  CPS    GDNNL+PLD  +   FDN Y+K
Sbjct  200  RCTSFRARLYNENNINTTFATSLKANCPSS--GGDNNLSPLDTTSPTSFDNAYFK  252



>gb|ACU21377.1| unknown [Glycine max]
Length=261

 Score =   321 bits (823),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 184/237 (78%), Gaps = 5/237 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLS NFY   CPK+   VKSV++SA+ KE R GAS++RL FHDCFV GCDGS+LL
Sbjct  24   GSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVLL  83

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            D  SS   EK A PN NS+RG+ VID+IKS VE +CPGVVSCADIVTIAARDSV +LGGP
Sbjct  84   DGPSS---EKIALPNKNSLRGYEVIDAIKSKVEALCPGVVSCADIVTIAARDSVAILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW VKLGRRDS T   + ANSGV+P P ++L++LI RF ++GLS +DMVALSGAHTIGKA
Sbjct  141  NWKVKLGRRDSTTGFFNLANSGVLPGPNSSLSSLIQRFDDQGLSTKDMVALSGAHTIGKA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCP--SQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  +R RIYNE NIDS FAK RQ+ CP  S     DNN+APLDFKT   FDN Y+K
Sbjct  201  RCVSYRDRIYNENNIDSLFAKARQKNCPKGSSGTPKDNNVAPLDFKTPNHFDNEYFK  257



>ref|XP_003577141.1| PREDICTED: peroxidase 4-like [Brachypodium distachyon]
Length=329

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 185/235 (79%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS++ QLST FY+ +CP  +  VKSV+++A+  E R+GAS+LRL FHDCFVQGCDGS+LL
Sbjct  29   GSSAQQLSTGFYAYTCPGAMDAVKSVMEAAIAGEPRIGASILRLFFHDCFVQGCDGSLLL  88

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DD   F GEKTA PNN SVRGF V+D+ K+AVE +CP +VSCAD++ +AARDSVV+LGGP
Sbjct  89   DDAPGFQGEKTATPNNGSVRGFEVVDAAKAAVEALCPAIVSCADVLALAARDSVVILGGP  148

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W VK+GRRDS TAS + AN+  IPPP + L NL   F  +GLS +DMVALSG+HTIG+A
Sbjct  149  SWEVKVGRRDSTTASFAGANNN-IPPPASGLANLTALFAQQGLSQKDMVALSGSHTIGQA  207

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR  IYN+TNIDS FA  R+  CPS +GSGDNNLAPLD +T   F+NNYYK
Sbjct  208  RCTNFRAHIYNDTNIDSGFAGGRRSGCPSTSGSGDNNLAPLDLQTPTTFENNYYK  262



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 191/233 (82%), Gaps = 4/233 (2%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            +SA+L++NFYS +CP +L+ +K+ V SA++KE RMGASLLRLHFHDCFV GCD S+LLDD
Sbjct  19   SSAELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDD  78

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TSSFTGEKTA PN+ S+RGF+VID+IK+ VE  C GVVSCADI+ +AARDSVV LGGP+W
Sbjct  79   TSSFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSW  138

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            NV LGRRDS TASLSAAN+  IP PT  L++LI+ F NKG +AR+MVALSG+HTIG+ARC
Sbjct  139  NVLLGRRDSTTASLSAANND-IPAPTLNLSSLISSFSNKGFNAREMVALSGSHTIGQARC  197

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR R+YNETNI+SSF  + +  CP Q G GDNNL+PLD  +   FDN YYK
Sbjct  198  TTFRDRLYNETNINSSFGTSIKANCP-QNG-GDNNLSPLD-TSPTTFDNAYYK  247



>sp|P22195.2|PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: 
Precursor [Arachis hypogaea]
 gb|AAB06183.1| cationic peroxidase [Arachis hypogaea]
Length=316

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 184/234 (79%), Gaps = 3/234 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLS+NFY+  CP  L+T+KS V SAV KE RMGASLLRLHFHDCFVQGCD S+LL
Sbjct  18   GLGSAQLSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEKTAGPN NS+RGF VID+IKS VE +CPGVVSCADI+ +AARDSVV LGG 
Sbjct  78   DDTSNFTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGA  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNV LGRRDS TASLS+ANS  +P P   L+ LI+ F NKG + +++V LSGAHTIG+A
Sbjct  138  SWNVLLGRRDSTTASLSSANSD-LPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            +CT FR RIYNE+NID ++AK+ Q  CPS    GD NL+P D  T   FDN YY
Sbjct  197  QCTAFRTRIYNESNIDPTYAKSLQANCPSV--GGDTNLSPFDVTTPNKFDNAYY  248



>ref|XP_008388322.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=323

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLS+ FY KSCP  L+T+KS V SAV+KE RMGASLLRLHFHDCFV GCD S+LLDDT
Sbjct  28   SAQLSSTFYGKSCPNALSTIKSAVNSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDT  87

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
            ++FTGEKTAGPN NS+RGF+VI++IKS +E +CP VVSCADI+T+AARDS+V LGGP + 
Sbjct  88   ANFTGEKTAGPNANSLRGFDVINTIKSQLESLCPKVVSCADILTVAARDSIVALGGPTYT  147

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V LGRRDS TASLSAANS  IP PT  L+ LIT F NKG +A+++VALSG+HTIG+ RCT
Sbjct  148  VPLGRRDSTTASLSAANSN-IPAPTLNLSGLITAFSNKGFTAKELVALSGSHTIGQVRCT  206

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR R+YNETNI  SFA + + +CP++   GDNNL+PLD  +   FDN Y++
Sbjct  207  SFRARLYNETNISDSFATSLKSSCPTR--GGDNNLSPLDVTSPTSFDNAYFR  256



>gb|ABR18139.1| unknown [Picea sitchensis]
Length=327

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 183/233 (79%), Gaps = 3/233 (1%)
 Frame = +2

Query  92   STSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLD  271
            S   QL  +FY KSCP +L+ V SVV  AV KEKRMGASLLRLHFHDCFV GCDGSILLD
Sbjct  30   SVYGQLCPDFYDKSCPNVLSIVNSVVMQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLD  89

Query  272  DTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPN  451
            DTS+FTGEKTA PNNNSVRGF+VID+IK+ VE  C GVVSCADIV IAARDSVV LGGP 
Sbjct  90   DTSTFTGEKTANPNNNSVRGFDVIDTIKTQVEATCSGVVSCADIVAIAARDSVVQLGGPT  149

Query  452  WNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKAR  631
            W V LGRRDS +AS SAAN+  IPPPT+ L+ LI+ FQ +GL+  DMVALSG+HTIG+AR
Sbjct  150  WTVMLGRRDSTSASKSAANNN-IPPPTSNLSALISFFQAQGLTTEDMVALSGSHTIGQAR  208

Query  632  CTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            CT FR RIYNE+NI   FA  R+  CP  TG GDNNLAPLD  T   FDN+YY
Sbjct  209  CTNFRNRIYNESNIALLFAGLRKANCPV-TG-GDNNLAPLDLFTPTAFDNSYY  259



>ref|XP_004492537.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=316

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 191/235 (81%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+TSAQLS+NFY K+CP +LAT+KS V  AVN E+RMGASLLRLHFHDCFVQGCD S+LL
Sbjct  18   GTTSAQLSSNFYLKTCPLVLATIKSEVTLAVNNERRMGASLLRLHFHDCFVQGCDASVLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEK+AGPN NS+RGF+VID+IKS VEK+CP  VSCADI+++AARDSVV LGGP
Sbjct  78   DDTSSFTGEKSAGPNANSLRGFDVIDTIKSKVEKLCPNTVSCADILSVAARDSVVALGGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+V+LGRRDS TASLS ANS  +P P++ L++L T F NKG +  ++VALSG+HTIG+ 
Sbjct  138  SWSVQLGRRDSTTASLSIANSD-LPGPSSDLSDLKTAFSNKGFTLEELVALSGSHTIGEG  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             C  FR RIYNE NID +FA   Q  CPS TG GD+NL+PLD  T   FDN YY+
Sbjct  197  SCRFFRARIYNEKNIDPTFATLLQGNCPS-TG-GDSNLSPLDTTTPNTFDNAYYR  249



>ref|XP_004977590.1| PREDICTED: cationic peroxidase 1-like [Setaria italica]
Length=317

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 183/232 (79%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQL+ NFY KSCP  L T+++ VKSAV KE RMGASLLRLHFHDCFV GCDGS+LLDDT
Sbjct  22   SAQLTANFYDKSCPNALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDT  81

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
             +FTGEKTA PNNNS+RGF+VIDSIK+ +E +CP VVSCADI+ +AARDSVV LGGP W 
Sbjct  82   PTFTGEKTAVPNNNSIRGFDVIDSIKAQIEGICPQVVSCADILAVAARDSVVTLGGPTWV  141

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V LGRRDS TASL AAN+  IP PT  L++L   F NKGL+A DM+ALSG HTIG+ARC 
Sbjct  142  VNLGRRDSTTASLDAANND-IPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARCV  200

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR RIY+E NID+S A + +  CP++T  GDNN++PLD  T   FDN YYK
Sbjct  201  NFRNRIYSEANIDTSLATSLKSNCPNKT--GDNNISPLDASTPYVFDNFYYK  250



>emb|CAH10840.1| peroxidase [Picea abies]
Length=320

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 184/229 (80%), Gaps = 3/229 (1%)
 Frame = +2

Query  104  QLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  283
            QLS+ FY+KSCP++ + VK+VVK AV KEKRMGASL+RLHFHDCFV GCDGSILLDD ++
Sbjct  27   QLSSTFYAKSCPRVQSIVKTVVKQAVAKEKRMGASLVRLHFHDCFVNGCDGSILLDDNAT  86

Query  284  FTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVK  463
            FTGEKTAGPN NS RGF+VID+IK+ VE  C GVVSCADI+TIAARDS+V L GP W V 
Sbjct  87   FTGEKTAGPNANSARGFDVIDTIKTQVEAACSGVVSCADILTIAARDSIVELQGPTWTVM  146

Query  464  LGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVF  643
            LGRRDS TASLSAAN+  IP P ++L+ LIT FQN GLS +D+VALSGAHTIG++RC  F
Sbjct  147  LGRRDSPTASLSAANNN-IPSPASSLSTLITSFQNHGLSTKDLVALSGAHTIGQSRCAFF  205

Query  644  RRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            R RIYNE+NI+++FA + +  CPS    GDN L+PLD  T   FDN YY
Sbjct  206  RTRIYNESNINAAFATSVKPNCPS--AGGDNTLSPLDVVTPTTFDNKYY  252



>dbj|BAM28607.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/235 (67%), Positives = 185/235 (79%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+ SAQLS+ +Y  SCPK L+T++S V SA+ KE RMGASLLRLHFHDCFV GCDGS+LL
Sbjct  18   GAASAQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT++FTGEKTA PN NS+RGF+VID+IK++VE VCPGVVSCADI+ + ARDSVV LGG 
Sbjct  78   DDTANFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQ  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TASLSAAN+  IP PT  L+ LI+ F NKGL+  +MVALSGAHTIG A
Sbjct  138  SWTVLLGRRDSTTASLSAANAN-IPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  FR RIYNETNI SS+A + ++ CP  T  G NN APLD  T   FDN Y+K
Sbjct  197  RCVTFRSRIYNETNIKSSYAASLKKNCP--TNDGGNNTAPLDITTPFIFDNAYFK  249



>emb|CAA62597.1| korean-radish isoperoxidase [Raphanus sativus]
Length=315

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 188/231 (81%), Gaps = 3/231 (1%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQL+TNFYS SCP LL+TVKS VKSAV+ + RMGAS+LRL FHDCFV GCDGSILLDDTS
Sbjct  21   AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  80

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
             FTGE+ AGPN NS RGFNVID+IKSAVEK CPGVVSCADI+ IAARDSVV LGGPNWNV
Sbjct  81   -FTGEQNAGPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  139

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            K+GRRD+KTAS +AANS  IP P+ +L+ LI+ F+  GLS RDMVALSGAHTIG++RCT 
Sbjct  140  KVGRRDAKTASQAAANSN-IPAPSMSLSQLISSFRAVGLSTRDMVALSGAHTIGQSRCTN  198

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR RIYNETNI+++FA  RQ++CP +         PLD  +   FDN+Y+K
Sbjct  199  FRTRIYNETNINAAFATLRQKSCP-RAAFRRRKPQPLDINSPTSFDNSYFK  248



>ref|XP_010683552.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   322 bits (826),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 186/234 (79%), Gaps = 3/234 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  SAQLS+ FYS SCP +L+T++S V+SA++ E RMGASLLRLHFHDCFV GCDGSILL
Sbjct  27   GVVSAQLSSTFYSSSCPNVLSTIQSAVQSAIDTESRMGASLLRLHFHDCFVNGCDGSILL  86

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DD ++FTGEKTA PN NSVRG++VID+IKS VE VCPGVVSCADI+ +AARDSVV LGG 
Sbjct  87   DDNATFTGEKTALPNVNSVRGYDVIDTIKSQVENVCPGVVSCADILAVAARDSVVALGGQ  146

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V+LGRRDS TASLS ANS  IP PT  L+ L+  F N+G + +++V LSGAHTIG+A
Sbjct  147  SWTVQLGRRDSTTASLSTANSN-IPAPTLDLSQLLDSFNNQGFTPQELVVLSGAHTIGQA  205

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNETNI+S+FA + Q  CPS    GDNNL+PLD  +   FDN Y+
Sbjct  206  RCTTFRSRIYNETNINSTFATSLQANCPSN--GGDNNLSPLDQTSPTTFDNAYF  257



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score =   322 bits (825),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 182/230 (79%), Gaps = 3/230 (1%)
 Frame = +2

Query  104  QLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  283
            QLS  FY  SCP  L T+++ V++AV KE+RMGASLLRLHFHDCFV GCDGSILLDDT +
Sbjct  23   QLSPTFYETSCPGALYTIQNAVRAAVFKERRMGASLLRLHFHDCFVNGCDGSILLDDTPT  82

Query  284  FTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVK  463
            FTGEKTAGPNNNSVRGF+VID+IKS VE +C  VVSCADI+ +AARDSVV LGGP+W V+
Sbjct  83   FTGEKTAGPNNNSVRGFDVIDTIKSQVEAICTQVVSCADILAVAARDSVVALGGPSWAVQ  142

Query  464  LGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVF  643
            LGRRD+ TAS S ANS  IP PT+ L+ LI+ F  KGLS  DMVALSGAHTIG+ARCTVF
Sbjct  143  LGRRDATTASFSGANSD-IPSPTSDLSALISAFSKKGLSTTDMVALSGAHTIGQARCTVF  201

Query  644  RRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            R R+YNETNID+S A + +  CPS    GD+NL+PLD  T    DN YYK
Sbjct  202  RTRLYNETNIDASLATSLKSNCPSS--GGDDNLSPLDAITPTIVDNFYYK  249



>gb|EPS58134.1| anionic peroxidase swpb3, partial [Genlisea aurea]
Length=315

 Score =   322 bits (824),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 184/235 (78%), Gaps = 1/235 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLS ++Y  SCP L  TV+SVV+SA+  E R+GAS+LRL FHDCFV GCDGSILL
Sbjct  14   GSSSAQLSYDYYWDSCPDLFPTVRSVVRSAIQAEPRIGASILRLFFHDCFVNGCDGSILL  73

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DD  +F GEK A PN NS RGF V+D IK+AVE VCPGVVSCADI+ +A+RDSV +LGGP
Sbjct  74   DDGPNFVGEKGATPNRNSARGFEVVDRIKAAVEYVCPGVVSCADILAVASRDSVEILGGP  133

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W+VKLGRRD+KTASL+AANS  IPPP + L  L+T F + GLS RD+V LSG+HTIG+A
Sbjct  134  GWDVKLGRRDAKTASLAAANSN-IPPPRSNLTALVTSFASHGLSVRDLVVLSGSHTIGQA  192

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR RIYNETNI+   A+ R+  CP   G+GDNNLAPLD +T   FDN Y++
Sbjct  193  RCTSFRPRIYNETNIEPYLARIRKYNCPEINGTGDNNLAPLDPQTPTRFDNFYFR  247



>ref|XP_003519284.1| PREDICTED: peroxidase 4 [Glycine max]
 gb|KHN46096.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   322 bits (825),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 185/237 (78%), Gaps = 5/237 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLS NFY   CPK+   VKSV++SA+ KE R GAS++RL FHDCFV GCDGS+LL
Sbjct  24   GSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVLL  83

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            D  SS   EKTA PNNNS+RG+ VID+IKS VE VCPGVVSCADIVTIAARDSV +LGGP
Sbjct  84   DGPSS---EKTAPPNNNSLRGYEVIDAIKSKVETVCPGVVSCADIVTIAARDSVAILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W VKLGRRDS T   + A+SGV+P P ++L++LI RF ++GLS +DMVALSGAHTIGKA
Sbjct  141  YWKVKLGRRDSTTGFFNLASSGVLPGPGSSLSDLIKRFDDQGLSTKDMVALSGAHTIGKA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCP--SQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  +R RIYNE NIDS FAK RQ+ CP  S     DNN+APLDFKT   FDN Y+K
Sbjct  201  RCASYRGRIYNENNIDSLFAKARQKNCPKGSNGTPKDNNVAPLDFKTPNHFDNEYFK  257



>ref|XP_010921098.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=319

 Score =   322 bits (824),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 186/233 (80%), Gaps = 3/233 (1%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            TSAQLS+ FY  SCP  L+T++S VK+AV KE RMGASLLRLHFHDCFVQGCDGS+LLDD
Sbjct  23   TSAQLSSTFYDTSCPNALSTIQSAVKAAVAKEARMGASLLRLHFHDCFVQGCDGSVLLDD  82

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            TS+FTGEKTA PN NS+RGF+VID+IKS VE VC   VSCADI+ +AARDSVV LGGP+W
Sbjct  83   TSTFTGEKTAKPNINSIRGFDVIDTIKSQVEAVCNQTVSCADILAVAARDSVVALGGPSW  142

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
             V LGRRDS TASLS ANS  IPPPT+ L+ LI+ F  KGLS  DMVALSG+HTIG+ARC
Sbjct  143  TVLLGRRDSTTASLSLANSD-IPPPTSDLSALISAFSKKGLSTSDMVALSGSHTIGQARC  201

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            T FR RIYNETNIDSS+A + Q  CP     GDNNL+PLD  T   FDN YY+
Sbjct  202  TSFRARIYNETNIDSSYATSLQSNCP--VSGGDNNLSPLDVSTPTTFDNFYYR  252



>gb|KHN08835.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   322 bits (824),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 184/237 (78%), Gaps = 5/237 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLS NFY   CPK+   VKSV++SA+ KE R GAS++RL FHDCFV GCDGS+LL
Sbjct  24   GSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVLL  83

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            D  SS   EK A PN NS+RG+ VID+IKS VE +CPGVVSCADIVTIAARDSV +LGGP
Sbjct  84   DGPSS---EKIALPNKNSLRGYEVIDAIKSKVEALCPGVVSCADIVTIAARDSVAILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW VKLGRRDS T   + ANSGV+P P ++L++LI RF ++GLS +DMVALSGAHTIGKA
Sbjct  141  NWKVKLGRRDSTTGFFNLANSGVLPGPNSSLSSLIQRFDDQGLSTKDMVALSGAHTIGKA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCP--SQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  +R RIYNE NIDS FAK RQ+ CP  S     DNN+APLDFKT   FDN Y+K
Sbjct  201  RCVSYRDRIYNENNIDSLFAKARQKNCPKGSSGTPKDNNVAPLDFKTPNHFDNEYFK  257



>ref|XP_003544922.1| PREDICTED: peroxidase 4 [Glycine max]
Length=324

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 184/237 (78%), Gaps = 5/237 (2%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            GS+SAQLS NFY   CPK+   VKSV++SA+ KE R GAS++RL FHDCFV GCDGS+LL
Sbjct  24   GSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVLL  83

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            D  SS   EK A PN NS+RG+ VID+IKS VE +CPGVVSCADIVTIAARDSV +LGGP
Sbjct  84   DGPSS---EKIALPNKNSLRGYEVIDAIKSKVEALCPGVVSCADIVTIAARDSVAILGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            NW VKLGRRDS T   + ANSGV+P P ++L++LI RF ++GLS +DMVALSGAHTIGKA
Sbjct  141  NWKVKLGRRDSTTGFFNLANSGVLPGPNSSLSSLIQRFDDQGLSTKDMVALSGAHTIGKA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCP--SQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC  +R RIYNE NIDS FAK RQ+ CP  S     DNN+APLDFKT   FDN Y+K
Sbjct  201  RCVSYRDRIYNENNIDSLFAKARQKNCPKGSSGTPKDNNVAPLDFKTPNHFDNEYFK  257



>gb|AAB02554.1| cationic peroxidase [Stylosanthes humilis]
Length=320

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 187/234 (80%), Gaps = 3/234 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G  S QLS+NFY+  CP  L+T+KS V SAV+KE R+GASLLRLHFHDCFVQGCD S+LL
Sbjct  21   GLGSGQLSSNFYATKCPNALSTIKSAVNSAVSKEARLGASLLRLHFHDCFVQGCDASVLL  80

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTS+FTGEKTA PN NS RGF+VID+IKS VE +CPGVVSCADI+ +AARDSVV LGGP
Sbjct  81   DDTSTFTGEKTAFPNVNSARGFDVIDTIKSQVESLCPGVVSCADILALAARDSVVALGGP  140

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +WNV+LGRRDS TASL++ANS  +P P+  L+ LI+ F  KG +A+++V LSGAHTIG+A
Sbjct  141  SWNVQLGRRDSTTASLNSANSD-LPGPSFNLSGLISAFSKKGFTAKELVTLSGAHTIGQA  199

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            RCT FR RIYNE+NID S+AK+ Q  CPS    GD+NL+P D  T   FDN YY
Sbjct  200  RCTTFRTRIYNESNIDPSYAKSLQGNCPSV--GGDSNLSPFDVTTPNKFDNAYY  251



>ref|XP_009371984.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=323

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 189/232 (81%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            SAQLS+ FY KSCP  L+T+KS V SAV+KE RMGASLLRLHFHDCFV GCD S+LLDDT
Sbjct  28   SAQLSSTFYGKSCPNALSTIKSAVNSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDT  87

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
             +FTGEKTAGPN NS+RGF+VI++IKS +E +CP VVSCADI+T+AARDS+V LGGP + 
Sbjct  88   PNFTGEKTAGPNANSLRGFDVINTIKSQLESLCPKVVSCADILTVAARDSIVALGGPTYT  147

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V LGRRDS TASLSAANS  +P PT  L  LIT F NKG +A+++VALSG+HTIG+A+CT
Sbjct  148  VPLGRRDSTTASLSAANSN-LPAPTLNLAGLITAFSNKGFTAKELVALSGSHTIGQAKCT  206

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR R+YNETNI++SFA + + +CP++   GDNNL+PLD  +   FDN Y++
Sbjct  207  SFRARLYNETNINNSFATSLKSSCPTR--GGDNNLSPLDVTSPTSFDNAYFR  256



>ref|XP_010685954.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=318

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 184/235 (78%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G+  AQLSTN+YSK+CP+ L T+K+ V  AV  E RMGASLLRLHFHDCFV GCD S+LL
Sbjct  20   GTAQAQLSTNYYSKTCPRALFTIKTAVHKAVAAEHRMGASLLRLHFHDCFVNGCDASVLL  79

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            +D+S+FTGE+TAG N  S+RGF VID IKS VE VCPGVVSCADI+ +AARDSV LLGGP
Sbjct  80   NDSSTFTGEQTAGGNAGSLRGFTVIDDIKSQVESVCPGVVSCADILAVAARDSVALLGGP  139

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
             W V+LGRRDS TASLS ANS  IP PT  L+ L++ F NKGL+A++MVAL+GAHTIG+A
Sbjct  140  TWPVQLGRRDSTTASLSIANSD-IPSPTMDLSGLLSSFSNKGLTAKEMVALAGAHTIGQA  198

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC VFR R+YNE+NID+S+  + +  CP+    GDNNL PLD  T   FDN Y+K
Sbjct  199  RCVVFRNRVYNESNIDASYVSSVKPNCPNN--GGDNNLTPLDSNTPVIFDNGYFK  251



>ref|XP_006468149.1| PREDICTED: cationic peroxidase 1-like [Citrus sinensis]
Length=305

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 183/231 (79%), Gaps = 3/231 (1%)
 Frame = +2

Query  101  AQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  280
            AQLS+N Y  +CPK L+T+KS+V +AV KE RMGASLLRLHFHDCFV GCD S+LLDDTS
Sbjct  11   AQLSSNHYDNTCPKALSTIKSIVHNAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  70

Query  281  SFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNV  460
            SFTGEK+A  N NS+RGF VIDS+KS VE +CPGVVSCADI+ +AARDSVV  GGP+W V
Sbjct  71   SFTGEKSASANANSIRGFEVIDSVKSKVESLCPGVVSCADILAVAARDSVVAFGGPSWTV  130

Query  461  KLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTV  640
            +LGRRDS TAS SA N+  IP P   LN+LI+ F  KGLSA++MVALSGAHTIG+ARC +
Sbjct  131  QLGRRDSTTASSSAVNTN-IPSPLMDLNDLISNFAKKGLSAKEMVALSGAHTIGQARCLL  189

Query  641  FRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            FR+RIYNETNIDS FA + +  CPS    GD+NL+ LD  +   FDN Y++
Sbjct  190  FRQRIYNETNIDSEFATSLKSNCPSS--GGDDNLSSLDATSPVLFDNGYFR  238



>ref|XP_002450134.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
 gb|EES09122.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
Length=317

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 183/232 (79%), Gaps = 3/232 (1%)
 Frame = +2

Query  98   SAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDT  277
            S+QL+ NFY KSCP  L T+++ V+SAV +E RMGASLLRLHFHDCFV GCDGS+LLDDT
Sbjct  22   SSQLNANFYDKSCPNALYTIQTAVRSAVARENRMGASLLRLHFHDCFVNGCDGSVLLDDT  81

Query  278  SSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWN  457
             +FTGEKTA PNNNS+RGF+VIDSIK+ +E++CP VVSCADIV +AARDSVV LGGP W 
Sbjct  82   PTFTGEKTAVPNNNSLRGFDVIDSIKAQLERICPQVVSCADIVAVAARDSVVALGGPTWA  141

Query  458  VKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCT  637
            V LGRRDS TASL AAN+  IP PT  L +L   F NKGLSA DM+ALSG HTIG+ARC 
Sbjct  142  VNLGRRDSLTASLDAANND-IPAPTLDLTDLTKSFSNKGLSASDMIALSGGHTIGQARCV  200

Query  638  VFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
             FR RIY+E NID+S A + +  CP++T  GDNN++PLD  T   FDN YYK
Sbjct  201  NFRDRIYSEANIDTSLATSLKTNCPNKT--GDNNISPLDASTPYVFDNFYYK  250



>ref|NP_200647.1| peroxidase [Arabidopsis thaliana]
 sp|Q9LVL2.1|PER67_ARATH RecName: Full=Peroxidase 67; Short=Atperox P67; AltName: Full=ATP44; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA96930.1| peroxidase [Arabidopsis thaliana]
 gb|AED97047.1| peroxidase [Arabidopsis thaliana]
Length=316

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 189/233 (81%), Gaps = 0/233 (0%)
 Frame = +2

Query  95   TSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDD  274
            + AQL+ +FY +SCP L   V+ VVK AV +E RMGASLLRL FHDCFV GCDGS+LLDD
Sbjct  17   SEAQLNRDFYKESCPSLFLVVRRVVKRAVAREPRMGASLLRLFFHDCFVNGCDGSLLLDD  76

Query  275  TSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNW  454
            T SF GEKT+GP+NNSVRGF VID IK  VEK+CPG+VSCADI+ I ARDSV+LLGGP W
Sbjct  77   TPSFLGEKTSGPSNNSVRGFEVIDKIKFKVEKMCPGIVSCADILAITARDSVLLLGGPGW  136

Query  455  NVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARC  634
            +VKLGRRDS TA+ +AANSGVIPPP  TL+NLI RF+ +GLS RDMVALSGAHTIG+A+C
Sbjct  137  SVKLGRRDSTTANFAAANSGVIPPPITTLSNLINRFKAQGLSTRDMVALSGAHTIGRAQC  196

Query  635  TVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
              FR RIYN +NID+SFA ++++ CP+ +GSGDN  A LD ++   FD+ +YK
Sbjct  197  VTFRNRIYNASNIDTSFAISKRRNCPATSGSGDNKKANLDVRSPDRFDHGFYK  249



>ref|XP_006345522.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 189/235 (80%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G +SAQL++NFY+ SCP +L+ +K+ V SA+ KE RMGAS+LRLHFHDCFV GCD S+LL
Sbjct  19   GMSSAQLTSNFYNSSCPNILSIIKTAVNSAIAKESRMGASMLRLHFHDCFVNGCDASVLL  78

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTA PN+ S+RGF+VID+IK+ VE  C GVVSCADI+ +AARDSVV LGGP
Sbjct  79   DDTSSFTGEKTANPNSGSLRGFDVIDTIKTQVESSCAGVVSCADILAVAARDSVVKLGGP  138

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V LGRRDS TASLS ANS  IP PT  L+ LI+ F NKG +AR+MVALSG+HTIG+A
Sbjct  139  SWTVLLGRRDSTTASLSTANSD-IPAPTLNLSGLISSFSNKGFNAREMVALSGSHTIGQA  197

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RCT FR R+YNET+I+ SFA + +  CP Q+GS DNN++PLD  +   FDN YYK
Sbjct  198  RCTTFRDRLYNETDINDSFATSVKSKCP-QSGS-DNNISPLDTTSANTFDNIYYK  250



>gb|ACZ51443.1| peroxidase protein [Mikania micrantha]
Length=321

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 180/229 (79%), Gaps = 3/229 (1%)
 Frame = +2

Query  104  QLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILLDDTSS  283
            QLS NFY+ SCP   + + S V SAV+ E RMGASLLRLHFHDCFV GCD S+LLDDT++
Sbjct  28   QLSANFYATSCPNFSSIISSAVNSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDDTTN  87

Query  284  FTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGPNWNVK  463
            FTGEKTAGPNNNS+RGF+VID+IKS +E  CPGVVSCAD++  AARDSVV LGGP+WN+ 
Sbjct  88   FTGEKTAGPNNNSLRGFDVIDTIKSQLESSCPGVVSCADLLATAARDSVVALGGPSWNLA  147

Query  464  LGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKARCTVF  643
             GRRDS TASLSAANS  IP PT  L+ LIT F N G +A +MVALSG+HTIG+ARCTVF
Sbjct  148  FGRRDSITASLSAANSN-IPAPTLNLSGLITSFSNLGFTANEMVALSGSHTIGQARCTVF  206

Query  644  RRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            R RIYNE NI+SSFA + +  CPS    GDNNL+PLD  +   FDN Y+
Sbjct  207  RARIYNENNINSSFATSLRANCPSS--GGDNNLSPLDVVSPTSFDNTYF  253



>ref|XP_011021015.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=316

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 190/235 (81%), Gaps = 3/235 (1%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G   AQLSTNFY+ +CPK L+T+++ V  AV KE RMGASLLRLHFHDCFV GCD S+LL
Sbjct  18   GLVRAQLSTNFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVNGCDASVLL  77

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDTSSFTGEKTAGPN NS+RG++VID+IKS +E +CPGVVSCADI+ +AARDSVV L GP
Sbjct  78   DDTSSFTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGP  137

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W V+LGRRDS TASLSAANS  +P P   L++LIT F NKG +A++MVALSG+HTIG+A
Sbjct  138  SWTVQLGRRDSTTASLSAANSD-LPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQA  196

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYYK  793
            RC +FR R+YNET++DS+ A + +  CP  TGS D++L+ LD  T   FDN+Y+K
Sbjct  197  RCLMFRNRVYNETSLDSTLATSLKSNCP-DTGS-DDSLSSLDATTPVTFDNSYFK  249



>ref|XP_010041552.1| PREDICTED: peroxidase P7-like [Eucalyptus grandis]
Length=322

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 185/234 (79%), Gaps = 1/234 (0%)
 Frame = +2

Query  89   GSTSAQLSTNFYSKSCPKLLATVKSVVKSAVNKEKRMGASLLRLHFHDCFVQGCDGSILL  268
            G + AQLS +FYSKSCP     VKS V+SAV+KE  +GASLLRL FHDCFV GCDGS+LL
Sbjct  22   GCSDAQLSPDFYSKSCPDAFTGVKSQVESAVSKEPGIGASLLRLFFHDCFVNGCDGSVLL  81

Query  269  DDTSSFTGEKTAGPNNNSVRGFNVIDSIKSAVEKVCPGVVSCADIVTIAARDSVVLLGGP  448
            DDT +FTGEK A PN NS RGF VID +KSAVEKVCPGVVSCAD++ I ARDSVVLLGGP
Sbjct  82   DDTPTFTGEKNAAPNRNSARGFEVIDDVKSAVEKVCPGVVSCADLLAITARDSVVLLGGP  141

Query  449  NWNVKLGRRDSKTASLSAANSGVIPPPTATLNNLITRFQNKGLSARDMVALSGAHTIGKA  628
            +W+VKLGRRD++TAS +AANS  +P P + L +LI+ F++ GLS  D+VALSG+H+IG+A
Sbjct  142  SWSVKLGRRDARTASQAAANSS-LPSPASNLTDLISSFESAGLSTTDLVALSGSHSIGQA  200

Query  629  RCTVFRRRIYNETNIDSSFAKTRQQTCPSQTGSGDNNLAPLDFKTQAFFDNNYY  790
            +C  FR RIYNET++D SF + R++ CPS  G GDNNLA LD ++   +DN YY
Sbjct  201  KCANFRARIYNETDLDRSFGEIRRKNCPSSAGPGDNNLASLDLQSPVAYDNTYY  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1450662993712