BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6392_g1_i1 len=1112 path=[1:0-331 333:332-1111]

Length=1112
                                                                      Score     E

ref|XP_004238260.1|  PREDICTED: uncharacterized protein LOC101260133    256   7e-80   
ref|XP_011083684.1|  PREDICTED: uncharacterized protein LOC105166...    255   2e-79   
ref|XP_006341942.1|  PREDICTED: uncharacterized protein LOC102591734    254   4e-79   
ref|XP_009594152.1|  PREDICTED: uncharacterized protein LOC104090691    253   1e-78   
ref|XP_009775284.1|  PREDICTED: uncharacterized protein LOC104225218    252   2e-78   
gb|EYU45160.1|  hypothetical protein MIMGU_mgv1a012824mg                252   4e-78   
ref|XP_011083682.1|  PREDICTED: uncharacterized protein LOC105166...    250   1e-77   
ref|XP_002320631.1|  hypothetical protein POPTR_0014s18330g             246   4e-76   Populus trichocarpa [western balsam poplar]
ref|XP_011008409.1|  PREDICTED: uncharacterized protein LOC105113...    245   7e-76   
emb|CDP07514.1|  unnamed protein product                                246   7e-76   
gb|KDP38504.1|  hypothetical protein JCGZ_04429                         242   2e-74   
ref|XP_006434988.1|  hypothetical protein CICLE_v10002305mg             241   4e-74   
ref|XP_007017537.1|  Chloroplast thylakoid membrane                     241   1e-73   
ref|XP_006473498.1|  PREDICTED: uncharacterized protein LOC102608992    240   2e-73   
ref|XP_002281439.2|  PREDICTED: uncharacterized protein LOC100243825    238   7e-73   Vitis vinifera
emb|CBI19697.3|  unnamed protein product                                238   9e-73   
ref|XP_002510386.1|  conserved hypothetical protein                     234   2e-71   Ricinus communis
ref|XP_010538090.1|  PREDICTED: uncharacterized protein LOC104812...    234   4e-71   
ref|XP_010061315.1|  PREDICTED: uncharacterized protein LOC104449021    233   7e-71   
ref|XP_004152696.1|  PREDICTED: uncharacterized protein LOC101216764    231   4e-70   
gb|KHG07014.1|  Plasma membrane fusion prm1                             230   1e-69   
ref|XP_009336256.1|  PREDICTED: uncharacterized protein LOC103928...    231   2e-69   
ref|XP_009365567.1|  PREDICTED: uncharacterized protein LOC103955406    229   2e-69   
ref|XP_004160037.1|  PREDICTED: uncharacterized protein LOC101225525    229   2e-69   
ref|XP_009364836.1|  PREDICTED: uncharacterized protein LOC103954...    229   7e-69   
ref|XP_008220800.1|  PREDICTED: uncharacterized protein LOC103320844    228   8e-69   
ref|XP_008388066.1|  PREDICTED: uncharacterized protein LOC103450...    227   2e-68   
ref|XP_007223845.1|  hypothetical protein PRUPE_ppa010740mg             226   2e-68   
ref|XP_008444717.1|  PREDICTED: uncharacterized protein LOC103487971    226   3e-68   
gb|KEH36155.1|  hypothetical protein MTR_3g111850                       225   4e-68   
ref|XP_010263665.1|  PREDICTED: uncharacterized protein LOC104601...    226   6e-68   
ref|XP_004501013.1|  PREDICTED: uncharacterized protein LOC101503744    225   8e-68   
ref|XP_010097367.1|  hypothetical protein L484_001599                   230   2e-67   
ref|XP_003528103.1|  PREDICTED: uncharacterized protein LOC100796...    221   2e-66   
ref|XP_007136592.1|  hypothetical protein PHAVU_009G057900g             220   7e-66   
gb|ACU23819.1|  unknown                                                 219   2e-65   Glycine max [soybeans]
ref|XP_010481950.1|  PREDICTED: uncharacterized protein LOC104760688    219   2e-65   
ref|XP_006577773.1|  PREDICTED: uncharacterized protein LOC100499...    218   2e-65   
gb|AAM65999.1|  unknown                                                 218   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494224.1|  PREDICTED: uncharacterized protein LOC104771408    218   4e-65   
ref|NP_568612.1|  uncharacterized protein                               218   4e-65   Arabidopsis thaliana [mouse-ear cress]
gb|ACU16829.1|  unknown                                                 217   9e-65   Glycine max [soybeans]
ref|XP_006577774.1|  PREDICTED: uncharacterized protein LOC100499...    216   2e-64   
ref|XP_010442124.1|  PREDICTED: uncharacterized protein LOC104725201    216   3e-64   
ref|XP_004293207.1|  PREDICTED: uncharacterized protein LOC101306500    215   5e-64   
ref|XP_006281050.1|  hypothetical protein CARUB_v10027066mg             215   6e-64   
ref|XP_010684332.1|  PREDICTED: uncharacterized protein LOC104898898    215   7e-64   
ref|NP_001236729.1|  uncharacterized protein LOC100499839               213   2e-63   
emb|CDX95168.1|  BnaC09g17020D                                          213   2e-63   
ref|XP_010263666.1|  PREDICTED: uncharacterized protein LOC104601...    214   2e-63   
ref|XP_002863738.1|  hypothetical protein ARALYDRAFT_494744             213   3e-63   
ref|XP_006403353.1|  hypothetical protein EUTSA_v10003376mg             213   3e-63   
gb|KFK31819.1|  hypothetical protein AALP_AA6G162500                    211   1e-62   
emb|CDY52369.1|  BnaA09g15680D                                          210   2e-62   
ref|XP_009114040.1|  PREDICTED: uncharacterized protein LOC103839284    210   4e-62   
ref|XP_011008410.1|  PREDICTED: uncharacterized protein LOC105113...    199   3e-58   
ref|XP_009336273.1|  PREDICTED: uncharacterized protein LOC103928...    189   1e-53   
ref|XP_009364850.1|  PREDICTED: uncharacterized protein LOC103954...    188   3e-53   
ref|XP_008388068.1|  PREDICTED: uncharacterized protein LOC103450...    186   7e-53   
ref|XP_010943014.1|  PREDICTED: uncharacterized protein LOC105060...    184   2e-51   
ref|XP_006577776.1|  PREDICTED: uncharacterized protein LOC100499...    181   2e-51   
ref|XP_009403512.1|  PREDICTED: uncharacterized protein LOC103987051    182   2e-51   
emb|CAN75690.1|  hypothetical protein VITISV_038531                     179   2e-50   Vitis vinifera
gb|EPS70200.1|  hypothetical protein M569_04561                         176   4e-50   
ref|XP_002466375.1|  hypothetical protein SORBIDRAFT_01g006620          174   2e-48   Sorghum bicolor [broomcorn]
tpg|DAA51674.1|  TPA: hypothetical protein ZEAMMB73_411815              174   3e-48   
gb|ABF99113.1|  expressed protein                                       173   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|AAP68897.1|  unknown protein                                         172   7e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010942996.1|  PREDICTED: uncharacterized protein LOC105060...    172   8e-47   
ref|XP_006650669.1|  PREDICTED: uncharacterized protein LOC102718346    169   2e-46   
ref|XP_008347422.1|  PREDICTED: uncharacterized protein LOC103410505    165   3e-46   
ref|XP_009336277.1|  PREDICTED: uncharacterized protein LOC103928...    168   4e-46   
ref|XP_009364867.1|  PREDICTED: uncharacterized protein LOC103954...    167   2e-45   
ref|XP_008388070.1|  PREDICTED: uncharacterized protein LOC103450...    165   2e-45   
ref|XP_010538091.1|  PREDICTED: uncharacterized protein LOC104812...    163   4e-45   
dbj|BAJ89590.1|  predicted protein                                      165   1e-44   
ref|XP_010263668.1|  PREDICTED: uncharacterized protein LOC104601...    164   2e-44   
ref|XP_010263667.1|  PREDICTED: uncharacterized protein LOC104601...    164   2e-44   
ref|XP_003559381.1|  PREDICTED: uncharacterized protein LOC100836593    164   2e-44   
dbj|BAJ87619.1|  predicted protein                                      164   3e-44   
gb|AAN65006.1|  hypothetical protein                                    156   2e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001766235.1|  predicted protein                                  149   7e-38   
ref|XP_002975462.1|  hypothetical protein SELMODRAFT_442834             145   2e-37   
ref|XP_002964057.1|  hypothetical protein SELMODRAFT_438781             145   2e-37   
gb|ACN35948.1|  unknown                                                 143   8e-37   Zea mays [maize]
ref|XP_010943003.1|  PREDICTED: uncharacterized protein LOC105060...    145   1e-36   
gb|EEC76255.1|  hypothetical protein OsI_13704                          142   5e-36   Oryza sativa Indica Group [Indian rice]
gb|EEE60016.1|  hypothetical protein OsJ_12765                          141   5e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010943008.1|  PREDICTED: uncharacterized protein LOC105060...    137   5e-34   
ref|XP_010942989.1|  PREDICTED: uncharacterized protein LOC105060...    134   3e-32   
ref|NP_001051422.2|  Os03g0774400                                       121   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004986216.1|  PREDICTED: WW domain-binding protein 11-like       113   1e-25   
ref|NP_001169858.1|  uncharacterized protein LOC100383751             93.2    2e-19   Zea mays [maize]
gb|EPS65687.1|  hypothetical protein M569_09091                       82.8    2e-16   
gb|EMS47230.1|  hypothetical protein TRIUR3_00981                     80.9    6e-15   
gb|AFK44438.1|  unknown                                               66.2    4e-10   



>ref|XP_004238260.1| PREDICTED: uncharacterized protein LOC101260133 [Solanum lycopersicum]
Length=226

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK+WL++QKKK+AK+LLAP++ASRN L+ A LLL ++ PEF EK+L E+QSLL
Sbjct  61   FSFGISGPKEWLRDQKKKTAKYLLAPIEASRNILRYANLLLTRTEPEFGEKELEEVQSLL  120

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCVPQ+RNSFVQFQSK+GVEVCTFQLVV NASSLL DKDP+KL AE+KL D+IR 
Sbjct  121  RSAARDCVPQERNSFVQFQSKSGVEVCTFQLVVKNASSLLPDKDPVKLAAEAKLIDLIRS  180

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            FASL+ M +E D+QVASNRQK+A+ALMDT++ L++FEQGVK+CLE
Sbjct  181  FASLSDMANEFDVQVASNRQKVANALMDTLTCLDNFEQGVKECLE  225



>ref|XP_011083684.1| PREDICTED: uncharacterized protein LOC105166140 isoform X2 [Sesamum 
indicum]
Length=234

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             S GISGPK+WLKEQKKKSAKFLLAPVDASRN LQ+AYLLLMKS  EF E DL E+Q L 
Sbjct  69   LSFGISGPKEWLKEQKKKSAKFLLAPVDASRNILQSAYLLLMKSEAEFGENDLEEVQKLF  128

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             SAARDCVPQDRNSFV+FQ+ TGVEVCTF+L+V NASSLLDDKDPIKLEAE+KL+D++R 
Sbjct  129  VSAARDCVPQDRNSFVEFQANTGVEVCTFRLIVKNASSLLDDKDPIKLEAEAKLSDLVRS  188

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            F+SLNG+  E  +Q+ S+RQ+ ADAL DT+SSLN+FEQ +KDCL+ 
Sbjct  189  FSSLNGIARESGVQLTSDRQRAADALKDTISSLNNFEQVIKDCLQV  234



>ref|XP_006341942.1| PREDICTED: uncharacterized protein LOC102591734 [Solanum tuberosum]
Length=227

 Score =   254 bits (649),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             S GISGPK+WL++QKKK+AK+LLAP++ASRN L+ A LLL ++ PEF EK+L E+QSLL
Sbjct  62   LSFGISGPKEWLRDQKKKTAKYLLAPIEASRNILRYANLLLTRTEPEFGEKELEEVQSLL  121

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCVPQ+RNSFVQFQSK+GVEVCTFQLVV NASSLL DKDP+KL AE+KL D+IR 
Sbjct  122  RSAARDCVPQERNSFVQFQSKSGVEVCTFQLVVKNASSLLPDKDPVKLAAEAKLIDLIRS  181

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            FASL+ M +E D+QVASNRQK+A+ALMDTV+ L++FEQG+K+CLE 
Sbjct  182  FASLSDMANEFDVQVASNRQKVANALMDTVTCLDNFEQGIKECLEV  227



>ref|XP_009594152.1| PREDICTED: uncharacterized protein LOC104090691 [Nicotiana tomentosiformis]
Length=227

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 163/198 (82%), Gaps = 6/198 (3%)
 Frame = +2

Query  218  LDVKLISRRNavvllslvapllpalhhpspasaFSLGISGPKQWLKEQKKKSAKFLLAPV  397
            L+ KL SRRNAVV LSL+APL             S GISGPK+WLK+QKKK+AK+LLAP+
Sbjct  35   LETKLFSRRNAVVWLSLIAPLTYPASA------LSFGISGPKEWLKDQKKKTAKYLLAPI  88

Query  398  DASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVC  577
            DASRN L +AYLLL ++  +F EK+L E+QSLL+SAARDCVPQ+RNSFVQFQS TGVEVC
Sbjct  89   DASRNILGSAYLLLTRTESDFGEKELEEVQSLLRSAARDCVPQERNSFVQFQSNTGVEVC  148

Query  578  TFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNRQKIADALM  757
            TF+LVV NASSLL DKDP+KL AE+KL D+IR FASL+ M +E+D+QVASNRQK+A+ALM
Sbjct  149  TFRLVVKNASSLLADKDPVKLAAETKLIDLIRSFASLSDMANEIDMQVASNRQKVANALM  208

Query  758  DTVSSLNSFEQGVKDCLE  811
            DTV+ L+  EQGVK+CLE
Sbjct  209  DTVTCLDKLEQGVKECLE  226



>ref|XP_009775284.1| PREDICTED: uncharacterized protein LOC104225218 [Nicotiana sylvestris]
 ref|XP_009775285.1| PREDICTED: uncharacterized protein LOC104225218 [Nicotiana sylvestris]
 ref|XP_009775286.1| PREDICTED: uncharacterized protein LOC104225218 [Nicotiana sylvestris]
Length=227

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 163/198 (82%), Gaps = 6/198 (3%)
 Frame = +2

Query  218  LDVKLISRRNavvllslvapllpalhhpspasaFSLGISGPKQWLKEQKKKSAKFLLAPV  397
            L+ KL SRRNAVV LSL+APL             S GISGPK+WL++QKKK+AK+LLAP+
Sbjct  35   LETKLFSRRNAVVWLSLIAPLTYPASA------LSFGISGPKEWLRDQKKKTAKYLLAPI  88

Query  398  DASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVC  577
            DASRN L +AYLLL ++  +F EK+L E+QSLL+SAARDCVPQ+RNSFVQFQS TGVEVC
Sbjct  89   DASRNILGSAYLLLTRTESDFGEKELEEVQSLLRSAARDCVPQERNSFVQFQSNTGVEVC  148

Query  578  TFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNRQKIADALM  757
            TF+LVV NASSLL DKDP+KL AE+KL D+IR FASL+ M +E+D+QVASNRQK+A+ALM
Sbjct  149  TFRLVVKNASSLLADKDPVKLAAETKLIDLIRSFASLSDMANEIDVQVASNRQKVANALM  208

Query  758  DTVSSLNSFEQGVKDCLE  811
            DTV+ L+  EQGVK+CLE
Sbjct  209  DTVTCLDKLEQGVKECLE  226



>gb|EYU45160.1| hypothetical protein MIMGU_mgv1a012824mg [Erythranthe guttata]
Length=239

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMK-SGPEFSEKDLGEIQSL  493
            FS+GISGPK+WLKEQKKK+ KFLLAPVD SRN LQ+AYL+LMK S  EF E DL E+Q L
Sbjct  73   FSIGISGPKEWLKEQKKKTYKFLLAPVDGSRNILQSAYLVLMKKSEAEFGEDDLAEVQKL  132

Query  494  LKSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIR  673
            L SAARDCVP DRNSFV+FQS TGVEVCTF+L+V NASSLLD+KDPIKLEAE+KL D+IR
Sbjct  133  LVSAARDCVPLDRNSFVEFQSTTGVEVCTFRLIVKNASSLLDEKDPIKLEAEAKLDDLIR  192

Query  674  CFASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
             F+SLNGM  E  I++ SNRQ++ADAL DT+SSLN+ EQG+KDCL+
Sbjct  193  SFSSLNGMVRERGIELTSNRQRVADALNDTISSLNNLEQGIKDCLQ  238



>ref|XP_011083682.1| PREDICTED: uncharacterized protein LOC105166140 isoform X1 [Sesamum 
indicum]
 ref|XP_011083683.1| PREDICTED: uncharacterized protein LOC105166140 isoform X1 [Sesamum 
indicum]
Length=235

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             S GISGPK+WLKEQKKKSAKFLLAPVDASRN LQ+AYLLLMKS  EF E DL E+Q L 
Sbjct  69   LSFGISGPKEWLKEQKKKSAKFLLAPVDASRNILQSAYLLLMKSEAEFGENDLEEVQKLF  128

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             SAARDCVPQDRNSFV+FQ+ TGVEVCTF+L+V NASSLLDDKDPIKLEAE+KL+D++R 
Sbjct  129  VSAARDCVPQDRNSFVEFQANTGVEVCTFRLIVKNASSLLDDKDPIKLEAEAKLSDLVRS  188

Query  677  FASLNGMTSELDIQVASN-RQKIADALMDTVSSLNSFEQGVKDCLET  814
            F+SLNG+  E  +Q+ S+ RQ+ ADAL DT+SSLN+FEQ +KDCL+ 
Sbjct  189  FSSLNGIARESGVQLTSDSRQRAADALKDTISSLNNFEQVIKDCLQV  235



>ref|XP_002320631.1| hypothetical protein POPTR_0014s18330g [Populus trichocarpa]
 gb|EEE98946.1| hypothetical protein POPTR_0014s18330g [Populus trichocarpa]
Length=221

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WLK+QKKK+AK++LAP+DASR  L++AYLLL  S PEF E+ L E+Q LL
Sbjct  56   FSVGISGPKDWLKDQKKKTAKYILAPIDASREILRSAYLLLTDSQPEFKEEKLEEVQRLL  115

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLLD  DP KLEAE+ L D+IR 
Sbjct  116  KSAARDCVPQDRNSFVAFQANTGVEVCTFRLIVKNAASLLDKNDPAKLEAEAILDDLIRS  175

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            F SL+G+ +E ++Q+AS+RQK+ADALM+T+SSL+ FEQGVKDCLE 
Sbjct  176  FTSLDGLANEANVQLASDRQKVADALMNTISSLDKFEQGVKDCLEA  221



>ref|XP_011008409.1| PREDICTED: uncharacterized protein LOC105113788 isoform X1 [Populus 
euphratica]
Length=221

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WLK+QKKK+AK++LAP+DASR  L++AYLLL +S  EF E+ L E+Q LL
Sbjct  56   FSVGISGPKDWLKDQKKKTAKYVLAPIDASREILRSAYLLLTESQSEFKEEKLEEVQRLL  115

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLLD KDP+KLEAE+ L D+IR 
Sbjct  116  KSAARDCVPQDRNSFVAFQANTGVEVCTFRLIVKNAASLLDKKDPVKLEAEAILDDLIRS  175

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            F SL+G+ +E ++Q+AS+RQK+ADALM+T+SSL+ FEQGVKDCLE 
Sbjct  176  FTSLDGLANEANVQLASDRQKVADALMNTISSLDKFEQGVKDCLEA  221



>emb|CDP07514.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGISGPK WLKEQKKKS+KFLLAPVDASRN L++AYLL+ K   ++ E DL E++ L+
Sbjct  77   FSLGISGPKNWLKEQKKKSSKFLLAPVDASRNILRSAYLLMTKGETDYEENDLEEVKKLV  136

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             SA RDCV + RNSFV FQ+KTGVEVCTF+L+VNNASSLLDDKDP KLEAESKLTD+IR 
Sbjct  137  TSATRDCVAEQRNSFVAFQAKTGVEVCTFRLIVNNASSLLDDKDPTKLEAESKLTDLIRS  196

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL+ MT+E+  Q ASNRQ++A+ALMD + SL++FEQG+KDCLE
Sbjct  197  FTSLSDMTNEIGGQAASNRQRVANALMDALYSLDNFEQGIKDCLE  241



>gb|KDP38504.1| hypothetical protein JCGZ_04429 [Jatropha curcas]
Length=240

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WLKEQK+KS+KFLLAP+DASR  L++AYLLL  +  E ++K+L E+Q LL
Sbjct  75   FSIGISGPKDWLKEQKRKSSKFLLAPIDASREILRSAYLLLTANELEHTDKELEEVQGLL  134

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCVPQ+RNSFV FQ+ TGVEVCTF+L+V NASSLLD KDP KLEAE+ L D+IR 
Sbjct  135  RSAARDCVPQERNSFVAFQANTGVEVCTFRLIVKNASSLLDKKDPTKLEAEAMLDDLIRS  194

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLNG+ +E DIQ AS+R+K+ADALM+T+SSLN FE+ VKDCLE
Sbjct  195  FTSLNGLANEPDIQAASSRKKVADALMNTISSLNKFEERVKDCLE  239



>ref|XP_006434988.1| hypothetical protein CICLE_v10002305mg [Citrus clementina]
 gb|ESR48228.1| hypothetical protein CICLE_v10002305mg [Citrus clementina]
Length=242

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WLKEQKKKS+KFLLAP+DASR  L +AYLLLM    +++ KDL E+Q + 
Sbjct  77   FSIGISGPKDWLKEQKKKSSKFLLAPIDASRQILNSAYLLLMDKQSDYTNKDLEEVQKMF  136

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCVPQ+RNSFV FQ+ TGVEVCTF+L+V NASSLLD+KDP KL+AE+ L D+IR 
Sbjct  137  RSAARDCVPQERNSFVAFQANTGVEVCTFRLIVKNASSLLDNKDPAKLQAEAILDDLIRS  196

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            FASLNG+  +  I+++S R+K+ADALMDT+SSLN FEQG+KDCLE
Sbjct  197  FASLNGLAGDTAIELSSRREKLADALMDTISSLNKFEQGIKDCLE  241



>ref|XP_007017537.1| Chloroplast thylakoid membrane [Theobroma cacao]
 gb|EOY14762.1| Chloroplast thylakoid membrane [Theobroma cacao]
Length=244

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK+WLKEQK+KS+KFL+AP+DASR SL++AYLLLM      S KDL E+Q LL
Sbjct  82   FSIGISGPKEWLKEQKRKSSKFLVAPIDASRQSLRSAYLLLMDKE---STKDLEEVQKLL  138

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCV Q+RNSFV FQ+ TGVEVCTF+L+V NASSLL+DK+P+KLEAE+ L D+I  
Sbjct  139  KSAARDCVVQERNSFVAFQASTGVEVCTFRLIVKNASSLLEDKNPVKLEAEAMLDDLISS  198

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLN + +E DIQV+S+RQK+ADALMDT+SSL+ FEQGVKDCLE
Sbjct  199  FTSLNSLANETDIQVSSSRQKVADALMDTISSLDKFEQGVKDCLE  243



>ref|XP_006473498.1| PREDICTED: uncharacterized protein LOC102608992 [Citrus sinensis]
Length=242

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WLKEQKKKS+KFLLAP+DASR  L +AYLLLM    +++ KDL E+Q + 
Sbjct  77   FSIGISGPKDWLKEQKKKSSKFLLAPIDASRQILNSAYLLLMDKQFDYTNKDLEEVQKMF  136

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCVPQ+RNSFV FQ+ TGVEVCTF+L+V NASSLLD+KDP KL+AE+ L D+IR 
Sbjct  137  RSAARDCVPQERNSFVAFQANTGVEVCTFRLIVKNASSLLDNKDPAKLQAEAILDDLIRS  196

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            FASLNG+  +  I+++S R+K+ADALMDT+SSLN FEQG+KDCLE
Sbjct  197  FASLNGLAGDTAIELSSRREKLADALMDTISSLNKFEQGIKDCLE  241



>ref|XP_002281439.2| PREDICTED: uncharacterized protein LOC100243825 [Vitis vinifera]
Length=246

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             + GISGPK WLK QK+K++KFLLAPVDASR SL+ AYLL   SG     KDL E+Q LL
Sbjct  81   LTFGISGPKDWLKGQKRKASKFLLAPVDASRESLRTAYLLFTASGSNDPNKDLEEVQRLL  140

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCVPQ+RNSFV FQ+ TGVEVCTF+L++ NA+SLLDDKDP+KLEAE+ L D+I  
Sbjct  141  KSAARDCVPQERNSFVAFQATTGVEVCTFRLILKNAASLLDDKDPVKLEAEAMLNDLISS  200

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL+ +T+E D++ AS RQK+ADALMDT+SSLN FEQG+KDCLE
Sbjct  201  FTSLDDVTNETDMEFASKRQKVADALMDTISSLNKFEQGIKDCLE  245



>emb|CBI19697.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             + GISGPK WLK QK+K++KFLLAPVDASR SL+ AYLL   SG     KDL E+Q LL
Sbjct  76   LTFGISGPKDWLKGQKRKASKFLLAPVDASRESLRTAYLLFTASGSNDPNKDLEEVQRLL  135

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCVPQ+RNSFV FQ+ TGVEVCTF+L++ NA+SLLDDKDP+KLEAE+ L D+I  
Sbjct  136  KSAARDCVPQERNSFVAFQATTGVEVCTFRLILKNAASLLDDKDPVKLEAEAMLNDLISS  195

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL+ +T+E D++ AS RQK+ADALMDT+SSLN FEQG+KDCLE
Sbjct  196  FTSLDDVTNETDMEFASKRQKVADALMDTISSLNKFEQGIKDCLE  240



>ref|XP_002510386.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52573.1| conserved hypothetical protein [Ricinus communis]
Length=243

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 141/176 (80%), Gaps = 10/176 (6%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMK----------SGPEFSE  466
            FS+GISGPK WLKEQKKKS+KFLLAP+DASR  L++AYLLL +          S   +S 
Sbjct  68   FSIGISGPKDWLKEQKKKSSKFLLAPIDASREILRSAYLLLSERDLFSLLIAASESGYSN  127

Query  467  KDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEA  646
            K+L E+Q+LL+SAARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLLD KDP+KLEA
Sbjct  128  KELQEVQTLLRSAARDCVPQDRNSFVAFQANTGVEVCTFRLIVKNAASLLDKKDPVKLEA  187

Query  647  ESKLTDVIRCFASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            E  L D+IR F SL G+ +E +I +AS+R++IADALM T+SSLN FEQGVKDCLE 
Sbjct  188  EVMLNDLIRSFTSLTGLANEANILIASDRKEIADALMKTLSSLNKFEQGVKDCLEV  243



>ref|XP_010538090.1| PREDICTED: uncharacterized protein LOC104812558 isoform X1 [Tarenaya 
hassleriana]
Length=231

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGISGPK+WLKEQKKKS++FLLAP+DASR SL++AY LL     +F++ DL E+Q LL
Sbjct  66   FSLGISGPKEWLKEQKKKSSRFLLAPIDASRESLRSAYRLLTSRDSDFTDSDLEELQRLL  125

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KS+ RDCVP+DRNS V FQSKTGVEVCTF+LVV NA+SLLD KDP+KL AE+ L D++R 
Sbjct  126  KSSGRDCVPEDRNSLVDFQSKTGVEVCTFKLVVKNAASLLDSKDPLKLAAENTLDDLVRS  185

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F+SLNG+ + +DI++ S+R KIADAL +T+S L+ FE+GVKDCLE
Sbjct  186  FSSLNGLANGIDIKLPSDRAKIADALAETISHLDKFEKGVKDCLE  230



>ref|XP_010061315.1| PREDICTED: uncharacterized protein LOC104449021 [Eucalyptus grandis]
 gb|KCW68245.1| hypothetical protein EUGRSUZ_F01893 [Eucalyptus grandis]
Length=243

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK+WLKEQKKKS+KFLLAP++ASR SL+AAYL+L K+  E +  DL E+QSL 
Sbjct  79   FSIGISGPKEWLKEQKKKSSKFLLAPIEASRESLRAAYLILTKAS-ESTSDDLEEVQSLF  137

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGVEVCTF+L+V NA+SLL DKDP+KLEAE+ L  +IR 
Sbjct  138  RSAARDCVAEDRNSFVAFQANTGVEVCTFKLIVKNAASLLADKDPVKLEAEAMLDHLIRS  197

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F+SLNG+TS+ D+Q  + R ++ADAL DT+SSL  FEQG+KDCLE
Sbjct  198  FSSLNGLTSKSDLQDTTYRARVADALTDTISSLEKFEQGIKDCLE  242



>ref|XP_004152696.1| PREDICTED: uncharacterized protein LOC101216764 [Cucumis sativus]
 gb|KGN62602.1| hypothetical protein Csa_2G361670 [Cucumis sativus]
Length=231

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F +GISGPK WLKEQKKK++KFLLAP++ASR+SLQA YLLL     ++S KD+ ++Q LL
Sbjct  67   FDIGISGPKDWLKEQKKKASKFLLAPIEASRDSLQAVYLLLSNDS-DYSSKDMEDVQRLL  125

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCV +DRNSFVQFQ+ TGVEVCTFQL+V NA+SLL ++DPIKLEAES L D++  
Sbjct  126  KSAARDCVLKDRNSFVQFQASTGVEVCTFQLIVKNAASLLGNRDPIKLEAESLLKDLVSS  185

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLN +T E DIQV SNRQK+ DAL DT++SL+ FE+G+KDCLE
Sbjct  186  FTSLNSLTYETDIQVNSNRQKVLDALNDTMTSLDKFEKGIKDCLE  230



>gb|KHG07014.1| Plasma membrane fusion prm1 [Gossypium arboreum]
Length=241

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WLKEQK+KS+KFLLAP+DASR SL++ YLLLM      S  DL E+Q LL
Sbjct  76   FSIGISGPKDWLKEQKRKSSKFLLAPIDASRQSLRSVYLLLMDKESTISNNDLEEVQKLL  135

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCV  +RNSFV FQ+ TGVEVCTF+L+V NASSLL++K+P+KLEAE+ L D+I  
Sbjct  136  KSAARDCVVLERNSFVAFQANTGVEVCTFRLIVKNASSLLENKNPVKLEAEAMLDDLISS  195

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLN + +E DIQVAS+R ++ADAL DT++SL+ FEQ VKDCLE
Sbjct  196  FTSLNTLANESDIQVASSRHRVADALKDTITSLDKFEQAVKDCLE  240



>ref|XP_009336256.1| PREDICTED: uncharacterized protein LOC103928873 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336263.1| PREDICTED: uncharacterized protein LOC103928873 isoform X1 [Pyrus 
x bretschneideri]
Length=272

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+++FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  107  FSFGISGPKDWLREQKKKASRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  166

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGVEVCTF+LVV NASSLL DKDP+KLEAES L D++R 
Sbjct  167  RSAARDCVIEDRNSFVAFQANTGVEVCTFRLVVKNASSLLGDKDPVKLEAESILNDLVRS  226

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLNG+ +E D Q A+ R+K+AD+LMDT+SSL+ FEQG+KDCL+
Sbjct  227  FTSLNGLVNETDFQFATERKKVADSLMDTLSSLDKFEQGIKDCLD  271



>ref|XP_009365567.1| PREDICTED: uncharacterized protein LOC103955406 [Pyrus x bretschneideri]
Length=236

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             S GISGPK WL+EQKKK+++FLLAP+DASR SL AA+ LL  +  +++ K++ E+Q L 
Sbjct  71   LSFGISGPKDWLREQKKKASRFLLAPIDASRESLVAAHQLLTATNSDYTNKEMEEVQRLF  130

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGVEVCTF LVV NASSLL DKDP+KLEAES L D+IR 
Sbjct  131  RSAARDCVVEDRNSFVAFQANTGVEVCTFLLVVKNASSLLGDKDPVKLEAESLLNDLIRS  190

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLNG+ +E D+Q ++ R+K+AD+LMDT+SSL+ FEQG+KDCLE
Sbjct  191  FTSLNGLVNETDVQFSAERKKVADSLMDTISSLDKFEQGIKDCLE  235



>ref|XP_004160037.1| PREDICTED: uncharacterized protein LOC101225525 [Cucumis sativus]
Length=231

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F +GISGPK WLKEQKKK++KFLLAP++ASR+SLQA YLLL     ++S KD+ ++Q LL
Sbjct  67   FDIGISGPKDWLKEQKKKASKFLLAPIEASRDSLQAVYLLLSNDS-DYSSKDMEDVQRLL  125

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCV +DRNSFVQFQ+ TGVEVCTFQL+V NA+SLL ++DPIKLEAES L D++  
Sbjct  126  KSAARDCVLKDRNSFVQFQASTGVEVCTFQLIVKNAASLLGNRDPIKLEAESLLKDLVSS  185

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLN +  E DIQV SNRQK+ DAL DT++SL+ FE+G+KDCLE
Sbjct  186  FTSLNSLAYETDIQVNSNRQKVLDALNDTMTSLDKFEKGIKDCLE  230



>ref|XP_009364836.1| PREDICTED: uncharacterized protein LOC103954736 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009364842.1| PREDICTED: uncharacterized protein LOC103954736 isoform X1 [Pyrus 
x bretschneideri]
Length=272

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+ +FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  107  FSFGISGPKDWLREQKKKAFRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  166

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGVEVCTF+LVV NASSLL DKDP+KLEAES L D++R 
Sbjct  167  RSAARDCVIEDRNSFVAFQANTGVEVCTFRLVVKNASSLLGDKDPVKLEAESILNDLVRS  226

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLNG+ +E D Q A+ R+K+AD+LMDT+SSL+ FEQG+KDCL+
Sbjct  227  FTSLNGLVNETDFQFATERKKVADSLMDTLSSLDKFEQGIKDCLD  271



>ref|XP_008220800.1| PREDICTED: uncharacterized protein LOC103320844 [Prunus mume]
 ref|XP_008220802.1| PREDICTED: uncharacterized protein LOC103320844 [Prunus mume]
Length=238

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             S GISGPK WL+EQKKK+++FLLAP+DASR SL  A+ +L  +    + +++ E+Q L 
Sbjct  73   LSFGISGPKDWLREQKKKASRFLLAPIDASRESLLTAHRILTATDSNSTNEEIEEVQRLF  132

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCVP+DRNSFV FQ+ TGVEVCTF+LVV NA+SLL DKDP+KLEAES L D+IR 
Sbjct  133  KSAARDCVPEDRNSFVAFQANTGVEVCTFRLVVKNAASLLGDKDPVKLEAESVLNDLIRS  192

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLN + +E D+Q AS R+K+AD+LMDT+SSL+ FEQG+KDCLE
Sbjct  193  FTSLNVLVNETDVQFASERKKVADSLMDTISSLDKFEQGIKDCLE  237



>ref|XP_008388066.1| PREDICTED: uncharacterized protein LOC103450484 isoform X1 [Malus 
domestica]
 ref|XP_008388067.1| PREDICTED: uncharacterized protein LOC103450484 isoform X1 [Malus 
domestica]
Length=236

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+++FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  71   FSFGISGPKDWLREQKKKASRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  130

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGV VCTF+LVV NASSLL DKDP+KLEAES L D++R 
Sbjct  131  RSAARDCVIEDRNSFVAFQANTGVXVCTFRLVVKNASSLLGDKDPVKLEAESMLNDLVRS  190

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLNG+ +E D Q A+ R+K+AD+LMDT+SSL+ FEQG+KDCL+
Sbjct  191  FTSLNGLVNETDAQFAAERKKVADSLMDTLSSLDKFEQGIKDCLD  235



>ref|XP_007223845.1| hypothetical protein PRUPE_ppa010740mg [Prunus persica]
 gb|EMJ25044.1| hypothetical protein PRUPE_ppa010740mg [Prunus persica]
Length=238

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             S GISGPK WL+EQKKK+++FLLAP+DASR SL  A+ +L  +    + +++ E+Q L 
Sbjct  73   LSFGISGPKDWLREQKKKASRFLLAPIDASRESLLTAHRILTATDSNSTNEEIEEVQRLF  132

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCVP DRNSFV FQ+ TGVEVCTF+LVV NA+SLL DKDP+KLEAES L D+IR 
Sbjct  133  KSAARDCVPDDRNSFVAFQANTGVEVCTFRLVVKNAASLLGDKDPVKLEAESMLNDLIRS  192

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLN + +E D+Q AS R+K+AD+LMDT+SSL+ FEQG+KDCLE
Sbjct  193  FTSLNVLVNETDVQFASERKKVADSLMDTISSLDKFEQGIKDCLE  237



>ref|XP_008444717.1| PREDICTED: uncharacterized protein LOC103487971 [Cucumis melo]
Length=231

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F +GISGPK WLKEQKKKS+KFLLAP++ASR+SLQ  YLLL     ++S KD+ ++Q LL
Sbjct  67   FDIGISGPKDWLKEQKKKSSKFLLAPIEASRDSLQTVYLLLSNDS-DYSNKDMEDVQRLL  125

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCV +DR+SFVQFQ+ TGVEVCTFQL+V NA+SLL +KDPIKLEAE+ L D++  
Sbjct  126  KSAARDCVLKDRSSFVQFQASTGVEVCTFQLIVKNAASLLGNKDPIKLEAENLLKDLVSS  185

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLN +  E DIQV SNRQK+ DAL DT++SL+ FE+G+KDCLE
Sbjct  186  FTSLNSLAYETDIQVNSNRQKVLDALNDTMTSLDKFEKGIKDCLE  230



>gb|KEH36155.1| hypothetical protein MTR_3g111850 [Medicago truncatula]
Length=223

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            +GISGPK WL+EQKKKS+KFLLAPVDASR SL++ YL L ++G  ++++DL + Q L +S
Sbjct  60   IGISGPKDWLREQKKKSSKFLLAPVDASRESLRSVYLYLTETGATYTDEDLQKFQQLFRS  119

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
            AARDCVP+DRNSFV FQ+ TGVEVCTF+L+V NA+SLL  KDP+KLEAE+ L ++IR FA
Sbjct  120  AARDCVPEDRNSFVAFQANTGVEVCTFRLIVKNAASLLGKKDPVKLEAEALLENLIRSFA  179

Query  683  SLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            S++G+ +E +I++AS+R KIADA+ DT+ SL+ FEQG++DCLE
Sbjct  180  SISGLANETNIELASDRSKIADAVSDTILSLDKFEQGIRDCLE  222



>ref|XP_010263665.1| PREDICTED: uncharacterized protein LOC104601866 isoform X1 [Nelumbo 
nucifera]
Length=238

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WL+EQKKK++KF+LAP+DASR SL+ AY LL K+   +  KDL EIQ+LL
Sbjct  74   FSIGISGPKDWLREQKKKASKFILAPIDASRESLRTAYRLLTKNASGY-PKDLEEIQNLL  132

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCVPQ+RNSFV FQ+ TG+EVCTF+L+V NASSLLD+  P+KL+AE+ L D+IR 
Sbjct  133  RSAARDCVPQERNSFVSFQANTGIEVCTFRLIVKNASSLLDNASPVKLKAEAMLGDLIRS  192

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SLN   + +DIQ+AS+RQK+AD LM T+ SL+ FEQ V+DCLE
Sbjct  193  FTSLNEAANNMDIQLASDRQKVADELMGTMYSLDKFEQSVRDCLE  237



>ref|XP_004501013.1| PREDICTED: uncharacterized protein LOC101503744 [Cicer arietinum]
Length=225

 Score =   225 bits (573),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            +GISGPK WLKEQKKKS+KFLLAPVDASR +L++AYL L ++   ++++DL + Q L +S
Sbjct  62   IGISGPKDWLKEQKKKSSKFLLAPVDASRETLRSAYLFLTETDAAYTDEDLPKFQQLFRS  121

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
            AARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLL  KDP+KLEAE+ L ++IR F 
Sbjct  122  AARDCVPQDRNSFVAFQANTGVEVCTFRLLVKNAASLLGKKDPVKLEAEALLDNLIRSFT  181

Query  683  SLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            S++GM +E +I +AS+R+KIA+A+ DT++SL+ FEQG+KDCLE
Sbjct  182  SISGMANETNIGLASDRRKIANAVSDTITSLDKFEQGIKDCLE  224



>ref|XP_010097367.1| hypothetical protein L484_001599 [Morus notabilis]
 gb|EXB67771.1| hypothetical protein L484_001599 [Morus notabilis]
Length=436

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WLKEQKKK++KFLLAP+DASR SL  AYLLL     ++S KD+ EIQ+LL
Sbjct  271  FSIGISGPKDWLKEQKKKASKFLLAPIDASRQSLHTAYLLLTTKDSDYSNKDMEEIQNLL  330

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCVP +RNSFV FQ+ TGVEVCTF+L+V NASSLL +KDP+KL+AE+ L  +IR 
Sbjct  331  RSAARDCVPGERNSFVAFQANTGVEVCTFRLIVKNASSLLQNKDPVKLQAEAILNYLIRS  390

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  + ++ DI++ S RQ+IAD+LM T+SSL+ FEQG+KDCLE
Sbjct  391  FTSLQDVANQADIKLPSERQRIADSLMATISSLDKFEQGIKDCLE  435



>ref|XP_003528103.1| PREDICTED: uncharacterized protein LOC100796598 isoform X1 [Glycine 
max]
 ref|XP_006581209.1| PREDICTED: uncharacterized protein LOC100796598 isoform X2 [Glycine 
max]
 gb|KHN22253.1| hypothetical protein glysoja_022009 [Glycine soja]
Length=230

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            +GISGPK WLKEQKKK++K+LLAPVDASR  L++AYL L ++   ++++DL ++Q L  S
Sbjct  67   IGISGPKDWLKEQKKKASKYLLAPVDASRQILRSAYLTLTETDAAYTDEDLEKMQQLFIS  126

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
            AARDCVPQDRNSFV  Q+ TGVEVCTF+L+V NA+SLL +KDP+KL+AE+ L ++IR F 
Sbjct  127  AARDCVPQDRNSFVTLQANTGVEVCTFRLIVKNAASLLGNKDPVKLKAEALLDNLIRSFT  186

Query  683  SLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            S++G+ SE +IQ+AS+R+KIADA+ DT+S L+ FEQG++DCLET
Sbjct  187  SVSGLASETNIQLASDRKKIADAVSDTISDLDKFEQGIRDCLET  230



>ref|XP_007136592.1| hypothetical protein PHAVU_009G057900g [Phaseolus vulgaris]
 gb|ESW08586.1| hypothetical protein PHAVU_009G057900g [Phaseolus vulgaris]
Length=226

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            +GISGPK WLKEQK+K++KFLL PVDASR  L++AYL L K+   ++++DL +I+ L  S
Sbjct  63   IGISGPKNWLKEQKRKASKFLLDPVDASRQILRSAYLTLTKTDATYTDEDLEKIRQLFIS  122

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
            AARDCVPQDR+SFV FQ+K+GVEVCTF+L+V NA+SLL +KDP+KL+AE+ L ++ R F+
Sbjct  123  AARDCVPQDRSSFVSFQAKSGVEVCTFRLIVKNAASLLGNKDPVKLKAEALLDNLTRSFS  182

Query  683  SLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            +++GM SE +IQ+AS+R+KIADA+ DT+S L+ FEQG++DCLE+
Sbjct  183  TISGMASETNIQLASHREKIADAVSDTISDLDKFEQGIRDCLES  226



>gb|ACU23819.1| unknown [Glycine max]
Length=230

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            +GISGPK WLKEQKKK++K+LLAPVDASR  L++AYL L ++   ++++DL ++Q L  S
Sbjct  67   IGISGPKDWLKEQKKKASKYLLAPVDASRQILRSAYLTLTETDAAYTDEDLEKMQQLFIS  126

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
            AARDCVPQDRNSFV  Q+ TGVEVCTF+L+V NA+SLL +KDP+ L+AE+ L ++IR F 
Sbjct  127  AARDCVPQDRNSFVTLQANTGVEVCTFRLIVKNAASLLGNKDPVMLKAEALLDNLIRSFT  186

Query  683  SLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            S++G+ SE +IQ+AS+R+KIADA+ DT+S L+ FEQG++DCLET
Sbjct  187  SVSGLASETNIQLASDRKKIADAVSDTISDLDKFEQGIRDCLET  230



>ref|XP_010481950.1| PREDICTED: uncharacterized protein LOC104760688 [Camelina sativa]
Length=228

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGISGPK+WLKEQKKKS++FLLAP+DASR +L++AYL +  S  EF++KDL  +Q+L 
Sbjct  64   FSLGISGPKEWLKEQKKKSSRFLLAPIDASREALRSAYLSIT-SESEFTDKDLENLQNLF  122

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KS+ARDCVP++R+S V FQSK+GVEVCTF+LVV NA+SLLDDKDP+KLEAE+ L+D++R 
Sbjct  123  KSSARDCVPKERSSLVDFQSKSGVEVCTFKLVVKNAASLLDDKDPLKLEAENILSDLVRS  182

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +++ +D+ + S+R+K+ADA+ D +S L+ FE+GVKDCLE
Sbjct  183  FGSLIVLSNGIDMNLPSDRKKVADAVTDAISYLDKFEKGVKDCLE  227



>ref|XP_006577773.1| PREDICTED: uncharacterized protein LOC100499839 isoform X1 [Glycine 
max]
 gb|KHN45852.1| hypothetical protein glysoja_023075 [Glycine soja]
Length=228

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            +G+SGPK WLK+QKKK++K+LLAP+DASR  L++AYL L ++   ++++DL +IQ L  S
Sbjct  65   IGMSGPKNWLKDQKKKASKYLLAPIDASRQILRSAYLTLTETDAAYTDEDLEKIQQLFIS  124

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
            AARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLL +KDP+KL+AE+ L ++IR F 
Sbjct  125  AARDCVPQDRNSFVTFQANTGVEVCTFRLIVKNAASLLGNKDPVKLKAEALLDNLIRSFT  184

Query  683  SLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            S++GM S+ +IQ+AS+R+KIADA+ DT+S L+ FE G++DCLET
Sbjct  185  SVSGMASKTNIQLASDRKKIADAVSDTISDLDKFELGIRDCLET  228



>gb|AAM65999.1| unknown [Arabidopsis thaliana]
Length=229

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +2

Query  227  KLISRRNavvllslvapllpalhhpspasaFSLGISGPKQWLKEQKKKSAKFLLAPVDAS  406
            ++ISRR+A VLLS    LL  L   +PA AFSLGISGPK+WLK+QKKKS++FLLAP+DA+
Sbjct  35   QIISRRDATVLLSSATSLLLTLSPTNPAFAFSLGISGPKEWLKDQKKKSSRFLLAPIDAT  94

Query  407  RNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQ  586
            R +LQ+AYL L  S  +++EKDL  +Q+L KS+ARDCVP++R+S V FQSK+GVEVCTF+
Sbjct  95   RQALQSAYLSLT-SESDYTEKDLENLQNLFKSSARDCVPKERSSLVDFQSKSGVEVCTFK  153

Query  587  LVVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNRQKIADALMDTV  766
            LVV NA+SLLDDKDP+KLEAE+ L D++R F SL  +T+ +D+ + S+R+K+AD + +T+
Sbjct  154  LVVKNAASLLDDKDPVKLEAENILYDLVRSFGSLIVLTNGVDMNLPSDRKKVADGVTETI  213

Query  767  SSLNSFEQGVKDCLE  811
            S L+ FE+GVKDCLE
Sbjct  214  SYLDKFEKGVKDCLE  228



>ref|XP_010494224.1| PREDICTED: uncharacterized protein LOC104771408 [Camelina sativa]
Length=231

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGISGPK+WLKEQKKKS++FLLAP+DASR +L++AYL +  S  E+++KDL  +Q+L 
Sbjct  67   FSLGISGPKEWLKEQKKKSSRFLLAPIDASREALRSAYLSIT-SESEYTDKDLENLQNLF  125

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KS+ARDCVP++R+S V FQSK+GVEVCTF+LVV NA+SLLDDKDP+KLEAE+ L+D++R 
Sbjct  126  KSSARDCVPKERSSLVDFQSKSGVEVCTFKLVVKNAASLLDDKDPLKLEAENILSDLVRS  185

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +++ +D+ + S+R+K+ADA+ D +S L+ FE+GVKDCLE
Sbjct  186  FGSLIVLSNGIDMNLPSDRKKVADAVTDAISYLDKFEKGVKDCLE  230



>ref|NP_568612.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED94859.1| uncharacterized protein AT5G42765 [Arabidopsis thaliana]
Length=229

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +2

Query  227  KLISRRNavvllslvapllpalhhpspasaFSLGISGPKQWLKEQKKKSAKFLLAPVDAS  406
            ++ISRR+A VLLS    LL  L   +PA AFSLGISGPK+WLK+QKKKS++FLLAP+DA+
Sbjct  35   QIISRRDATVLLSSATSLLLTLSPTNPAFAFSLGISGPKEWLKDQKKKSSRFLLAPIDAT  94

Query  407  RNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQ  586
            R +LQ+AYL L  S  +++EKDL  +Q+L KS+ARDCVP++R+S V FQSK+GVEVCTF+
Sbjct  95   RQALQSAYLSLT-SESDYTEKDLENLQNLFKSSARDCVPKERSSLVDFQSKSGVEVCTFK  153

Query  587  LVVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNRQKIADALMDTV  766
            LVV NA+SLLDDKDP+KLEAE+ L D++R F SL  +T+ +D+ + S+R+K+AD + +T+
Sbjct  154  LVVKNAASLLDDKDPVKLEAENILDDLVRSFGSLIVLTNGVDMNLPSDRKKVADGVTETI  213

Query  767  SSLNSFEQGVKDCLE  811
            S L+ FE+GVKDCLE
Sbjct  214  SYLDKFEKGVKDCLE  228



>gb|ACU16829.1| unknown [Glycine max]
Length=228

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            +G+SGPK WLK+QKKK++K+LLAP+DASR  L++AYL L ++   ++++DL +I+ L  S
Sbjct  65   IGMSGPKNWLKDQKKKASKYLLAPIDASRQILRSAYLTLTETDAAYTDEDLEKIRQLFIS  124

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
            AARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLL +KDP+KL+AE+ L ++IR F 
Sbjct  125  AARDCVPQDRNSFVTFQANTGVEVCTFRLIVKNAASLLGNKDPVKLKAEALLDNLIRSFT  184

Query  683  SLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            S++GM S+ +IQ+AS+R+KIADA+ DT+S L+ FE G++DCLET
Sbjct  185  SVSGMASKTNIQLASDRKKIADAVSDTISDLDKFELGIRDCLET  228



>ref|XP_006577774.1| PREDICTED: uncharacterized protein LOC100499839 isoform X2 [Glycine 
max]
Length=226

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  320  SLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLK  499
            ++ I+GPK WLK+QKKK++K+LLAP+DASR  L++AYL L ++   ++++DL +IQ L  
Sbjct  62   AIEIAGPKNWLKDQKKKASKYLLAPIDASRQILRSAYLTLTETDAAYTDEDLEKIQQLFI  121

Query  500  SAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCF  679
            SAARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLL +KDP+KL+AE+ L ++IR F
Sbjct  122  SAARDCVPQDRNSFVTFQANTGVEVCTFRLIVKNAASLLGNKDPVKLKAEALLDNLIRSF  181

Query  680  ASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
             S++GM S+ +IQ+AS+R+KIADA+ DT+S L+ FE G++DCLET
Sbjct  182  TSVSGMASKTNIQLASDRKKIADAVSDTISDLDKFELGIRDCLET  226



>ref|XP_010442124.1| PREDICTED: uncharacterized protein LOC104725201 [Camelina sativa]
Length=232

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGISGPK+WLKEQKKKS++FLLAP+ ASR +L++AYL +  S  E+++KDL  +QSL 
Sbjct  68   FSLGISGPKEWLKEQKKKSSRFLLAPIGASREALRSAYLSIT-SESEYTDKDLENLQSLF  126

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KS+ARDCVP +R+S V FQSK+GVEVCTF+LVV NA+SLLDDKDP+KLEAE+ L+D++R 
Sbjct  127  KSSARDCVPNERSSLVDFQSKSGVEVCTFKLVVKNAASLLDDKDPLKLEAENILSDLVRS  186

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +++ +D+ + S+R+K+ADA+ D +S L+ FE+GVKDCLE
Sbjct  187  FGSLIVLSNGIDMNLPSDRKKVADAVTDAISYLDKFEKGVKDCLE  231



>ref|XP_004293207.1| PREDICTED: uncharacterized protein LOC101306500 [Fragaria vesca 
subsp. vesca]
Length=225

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 135/166 (81%), Gaps = 4/166 (2%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F+ GISGPK WL+EQKKK+++FLLAP+DASR SL AA+ LLM      + +++ E+Q L 
Sbjct  64   FAFGISGPKDWLREQKKKASRFLLAPIDASRESLLAAHRLLMDD----TNQEIEEVQRLF  119

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DR+SFV FQ+ TGVEVCTF+L+V NA+SLL DKDP+KLEAES L D+IR 
Sbjct  120  RSAARDCVVEDRSSFVAFQANTGVEVCTFRLLVRNAASLLGDKDPVKLEAESMLNDLIRS  179

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            F+SLN + +E D  +AS R+K+AD+LMDT+SSL+ FEQG+KDCLE 
Sbjct  180  FSSLNVLVNESDALLASQRKKVADSLMDTISSLDKFEQGIKDCLEA  225



>ref|XP_006281050.1| hypothetical protein CARUB_v10027066mg [Capsella rubella]
 gb|EOA13948.1| hypothetical protein CARUB_v10027066mg [Capsella rubella]
Length=227

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGISGPK+WLK+QKKKS++FLLAP+DASR +L++AYL +  S  E+S+KDL  +Q+L 
Sbjct  63   FSLGISGPKEWLKDQKKKSSRFLLAPIDASREALRSAYLSIT-SESEYSDKDLENLQNLF  121

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KS+ARDCVP++R+S V FQSK+GVEVCTF+LVV NA+SLLDDKDP+KLEAE+ L++++R 
Sbjct  122  KSSARDCVPKERSSLVDFQSKSGVEVCTFKLVVKNAASLLDDKDPLKLEAENILSELVRS  181

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +T+ +D+ + S+R+K+ADA+ + +S L+ FE+GVKDCLE
Sbjct  182  FGSLIVLTNGIDMNLPSDRKKLADAVTEAISYLDKFEKGVKDCLE  226



>ref|XP_010684332.1| PREDICTED: uncharacterized protein LOC104898898 [Beta vulgaris 
subsp. vulgaris]
Length=238

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F++GISGPK WL+EQKKKS K+LLAP+DAS+  L+  Y LL+      + KDL EIQ LL
Sbjct  73   FNIGISGPKDWLREQKKKSIKYLLAPIDASQQILRHVYQLLLAEDNVLNPKDLEEIQELL  132

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSA RDCV +DRNS V FQ+KTGVEVCTF+L+V NASSLLDD D  KLEAE++L+++IR 
Sbjct  133  KSAGRDCVLEDRNSIVAFQAKTGVEVCTFKLIVTNASSLLDDGDSAKLEAEARLSNLIRS  192

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            F  LNG+  E ++Q+AS RQKIADA+MD++SSL+ FEQG+K C+E 
Sbjct  193  FTLLNGVVKEANLQLASQRQKIADAVMDSLSSLDKFEQGIKGCIEV  238



>ref|NP_001236729.1| uncharacterized protein LOC100499839 [Glycine max]
 ref|XP_006577775.1| PREDICTED: uncharacterized protein LOC100499839 isoform X3 [Glycine 
max]
 gb|ACU13870.1| unknown [Glycine max]
Length=225

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  335  GPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAARD  514
            GPK WLK+QKKK++K+LLAP+DASR  L++AYL L ++   ++++DL +IQ L  SAARD
Sbjct  66   GPKNWLKDQKKKASKYLLAPIDASRQILRSAYLTLTETDAAYTDEDLEKIQQLFISAARD  125

Query  515  CVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNG  694
            CVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLL +KDP+KL+AE+ L ++IR F S++G
Sbjct  126  CVPQDRNSFVTFQANTGVEVCTFRLIVKNAASLLGNKDPVKLKAEALLDNLIRSFTSVSG  185

Query  695  MTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLET  814
            M S+ +IQ+AS+R+KIADA+ DT+S L+ FE G++DCLET
Sbjct  186  MASKTNIQLASDRKKIADAVSDTISDLDKFELGIRDCLET  225



>emb|CDX95168.1| BnaC09g17020D [Brassica napus]
Length=220

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F+ GISGPK+WLK+QKKKS++FLLAP+DASR SL++ YL L     ++++KDL  +Q+LL
Sbjct  55   FAFGISGPKEWLKDQKKKSSRFLLAPIDASRESLRSVYLSLSTRESDYTDKDLESLQNLL  114

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +S+ARDCVP++R+S V FQSKTGVEVCTF+LV+ NA+SLLDDKDP+ LEAE+ L D++R 
Sbjct  115  RSSARDCVPKERSSLVDFQSKTGVEVCTFKLVLKNAASLLDDKDPVILEAENILHDLVRS  174

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +T+ +D+ + S+R+KIADA+M+ +S L+ FE+ VKDCLE
Sbjct  175  FGSLIVLTNGIDMNLPSDRKKIADAVMEAISYLDKFEKSVKDCLE  219



>ref|XP_010263666.1| PREDICTED: uncharacterized protein LOC104601866 isoform X2 [Nelumbo 
nucifera]
Length=237

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 130/158 (82%), Gaps = 1/158 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WL+EQKKK++KF+LAP+DASR SL+ AY LL K+   +  KDL EIQ+LL
Sbjct  74   FSIGISGPKDWLREQKKKASKFILAPIDASRESLRTAYRLLTKNASGY-PKDLEEIQNLL  132

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCVPQ+RNSFV FQ+ TG+EVCTF+L+V NASSLLD+  P+KL+AE+ L D+IR 
Sbjct  133  RSAARDCVPQERNSFVSFQANTGIEVCTFRLIVKNASSLLDNASPVKLKAEAMLGDLIRS  192

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQ  790
            F SLN   + +DIQ+AS+RQK+AD LM T+ SL+ FEQ
Sbjct  193  FTSLNEAANNMDIQLASDRQKVADELMGTMYSLDKFEQ  230



>ref|XP_002863738.1| hypothetical protein ARALYDRAFT_494744 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39997.1| hypothetical protein ARALYDRAFT_494744 [Arabidopsis lyrata subsp. 
lyrata]
Length=227

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 137/165 (83%), Gaps = 1/165 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGISGPK+WLKEQKKKS++FLLAP+DASR +L++AYL L  S  +++EKDL  +Q+L 
Sbjct  63   FSLGISGPKEWLKEQKKKSSRFLLAPIDASREALRSAYLSL-SSESDYTEKDLENLQNLF  121

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KS+ARDCVP++R S V FQSK+GVEV TF+LVV NA+SLL DKDP+KLEAE+ L D++R 
Sbjct  122  KSSARDCVPKERTSLVDFQSKSGVEVYTFKLVVKNAASLLGDKDPVKLEAENILDDLVRS  181

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +T+ +D+ + S+R+KIADA+ D +S L+ FE+GVKDCLE
Sbjct  182  FGSLIVLTNGVDMNLPSDRKKIADAVTDAISYLDKFEKGVKDCLE  226



>ref|XP_006403353.1| hypothetical protein EUTSA_v10003376mg [Eutrema salsugineum]
 gb|ESQ44806.1| hypothetical protein EUTSA_v10003376mg [Eutrema salsugineum]
Length=223

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F+ GISGPK+WLK+QKKKS++FLLAP+DASR SL++ YL L     ++++KDL  +Q+LL
Sbjct  58   FAFGISGPKEWLKDQKKKSSRFLLAPIDASRESLRSVYLSLTTRETDYTDKDLESLQNLL  117

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +S+ARDCVP++R+S V FQSKTGVEVCTF+LVV NA+SLLDDKDP+K+EAE  L D+IR 
Sbjct  118  RSSARDCVPKERSSLVDFQSKTGVEVCTFKLVVKNAASLLDDKDPLKVEAEDILNDLIRS  177

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +T+ +D+ + S+R+ I+DA+M+++S L+ FE+ VKDCLE
Sbjct  178  FGSLIVLTNGIDMNLPSDRKNISDAVMESISFLDKFEKSVKDCLE  222



>gb|KFK31819.1| hypothetical protein AALP_AA6G162500 [Arabis alpina]
Length=217

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F+ GISGPK+WLK+QK+KS++FLLAP+DASR SL++ YL L     ++ E DL  +Q+LL
Sbjct  52   FAFGISGPKEWLKDQKRKSSRFLLAPIDASRQSLRSVYLSLSSRDSDYKEGDLESLQNLL  111

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +S+ARDCV  +R+S V FQSKTGVEVCTF+LVV NA+SLLDDKDP+KLEAE+ L D++R 
Sbjct  112  RSSARDCVSNERSSLVDFQSKTGVEVCTFKLVVKNAASLLDDKDPLKLEAENILNDLVRS  171

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F+SL  +T+ +D+ + S+R+KIAD +M+ +S L+ FE+GVKDCLE
Sbjct  172  FSSLIVLTNGIDMNLPSDRKKIADGVMEVISYLDKFEKGVKDCLE  216



>emb|CDY52369.1| BnaA09g15680D [Brassica napus]
Length=221

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F+ GISGPK+WLK+QKKKS++FLLAP+DASR SL++ YL L     ++++KDL  +Q+LL
Sbjct  56   FAFGISGPKEWLKDQKKKSSRFLLAPIDASRESLRSVYLSLTTRESDYTDKDLESLQNLL  115

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +S+ARDCVP++R+S V FQSKTGVEVCTF+LV+ NA+SLLDDKDP+ L+AE+ L D+ R 
Sbjct  116  RSSARDCVPKERSSIVDFQSKTGVEVCTFKLVLKNAASLLDDKDPVILKAENILNDLARS  175

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +T+ +D+ + S+R+KIADA+M+ +S L+ FE+ VKDCLE
Sbjct  176  FGSLIVLTNGIDMNLPSDRKKIADAVMEAISYLDKFEKSVKDCLE  220



>ref|XP_009114040.1| PREDICTED: uncharacterized protein LOC103839284 [Brassica rapa]
Length=224

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            F+ GISGPK+WLK+QKKKS++FLLAP+DASR SL++ YL L     ++++KDL  +Q+LL
Sbjct  59   FAFGISGPKEWLKDQKKKSSRFLLAPIDASRESLRSVYLSLSTRESDYTDKDLESLQNLL  118

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +S+ARDCVP++R+S V FQSKTGVEVCTF+LV+ NA+SLLDDKDP+ L+AE+ L D+ R 
Sbjct  119  RSSARDCVPKERSSIVDFQSKTGVEVCTFKLVLKNAASLLDDKDPVILKAENILNDLARS  178

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            F SL  +T+ +D+ + S+R+KIADA+M+ +S L+ FE+ VKDCLE
Sbjct  179  FGSLIVLTNGIDMNLPSDRKKIADAVMEAISYLDKFEKSVKDCLE  223



>ref|XP_011008410.1| PREDICTED: uncharacterized protein LOC105113788 isoform X2 [Populus 
euphratica]
Length=209

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WLK+QKKK+AK++LAP+DASR  L++AYLLL +S  EF E+ L E+Q LL
Sbjct  56   FSVGISGPKDWLKDQKKKTAKYVLAPIDASREILRSAYLLLTESQSEFKEEKLEEVQRLL  115

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            KSAARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLLD KDP+KLEAE+ L D+IR 
Sbjct  116  KSAARDCVPQDRNSFVAFQANTGVEVCTFRLIVKNAASLLDKKDPVKLEAEAILDDLIRS  175

Query  677  FASLNGMTSELDIQVASNRQ  736
            F SL+G+ +E ++Q+AS+ Q
Sbjct  176  FTSLDGLANEANVQLASDSQ  195



>ref|XP_009336273.1| PREDICTED: uncharacterized protein LOC103928873 isoform X2 [Pyrus 
x bretschneideri]
Length=268

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+++FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  107  FSFGISGPKDWLREQKKKASRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  166

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGVEVCTF+LVV NASSLL DKDP+KLEAES L D++R 
Sbjct  167  RSAARDCVIEDRNSFVAFQANTGVEVCTFRLVVKNASSLLGDKDPVKLEAESILNDLVRS  226

Query  677  FASLNGMTSELDIQVASNR  733
            F SLNG+ +E D Q A+ R
Sbjct  227  FTSLNGLVNETDFQFATER  245



>ref|XP_009364850.1| PREDICTED: uncharacterized protein LOC103954736 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009364859.1| PREDICTED: uncharacterized protein LOC103954736 isoform X2 [Pyrus 
x bretschneideri]
Length=268

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+ +FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  107  FSFGISGPKDWLREQKKKAFRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  166

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGVEVCTF+LVV NASSLL DKDP+KLEAES L D++R 
Sbjct  167  RSAARDCVIEDRNSFVAFQANTGVEVCTFRLVVKNASSLLGDKDPVKLEAESILNDLVRS  226

Query  677  FASLNGMTSELDIQVASNR  733
            F SLNG+ +E D Q A+ R
Sbjct  227  FTSLNGLVNETDFQFATER  245



>ref|XP_008388068.1| PREDICTED: uncharacterized protein LOC103450484 isoform X2 [Malus 
domestica]
 ref|XP_008388069.1| PREDICTED: uncharacterized protein LOC103450484 isoform X2 [Malus 
domestica]
Length=232

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+++FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  71   FSFGISGPKDWLREQKKKASRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  130

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGV VCTF+LVV NASSLL DKDP+KLEAES L D++R 
Sbjct  131  RSAARDCVIEDRNSFVAFQANTGVXVCTFRLVVKNASSLLGDKDPVKLEAESMLNDLVRS  190

Query  677  FASLNGMTSELDIQVASNR  733
            F SLNG+ +E D Q A+ R
Sbjct  191  FTSLNGLVNETDAQFAAER  209



>ref|XP_010943014.1| PREDICTED: uncharacterized protein LOC105060835 isoform X5 [Elaeis 
guineensis]
Length=267

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  326  GISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSA  505
            GI GPK WL++QKKK+A+F+LAP++ SR SL+ AYLLL        E D GE++ LL  A
Sbjct  106  GIPGPKDWLRDQKKKAARFILAPIEDSRESLRNAYLLLSSEAGSPVE-DSGEVRRLLNLA  164

Query  506  ARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFAS  685
             +DCVPQ R+S V+FQS+TGVEVCTF+L+V NA+SLLD  DP+KL+ E+ L D+IR F+ 
Sbjct  165  VKDCVPQRRSSLVEFQSRTGVEVCTFRLLVKNAASLLDKGDPVKLDVEAMLNDLIRSFSL  224

Query  686  LNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            L  +    + +  ++RQK+ D LMDT+SSL+ FEQG+K+CL
Sbjct  225  LGSVIDSSNFEFTTDRQKVKDGLMDTISSLDRFEQGIKNCL  265



>ref|XP_006577776.1| PREDICTED: uncharacterized protein LOC100499839 isoform X4 [Glycine 
max]
Length=201

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            +G+SGPK WLK+QKKK++K+LLAP+DASR  L++AYL L ++   ++++DL +IQ L  S
Sbjct  65   IGMSGPKNWLKDQKKKASKYLLAPIDASRQILRSAYLTLTETDAAYTDEDLEKIQQLFIS  124

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
            AARDCVPQDRNSFV FQ+ TGVEVCTF+L+V NA+SLL +KDP+KL+AE+ L ++IR F 
Sbjct  125  AARDCVPQDRNSFVTFQANTGVEVCTFRLIVKNAASLLGNKDPVKLKAEALLDNLIRSFT  184

Query  683  SLNGMTSELDIQVASNR  733
            S++GM S+ +IQ+AS+R
Sbjct  185  SVSGMASKTNIQLASDR  201



>ref|XP_009403512.1| PREDICTED: uncharacterized protein LOC103987051 [Musa acuminata 
subsp. malaccensis]
Length=228

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
             S+GI GPK+WLKEQKKKSAKF+LAP++ASRN+L++A+ LL     + +  +  E++ LL
Sbjct  63   LSIGIPGPKEWLKEQKKKSAKFVLAPIEASRNTLRSAFDLLNAPDSQSTAVNSEEMRRLL  122

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
              A+RDCVP  R+S VQ QS+TGVEVCTF+L+V NA+SLLD  +P+KLEAE  L D+IR 
Sbjct  123  NLASRDCVPLQRSSLVQLQSQTGVEVCTFRLIVKNAASLLDKNNPVKLEAEVALDDLIRS  182

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F+ L  +  + + Q+ ++R+K+ D L  T+SSL+ FEQG+K+CL
Sbjct  183  FSLLGDVIIDGNFQLGADREKVKDGLAKTISSLDKFEQGIKECL  226



>emb|CAN75690.1| hypothetical protein VITISV_038531 [Vitis vinifera]
Length=211

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  434  LLMKSGPEFSEKDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSL  613
            L+  SG     KDL E+Q LLKSAARDCVPQ+RNSFV FQ+ TGVEVCTF+L++ NA+SL
Sbjct  85   LIAASGSNDPNKDLEEVQRLLKSAARDCVPQERNSFVAFQATTGVEVCTFRLILKNAASL  144

Query  614  LDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQG  793
            LDDKDP+KLEAE+ L D+I  F SL+ +T+E D++ AS RQK+ADALMDT+SSLN FEQG
Sbjct  145  LDDKDPVKLEAEAMLNDLISSFTSLDDVTNETDMEFASKRQKVADALMDTISSLNKFEQG  204

Query  794  VKDCLE  811
            +KDCLE
Sbjct  205  IKDCLE  210



>gb|EPS70200.1| hypothetical protein M569_04561, partial [Genlisea aurea]
Length=152

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK+WLKEQKKK+AK+L+AP+DASRN+LQ+A +LL K+  E  E D+ E+Q +L
Sbjct  28   FSIGISGPKEWLKEQKKKTAKYLIAPIDASRNTLQSALVLLTKNEGELVENDVEEVQKML  87

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             SA+RDCVPQDRNSFV FQ+ TGVEVCTF L+V NASSLL D+DP+KLEAE++L  ++R 
Sbjct  88   HSASRDCVPQDRNSFVVFQANTGVEVCTFSLIVKNASSLLGDRDPVKLEAEARLQHLVRS  147

Query  677  -FASL  688
             F++L
Sbjct  148  PFSTL  152



>ref|XP_002466375.1| hypothetical protein SORBIDRAFT_01g006620 [Sorghum bicolor]
 gb|EER93373.1| hypothetical protein SORBIDRAFT_01g006620 [Sorghum bicolor]
Length=232

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGI GPK+ L+EQKKKSA +LLAP+ ASR++L  +  LL  + P  S +D  E++  +
Sbjct  69   FSLGIPGPKELLREQKKKSASYLLAPIAASRDTLVKSQALL--ASPSASAEDAEEVRGRI  126

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP+ RNS V FQS+TGVEVCTF L++ NA+SLL +KDP+K+EA+++L ++I+ 
Sbjct  127  GAAGRDCVPRQRNSIVAFQSRTGVEVCTFSLILKNAASLLANKDPLKVEADARLGELIQS  186

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F+ L  +    + ++A +R+K+ D L+ T+S+L+ FEQ VKDCL
Sbjct  187  FSDLGTLADNSNFELADDREKMNDGLLSTISALDKFEQSVKDCL  230



>tpg|DAA51674.1| TPA: hypothetical protein ZEAMMB73_411815 [Zea mays]
Length=232

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGI GPK+ L+EQKKKSA FLLAP+ ASR++L  A+ LL  + P  S +D  E++  +
Sbjct  69   FSLGIPGPKELLREQKKKSASFLLAPIAASRDTLVKAHALL--ASPSASTEDAEEVKGRI  126

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP+ RNS V  QS+TGVEVCTF L++ NA+SLL +KD +K+EA+++L ++I+ 
Sbjct  127  LAAGRDCVPRQRNSIVALQSRTGVEVCTFSLILKNAASLLANKDSLKVEADTRLEELIKS  186

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F+ L  +    + ++A +R+KI D L+ +VS+L+ FEQ VKDCL
Sbjct  187  FSELGTLVENSNFELADDREKIKDGLLSSVSALDKFEQSVKDCL  230



>gb|ABF99113.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99114.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99115.1| expressed protein [Oryza sativa Japonica Group]
Length=241

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGI GPK+ L+EQKKKSA+FLLAP+ ASR  L  A  LL  +       D+ E+  +L
Sbjct  78   FSLGIPGPKELLREQKKKSARFLLAPIAASREILLKAQSLLASAN--VGADDVEEVGRML  135

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP+ RNS V  QS++GVEVCTF L++ NA+SLL DKDP+K+EA+++L ++I+ 
Sbjct  136  AAAGRDCVPRQRNSLVSLQSRSGVEVCTFSLILKNAASLLTDKDPLKVEADARLAELIQS  195

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F+ L  +    +I++ ++R+K+ D L+ TVS+++ FEQ VKDCL
Sbjct  196  FSDLGTVVDNSNIELTADREKMKDGLLSTVSAIDKFEQSVKDCL  239



>gb|AAP68897.1| unknown protein [Oryza sativa Japonica Group]
Length=297

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGI GPK+ L+EQKKKSA+FLLAP+ ASR  L  A  LL  +       D+ E+  +L
Sbjct  92   FSLGIPGPKELLREQKKKSARFLLAPIAASREILLKAQSLLASAN--VGADDVEEVGRML  149

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP+ RNS V  QS++GVEVCTF L++ NA+SLL DKDP+K+EA+++L ++I+ 
Sbjct  150  AAAGRDCVPRQRNSLVSLQSRSGVEVCTFSLILKNAASLLTDKDPLKVEADARLAELIQS  209

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F+ L  +    +I++ ++R+K+ D L+ TVS+++ FEQ VKDCL
Sbjct  210  FSDLGTVVDNSNIELTADREKMKDGLLSTVSAIDKFEQSVKDCL  253



>ref|XP_010942996.1| PREDICTED: uncharacterized protein LOC105060835 isoform X2 [Elaeis 
guineensis]
Length=300

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 125/193 (65%), Gaps = 32/193 (17%)
 Frame = +2

Query  326  GISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLL---------------------M  442
            GI GPK WL++QKKK+A+F+LAP++ SR SL+ AYLLL                     +
Sbjct  106  GIPGPKDWLRDQKKKAARFILAPIEDSRESLRNAYLLLCTLPHLFFSFFPFFPLCPLFLL  165

Query  443  KSGP------EFSE-----KDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQL  589
              GP        SE     +D GE++ LL  A +DCVPQ R+S V+FQS+TGVEVCTF+L
Sbjct  166  PFGPIVRFLNAASEAGSPVEDSGEVRRLLNLAVKDCVPQRRSSLVEFQSRTGVEVCTFRL  225

Query  590  VVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNRQKIADALMDTVS  769
            +V NA+SLLD  DP+KL+ E+ L D+IR F+ L  +    + +  ++RQK+ D LMDT+S
Sbjct  226  LVKNAASLLDKGDPVKLDVEAMLNDLIRSFSLLGSVIDSSNFEFTTDRQKVKDGLMDTIS  285

Query  770  SLNSFEQGVKDCL  808
            SL+ FEQG+K+CL
Sbjct  286  SLDRFEQGIKNCL  298



>ref|XP_006650669.1| PREDICTED: uncharacterized protein LOC102718346 [Oryza brachyantha]
Length=238

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGI GPK+ L+EQKKKSA+FLLAP+ ASR+ L  A  +L  +      +D  E+  +L
Sbjct  75   FSLGIPGPKELLREQKKKSARFLLAPIAASRDILLKASSILASAN--LGAEDAEEVGRML  132

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP+ RNS V  QS++GVEVCTF L++ NA+SLL DKDP+K+EA+++L ++I+ 
Sbjct  133  GAAGRDCVPRQRNSIVALQSRSGVEVCTFSLILKNAASLLTDKDPLKVEADARLAELIQS  192

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F+ L  +    + ++ ++R+K+ D L+ TVS+++ FEQ VKDCL
Sbjct  193  FSDLGTVVDNSNFELTADREKMKDGLLSTVSAIDKFEQSVKDCL  236



>ref|XP_008347422.1| PREDICTED: uncharacterized protein LOC103410505 [Malus domestica]
Length=114

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  473  LGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAES  652
            + E+Q L +S+ARDCV +DRNSFV FQ+ TGVEVCTF+LVV NASSLL DKDP+KLEAES
Sbjct  1    MEEVQRLFRSSARDCVIEDRNSFVAFQANTGVEVCTFRLVVKNASSLLGDKDPVKLEAES  60

Query  653  KLTDVIRCFASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
             L D+IR F SLNG+ +E D+Q A+ R+K+AD LMDT+SSL+ FEQG+KDCLE
Sbjct  61   LLNDLIRSFTSLNGLVNETDVQFAAERKKVADXLMDTISSLDKFEQGIKDCLE  113



>ref|XP_009336277.1| PREDICTED: uncharacterized protein LOC103928873 isoform X3 [Pyrus 
x bretschneideri]
Length=228

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+++FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  107  FSFGISGPKDWLREQKKKASRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  166

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGVEVCTF+LVV NASSLL DKDP+KLEAES L D+I  
Sbjct  167  RSAARDCVIEDRNSFVAFQANTGVEVCTFRLVVKNASSLLGDKDPVKLEAESILNDLIIH  226

Query  677  FA  682
            F+
Sbjct  227  FS  228



>ref|XP_009364867.1| PREDICTED: uncharacterized protein LOC103954736 isoform X3 [Pyrus 
x bretschneideri]
Length=228

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+ +FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  107  FSFGISGPKDWLREQKKKAFRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  166

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGVEVCTF+LVV NASSLL DKDP+KLEAES L D+I  
Sbjct  167  RSAARDCVIEDRNSFVAFQANTGVEVCTFRLVVKNASSLLGDKDPVKLEAESILNDLIIH  226

Query  677  FA  682
            F+
Sbjct  227  FS  228



>ref|XP_008388070.1| PREDICTED: uncharacterized protein LOC103450484 isoform X3 [Malus 
domestica]
Length=192

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS GISGPK WL+EQKKK+++FLLAP+DASR SL AA+ LL  +  +++ K++ E++ L 
Sbjct  71   FSFGISGPKDWLREQKKKASRFLLAPIDASRESLVAAHRLLTATDSDYTNKEMEEVRRLF  130

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            +SAARDCV +DRNSFV FQ+ TGV VCTF+LVV NASSLL DKDP+KLEAES L D+I  
Sbjct  131  RSAARDCVIEDRNSFVAFQANTGVXVCTFRLVVKNASSLLGDKDPVKLEAESMLNDLIIH  190

Query  677  FA  682
            F+
Sbjct  191  FS  192



>ref|XP_010538091.1| PREDICTED: uncharacterized protein LOC104812558 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010538092.1| PREDICTED: uncharacterized protein LOC104812558 isoform X2 [Tarenaya 
hassleriana]
Length=154

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  455  EFSEKDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPI  634
            +F++ DL E+Q LLKS+ RDCVP+DRNS V FQSKTGVEVCTF+LVV NA+SLLD KDP+
Sbjct  35   DFTDSDLEELQRLLKSSGRDCVPEDRNSLVDFQSKTGVEVCTFKLVVKNAASLLDSKDPL  94

Query  635  KLEAESKLTDVIRCFASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            KL AE+ L D++R F+SLNG+ + +DI++ S+R KIADAL +T+S L+ FE+GVKDCLE
Sbjct  95   KLAAENTLDDLVRSFSSLNGLANGIDIKLPSDRAKIADALAETISHLDKFEKGVKDCLE  153



>dbj|BAJ89590.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=235

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +2

Query  335  GPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAARD  514
            GPK+ L+EQK+KSA+FLLAP+ ASR +L  A  LL       S  D  E++  L +A RD
Sbjct  78   GPKELLREQKRKSARFLLAPIAASRETLVKAQDLLASEN--ASAADAEEVRGRLSAAGRD  135

Query  515  CVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNG  694
            CVP++RNS V FQS+TGVEVCTF L++ NA+SLLDDKDP+K+EA++ L ++I+ F+ L  
Sbjct  136  CVPRERNSIVAFQSRTGVEVCTFSLILKNAASLLDDKDPLKVEADTSLAELIQSFSDLGT  195

Query  695  MTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            +    + +++ +R+K+ D L+ T+S+L+ +EQGVK+CL
Sbjct  196  VVDNSNFELSDDRKKMKDDLLSTISALDKYEQGVKNCL  233



>ref|XP_010263668.1| PREDICTED: uncharacterized protein LOC104601866 isoform X4 [Nelumbo 
nucifera]
Length=227

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WL+EQKKK++KF+LAP+DASR SL+ AY LL K+   +  KDL EIQ+LL
Sbjct  74   FSIGISGPKDWLREQKKKASKFILAPIDASRESLRTAYRLLTKNASGY-PKDLEEIQNLL  132

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKL  658
            +SAARDCVPQ+RNSFV FQ+ TG+EVCTF+L+V NASSLLD+  P+KL+AE+ L
Sbjct  133  RSAARDCVPQERNSFVSFQANTGIEVCTFRLIVKNASSLLDNASPVKLKAEAML  186



>ref|XP_010263667.1| PREDICTED: uncharacterized protein LOC104601866 isoform X3 [Nelumbo 
nucifera]
Length=236

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS+GISGPK WL+EQKKK++KF+LAP+DASR SL+ AY LL K+   +  KDL EIQ+LL
Sbjct  74   FSIGISGPKDWLREQKKKASKFILAPIDASRESLRTAYRLLTKNASGY-PKDLEEIQNLL  132

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKL  658
            +SAARDCVPQ+RNSFV FQ+ TG+EVCTF+L+V NASSLLD+  P+KL+AE+ L
Sbjct  133  RSAARDCVPQERNSFVSFQANTGIEVCTFRLIVKNASSLLDNASPVKLKAEAML  186



>ref|XP_003559381.1| PREDICTED: uncharacterized protein LOC100836593 [Brachypodium 
distachyon]
 ref|XP_010229135.1| PREDICTED: uncharacterized protein LOC100836593 [Brachypodium 
distachyon]
 ref|XP_010229137.1| PREDICTED: uncharacterized protein LOC100836593 [Brachypodium 
distachyon]
 ref|XP_010229139.1| PREDICTED: uncharacterized protein LOC100836593 [Brachypodium 
distachyon]
Length=225

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FS    GPK+ L+EQK+KSA+FLLAP+ ASR++L  A  LL  +    S +D  E++  L
Sbjct  62   FSFSFPGPKELLREQKRKSARFLLAPIAASRDTLVKAQALLASA--NASAEDAEEVRGRL  119

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP++RNS V FQS+TGVEVCTF L++ NA+SLLDDKDP+K+ A+++L ++I+ 
Sbjct  120  SAAGRDCVPRERNSIVAFQSRTGVEVCTFSLILKNAASLLDDKDPLKVAADTRLAELIQS  179

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F+ L  +    + +++ +R+K+ D L+ T+++L+ +EQGVKDC+
Sbjct  180  FSDLRTVVENSNFELSGDRKKMNDDLLSTITALDKYEQGVKDCI  223



>dbj|BAJ87619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=235

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +2

Query  335  GPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAARD  514
            GPK+ L+EQ++KSA+FLLAP+ ASR +L  A  LL       S  D  E++  L +A RD
Sbjct  78   GPKELLREQRRKSARFLLAPIAASRETLVKAQDLLASEN--ASAADAEEVRGRLSAAGRD  135

Query  515  CVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNG  694
            CVP++RNS V FQS+TGVEVCTF L++ NA+SLLDDKDP+K+EA++ L ++I+ F+ L  
Sbjct  136  CVPRERNSIVAFQSRTGVEVCTFSLILKNAASLLDDKDPLKVEADTSLAELIQSFSDLGT  195

Query  695  MTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            +    + +++ +R+K+ D L+ T+S+L+ +EQGVK+CL
Sbjct  196  VVDNSNFELSDDRKKMKDDLLSTISALDKYEQGVKNCL  233



>gb|AAN65006.1| hypothetical protein [Oryza sativa Japonica Group]
Length=318

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 116/168 (69%), Gaps = 10/168 (6%)
 Frame = +2

Query  332  SGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAAR  511
            +GPK+ L+EQKKKSA+FLLAP+ ASR  L  A  LL  +       D+ E+  +L +A R
Sbjct  134  AGPKELLREQKKKSARFLLAPIAASREILLKAQSLLASAN--VGADDVEEVGRMLAAAGR  191

Query  512  DCVPQDRNSFVQFQSKTGVEV--------CTFQLVVNNASSLLDDKDPIKLEAESKLTDV  667
            DCVP+ RNS V  QS++GVEV        CTF L++ NA+SLL DKDP+K+EA+++L ++
Sbjct  192  DCVPRQRNSLVSLQSRSGVEVFDGITLQVCTFSLILKNAASLLTDKDPLKVEADARLAEL  251

Query  668  IRCFASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
            I+ F+ L  +    +I++ ++R+K+ D L+ TVS+++ FEQ VKDCL+
Sbjct  252  IQSFSDLGTVVDNSNIELTADREKMKDGLLSTVSAIDKFEQSVKDCLD  299



>ref|XP_001766235.1| predicted protein [Physcomitrella patens]
 gb|EDQ68867.1| predicted protein [Physcomitrella patens]
Length=334

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 113/166 (68%), Gaps = 3/166 (2%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRN-SLQAAYLLLMKSGPEFSEKDLGEIQSL  493
            FSLGISGPK WLK QK+K+A+FLL P++ASR+    A  LL    G  F   +  E   L
Sbjct  170  FSLGISGPKDWLKGQKRKTAQFLLNPIEASRSRLSSAVLLLSSAEGSSFENYE--EAGKL  227

Query  494  LKSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIR  673
            +K AARDC P +  S + FQ++TGVEVCTF+LV+ NA+SLL D DP+K+ A + L D+IR
Sbjct  228  VKVAARDCTPNELGSILDFQTRTGVEVCTFKLVLKNAASLLSDDDPVKVSAVAALNDLIR  287

Query  674  CFASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCLE  811
             F +++ + S      A+ R+ +  AL  T+++L++F+QGV++CL+
Sbjct  288  SFTTVDQLLSSGGASAATQREDVMGALKQTMAALDTFQQGVQNCLD  333



>ref|XP_002975462.1| hypothetical protein SELMODRAFT_442834 [Selaginella moellendorffii]
 gb|EFJ23663.1| hypothetical protein SELMODRAFT_442834 [Selaginella moellendorffii]
Length=214

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 109/164 (66%), Gaps = 12/164 (7%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLG SGPK+WLK+QKK++A FLL P+  SR  L++A+LL   S P        E  +L+
Sbjct  60   FSLGTSGPKEWLKQQKKRTADFLLVPIARSRERLESAFLLFSSSNPL-------EAGNLI  112

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            + AARDC+P +  S +  QS+TGVEVCTF+L+V NA+SLLD+ DP+K++A   L ++IR 
Sbjct  113  RIAARDCIPVEAGSILDLQSRTGVEVCTFRLLVKNAASLLDNSDPVKIKAYLALENLIRS  172

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F  L+       +   ++  ++A+A   T ++L++FE G++ CL
Sbjct  173  FTYLDE-----SVTAPTSSTEVANAFELTYAALSTFEAGIRACL  211



>ref|XP_002964057.1| hypothetical protein SELMODRAFT_438781 [Selaginella moellendorffii]
 gb|EFJ34390.1| hypothetical protein SELMODRAFT_438781 [Selaginella moellendorffii]
Length=214

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 109/164 (66%), Gaps = 12/164 (7%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLG SGPK+WLK+QKK++A FLL P+  SR  L++A+LL   S P        E  +L+
Sbjct  60   FSLGTSGPKEWLKQQKKRTADFLLVPIARSRERLESAFLLFSSSNPL-------EAGNLI  112

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
            + AARDC+P +  S +  QS+TGVEVCTF+L+V NA+SLLD+ DP+K++A   L ++IR 
Sbjct  113  RIAARDCIPVEAGSILDLQSRTGVEVCTFRLLVKNAASLLDNSDPVKIKAYLALENLIRS  172

Query  677  FASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            F  L+       +   ++  ++A+A   T ++L++FE G++ CL
Sbjct  173  FTYLDE-----SVTAPTSSTEVANAFELTYAALSTFEAGIRACL  211



>gb|ACN35948.1| unknown [Zea mays]
 tpg|DAA51675.1| TPA: hypothetical protein ZEAMMB73_411815 [Zea mays]
Length=216

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGI GPK+ L+EQKKKSA FLLAP+ ASR++L  A+ LL  + P  S +D  E++  +
Sbjct  69   FSLGIPGPKELLREQKKKSASFLLAPIAASRDTLVKAHALL--ASPSASTEDAEEVKGRI  126

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP+ RNS V  QS+TGVEVCTF L++ NA+SLL +KD +K+EA+++L ++I+ 
Sbjct  127  LAAGRDCVPRQRNSIVALQSRTGVEVCTFSLILKNAASLLANKDSLKVEADTRLEELIKS  186

Query  677  FASLNGMTSELDIQVASNRQ  736
            F+ L  +    + ++A +R+
Sbjct  187  FSELGTLVENSNFELADDRR  206



>ref|XP_010943003.1| PREDICTED: uncharacterized protein LOC105060835 isoform X3 [Elaeis 
guineensis]
Length=280

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 98/136 (72%), Gaps = 1/136 (1%)
 Frame = +2

Query  326  GISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSA  505
            GI GPK WL++QKKK+A+F+LAP++ SR SL+ AYLLL        E D GE++ LL  A
Sbjct  106  GIPGPKDWLRDQKKKAARFILAPIEDSRESLRNAYLLLSSEAGSPVE-DSGEVRRLLNLA  164

Query  506  ARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFAS  685
             +DCVPQ R+S V+FQS+TGVEVCTF+L+V NA+SLLD  DP+KL+ E+ L D+IR F+ 
Sbjct  165  VKDCVPQRRSSLVEFQSRTGVEVCTFRLLVKNAASLLDKGDPVKLDVEAMLNDLIRSFSL  224

Query  686  LNGMTSELDIQVASNR  733
            L  +    + +  ++R
Sbjct  225  LGSVIDSSNFEFTTDR  240



>gb|EEC76255.1| hypothetical protein OsI_13704 [Oryza sativa Indica Group]
Length=230

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGI GPK+ L+EQKKKSA+FLLAP+ ASR  L  A  LL  +       D+ E+  +L
Sbjct  78   FSLGIPGPKELLREQKKKSARFLLAPIAASREILLKAQSLLASAN--VGADDVEEVGRML  135

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP+ RNS V  QS++GVEVCTF L++ NA+SLL DKDP+K+EA+++L ++I+ 
Sbjct  136  AAAGRDCVPRQRNSLVSLQSRSGVEVCTFSLILKNAASLLTDKDPLKVEADARLAELIQS  195

Query  677  FASLNGMTSELDIQVASNR  733
            F+ L  +    +I++ ++R
Sbjct  196  FSDLGTVVDNSNIELTADR  214



>gb|EEE60016.1| hypothetical protein OsJ_12765 [Oryza sativa Japonica Group]
Length=230

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
 Frame = +2

Query  317  FSLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLL  496
            FSLGI GPK+ L+EQKKKSA+FLLAP+ ASR  L  A  LL  +       D+ E+  +L
Sbjct  78   FSLGIPGPKELLREQKKKSARFLLAPIAASREILLKAQSLLASAN--VGADDVEEVGRML  135

Query  497  KSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRC  676
             +A RDCVP+ RNS V  QS++GVEVCTF L++ NA+SLL DKDP+K+EA+++L ++I+ 
Sbjct  136  AAAGRDCVPRQRNSLVSLQSRSGVEVCTFSLILKNAASLLTDKDPLKVEADARLAELIQS  195

Query  677  FASLNGMTSELDIQVASNR  733
            F+ L  +    +I++ ++R
Sbjct  196  FSDLGTVVDNSNIELTADR  214



>ref|XP_010943008.1| PREDICTED: uncharacterized protein LOC105060835 isoform X4 [Elaeis 
guineensis]
Length=279

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 105/170 (62%), Gaps = 32/170 (19%)
 Frame = +2

Query  326  GISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLL---------------------M  442
            GI GPK WL++QKKK+A+F+LAP++ SR SL+ AYLLL                     +
Sbjct  106  GIPGPKDWLRDQKKKAARFILAPIEDSRESLRNAYLLLCTLPHLFFSFFPFFPLCPLFLL  165

Query  443  KSGP------EFSE-----KDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQL  589
              GP        SE     +D GE++ LL  A +DCVPQ R+S V+FQS+TGVEVCTF+L
Sbjct  166  PFGPIVRFLNAASEAGSPVEDSGEVRRLLNLAVKDCVPQRRSSLVEFQSRTGVEVCTFRL  225

Query  590  VVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNRQK  739
            +V NA+SLLD  DP+KL+ E+ L D+IR F+ L  +    + +  ++RQK
Sbjct  226  LVKNAASLLDKGDPVKLDVEAMLNDLIRSFSLLGSVIDSSNFEFTTDRQK  275



>ref|XP_010942989.1| PREDICTED: uncharacterized protein LOC105060835 isoform X1 [Elaeis 
guineensis]
Length=313

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 103/168 (61%), Gaps = 32/168 (19%)
 Frame = +2

Query  326  GISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLL---------------------M  442
            GI GPK WL++QKKK+A+F+LAP++ SR SL+ AYLLL                     +
Sbjct  106  GIPGPKDWLRDQKKKAARFILAPIEDSRESLRNAYLLLCTLPHLFFSFFPFFPLCPLFLL  165

Query  443  KSGP------EFSE-----KDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQL  589
              GP        SE     +D GE++ LL  A +DCVPQ R+S V+FQS+TGVEVCTF+L
Sbjct  166  PFGPIVRFLNAASEAGSPVEDSGEVRRLLNLAVKDCVPQRRSSLVEFQSRTGVEVCTFRL  225

Query  590  VVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNR  733
            +V NA+SLLD  DP+KL+ E+ L D+IR F+ L  +    + +  ++R
Sbjct  226  LVKNAASLLDKGDPVKLDVEAMLNDLIRSFSLLGSVIDSSNFEFTTDR  273



>ref|NP_001051422.2| Os03g0774400 [Oryza sativa Japonica Group]
 dbj|BAF13336.2| Os03g0774400 [Oryza sativa Japonica Group]
Length=150

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  491  LLKSAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVI  670
            +L +A RDCVP+ RNS V  QS++GVEVCTF L++ NA+SLL DKDP+K+EA+++L ++I
Sbjct  1    MLAAAGRDCVPRQRNSLVSLQSRSGVEVCTFSLILKNAASLLTDKDPLKVEADARLAELI  60

Query  671  RCFASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
            + F+ L  +    +I++ ++R+K+ D L+ TVS+++ FEQ VKDCL
Sbjct  61   QSFSDLGTVVDNSNIELTADREKMKDGLLSTVSAIDKFEQSVKDCL  106



>ref|XP_004986216.1| PREDICTED: WW domain-binding protein 11-like [Setaria italica]
Length=207

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 90/163 (55%), Gaps = 33/163 (20%)
 Frame = +2

Query  320  SLGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLK  499
            SLGI GPK+ L+EQKKKSA FLLAP+ ASR++L  A  LL  + P  S +D  E++  + 
Sbjct  76   SLGIPGPKELLREQKKKSASFLLAPIAASRDTLLKAQALL--ASPNASAEDAEEVRGRIG  133

Query  500  SAARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCF  679
            +A RDCVP+ RNS V FQSKTGVE+    L                              
Sbjct  134  AAGRDCVPRQRNSIVAFQSKTGVELALRHL------------------------------  163

Query  680  ASLNGMTSELDIQVASNRQKIADALMDTVSSLNSFEQGVKDCL  808
              L  +    + ++  +R+K+ D ++ ++S+L+ FEQ VKDCL
Sbjct  164  -RLGTIVENSNFELTGDREKMKDGVLSSISALDKFEQSVKDCL  205



>ref|NP_001169858.1| uncharacterized protein LOC100383751 [Zea mays]
 gb|ACN35100.1| unknown [Zea mays]
 tpg|DAA51676.1| TPA: hypothetical protein ZEAMMB73_411815 [Zea mays]
Length=122

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +2

Query  404  SRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKSAARDCVPQDRNSFVQFQSKTGVEVCTF  583
            SR  L    +    + P  S +D  E++  + +A RDCVP+ RNS V  QS+TGVEVCTF
Sbjct  2    SRKPLATVAVRCNVASPSASTEDAEEVKGRILAAGRDCVPRQRNSIVALQSRTGVEVCTF  61

Query  584  QLVVNNASSLLDDKDPIKLEAESKLTDVIRCFASLNGMTSELDIQVASNRQ  736
             L++ NA+SLL +KD +K+EA+++L ++I+ F+ L  +    + ++A +R+
Sbjct  62   SLILKNAASLLANKDSLKVEADTRLEELIKSFSELGTLVENSNFELADDRR  112



>gb|EPS65687.1| hypothetical protein M569_09091, partial [Genlisea aurea]
Length=57

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +2

Query  509  RDCVPQDRNSF-VQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIR  673
            R+CVP+DRNSF V FQ+ TGVEVCTF L+V NASSLL D+DP+KLEAE++L  ++R
Sbjct  1    RNCVPRDRNSFGVVFQANTGVEVCTFSLIVKNASSLLGDRDPVKLEAEARLQHLVR  56



>gb|EMS47230.1| hypothetical protein TRIUR3_00981 [Triticum urartu]
Length=133

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 75/137 (55%), Gaps = 22/137 (16%)
 Frame = +2

Query  323  LGISGPKQWLKEQKKKSAKFLLAPVDASRNSLQAAYLLLMKSGPEFSEKDLGEIQSLLKS  502
            L  +GPK+ L+EQK+KSA+FLLAP+ ASR +L  A  LL+    +               
Sbjct  19   LSRAGPKELLREQKRKSARFLLAPIAASRETLVKAQNLLVLGNCDLRNA-----------  67

Query  503  AARDCVPQDRNSFVQFQSKTGVEVCTFQLVVNNASSLLDDKDPIKLEAESKLTDVIRCFA  682
                       +     +    EVCTF L++ NA+SLLDDKDP+K+EA++ L ++I+ F+
Sbjct  68   -----------ASENASAADAEEVCTFSLILKNAASLLDDKDPLKVEADTSLAELIQSFS  116

Query  683  SLNGMTSELDIQVASNR  733
             L  +    + +++ +R
Sbjct  117  DLGTVVENSNFELSDDR  133



>gb|AFK44438.1| unknown [Lotus japonicus]
Length=76

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -3

Query  705  SLVMPFREAKHLITSVSLDSASNFMGSLSSSKEEALFTTS*NVQTSTPVLD*N*TKEFLS  526
            SL  P  + K LI S ++ SA NF  SL  SK+ A FTT+ NV TSTPVL    TKEFLS
Sbjct  4    SLANPLIDVKDLIRSSNITSAFNFTESLFPSKDAAFFTTNRNVHTSTPVLAWKATKEFLS  63

Query  525  *GTQSLAAD  499
             GTQSLAAD
Sbjct  64   CGTQSLAAD  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2653716996480