BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6390_g1_i1 len=1268 path=[1246:0-1267]

Length=1268
                                                                      Score     E

ref|XP_011097432.1|  PREDICTED: uncharacterized protein LOC105176355    466   4e-160   
ref|XP_010109055.1|  hypothetical protein L484_007389                   461   6e-158   
ref|XP_002513847.1|  conserved hypothetical protein                     460   1e-157   Ricinus communis
ref|XP_011074905.1|  PREDICTED: uncharacterized protein LOC105159516    459   3e-157   
ref|XP_011027643.1|  PREDICTED: uncharacterized protein LOC105127877    459   4e-157   
ref|XP_002302266.1|  hypothetical protein POPTR_0002s09090g             457   3e-156   Populus trichocarpa [western balsam poplar]
ref|XP_006366933.1|  PREDICTED: uncharacterized protein LOC102584068    454   4e-155   
ref|XP_006386387.1|  hypothetical protein POPTR_0002s09090g             457   5e-155   
ref|XP_008445364.1|  PREDICTED: uncharacterized protein LOC103488422    453   7e-155   
ref|XP_004169470.1|  PREDICTED: uncharacterized LOC101222277            453   9e-155   
ref|XP_002306599.1|  hypothetical protein POPTR_0005s16380g             451   3e-154   Populus trichocarpa [western balsam poplar]
ref|XP_002285822.2|  PREDICTED: uncharacterized protein LOC100245399    451   3e-154   Vitis vinifera
emb|CBI19094.3|  unnamed protein product                                451   5e-154   
ref|XP_004250344.1|  PREDICTED: uncharacterized protein LOC101254049    450   1e-153   
ref|XP_007136199.1|  hypothetical protein PHAVU_009G026500g             445   1e-151   
ref|XP_007018907.1|  Uncharacterized protein TCM_034998                 440   1e-149   
ref|XP_007222740.1|  hypothetical protein PRUPE_ppa008741mg             439   1e-149   
ref|XP_009627890.1|  PREDICTED: uncharacterized protein LOC104118366    438   4e-149   
ref|XP_010277672.1|  PREDICTED: uncharacterized protein LOC104612057    436   2e-148   
ref|XP_009767181.1|  PREDICTED: uncharacterized protein LOC104218395    436   3e-148   
emb|CDP18303.1|  unnamed protein product                                434   2e-147   
ref|XP_010245055.1|  PREDICTED: uncharacterized protein LOC104588713    432   6e-147   
ref|XP_003601142.1|  hypothetical protein MTR_3g073480                  432   1e-146   
ref|XP_010673046.1|  PREDICTED: uncharacterized protein LOC104889478    429   2e-145   
ref|XP_006472686.1|  PREDICTED: uncharacterized protein LOC102629833    429   4e-145   
ref|XP_006434083.1|  hypothetical protein CICLE_v10001805mg             424   2e-143   
ref|XP_004515656.1|  PREDICTED: uncharacterized protein LOC101513911    424   2e-143   
ref|XP_008338804.1|  PREDICTED: uncharacterized protein LOC103401868    424   2e-143   
gb|KDO80841.1|  hypothetical protein CISIN_1g020112mg                   424   2e-143   
ref|XP_009367335.1|  PREDICTED: uncharacterized protein LOC103956999    422   1e-142   
ref|XP_004307239.1|  PREDICTED: uncharacterized protein LOC101299035    422   2e-142   
gb|KHG26191.1|  Monofunctional biosynthetic peptidoglycan transgl...    421   2e-141   
ref|XP_003526603.1|  PREDICTED: uncharacterized protein LOC100809357    418   3e-141   
gb|KHN09157.1|  hypothetical protein glysoja_025618                     417   1e-140   
ref|XP_009338615.1|  PREDICTED: uncharacterized protein LOC103930940    412   9e-139   
ref|XP_008233945.1|  PREDICTED: uncharacterized protein LOC103332953    411   2e-138   
gb|KHG12279.1|  Histidinol-phosphate aminotransferase                   410   5e-138   
ref|XP_008363867.1|  PREDICTED: uncharacterized protein LOC103427587    409   2e-137   
gb|EYU22894.1|  hypothetical protein MIMGU_mgv1a010066mg                404   2e-135   
ref|XP_010064016.1|  PREDICTED: uncharacterized protein LOC104450970    403   3e-135   
ref|XP_008387801.1|  PREDICTED: uncharacterized protein LOC103450258    397   8e-133   
emb|CBI23760.3|  unnamed protein product                                395   5e-132   
ref|XP_002268252.2|  PREDICTED: uncharacterized protein LOC100266907    394   6e-132   Vitis vinifera
ref|XP_002529532.1|  conserved hypothetical protein                     380   3e-126   Ricinus communis
ref|XP_009344258.1|  PREDICTED: uncharacterized protein LOC103936140    379   5e-126   
gb|KDP38841.1|  hypothetical protein JCGZ_04998                         374   8e-124   
ref|XP_009771661.1|  PREDICTED: uncharacterized protein LOC104222167    373   2e-123   
ref|XP_004230482.1|  PREDICTED: uncharacterized protein LOC101250842    370   2e-122   
ref|XP_006349366.1|  PREDICTED: uncharacterized protein LOC102603732    369   4e-122   
ref|XP_007042253.1|  Uncharacterized protein TCM_006929                 371   4e-122   
ref|XP_009603248.1|  PREDICTED: uncharacterized protein LOC104098263    368   1e-121   
ref|XP_010064988.1|  PREDICTED: uncharacterized protein LOC104452178    370   2e-121   
ref|XP_003543779.1|  PREDICTED: uncharacterized protein LOC100805100    366   8e-121   
ref|XP_010930763.1|  PREDICTED: uncharacterized protein LOC105051831    366   9e-121   
ref|XP_008781573.1|  PREDICTED: protein BPS1, chloroplastic-like        360   2e-118   
ref|XP_003614891.1|  hypothetical protein MTR_5g060880                  362   7e-118   
ref|XP_010910922.1|  PREDICTED: uncharacterized protein LOC105036897    358   9e-118   
ref|XP_006596310.1|  PREDICTED: uncharacterized protein LOC100775339    353   6e-116   
emb|CDO97568.1|  unnamed protein product                                353   7e-116   
ref|XP_006431830.1|  hypothetical protein CICLE_v10001863mg             353   9e-116   
ref|XP_008799181.1|  PREDICTED: uncharacterized protein LOC103713907    352   4e-115   
ref|XP_003539403.2|  PREDICTED: uncharacterized protein LOC100818401    346   3e-113   
ref|XP_002299665.1|  hypothetical protein POPTR_0001s21940g             342   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_007148522.1|  hypothetical protein PHAVU_006G215900g             342   2e-111   
ref|XP_008807663.1|  PREDICTED: uncharacterized protein LOC103719952    341   6e-111   
ref|XP_011087730.1|  PREDICTED: uncharacterized protein LOC105169126    340   1e-110   
ref|XP_009414883.1|  PREDICTED: uncharacterized protein LOC103995880    340   2e-110   
ref|XP_011009739.1|  PREDICTED: uncharacterized protein LOC105114771    338   1e-109   
ref|XP_010912534.1|  PREDICTED: uncharacterized protein LOC105038420    337   2e-109   
ref|XP_008780600.1|  PREDICTED: uncharacterized protein LOC103700435    335   7e-109   
gb|KHN11239.1|  hypothetical protein glysoja_023303                     335   1e-108   
ref|XP_003532991.2|  PREDICTED: uncharacterized protein LOC100798952    335   1e-108   
ref|XP_010539615.1|  PREDICTED: uncharacterized protein LOC104813637    331   3e-107   
ref|XP_010534596.1|  PREDICTED: uncharacterized protein LOC104810096    330   1e-106   
ref|XP_010101159.1|  hypothetical protein L484_016724                   330   3e-106   
ref|XP_008218945.1|  PREDICTED: uncharacterized protein LOC103319200    327   1e-105   
ref|XP_010477455.1|  PREDICTED: uncharacterized protein LOC104756547    328   1e-105   
emb|CDY41498.1|  BnaA08g21000D                                          327   3e-105   
ref|XP_002304062.1|  hypothetical protein POPTR_0003s01260g             326   7e-105   Populus trichocarpa [western balsam poplar]
ref|XP_002893207.1|  predicted protein                                  325   1e-104   
gb|EYU23938.1|  hypothetical protein MIMGU_mgv1a012516mg                321   3e-104   
emb|CDY30644.1|  BnaAnng04190D                                          324   3e-104   
ref|XP_009384220.1|  PREDICTED: uncharacterized protein LOC103971817    323   4e-104   
ref|XP_011006544.1|  PREDICTED: uncharacterized protein LOC105112516    324   4e-104   
ref|XP_009145382.1|  PREDICTED: uncharacterized protein LOC103869083    323   7e-104   
ref|XP_009399170.1|  PREDICTED: uncharacterized protein LOC103983642    322   1e-103   
ref|XP_007222723.1|  hypothetical protein PRUPE_ppa008717mg             322   2e-103   
ref|XP_006305285.1|  hypothetical protein CARUB_v10009660mg             322   2e-103   
ref|XP_010498663.1|  PREDICTED: uncharacterized protein LOC104776321    321   4e-103   
ref|XP_009110156.1|  PREDICTED: uncharacterized protein LOC103835713    319   2e-102   
ref|XP_004485487.1|  PREDICTED: uncharacterized protein LOC101512752    319   3e-102   
ref|XP_010459927.1|  PREDICTED: uncharacterized protein LOC104740901    319   3e-102   
ref|XP_007159581.1|  hypothetical protein PHAVU_002G249400g             318   6e-102   
gb|KFK44306.1|  hypothetical protein AALP_AA1G240800                    316   4e-101   
ref|XP_009420185.1|  PREDICTED: uncharacterized protein LOC103999984    315   4e-101   
ref|XP_007141119.1|  hypothetical protein PHAVU_008G168900g             315   4e-101   
ref|XP_007141118.1|  hypothetical protein PHAVU_008G168900g             315   7e-101   
ref|XP_006390046.1|  hypothetical protein EUTSA_v10018874mg             314   3e-100   
ref|XP_006586379.1|  PREDICTED: uncharacterized protein LOC100811367    313   6e-100   
ref|XP_003629964.1|  hypothetical protein MTR_8g088750                  311   2e-99    
emb|CDY38838.1|  BnaC08g20120D                                          310   3e-99    
gb|AAM65421.1|  unknown                                                 311   3e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564155.1|  uncharacterized protein                               310   8e-99    Arabidopsis thaliana [mouse-ear cress]
emb|CDY04696.1|  BnaC05g17340D                                          306   3e-97    
ref|XP_006302561.1|  hypothetical protein CARUB_v10020667mg             305   7e-97    
ref|XP_004151123.1|  PREDICTED: uncharacterized protein LOC101222277    300   1e-95    
ref|XP_009393453.1|  PREDICTED: uncharacterized protein LOC103979128    301   2e-95    
ref|XP_010521221.1|  PREDICTED: uncharacterized protein LOC104800...    300   4e-95    
ref|XP_010521220.1|  PREDICTED: uncharacterized protein LOC104800...    299   1e-94    
ref|XP_003593017.1|  hypothetical protein MTR_2g006850                  296   7e-94    
gb|AES63268.2|  hypothetical protein MTR_2g006850                       296   8e-94    
ref|XP_009390144.1|  PREDICTED: uncharacterized protein LOC103976603    298   1e-93    
emb|CDX88393.1|  BnaC06g38370D                                          296   2e-93    
ref|XP_009411904.1|  PREDICTED: uncharacterized protein LOC103993535    291   1e-90    
emb|CDX87498.1|  BnaA07g33750D                                          288   2e-90    
ref|XP_002889164.1|  hypothetical protein ARALYDRAFT_316696             288   2e-90    
ref|XP_011092344.1|  PREDICTED: uncharacterized protein LOC105172557    288   3e-90    
ref|NP_683505.1|  uncharacterized protein                               287   3e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAT06471.1|  At1g77855                                               286   1e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KHN48097.1|  hypothetical protein glysoja_015567                     285   2e-89    
ref|XP_009106428.1|  PREDICTED: uncharacterized protein LOC103832214    285   3e-89    
ref|XP_010471985.1|  PREDICTED: protein BPS1, chloroplastic-like        283   1e-88    
gb|KCW70533.1|  hypothetical protein EUGRSUZ_F03734                     279   1e-87    
ref|XP_010416747.1|  PREDICTED: uncharacterized protein LOC104702570    280   3e-87    
ref|XP_010428871.1|  PREDICTED: uncharacterized protein LOC104713461    279   9e-87    
ref|XP_006471021.1|  PREDICTED: uncharacterized protein LOC102611551    266   6e-83    
ref|XP_006416238.1|  hypothetical protein EUTSA_v10010029mg             266   6e-82    
ref|XP_008456067.1|  PREDICTED: uncharacterized protein LOC103496110    268   9e-82    
ref|XP_004146285.1|  PREDICTED: uncharacterized protein LOC101211523    263   1e-80    
gb|EMT16172.1|  hypothetical protein F775_05383                         262   2e-80    
ref|XP_010236397.1|  PREDICTED: uncharacterized protein LOC100827395    258   6e-79    
ref|XP_010065458.1|  PREDICTED: uncharacterized protein LOC104452690    257   7e-78    
gb|AAF17700.1|AC009243_27  F28K19.7                                     266   1e-77    Arabidopsis thaliana [mouse-ear cress]
gb|EYU35452.1|  hypothetical protein MIMGU_mgv1a010516mg                244   1e-73    
ref|XP_010538968.1|  PREDICTED: uncharacterized protein LOC104813135    243   3e-73    
gb|KDP32730.1|  hypothetical protein JCGZ_12022                         240   3e-73    
gb|EMS46824.1|  hypothetical protein TRIUR3_20698                       242   3e-73    
ref|XP_006859212.1|  hypothetical protein AMTR_s00070p00193550          226   2e-66    
gb|ACJ85859.1|  unknown                                                 212   2e-63    Medicago truncatula
ref|XP_008648352.1|  PREDICTED: uncharacterized protein LOC103628940    204   2e-57    
gb|KHN06140.1|  hypothetical protein glysoja_036005                     197   2e-56    
ref|XP_003564750.1|  PREDICTED: uncharacterized protein LOC100839683    195   2e-54    
emb|CDM85197.1|  unnamed protein product                                194   2e-54    
ref|NP_001044961.1|  Os01g0875000                                       193   5e-54    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001170097.1|  uncharacterized protein LOC100384015               191   5e-53    Zea mays [maize]
ref|XP_008674768.1|  PREDICTED: uncharacterized protein LOC103650942    186   2e-51    
ref|XP_004952827.1|  PREDICTED: uncharacterized protein LOC101782732    187   2e-51    
ref|XP_002453972.1|  hypothetical protein SORBIDRAFT_04g022520          186   3e-51    Sorghum bicolor [broomcorn]
gb|EAZ05303.1|  hypothetical protein OsI_27508                          184   2e-50    Oryza sativa Indica Group [Indian rice]
dbj|BAK01269.1|  predicted protein                                      184   2e-50    
dbj|BAD08928.1|  unknown protein                                        178   2e-48    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060781.1|  Os08g0104800                                       178   3e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970748.1|  PREDICTED: uncharacterized protein LOC101775305    178   3e-48    
gb|EAY76676.1|  hypothetical protein OsI_04631                          177   8e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_003572612.1|  PREDICTED: uncharacterized protein LOC100826877    176   2e-47    
gb|KEH28047.1|  hypothetical protein MTR_5g460870                       174   3e-47    
gb|KCW60115.1|  hypothetical protein EUGRSUZ_H02848                     164   3e-43    
ref|XP_010026769.1|  PREDICTED: uncharacterized protein LOC104417151    162   5e-42    
gb|EAY86253.1|  hypothetical protein OsI_07624                          161   5e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_002443702.1|  hypothetical protein SORBIDRAFT_07g000580          160   8e-42    Sorghum bicolor [broomcorn]
ref|NP_001047106.1|  Os02g0552200                                       160   1e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004504194.1|  PREDICTED: uncharacterized protein LOC101493759    151   6e-40    
dbj|BAD15487.1|  hypothetical protein                                   157   6e-40    Oryza sativa Japonica Group [Japonica rice]
gb|EPS59828.1|  hypothetical protein M569_14978                         136   6e-35    
gb|EPS70985.1|  hypothetical protein M569_03777                         134   3e-33    
ref|XP_006646526.1|  PREDICTED: uncharacterized protein LOC102706068    134   1e-32    
ref|XP_003523470.2|  PREDICTED: uncharacterized protein LOC100777252    130   2e-32    
gb|KDO50098.1|  hypothetical protein CISIN_1g037305mg                   118   8e-29    
ref|XP_002458849.1|  hypothetical protein SORBIDRAFT_03g041420        99.8    6e-21    Sorghum bicolor [broomcorn]
gb|KHN01196.1|  hypothetical protein glysoja_008098                   79.3    1e-17    
gb|EYU26522.1|  hypothetical protein MIMGU_mgv1a023906mg              85.5    7e-17    
gb|KHN47067.1|  hypothetical protein glysoja_018434                   82.0    1e-15    
ref|XP_006659739.1|  PREDICTED: uncharacterized protein LOC102710720  81.6    1e-14    
gb|EMT16953.1|  hypothetical protein F775_12281                       76.3    3e-13    
ref|XP_001773729.1|  predicted protein                                73.6    6e-11    
gb|EAZ19409.1|  hypothetical protein OsJ_34964                        70.5    9e-11    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009345453.1|  PREDICTED: uncharacterized protein LOC103937...  65.9    2e-09    
gb|EAZ08655.1|  hypothetical protein OsI_30926                        63.9    2e-08    Oryza sativa Indica Group [Indian rice]
ref|XP_001754282.1|  predicted protein                                65.9    2e-08    
ref|XP_001757786.1|  predicted protein                                65.5    3e-08    
gb|ABA95137.1|  Transposable element protein, putative, MuDR          64.3    1e-07    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001771433.1|  predicted protein                                63.2    2e-07    
ref|XP_010930671.1|  PREDICTED: uncharacterized protein LOC105051...  61.2    5e-07    
ref|XP_010256523.1|  PREDICTED: protein BPS1, chloroplastic-like      60.5    1e-06    
ref|XP_007019960.1|  Uncharacterized protein TCM_036338               58.2    5e-06    
ref|XP_001784434.1|  predicted protein                                58.2    6e-06    
gb|AFK38947.1|  unknown                                               53.5    9e-06    
ref|XP_001771624.1|  predicted protein                                57.0    1e-05    
ref|XP_006851239.1|  hypothetical protein AMTR_s00180p00025240        55.8    2e-05    
ref|XP_011046701.1|  PREDICTED: uncharacterized protein LOC105141230  54.3    7e-05    
ref|XP_009420548.1|  PREDICTED: protein BPS1, chloroplastic-like      53.9    1e-04    
gb|ADE77690.1|  unknown                                               54.3    1e-04    
ref|XP_011001795.1|  PREDICTED: uncharacterized protein LOC105108963  52.8    3e-04    
ref|XP_002325994.2|  hypothetical protein POPTR_0019s11410g           52.0    4e-04    Populus trichocarpa [western balsam poplar]
ref|XP_008790220.1|  PREDICTED: protein BPS1, chloroplastic-like      50.8    0.001    



>ref|XP_011097432.1| PREDICTED: uncharacterized protein LOC105176355 [Sesamum indicum]
Length=322

 Score =   466 bits (1200),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 260/326 (80%), Positives = 288/326 (88%), Gaps = 11/326 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFY+FLTRGIDDLE +FLS NFMS+QFLQR L+LLRS HS L LLVQKLH
Sbjct  2     MDPSSTNSVNGFYNFLTRGIDDLERLFLSNNFMSVQFLQRVLSLLRSSHSQLTLLVQKLH  61

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWEVC +LK+G+SGMENYYSAG N+TSSLD+H HL+PQLSRQV
Sbjct  62    LPVGEKWLDEYMDESSKLWEVCQILKTGISGMENYYSAGLNITSSLDAHRHLSPQLSRQV  121

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENR+LMETRIEPL L+FD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  122   IRAISGCRREAVGLEEENRSLMETRIEPLSLKFDETVSI-ESKLNGFNGFRGVLYAMRNV  180

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLV+CWP ESN P + YEGCLFFGSAFMIS +RLQQRVA E+N  Q+ G 
Sbjct  181   SSLLLMILLYGLVFCWP-ESNSPRNGYEGCLFFGSAFMISTARLQQRVASEIN--QITGR  237

Query  291   HGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTENI  130
              GVLLYEF+RSKAA+DELRGELER           E GIRE++ESLK CFG+LR+GTENI
Sbjct  238   PGVLLYEFRRSKAALDELRGELERKCSQGILEWESEVGIRERVESLKGCFGILRAGTENI  297

Query  129   IGQLDDFFDEIVEGRKKLLDFCSTHR  52
             IGQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  298   IGQLDDFFDEIVEGRKKLLDFCS-HR  322



>ref|XP_010109055.1| hypothetical protein L484_007389 [Morus notabilis]
 gb|EXC20807.1| hypothetical protein L484_007389 [Morus notabilis]
Length=324

 Score =   461 bits (1186),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 254/329 (77%), Positives = 276/329 (84%), Gaps = 14/329 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+LS NFMSIQFLQRAL+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLSNNFMSIQFLQRALSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSG+SGMENYYSAGFNLTSSLD H HL+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGISGMENYYSAGFNLTSSLDGHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENRALMETRI+PL LRFD  VS+ ESKLNGF+GFRGVLYAMRNV
Sbjct  121   IRAISGCRREALGLEEENRALMETRIQPLSLRFDEKVSI-ESKLNGFSGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ES+     YEGCLFFGSAFMIS  RLQQRVA E+   Q+GG 
Sbjct  180   SSLLLMILLYGLVYCWP-ESSFLRGGYEGCLFFGSAFMISTGRLQQRVAAEIG--QIGGR  236

Query  291   HGVLLYEFKRSKAAM---------delrgelersgggdedGIREKIESLKACFGVLRSGT  139
              G+LLYEF+RSKAAM             G         E GIRE++E+L+ CF VLRSG 
Sbjct  237   PGILLYEFRRSKAAMEELRGELERRSSGGGTAADWEAAEGGIRERVENLRGCFMVLRSGA  296

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             ENI+ QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   ENIVAQLDDFFDEIVEGRKKLLDFCS-HR  324



>ref|XP_002513847.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48430.1| conserved hypothetical protein [Ricinus communis]
Length=320

 Score =   460 bits (1183),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 254/324 (78%), Positives = 281/324 (87%), Gaps = 9/324 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLSNNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSG+SGMEN+YSAGFN+TSSLD+H  L+ QLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGISGMENFYSAGFNITSSLDNHRRLSSQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENRALMETRI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREALGLEEENRALMETRIQPLSLRFDEKVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ES+     YEGCLFFGSAFMIS +RLQQRVAEE+N  Q+ G 
Sbjct  180   SSLLLMILLYGLVYCWP-ESSFLKGGYEGCLFFGSAFMISTARLQQRVAEEIN--QINGR  236

Query  291   HGVLLYEFKRSKAAMdelrgel-----ersgggdedGIREKIESLKACFGVLRSGTENII  127
              G+LLYEF+RSK AM+ELRGEL     +      E  IRE++E+L+ CFGVLRSG ENI+
Sbjct  237   PGILLYEFRRSKMAMEELRGELERRCGQVVDWETEVEIRERVENLRGCFGVLRSGAENIV  296

Query  126   GQLDDFFDEIVEGRKKLLDFCSTH  55
             GQLDDFFDEIVEGRKKLLDFCS  
Sbjct  297   GQLDDFFDEIVEGRKKLLDFCSIR  320



>ref|XP_011074905.1| PREDICTED: uncharacterized protein LOC105159516 [Sesamum indicum]
Length=324

 Score =   459 bits (1181),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 256/328 (78%), Positives = 276/328 (84%), Gaps = 13/328 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFY+FLTRGIDDLE VFLS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  2     MDPSSTNSVNGFYNFLTRGIDDLERVFLSNNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  61

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWEVCHVLK+G+SGMENYY+AGFN+TSSLD H  L+PQLSRQV
Sbjct  62    LPVGEKWLDEYMDESSKLWEVCHVLKAGISGMENYYTAGFNITSSLDGHRRLSPQLSRQV  121

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENR+LMETRIEPL L+FD  VSV ESKLNGFNGFRGVLYAMRNV
Sbjct  122   IRAISGCRREAVGLEEENRSLMETRIEPLSLKFDEKVSV-ESKLNGFNGFRGVLYAMRNV  180

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP E N   +  EGCLFFGSAFMIS +RLQQRV  E+N  QM G 
Sbjct  181   SSLLLMILLYGLVYCWP-EPNFSINGCEGCLFFGSAFMISTARLQQRVESEIN--QMTGR  237

Query  291   HGVLLYEFKRSKAAMdel--------rgelersgggdedGIREKIESLKACFGVLRSGTE  136
              GVLLYEF+RSK AM+EL                   E GIRE +ESLK CFGVLR+GTE
Sbjct  238   AGVLLYEFRRSKVAMEELRGELERRCSQSQGIVEWESEVGIRESVESLKGCFGVLRAGTE  297

Query  135   NIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             NIIGQLDDFFDEIVEGRK LLDFCS HR
Sbjct  298   NIIGQLDDFFDEIVEGRKMLLDFCS-HR  324



>ref|XP_011027643.1| PREDICTED: uncharacterized protein LOC105127877 [Populus euphratica]
Length=322

 Score =   459 bits (1180),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 258/327 (79%), Positives = 284/327 (87%), Gaps = 12/327 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLSNNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSGVSG+ENYYSAGFN+TSSLDSH HL+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGVSGIENYYSAGFNITSSLDSHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEE+NRALMETRI+PL LRFD  +S+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREAVGLEEDNRALMETRIQPLSLRFDEKISI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ES+     YEGCLFFGSAFMIS  RLQQRVA E+N  Q+ G 
Sbjct  180   SSLLLMILLYGLVYCWP-ESSFLRGGYEGCLFFGSAFMISTGRLQQRVAAEIN--QINGR  236

Query  291   HGVLLYEFKRSKAAMdelrgele-------rsgggdedGIREKIESLKACFGVLRSGTEN  133
              G+LLYEF+RSK AM+ELRGELE             E G+RE++++L+ CFGVLRSG EN
Sbjct  237   PGILLYEFRRSKMAMEELRGELERKCGQGGAVEWETEVGMRERVDNLRGCFGVLRSGAEN  296

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             IIGQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   IIGQLDDFFDEIVEGRKKLLDFCS-HR  322



>ref|XP_002302266.1| hypothetical protein POPTR_0002s09090g [Populus trichocarpa]
 gb|EEE81539.1| hypothetical protein POPTR_0002s09090g [Populus trichocarpa]
Length=322

 Score =   457 bits (1175),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 256/327 (78%), Positives = 284/327 (87%), Gaps = 12/327 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+L+ NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLANNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSGVSG+ENYYSAGFN+TSSLD+H HL+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGVSGIENYYSAGFNITSSLDNHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEE+NRALMETRI+PL LRFD  +S+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREAVGLEEDNRALMETRIQPLSLRFDEKISI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ES+     YEGCLFFGSAFMIS  RLQQRVA E+N  Q+ G 
Sbjct  180   SSLLLMILLYGLVYCWP-ESSFLRGGYEGCLFFGSAFMISTGRLQQRVAAEIN--QINGR  236

Query  291   HGVLLYEFKRSKAAMdelrgele-------rsgggdedGIREKIESLKACFGVLRSGTEN  133
              G+LLYEF+RSK AM+ELRGELE             E G+RE++++L+ CFGVLRSG EN
Sbjct  237   PGILLYEFRRSKMAMEELRGELERKCGQGGAVEWETEVGMRERVDNLRGCFGVLRSGAEN  296

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             IIGQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   IIGQLDDFFDEIVEGRKKLLDFCS-HR  322



>ref|XP_006366933.1| PREDICTED: uncharacterized protein LOC102584068 [Solanum tuberosum]
Length=316

 Score =   454 bits (1167),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 246/321 (77%), Positives = 273/321 (85%), Gaps = 6/321 (2%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFY+FLTRGIDDLE VFLS NFMSIQFLQR L+LLRSFH+ L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYTFLTRGIDDLERVFLSNNFMSIQFLQRVLSLLRSFHTQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWEVCHVLK+G+SG+ENYYS+GFN+ SSLD+H HL PQLSRQV
Sbjct  61    LPVGEKWLDEYMDESSKLWEVCHVLKTGISGLENYYSSGFNVISSLDNHQHLTPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAITGCRREA+GLEEENRALMETRIEPL LRFD +VSV ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAITGCRREAIGLEEENRALMETRIEPLSLRFDEIVSV-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYE-GCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
             SS+LL+ILL+GLVYCWP  S+   S  E GCLFFGS FMIS SRLQQR+  ++NQ    G
Sbjct  180   SSVLLMILLHGLVYCWPESSSSDFSRSETGCLFFGSNFMISTSRLQQRIGSQINQMN-SG  238

Query  294   GHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLD  115
                +LLYEF+RSKAAM       E     +   IRE++E+LK  FGVL++GTENIIGQLD
Sbjct  239   RQSILLYEFRRSKAAM--DELRGELENKCENGIIRERVENLKGYFGVLKNGTENIIGQLD  296

Query  114   DFFDEIVEGRKKLLDFCSTHR  52
             DFFDEIVEGRKKLLDFCS HR
Sbjct  297   DFFDEIVEGRKKLLDFCS-HR  316



>ref|XP_006386387.1| hypothetical protein POPTR_0002s09090g [Populus trichocarpa]
 gb|ERP64184.1| hypothetical protein POPTR_0002s09090g [Populus trichocarpa]
Length=408

 Score =   457 bits (1175),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 254/324 (78%), Positives = 282/324 (87%), Gaps = 11/324 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+L+ NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLANNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSGVSG+ENYYSAGFN+TSSLD+H HL+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGVSGIENYYSAGFNITSSLDNHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEE+NRALMETRI+PL LRFD  +S+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREAVGLEEDNRALMETRIQPLSLRFDEKISI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ES+     YEGCLFFGSAFMIS  RLQQRVA E+N  Q+ G 
Sbjct  180   SSLLLMILLYGLVYCWP-ESSFLRGGYEGCLFFGSAFMISTGRLQQRVAAEIN--QINGR  236

Query  291   HGVLLYEFKRSKAAMdelrgele-------rsgggdedGIREKIESLKACFGVLRSGTEN  133
              G+LLYEF+RSK AM+ELRGELE             E G+RE++++L+ CFGVLRSG EN
Sbjct  237   PGILLYEFRRSKMAMEELRGELERKCGQGGAVEWETEVGMRERVDNLRGCFGVLRSGAEN  296

Query  132   IIGQLDDFFDEIVEGRKKLLDFCS  61
             IIGQLDDFFDEIVEGRKKLLDFCS
Sbjct  297   IIGQLDDFFDEIVEGRKKLLDFCS  320



>ref|XP_008445364.1| PREDICTED: uncharacterized protein LOC103488422 [Cucumis melo]
Length=324

 Score =   453 bits (1166),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 279/329 (85%), Gaps = 14/329 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFY+FLTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYTFLTRGIDDLERVYLSNNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLW+ CHVLKSG+SG+EN+YS+GFN+TSSL++H HL+PQLSRQV
Sbjct  61    LPVGEKWLDEYMDESSKLWDACHVLKSGISGIENFYSSGFNITSSLETHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENRALME RI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREAVGLEEENRALMEARIQPLSLRFDEKVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ESN     YEGCLFFGSAFMIS +RLQ+RVA E+N  QM G 
Sbjct  180   SSLLLMILLYGLVYCWP-ESNFVRGGYEGCLFFGSAFMISTARLQERVAGEIN--QMNGR  236

Query  291   HGVLLYEFKRSKAAMdelrg---------elersgggdedGIREKIESLKACFGVLRSGT  139
              G+LLYEF+RSK AM+ELR                   E GIRE++E+L+ACFGVLRSG 
Sbjct  237   PGILLYEFRRSKMAMEELRAELERRVGMGSQGVVEWETEIGIRERVENLRACFGVLRSGA  296

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             ENI+ QLDDF DEIVEGRKKLLDFCS HR
Sbjct  297   ENIVCQLDDFIDEIVEGRKKLLDFCS-HR  324



>ref|XP_004169470.1| PREDICTED: uncharacterized LOC101222277 [Cucumis sativus]
 gb|KGN62183.1| hypothetical protein Csa_2G317400 [Cucumis sativus]
Length=324

 Score =   453 bits (1165),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 256/329 (78%), Positives = 284/329 (86%), Gaps = 14/329 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFY+FLTRGIDDLE V+LS NFMSIQFLQR L+ LRSFHS LILLVQKLH
Sbjct  1     MDPSSTNSVNGFYTFLTRGIDDLERVYLSNNFMSIQFLQRVLSHLRSFHSQLILLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLW+ CHVLKSG+SG+EN+YSAGFN+TSSL++H HL+PQLSRQV
Sbjct  61    LPVGEKWLDEYMDESSKLWDACHVLKSGISGIENFYSAGFNITSSLETHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENRALME RI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREAVGLEEENRALMEARIQPLSLRFDEKVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ESN     YEGCLFFGSAFMIS +RLQ+RVA E+N  QM G 
Sbjct  180   SSLLLMILLYGLVYCWP-ESNFVRGGYEGCLFFGSAFMISTARLQERVAGEIN--QMNGR  236

Query  291   HGVLLYEFKRSKAAMdelrgelersggg---------dedGIREKIESLKACFGVLRSGT  139
              G+LLYEF+RSK AM+ELR ELER  G           E GIRE++E+L+ACFGVLRSG 
Sbjct  237   PGILLYEFRRSKMAMEELRAELERRVGMGSQGLVEWETEIGIRERVENLRACFGVLRSGA  296

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             ENI+ QLDDF DEIVEGRKKLLDFCS HR
Sbjct  297   ENIVCQLDDFIDEIVEGRKKLLDFCS-HR  324



>ref|XP_002306599.1| hypothetical protein POPTR_0005s16380g [Populus trichocarpa]
 ref|XP_011006318.1| PREDICTED: uncharacterized protein LOC105112337 [Populus euphratica]
 gb|EEE93595.1| hypothetical protein POPTR_0005s16380g [Populus trichocarpa]
Length=322

 Score =   451 bits (1161),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 253/327 (77%), Positives = 282/327 (86%), Gaps = 12/327 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NS+NGFYSFLTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSANSLNGFYSFLTRGIDDLERVYLSNNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSG+SG+ENYYSAGFN+TSSL++H HL+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGLSGIENYYSAGFNITSSLENHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
              RAI+GCRREA+GLEEENRALMETRI+PL LRFD  +S+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   TRAISGCRREAVGLEEENRALMETRIQPLSLRFDEKISI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ES+     YEGCLFFGSAF+IS  RLQQRVA E+N  Q+ G 
Sbjct  180   SSLLLMILLYGLVYCWP-ESSFLRGGYEGCLFFGSAFLISTGRLQQRVAAEIN--QINGR  236

Query  291   HGVLLYEFKRSKAAMdelrgele-------rsgggdedGIREKIESLKACFGVLRSGTEN  133
              G+LLYEF+RSK AM+ELRGELE             E GIRE++++L+ CFGVLRSG EN
Sbjct  237   PGILLYEFRRSKMAMEELRGELERKCGQGGAVEWETEVGIRERVDNLRGCFGVLRSGAEN  296

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             I+GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   IVGQLDDFFDEIVEGRKKLLDFCS-HR  322



>ref|XP_002285822.2| PREDICTED: uncharacterized protein LOC100245399 [Vitis vinifera]
Length=322

 Score =   451 bits (1161),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 257/326 (79%), Positives = 278/326 (85%), Gaps = 11/326 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS TNSVNGFYSFLTRGIDDLE VFLSTNFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  2     MDPSPTNSVNGFYSFLTRGIDDLERVFLSTNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  61

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWE CHVLKSG+SGMENYYSAG N+ +SLDSH HL+PQLSRQV
Sbjct  62    LPVGEKWLDEYMDESSKLWEACHVLKSGISGMENYYSAGLNIAASLDSHRHLSPQLSRQV  121

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCR EA+GLEE NRA+METRI+PL LR D  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  122   IRAISGCRIEAVGLEEGNRAMMETRIQPLSLRLDEKVSI-ESKLNGFNGFRGVLYAMRNV  180

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILL GLVYCWP ESN     YEGCL FGSAFMIS +RLQQRVA E+N  Q+ G 
Sbjct  181   SSLLLMILLCGLVYCWP-ESNFLRGGYEGCLLFGSAFMISTARLQQRVAAEIN--QINGR  237

Query  291   HGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTENI  130
              G+LLYEF+RSK AMDELRGELER           E GI E++E+L+ CFGVLRSG ENI
Sbjct  238   PGILLYEFRRSKVAMDELRGELERRCSQGVLDWESEVGIGERVENLRGCFGVLRSGAENI  297

Query  129   IGQLDDFFDEIVEGRKKLLDFCSTHR  52
             IGQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  298   IGQLDDFFDEIVEGRKKLLDFCS-HR  322



>emb|CBI19094.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   451 bits (1159),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 257/326 (79%), Positives = 278/326 (85%), Gaps = 11/326 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS TNSVNGFYSFLTRGIDDLE VFLSTNFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSPTNSVNGFYSFLTRGIDDLERVFLSTNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWE CHVLKSG+SGMENYYSAG N+ +SLDSH HL+PQLSRQV
Sbjct  61    LPVGEKWLDEYMDESSKLWEACHVLKSGISGMENYYSAGLNIAASLDSHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCR EA+GLEE NRA+METRI+PL LR D  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRIEAVGLEEGNRAMMETRIQPLSLRLDEKVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILL GLVYCWP ESN     YEGCL FGSAFMIS +RLQQRVA E+N  Q+ G 
Sbjct  180   SSLLLMILLCGLVYCWP-ESNFLRGGYEGCLLFGSAFMISTARLQQRVAAEIN--QINGR  236

Query  291   HGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTENI  130
              G+LLYEF+RSK AMDELRGELER           E GI E++E+L+ CFGVLRSG ENI
Sbjct  237   PGILLYEFRRSKVAMDELRGELERRCSQGVLDWESEVGIGERVENLRGCFGVLRSGAENI  296

Query  129   IGQLDDFFDEIVEGRKKLLDFCSTHR  52
             IGQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   IGQLDDFFDEIVEGRKKLLDFCS-HR  321



>ref|XP_004250344.1| PREDICTED: uncharacterized protein LOC101254049 [Solanum lycopersicum]
Length=319

 Score =   450 bits (1157),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 246/324 (76%), Positives = 273/324 (84%), Gaps = 9/324 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFY+FLTRGIDDLE VFLS+NFMSIQFLQR L+LLRSFH+ L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYTFLTRGIDDLERVFLSSNFMSIQFLQRVLSLLRSFHTQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWEVCHVLK+G+SG+ENYYS+GFN+ SSL++H HLNPQLSRQV
Sbjct  61    LPVGEKWLDEYMDESSKLWEVCHVLKTGISGLENYYSSGFNVISSLENHQHLNPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
              RAITGCRREA GLEEENRALMETRIEPL LRFD +VSV ESKLNGFNGFRGVLYAMRNV
Sbjct  121   SRAITGCRREANGLEEENRALMETRIEPLSLRFDEIVSV-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYE----GCLFFGSAFMISISRLQQRVAEEMNQRQ  304
             SS+LL+ILL+GLVYCWP  S+           GCLFFGS FMISISRLQQR+  ++NQ  
Sbjct  180   SSVLLMILLHGLVYCWPESSSSSSDFSTSETGGCLFFGSNFMISISRLQQRIGSQINQMN  239

Query  303   MGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIG  124
               G   +LLYEF+RSKAAM       E     +   IRE++E+LKA FGVL++GTENIIG
Sbjct  240   -PGRRSILLYEFRRSKAAM--DELRGELENKCENGIIRERVENLKAYFGVLKNGTENIIG  296

Query  123   QLDDFFDEIVEGRKKLLDFCSTHR  52
             QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   QLDDFFDEIVEGRKKLLDFCS-HR  319



>ref|XP_007136199.1| hypothetical protein PHAVU_009G026500g [Phaseolus vulgaris]
 gb|ESW08193.1| hypothetical protein PHAVU_009G026500g [Phaseolus vulgaris]
Length=321

 Score =   445 bits (1144),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 244/325 (75%), Positives = 277/325 (85%), Gaps = 9/325 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDL+ VFL+TNFMSIQF+QR L+LLRSFH+ L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLDRVFLTTNFMSIQFIQRTLSLLRSFHTQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHV+KSG+SG+E YYSA   +T+SLDSH H+ PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVIKSGISGIETYYSAALTITTSLDSHRHITPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             MRAI+GCRREA+GLEEENRALMETRI+PL LRF+  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   MRAISGCRREAVGLEEENRALMETRIQPLSLRFEERVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCW   S+     YEGCLF GSAFM+S  RLQQRVA E+    MGG 
Sbjct  180   SSLLLMILLYGLVYCWGESSDFVLGGYEGCLFLGSAFMMSTVRLQQRVAAEIG--HMGGA  237

Query  291   HGVLLYEFKRSKAAMdelrgelersggg-----dedGIREKIESLKACFGVLRSGTENII  127
              G+LL+EF+RSK AM+ELRGELER G        E  IRE++E+++ACFGVLRSG +NI+
Sbjct  238   QGMLLHEFRRSKVAMEELRGELERRGSQGVEWESEVAIRERVENVRACFGVLRSGADNIV  297

Query  126   GQLDDFFDEIVEGRKKLLDFCSTHR  52
              QLDDFFDEIVEGRK+LLDFCS HR
Sbjct  298   AQLDDFFDEIVEGRKRLLDFCS-HR  321



>ref|XP_007018907.1| Uncharacterized protein TCM_034998 [Theobroma cacao]
 gb|EOY16132.1| Uncharacterized protein TCM_034998 [Theobroma cacao]
Length=322

 Score =   440 bits (1131),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 259/327 (79%), Positives = 286/327 (87%), Gaps = 12/327 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSST+SVNGFY+FLTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L+LLVQKLH
Sbjct  1     MDPSSTSSVNGFYTFLTRGIDDLERVYLSNNFMSIQFLQRVLSLLRSFHSQLLLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSG+SGMENYYSAGFN+TSSLD+H HL+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGISGMENYYSAGFNITSSLDNHRHLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENRALMETRI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   VRAISGCRREAVGLEEENRALMETRIQPLSLRFDEKVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYCWP ES+     YEGCLFFGSAFMIS +RLQQRVA E+N  Q+ G 
Sbjct  180   SSLLLMILLYGLVYCWP-ESSFLRGGYEGCLFFGSAFMISTARLQQRVAAEIN--QINGR  236

Query  291   HGVLLYEFKRSKAAMdelrgele-------rsgggdedGIREKIESLKACFGVLRSGTEN  133
              G+LLYEF+RSK AM+ELRGELE             E GIRE++E+LK CFGVLRSG EN
Sbjct  237   PGILLYEFRRSKLAMEELRGELERWCGQGGAVECETEVGIRERVENLKGCFGVLRSGAEN  296

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             I+GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   IVGQLDDFFDEIVEGRKKLLDFCS-HR  322



>ref|XP_007222740.1| hypothetical protein PRUPE_ppa008741mg [Prunus persica]
 gb|EMJ23939.1| hypothetical protein PRUPE_ppa008741mg [Prunus persica]
Length=321

 Score =   439 bits (1130),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 246/326 (75%), Positives = 276/326 (85%), Gaps = 11/326 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+LS NFMSIQFLQRAL+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLSNNFMSIQFLQRALSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKS +S MENYY++G N+TS+LDSH HL PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSAISAMENYYTSGLNITSTLDSHRHLTPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA GLEEENRALMETRI+PL L+FD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   VRAISGCRREAFGLEEENRALMETRIQPLSLKFDERVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLV+CWP ES+     YEGCL FGS+FMIS +RLQQRVA E++  Q+   
Sbjct  180   SSLLLMILLYGLVFCWP-ESSFCRGGYEGCLIFGSSFMISTARLQQRVAAEIS--QINER  236

Query  291   HGVLLYEFKRSKAAMdelrge------lersgggdedGIREKIESLKACFGVLRSGTENI  130
              G+L++EF+RSK AMDELRGE              E GIRE++++L+ CFGVLRSG ENI
Sbjct  237   PGILMWEFRRSKMAMDELRGELERRGPQGVMDWESEGGIRERVDNLRGCFGVLRSGAENI  296

Query  129   IGQLDDFFDEIVEGRKKLLDFCSTHR  52
             I QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   ISQLDDFFDEIVEGRKKLLDFCS-HR  321



>ref|XP_009627890.1| PREDICTED: uncharacterized protein LOC104118366 [Nicotiana tomentosiformis]
Length=323

 Score =   438 bits (1127),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 249/327 (76%), Positives = 271/327 (83%), Gaps = 14/327 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS  NSVNGFYSFLTRGIDDLE VFLS  FMSIQFLQR L+LLRSFH+ L LLVQKLH
Sbjct  4     MDPS--NSVNGFYSFLTRGIDDLERVFLSNKFMSIQFLQRVLSLLRSFHTQLTLLVQKLH  61

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWEVCHVLK+G+SG+ENYYSAGFN+TSSLD+H HL PQLSRQV
Sbjct  62    LPVGEKWLDEYMDESSKLWEVCHVLKNGISGIENYYSAGFNVTSSLDTHPHLTPQLSRQV  121

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAITGC+REA+GLEEENRALMETRIEPL LRFD  VSV ESKLNGFNGFRGVLYAMRNV
Sbjct  122   IRAITGCKREAVGLEEENRALMETRIEPLSLRFDEAVSV-ESKLNGFNGFRGVLYAMRNV  180

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SS+LL+ILLYGLVYCWP            CLFFGS FMIS SRLQQRVA EM        
Sbjct  181   SSVLLMILLYGLVYCWPQSEFLRGGESSDCLFFGSNFMISTSRLQQRVANEMIS---TSS  237

Query  291   HGVLLYEFKRSKAAMdelrgelersgggdedG-------IREKIESLKACFGVLRSGTEN  133
              GVLLYEF+RSK+A+DELRGELE+               IRE++++LKACFGVLRSGT+N
Sbjct  238   MGVLLYEFRRSKSALDELRGELEKRQSSTSVVEWESEIGIRERVDNLKACFGVLRSGTDN  297

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             IIGQLDDFFDEIV+ RK LLDFCS HR
Sbjct  298   IIGQLDDFFDEIVQARKMLLDFCS-HR  323



>ref|XP_010277672.1| PREDICTED: uncharacterized protein LOC104612057 [Nelumbo nucifera]
Length=319

 Score =   436 bits (1122),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 247/324 (76%), Positives = 275/324 (85%), Gaps = 9/324 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSST SVNGFY+FLTRGIDDLE  FLS NFMSIQFLQR L+LLRSFHS L +LVQKLH
Sbjct  1     MDPSSTTSVNGFYTFLTRGIDDLERSFLSNNFMSIQFLQRVLSLLRSFHSQLTILVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESS+LWE CHVLKSG+SGMENYY AG  + SSLD HH+L+PQL RQV
Sbjct  61    LPVGEKWLDEYMDESSRLWEACHVLKSGISGMENYYLAGAEIASSLDGHHNLSPQLLRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRRE +GLEEENRALMETRI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREVVGLEEENRALMETRIQPLSLRFDENVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILL GLVYCWP ES+     YEGCLFFGSAFM+S +RLQQRVA E+N  +M G 
Sbjct  180   SSLLLMILLCGLVYCWP-ESSFRRGGYEGCLFFGSAFMVSTARLQQRVAAEIN--RMDGR  236

Query  291   HGVLLYEFKRSKAAMdelrgelersgg----gdedGIREKIESLKACFGVLRSGTENIIG  124
              G+LLYEF+R+K AMDELR ELERS G      E  IRE++E+L+ CFG+LRSG E+IIG
Sbjct  237   PGILLYEFRRAKMAMDELRAELERSQGLGECESEVSIRERVENLEGCFGLLRSGIESIIG  296

Query  123   QLDDFFDEIVEGRKKLLDFCSTHR  52
             QLDDFFDEIVEGRKKL D CS HR
Sbjct  297   QLDDFFDEIVEGRKKLSDICS-HR  319



>ref|XP_009767181.1| PREDICTED: uncharacterized protein LOC104218395 [Nicotiana sylvestris]
Length=327

 Score =   436 bits (1122),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 243/327 (74%), Positives = 267/327 (82%), Gaps = 12/327 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS  NSVNGFYSFLTRGIDDLE VFLS NFMSIQFLQR L+LLRSFH+ L LLVQKLH
Sbjct  6     MDPS--NSVNGFYSFLTRGIDDLERVFLSNNFMSIQFLQRVLSLLRSFHTQLTLLVQKLH  63

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWEVCHVLK+G+SG+ENYYSAGFN+TSSLDSH HL  QLSRQV
Sbjct  64    LPVGEKWLDEYMDESSKLWEVCHVLKNGISGIENYYSAGFNVTSSLDSHPHLTTQLSRQV  123

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAITGC+REA+GLEEENRALMETRIEPL LRFD VVSV ESKLNGFNGFRGVLYAMRNV
Sbjct  124   IRAITGCKREAVGLEEENRALMETRIEPLSLRFDEVVSV-ESKLNGFNGFRGVLYAMRNV  182

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SS+LL++LLYGLVYCWP            CLFFGS FMIS SRLQQRVA EM        
Sbjct  183   SSVLLMMLLYGLVYCWPQSEFLRGGESSECLFFGSNFMISTSRLQQRVANEMMSSST-SS  241

Query  291   HGVLLYEFKRSKAA-------MdelrgelersgggdedGIREKIESLKACFGVLRSGTEN  133
              GVLLYEF+RSK+A       +++ +          E  IRE++++LKACFGVLRSGT+N
Sbjct  242   MGVLLYEFRRSKSALDELRDELEKRQSSSSVVEWESEIEIRERVDNLKACFGVLRSGTDN  301

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             IIGQLDDFFDEIV+ RK LLDFCS HR
Sbjct  302   IIGQLDDFFDEIVQARKMLLDFCS-HR  327



>emb|CDP18303.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   434 bits (1117),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 249/331 (75%), Positives = 276/331 (83%), Gaps = 14/331 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE  FLS NF+SIQFLQR L LLRS H+HLILLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERYFLSNNFLSIQFLQRVLTLLRSSHTHLILLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWEVCHVLKSG+SGMENYY+AG N+ SSL++H  L+PQ++RQV
Sbjct  61    LPVGEKWLDEYMDESSKLWEVCHVLKSGISGMENYYAAGLNINSSLENHPFLSPQVNRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRRE +GLEE+NRALMETRIEPL LRFD    V ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRRETVGLEEDNRALMETRIEPLSLRFDEKGCV-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESN---HPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQM  301
             SSLLL+ILLYGLVYCWP ES+          GCLFFGSA MIS +RL QRVA E+N  Q+
Sbjct  180   SSLLLMILLYGLVYCWPQESDFLRGGGYEGGGCLFFGSALMISTARLHQRVAAEIN--QI  237

Query  300   GGGHGVLLYEFKRSKAAMdelrgelersggg--------dedGIREKIESLKACFGVLRS  145
              G  G+LLYEF+RSKAAM+ELR ELER             E GI E++E+L+ CFGVLRS
Sbjct  238   NGRPGILLYEFRRSKAAMEELRVELERRCSQGVGVVDWESEHGITERVENLRDCFGVLRS  297

Query  144   GTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             GTENI+GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  298   GTENIVGQLDDFFDEIVEGRKKLLDFCSHHR  328



>ref|XP_010245055.1| PREDICTED: uncharacterized protein LOC104588713 [Nelumbo nucifera]
Length=320

 Score =   432 bits (1112),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 241/325 (74%), Positives = 274/325 (84%), Gaps = 10/325 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSST SVNGFY+FLTRGIDDLE  FL+ NFMSIQFLQRAL+LLRSFHS L +LVQKLH
Sbjct  1     MDPSSTTSVNGFYTFLTRGIDDLERSFLANNFMSIQFLQRALSLLRSFHSQLTILVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDE+S+LWE CHVLKSG+SGMENYY AG  + +SLD H + +PQLSRQ+
Sbjct  61    LPVGEKWLDEYMDETSRLWEACHVLKSGISGMENYYLAGAEIATSLDGHRNPSPQLSRQI  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRRE +GLEEENRALMETRI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREVVGLEEENRALMETRIQPLSLRFDEKVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILL GLVYCWP ES+     YEGCLFFGSAFM+S +RLQQRVA EMN  +M G 
Sbjct  180   SSLLLMILLCGLVYCWP-ESSFRRGGYEGCLFFGSAFMVSTARLQQRVAAEMN--RMDGR  236

Query  291   HGVLLYEFKRSKAAMdelrgelers-----gggdedGIREKIESLKACFGVLRSGTENII  127
              G+LL EF+R+K AM+EL+ ELER+         E GIRE++E+LK CFG+LRSG E+II
Sbjct  237   PGILLNEFRRAKMAMEELKAELERTGQGPVESESEVGIRERVENLKGCFGLLRSGIESII  296

Query  126   GQLDDFFDEIVEGRKKLLDFCSTHR  52
             GQLDDFFDEIVEGRKKL D CS HR
Sbjct  297   GQLDDFFDEIVEGRKKLSDICS-HR  320



>ref|XP_003601142.1| hypothetical protein MTR_3g073480 [Medicago truncatula]
 gb|AES71393.1| hypothetical protein MTR_3g073480 [Medicago truncatula]
Length=325

 Score =   432 bits (1112),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 241/329 (73%), Positives = 278/329 (84%), Gaps = 13/329 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE VFL+ NFMSIQFLQR L+LLRS H+ L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVFLTNNFMSIQFLQRTLSLLRSLHTQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSG+SG+ENYYSA  N+TS+LDSH H+ PQ+SRQ+
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGISGIENYYSAASNITSTLDSHIHITPQISRQI  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENRALMETRI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREAVGLEEENRALMETRIQPLSLRFDERVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESN-----HPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQR  307
             SSLLL+ILLYGLVYC+P  S+     +    YEGCLF GS+FMIS +RLQQRVA EM   
Sbjct  180   SSLLLMILLYGLVYCYPESSDLIFGGYEDYEYEGCLFLGSSFMISTARLQQRVAAEMA--  237

Query  306   QMGGGHGVLLYEFKRSKAAMdelrgelersgggd----edGIREKIESLKACFGVLRSGT  139
              + GG G+LL+EF+RSK  +++LRGE+ER G       E  IRE++++L++ FGVLRSG 
Sbjct  238   GINGGPGMLLHEFRRSKVVIEDLRGEMERKGSMMEWENEVAIRERVDNLRSSFGVLRSGA  297

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             +NII QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  298   DNIIAQLDDFFDEIVEGRKKLLDFCS-HR  325



>ref|XP_010673046.1| PREDICTED: uncharacterized protein LOC104889478 [Beta vulgaris 
subsp. vulgaris]
Length=319

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 243/325 (75%), Positives = 272/325 (84%), Gaps = 11/325 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDP  T+SVNGFY+FLTRGIDDLE VFLS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDP--TSSVNGFYTFLTRGIDDLERVFLSNNFMSIQFLQRTLSLLRSFHSQLTLLVQKLH  58

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSG+S MENYYS+G N+ SSLD H ++ PQLSRQV
Sbjct  59    LPVGDKWLDEYMDESSKLWEACHVLKSGISTMENYYSSGLNIASSLDGHRYITPQLSRQV  118

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RA++GCRREA+G EEENRAL+ETRI+ L LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  119   IRALSGCRREAIGSEEENRALVETRIQTLSLRFDEKVSI-ESKLNGFNGFRGVLYAMRNV  177

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILL GLVYCWP ESN     YEGC+ FGSAFM+S +RLQQR+  ++NQ   GG 
Sbjct  178   SSLLLMILLCGLVYCWP-ESNFLRGGYEGCVIFGSAFMVSTARLQQRMVAQINQIN-GGR  235

Query  291   HGVLLYEFKRSKAAMdelrgel-----ersgggdedGIREKIESLKACFGVLRSGTENII  127
              GVLLYEF+RSKAAM+ELR EL     ER     E GIRE++++LK  FGVLRSG ENII
Sbjct  236   PGVLLYEFRRSKAAMEELRAELERRGGERVEWESEVGIRERVDNLKGSFGVLRSGAENII  295

Query  126   GQLDDFFDEIVEGRKKLLDFCSTHR  52
              QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  296   SQLDDFFDEIVEGRKKLLDFCS-HR  319



>ref|XP_006472686.1| PREDICTED: uncharacterized protein LOC102629833 [Citrus sinensis]
Length=331

 Score =   429 bits (1102),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 244/334 (73%), Positives = 270/334 (81%), Gaps = 17/334 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS+ SVNGFYS LTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSS-SVNGFYSSLTRGIDDLELVYLSNNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWE CHV+KSG+SGME YYSAGFN+TSSLD+H HL PQLSRQV
Sbjct  60    LPVGEKWLDEYMDESSKLWEACHVIKSGISGMETYYSAGFNITSSLDNHRHLTPQLSRQV  119

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+ CRREA  LEEENRALMETRI+ L LRFD  VS+ ESKLNGFNGFRGVLY MRNV
Sbjct  120   IRAISVCRREAAALEEENRALMETRIQALSLRFDEKVSI-ESKLNGFNGFRGVLYGMRNV  178

Query  471   ssllliillyglvYCWPAESN--HPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             SSLLL+ILLYG+VYCWP  +N       YEG L FGSAFMIS +RLQ+RVA E+NQ  + 
Sbjct  179   SSLLLMILLYGVVYCWPESNNFLGGGGGYEGRLCFGSAFMISTARLQERVAAEINQMSVS  238

Query  297   G----GHGVLLYEFKRSKAAMdelr--------gelersgggdedGIREKIESLKACFGV  154
             G      GVLLYEF+RSK A+DELR                 +E GIRE++E+L+ CFGV
Sbjct  239   GCGRQQQGVLLYEFRRSKMALDELRGELERKCGQGQMAVDWENEVGIRERVENLRGCFGV  298

Query  153   LRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             LRSG ENI+GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  299   LRSGAENIVGQLDDFFDEIVEGRKKLLDFCS-HR  331



>ref|XP_006434083.1| hypothetical protein CICLE_v10001805mg [Citrus clementina]
 gb|ESR47323.1| hypothetical protein CICLE_v10001805mg [Citrus clementina]
Length=330

 Score =   424 bits (1091),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/333 (73%), Positives = 269/333 (81%), Gaps = 16/333 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS+ SVNGFYS LTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSS-SVNGFYSSLTRGIDDLELVYLSNNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWE CHV+KSG+SGME Y SAGFN+TSSLD+H HL PQLSRQV
Sbjct  60    LPVGEKWLDEYMDESSKLWEACHVIKSGISGMETYCSAGFNITSSLDNHRHLTPQLSRQV  119

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+ CRREA  LEEENRALMETRI+ L LRFD  VS+ ESKLNGFNGFRGVLY MRNV
Sbjct  120   IRAISVCRREAAALEEENRALMETRIQALSLRFDEKVSI-ESKLNGFNGFRGVLYGMRNV  178

Query  471   ssllliillyglvYCWPAESNH-PPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
             SSLLL+ILLYG+VYCWP  +N      YEG L FGSAFMIS +RLQ+RVA E+NQ  + G
Sbjct  179   SSLLLMILLYGVVYCWPESNNFLGGGGYEGRLCFGSAFMISTARLQERVAAEINQMSVSG  238

Query  294   ----GHGVLLYEFKRSKAAMdelr--------gelersgggdedGIREKIESLKACFGVL  151
                   GVLLYEF+RSK A+DELR                 +E GIRE++E+L+ CFGVL
Sbjct  239   CGRQQQGVLLYEFRRSKMALDELRGELERKCGQGQMAVDWENEVGIRERVENLRGCFGVL  298

Query  150   RSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             RSG ENI+GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  299   RSGAENIVGQLDDFFDEIVEGRKKLLDFCS-HR  330



>ref|XP_004515656.1| PREDICTED: uncharacterized protein LOC101513911 [Cicer arietinum]
Length=323

 Score =   424 bits (1090),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 245/329 (74%), Positives = 276/329 (84%), Gaps = 15/329 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE +FL+ NFMSIQFLQRAL+LLRS H+ L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERMFLNNNFMSIQFLQRALSLLRSLHTQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVL+SG+SG+ENYYS+  N+TSSLDSH H+ PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLRSGISGIENYYSSASNITSSLDSHRHITPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA+GLEEENRALMETRI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISGCRREAVGLEEENRALMETRIQPLSLRFDERVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESN-----HPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQR  307
             SSLLL+ILLYGLVYCWP  S+     +    YEGCLF GSAFM    RLQQRVA EM + 
Sbjct  180   SSLLLMILLYGLVYCWPESSDLVFGGYEYDEYEGCLFLGSAFM----RLQQRVAAEMGRI  235

Query  306   QMGGGHGVLLYEFKRSKAAMdelrgelersgg----gdedGIREKIESLKACFGVLRSGT  139
               GGG G+LL+EF+RSK  M++LR ELER G      +E GIREK+E+ +  FGVLRSG 
Sbjct  236   NGGGGAGMLLHEFRRSKVVMEDLRSELERKGSILEWENEVGIREKVENFRGSFGVLRSGV  295

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             +NI+ QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  296   DNIVAQLDDFFDEIVEGRKKLLDFCS-HR  323



>ref|XP_008338804.1| PREDICTED: uncharacterized protein LOC103401868 [Malus domestica]
Length=319

 Score =   424 bits (1089),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/323 (75%), Positives = 273/323 (85%), Gaps = 7/323 (2%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+LS NFMSIQFLQRAL+L RSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLSNNFMSIQFLQRALSLJRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKS VS MENYY++G N+TS+LDSH HL PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSAVSAMENYYTSGLNITSTLDSHRHLTPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRR+A GLEEENR LMETRI+PL L+FD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   VRAISGCRRQAFGLEEENRGLMETRIQPLSLKFDERVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWP-AESNHPPSSY-EGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             SSLLLIILLYGLV+CWP  ES+     Y EGC+ FGS+FM+S +RLQQRVA E+  RQ+ 
Sbjct  180   SSLLLIILLYGLVFCWPEEESSFCRGGYNEGCVIFGSSFMVSTARLQQRVAAEI--RQIR  237

Query  297   GGHGVLLYEFKRSKAAMdelr-gelersgggdedGIREKIESLKACFGVLRSGTENIIGQ  121
                GVL++EF+RSK AM+ELR     R  GG   GIRE +++L+ CFGVLRSG ENI+ Q
Sbjct  238   ERPGVLMWEFRRSKXAMEELRGDLERRRVGGGGGGIREGVDNLRECFGVLRSGAENIVNQ  297

Query  120   LDDFFDEIVEGRKKLLDFCSTHR  52
             LDDFFDEIVEGRKKLLDFCS HR
Sbjct  298   LDDFFDEIVEGRKKLLDFCS-HR  319



>gb|KDO80841.1| hypothetical protein CISIN_1g020112mg [Citrus sinensis]
Length=331

 Score =   424 bits (1090),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/334 (73%), Positives = 269/334 (81%), Gaps = 17/334 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS+ SVNGFYS LTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSS-SVNGFYSSLTRGIDDLELVYLSNNFMSIQFLQRVLSLLRSFHSQLTLLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWE CHV+KSG+SGME Y SAGFN+TSSLD+H HL PQLSRQV
Sbjct  60    LPVGEKWLDEYMDESSKLWEACHVIKSGISGMETYCSAGFNITSSLDNHRHLTPQLSRQV  119

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+ CRREA  LEEENRALMETRI+ L LRFD  VS+ ESKLNGFNGFRGVLY MRNV
Sbjct  120   IRAISVCRREAAALEEENRALMETRIQALSLRFDEKVSI-ESKLNGFNGFRGVLYGMRNV  178

Query  471   ssllliillyglvYCWPAESN--HPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             SSLLL+ILLYG+VYCWP  +N       YEG L FGSAFMIS +RLQ+RVA E+NQ  + 
Sbjct  179   SSLLLMILLYGVVYCWPESNNFLGGGGGYEGRLCFGSAFMISTARLQERVAAEINQMSVS  238

Query  297   G----GHGVLLYEFKRSKAAMdelr--------gelersgggdedGIREKIESLKACFGV  154
             G      GVLLYEF+RSK A+DELR                 +E GIRE++E+L+ CFGV
Sbjct  239   GCGRQQQGVLLYEFRRSKMALDELRGELERKCGQGQMAVDWENEVGIRERVENLRGCFGV  298

Query  153   LRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             LRSG ENI+GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  299   LRSGAENIVGQLDDFFDEIVEGRKKLLDFCS-HR  331



>ref|XP_009367335.1| PREDICTED: uncharacterized protein LOC103956999 [Pyrus x bretschneideri]
Length=336

 Score =   422 bits (1086),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 247/340 (73%), Positives = 274/340 (81%), Gaps = 24/340 (7%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRAL------------ALLRSF  868
             MDPSSTNSVNGFYSFLTRGIDDLE V+LS NFMSIQFLQRAL            +LLRSF
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLSNNFMSIQFLQRALXXXXXXXXXXXLSLLRSF  60

Query  867   HSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS  688
             HS L LLVQKLHLPVG+KWLDEYMDESSKLWE CHVLKS VS MENYY++G N+TS+ DS
Sbjct  61    HSQLALLVQKLHLPVGDKWLDEYMDESSKLWEACHVLKSAVSAMENYYTSGLNITSTFDS  120

Query  687   HHHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFN  508
             H HL PQLSRQV+RAI+GCRREA GLEEENR LMETRI+PL L+FD  VS+ ESKLNGFN
Sbjct  121   HRHLTPQLSRQVVRAISGCRREAFGLEEENRGLMETRIQPLSLKFDEGVSI-ESKLNGFN  179

Query  507   GFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSY-EGCLFFGSAFMISISRLQQR  331
             GFRGVLYAMRNVSSLLL+ILLYGLV+C P ES+     Y EGC+ FGS+FMIS +RLQQR
Sbjct  180   GFRGVLYAMRNVSSLLLMILLYGLVFCLPEESSFCRGGYNEGCMIFGSSFMISTARLQQR  239

Query  330   VAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedG-------IREKIESL  172
             VA E+   Q+    GVL++EF+RSKAAM+ELRGELER G             IRE +++L
Sbjct  240   VAAEIG--QIRERPGVLMWEFRRSKAAMEELRGELERGGQQGVVEWEVDGGGIREGVDNL  297

Query  171   KACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             KACFGVLRSG ENI  QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  298   KACFGVLRSGAENIASQLDDFFDEIVEGRKKLLDFCS-HR  336



>ref|XP_004307239.1| PREDICTED: uncharacterized protein LOC101299035 [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   422 bits (1084),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 246/329 (75%), Positives = 275/329 (84%), Gaps = 16/329 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+LS NFMSIQFLQRAL+LLRSFHS L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLSNNFMSIQFLQRALSLLRSFHSQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE  HVLKS +S MENYY++G NLTS+LDSH +L PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEASHVLKSAISSMENYYTSGCNLTSTLDSHRNLTPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA GLEEENRALMETRIEPL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   VRAISGCRREAFGLEEENRALMETRIEPLSLRFDERVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYE-GCLFFGSAFMISISRLQQRVAEE---MNQRQ  304
             S+LLL ILLYGLV+CWP ES+     YE GC+ FGS FMIS +RLQQRVA E   M++R+
Sbjct  180   STLLLTILLYGLVFCWP-ESSFCRGGYEQGCMIFGSPFMISTARLQQRVAGEIGGMSERR  238

Query  303   MGGGHGVLLYEFKRSKAAMdelrgelersggg-----dedGIREKIESLKACFGVLRSGT  139
                  G+L+ EF+RSK AM+ELRGE+ER G       +E GIRE+++ L+ CFGVLRSG 
Sbjct  239   ----PGILMDEFRRSKMAMEELRGEMERKGTMIMDWENESGIRERVDKLRGCFGVLRSGA  294

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             ENI  QLDDF DEIVEGRKKLLDFCS HR
Sbjct  295   ENISSQLDDFLDEIVEGRKKLLDFCS-HR  322



>gb|KHG26191.1| Monofunctional biosynthetic peptidoglycan transglycosylase [Gossypium 
arboreum]
Length=371

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 253/354 (71%), Positives = 297/354 (84%), Gaps = 19/354 (5%)
 Frame = -3

Query  1101  IPSFSLFNLKFPFSLNTPNSLNFFLTSPMA---MDPSSTNSVNGFYSFLTRGIDDLECVF  931
             IP  SL+NL FP    +P+ L     +P++   MDPSST SVNGFY+FLTRGIDDLE V+
Sbjct  33    IPP-SLYNL-FP----SPHPLYSHSLNPLSLSTMDPSSTTSVNGFYTFLTRGIDDLERVY  86

Query  930   LSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKS  751
             LS NFMSIQFLQR L+LLRSFHS L+LLVQKLHLPVG+KWLDEYMDESSKLWE CHVLK+
Sbjct  87    LSNNFMSIQFLQRVLSLLRSFHSQLLLLVQKLHLPVGDKWLDEYMDESSKLWEACHVLKT  146

Query  750   GVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIE  571
             G+S MENYYSAGFN+TSSLD+H HLNP    Q++RAI+GCRREA+GLEEEN+ALM+TRI+
Sbjct  147   GLSSMENYYSAGFNITSSLDNHRHLNP----QIIRAISGCRREALGLEEENKALMQTRIQ  202

Query  570   PLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSY  391
             PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNVSSLLL+ILLYGLVYCWP ES+     Y
Sbjct  203   PLSLRFDERVSI-ESKLNGFNGFRGVLYAMRNVSSLLLMILLYGLVYCWP-ESSFLRGGY  260

Query  390   EGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelers-g  214
             EGCLFFGS FMIS +RLQQRVAE++N  QM G  G+L+YE++R+K AM+E++ E+ER  G
Sbjct  261   EGCLFFGSTFMISTARLQQRVAEQIN--QMNGRGGILMYEYRRAKMAMEEVKEEMERKGG  318

Query  213   ggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
                E+G+RE++E +K CFGVLR GTE+II Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  319   ESREEGMRERVEKMKGCFGVLRCGTESIIAQIDDFFDEIVEGRKKLLDFCS-HR  371



>ref|XP_003526603.1| PREDICTED: uncharacterized protein LOC100809357 [Glycine max]
Length=321

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 239/328 (73%), Positives = 272/328 (83%), Gaps = 15/328 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS   VNGFYSFLTRGIDDLE VFLSTNFMSIQFLQRAL+LLRSFH+ L LLVQKLH
Sbjct  1     MDPSS---VNGFYSFLTRGIDDLESVFLSTNFMSIQFLQRALSLLRSFHTQLTLLVQKLH  57

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLW+ CHV+KSG+S ++ YYSA  N+TSSLDSH  + PQLSRQV
Sbjct  58    LPVGDKWLDEYMDESSKLWDACHVIKSGISSIDTYYSAALNITSSLDSHRPITPQLSRQV  117

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI GCRREA+GLEEENR LME RI+PL LRF+  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  118   IRAIAGCRREAVGLEEENRGLMEARIQPLSLRFEERVSI-ESKLNGFNGFRGVLYAMRNV  176

Query  471   ssllliillyglvYCWPAESNH--PPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             SSLLL++LLYGLVYC+   S+       YEGCLF GSAFM+S +RLQQRVA E+    MG
Sbjct  177   SSLLLMVLLYGLVYCYGDSSDFVLGGCGYEGCLFLGSAFMMSTARLQQRVAAEIG--HMG  234

Query  297   GGHGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTE  136
             G  G+LL+EF+RSK AM+ELRGELER G         E  IRE++E+L+ACFGVLRSG +
Sbjct  235   GAQGMLLHEFRRSKVAMEELRGELERRGSQGGVEWESEVAIRERVENLRACFGVLRSGAD  294

Query  135   NIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             NI+ QLDDFFDEIVEGRK+LLDFCS HR
Sbjct  295   NIVAQLDDFFDEIVEGRKRLLDFCS-HR  321



>gb|KHN09157.1| hypothetical protein glysoja_025618 [Glycine soja]
Length=321

 Score =   417 bits (1071),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 238/328 (73%), Positives = 271/328 (83%), Gaps = 15/328 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS   VNGFYSFLTRGIDDLE VFLSTNFMSIQFLQRAL+LLRSFH+ L LLVQKLH
Sbjct  1     MDPSS---VNGFYSFLTRGIDDLESVFLSTNFMSIQFLQRALSLLRSFHTQLTLLVQKLH  57

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLW+ CHV+KSG+S ++ YYSA  N+TSSLDSH  + PQLSRQV
Sbjct  58    LPVGDKWLDEYMDESSKLWDACHVIKSGISSIDTYYSAALNITSSLDSHRPITPQLSRQV  117

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI GCRREA+GLEEENR LME RI+PL LRF+  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  118   IRAIAGCRREAVGLEEENRGLMEARIQPLSLRFEERVSI-ESKLNGFNGFRGVLYAMRNV  176

Query  471   ssllliillyglvYCWPAESNH--PPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             SSLLL++LLYGLVYC+   S+       YEGCLF GSAFM+S +RLQQRVA E+    MG
Sbjct  177   SSLLLMVLLYGLVYCYGDSSDFVLGGCGYEGCLFLGSAFMMSTARLQQRVAAEIG--HMG  234

Query  297   GGHGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTE  136
             G  G+LL+EF+RSK AM+ELRGELER G         E  IRE++E+L+ CFGVLRSG +
Sbjct  235   GAQGMLLHEFRRSKVAMEELRGELERRGSQGGVEWESEVAIRERVENLRTCFGVLRSGAD  294

Query  135   NIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             NI+ QLDDFFDEIVEGRK+LLDFCS HR
Sbjct  295   NIVAQLDDFFDEIVEGRKRLLDFCS-HR  321



>ref|XP_009338615.1| PREDICTED: uncharacterized protein LOC103930940 [Pyrus x bretschneideri]
Length=329

 Score =   412 bits (1059),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 239/331 (72%), Positives = 268/331 (81%), Gaps = 16/331 (5%)
 Frame = -3

Query  1008  DPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHL  829
             DPSSTNSVNGFYSFL RG+DDLE V+LS NFMSIQFLQR+L LLRSFHS L LLVQKLHL
Sbjct  3     DPSSTNSVNGFYSFLARGMDDLERVYLSNNFMSIQFLQRSLTLLRSFHSQLTLLVQKLHL  62

Query  828   PVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSS-LDSHHHLNPQLSRQV  652
             PVG+KWLDEYMDESSKLWE CHVLKS VS MENYY++G  +TS+ LDSHHHLNPQLSRQV
Sbjct  63    PVGDKWLDEYMDESSKLWEACHVLKSAVSAMENYYTSGLTITSTLLDSHHHLNPQLSRQV  122

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+ CRREA GLEEENRALMETRI+PL L+FD  V+V ESKLNGF+GFRGVLYAMRNV
Sbjct  123   VRAISRCRREAFGLEEENRALMETRIQPLSLKFDERVAV-ESKLNGFSGFRGVLYAMRNV  181

Query  471   ssllliillyglvYCWPAESN---HPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQM  301
             SSLLL+ILLYGLV+C   +S         YEGCL FGS FMIS +RLQQ VA EM   QM
Sbjct  182   SSLLLMILLYGLVFCSLEDSTFCREGDYDYEGCLIFGSPFMISTARLQQLVAAEMG--QM  239

Query  300   GGGHGVLLYEFKRSKAAMdelrgelersgg--------gdedGIREKIESLKACFGVLRS  145
                 G+L++EF+RSKAAM+ELRG+LE              E GI E++E+L+ CFGVL S
Sbjct  240   SERPGILMWEFRRSKAAMEELRGKLEERRSPQQGVMDWESESGIGERVENLRECFGVLNS  299

Query  144   GTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             GTENI+ QLDD FDEIVEGRKKLLDFCS HR
Sbjct  300   GTENIVSQLDDLFDEIVEGRKKLLDFCS-HR  329



>ref|XP_008233945.1| PREDICTED: uncharacterized protein LOC103332953 [Prunus mume]
Length=315

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 235/326 (72%), Positives = 265/326 (81%), Gaps = 17/326 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE V+LS NFMSIQFLQ            L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVYLSNNFMSIQFLQXXXX------XQLTLLVQKLH  54

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKS +S MENYY++G N+TS+LDSH HL PQLSRQV
Sbjct  55    LPVGDKWLDEYMDESSKLWEACHVLKSAISAMENYYTSGLNITSTLDSHRHLTPQLSRQV  114

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRREA GLEEENRALMETRI+PL L+FD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  115   VRAISGCRREAFGLEEENRALMETRIQPLSLKFDERVSI-ESKLNGFNGFRGVLYAMRNV  173

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLV+CWP ES+     YEGCL FGS+FMIS +RLQQRVA E++  Q+   
Sbjct  174   SSLLLMILLYGLVFCWP-ESSFCRGGYEGCLIFGSSFMISTARLQQRVAAEIS--QINER  230

Query  291   HGVLLYEFKRSKAAMdelrge------lersgggdedGIREKIESLKACFGVLRSGTENI  130
              G+L+++F+RSK AMDELRGE              E GIRE++++L+ CFGVLRSG ENI
Sbjct  231   PGILMWDFRRSKMAMDELRGELERRGPQGVMDWESEGGIRERVDNLRGCFGVLRSGAENI  290

Query  129   IGQLDDFFDEIVEGRKKLLDFCSTHR  52
             I QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  291   ISQLDDFFDEIVEGRKKLLDFCS-HR  315



>gb|KHG12279.1| Histidinol-phosphate aminotransferase [Gossypium arboreum]
Length=322

 Score =   410 bits (1054),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 248/327 (76%), Positives = 277/327 (85%), Gaps = 12/327 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD SST+SVNGFY+FLTRGIDDLE V+LS NFMSIQFLQR L+LLRSFHS L+LL+QKLH
Sbjct  1     MDASSTSSVNGFYTFLTRGIDDLERVYLSNNFMSIQFLQRVLSLLRSFHSQLLLLIQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHV+KSG+SG+ENYYSAGFN+ SS D+H HL  QLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVIKSGISGIENYYSAGFNIISSFDNHRHLTHQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+ CRREA+GLEEENRALMETRI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  121   IRAISACRREAVGLEEENRALMETRIQPLSLRFDEKVSI-ESKLNGFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL+ILLYGLVYC   ES+     YEGCL FGSAFMIS  RLQQRVA E+N  QM G 
Sbjct  180   SSLLLMILLYGLVYC-RTESSFLRGGYEGCLIFGSAFMISTGRLQQRVAAEIN--QMNGR  236

Query  291   HGVLLYEFKRSKAAMdelrgelersgggdedG-------IREKIESLKACFGVLRSGTEN  133
              G+LLYEF+RSK AM+ELRGELER GGG  +        IRE++E+LK  FGVLRSG +N
Sbjct  237   PGILLYEFRRSKLAMEELRGELERRGGGGVEEWETEVGGIRERVENLKGWFGVLRSGADN  296

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             I+ QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  297   IVVQLDDFFDEIVEGRKKLLDFCS-HR  322



>ref|XP_008363867.1| PREDICTED: uncharacterized protein LOC103427587 [Malus domestica]
Length=329

 Score =   409 bits (1051),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 236/331 (71%), Positives = 267/331 (81%), Gaps = 16/331 (5%)
 Frame = -3

Query  1008  DPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHL  829
             DPS TNSVNGFYSFL RG+DDLE V+LS NFMSIQFLQR+L LLRSFHS L LLVQKLHL
Sbjct  3     DPSPTNSVNGFYSFLARGMDDLERVYLSNNFMSIQFLQRSLTLLRSFHSQLTLLVQKLHL  62

Query  828   PVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSS-LDSHHHLNPQLSRQV  652
             PVG+KWLDEYMDESSKLWE CHVLKS VS MENYY++G  +TS+ LDSHHHLNPQLSRQV
Sbjct  63    PVGDKWLDEYMDESSKLWEACHVLKSAVSAMENYYTSGLTITSTLLDSHHHLNPQLSRQV  122

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +R I+ CRREA GLEEENRALMETRI+PL L+FD  V+V ESKLNGF+GFRGVLYAMRNV
Sbjct  123   VRTISRCRREAFGLEEENRALMETRIQPLSLKFDERVAV-ESKLNGFSGFRGVLYAMRNV  181

Query  471   ssllliillyglvYCWPAESN---HPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQM  301
             SSLLL+ILLYGLV+C   +S         YEGCL FGS FMIS +RLQQRVA E+   QM
Sbjct  182   SSLLLMILLYGLVFCSLEDSTFCKEGDYDYEGCLIFGSPFMISTARLQQRVAAEIG--QM  239

Query  300   GGGHGVLLYEFKRSKAAMdelrgelersgg--------gdedGIREKIESLKACFGVLRS  145
                 G+L++EF+RSKAAM+ELRG+LE              E GI E++E+L+ CFGVL S
Sbjct  240   SERPGILMWEFRRSKAAMEELRGKLEERRSPQQGVMDWESESGIGERVENLRECFGVLNS  299

Query  144   GTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             G+ENI+ QLDD FDEIVEGRKKLLDFCS HR
Sbjct  300   GSENIVSQLDDLFDEIVEGRKKLLDFCS-HR  329



>gb|EYU22894.1| hypothetical protein MIMGU_mgv1a010066mg [Erythranthe guttata]
Length=323

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 228/326 (70%), Positives = 261/326 (80%), Gaps = 10/326 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFY+FLTRGI+DLE VF S+NFMSI FLQR L+LLRS H+ L LLVQKLH
Sbjct  2     MDPSSANSVNGFYNFLTRGIEDLERVFSSSNFMSIHFLQRVLSLLRSSHNQLTLLVQKLH  61

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESSKLWEVC +LK+G+SG+ENYYS+G N+ SS DSH HL+PQLSRQV
Sbjct  62    LPVGEKWLDEYMDESSKLWEVCQILKTGISGLENYYSSGLNIISSFDSHRHLSPQLSRQV  121

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+ CRREA+GLEEENR+LMETR EPL L+ D  +   ESKLNGFNGFRGVLYAMRNV
Sbjct  122   IRAISVCRREAVGLEEENRSLMETRTEPLSLKLDEKICA-ESKLNGFNGFRGVLYAMRNV  180

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             SSLLL ILLYG VY WP  +    + YEG L FGS+FMIS  RLQQRV  E+N+ +  GG
Sbjct  181   SSLLLTILLYGSVYYWPESNTGRRNGYEGSLLFGSSFMISTMRLQQRVDSEINETR--GG  238

Query  291   HGVLLYEFKRSKAAMdelrgelersgggdedG------IREKIESLKACFGVLRSGTENI  130
              GVLLYEFKRSK  +DELRGE+ER              IRE++E L+ CFG+LRSG ENI
Sbjct  239   PGVLLYEFKRSKDLLDELRGEIERKCVKGSVEWELEDGIRERVEILRGCFGILRSGIENI  298

Query  129   IGQLDDFFDEIVEGRKKLLDFCSTHR  52
             + QLDD FDEIV+GRK LL+FCS HR
Sbjct  299   VMQLDDVFDEIVDGRKMLLNFCS-HR  323



>ref|XP_010064016.1| PREDICTED: uncharacterized protein LOC104450970 [Eucalyptus grandis]
 gb|KCW71298.1| hypothetical protein EUGRSUZ_F04385 [Eucalyptus grandis]
Length=328

 Score =   403 bits (1036),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 266/329 (81%), Gaps = 10/329 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYS LTRGIDDLE + LS +FMS+QFLQR L++LRSFH+ L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSLLTRGIDDLERISLSHSFMSVQFLQRVLSVLRSFHTSLSLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSRQ  655
             LPVG+KWL+EYMDESSKLW+ CHVLKSGVSG+EN  SAG N+ S  D+ HHHL+PQ+SRQ
Sbjct  61    LPVGDKWLNEYMDESSKLWDACHVLKSGVSGLENCCSAGLNVISLFDAHHHHLSPQVSRQ  120

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
             V+RAI GCRREA+GLEEENRALME +  PL LRF+ +    ESKL+GFNGFRG LYAM+N
Sbjct  121   VIRAINGCRREAVGLEEENRALMEMKFRPLSLRFEEMGGAFESKLHGFNGFRGALYAMKN  180

Query  474   vssllliillyglvYCWPAESNHPPSSY--EGCLFFGSAFMISISRLQQRVAEEMNQRQM  301
             VSSLL++ILLYGLVY WP ESN     Y  EGCLF+GS+FM+S +RL+QRVA E+ Q   
Sbjct  181   VSSLLIMILLYGLVYYWPEESNILGKEYEMEGCLFYGSSFMVSTARLKQRVASEIEQVSG  240

Query  300   GGGHGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGT  139
             GGG G+L  E++RS+ AMDELRGELE+           +  +RE++E L+ CFG LRSG 
Sbjct  241   GGGTGILAQEYRRSRTAMDELRGELEKICSVGGVDFESQVRVRERVEHLRGCFGALRSGA  300

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             ENI+GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  301   ENIVGQLDDFFDEIVEGRKKLLDFCS-HR  328



>ref|XP_008387801.1| PREDICTED: uncharacterized protein LOC103450258 [Malus domestica]
Length=326

 Score =   397 bits (1020),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 264/328 (80%), Gaps = 13/328 (4%)
 Frame = -3

Query  1008  DPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHL  829
             DPSSTNSVNGF+SFL RG+DDLE V+LS+NFMSIQFLQR L LLRSFHS L LLVQKLHL
Sbjct  3     DPSSTNSVNGFFSFLARGVDDLERVYLSSNFMSIQFLQRVLTLLRSFHSQLNLLVQKLHL  62

Query  828   PVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVM  649
             PVG+KWLDEYMDESSKLWE CHVLKS VS MEN+Y++G  +TS+L   HHL PQLSRQV+
Sbjct  63    PVGDKWLDEYMDESSKLWEACHVLKSAVSAMENFYTSGHAITSTLLDSHHLTPQLSRQVV  122

Query  648   RAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvs  469
             RAI+  RREA GLEEENRALM TRI+PL L+FD  V+V ESKLNGF+GFRGVLYAMRNVS
Sbjct  123   RAISRWRREAFGLEEENRALMGTRIQPLSLKFDERVAV-ESKLNGFSGFRGVLYAMRNVS  181

Query  468   sllliillyglvYCWPAESN---HPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             SLLL+ILLYGLV+C P +S         YEGC+ FGS FMIS +RLQQRVA E+   QM 
Sbjct  182   SLLLMILLYGLVFCSPEDSTFCREGDDDYEGCMIFGSPFMISTARLQQRVAAEIG--QMS  239

Query  297   GGHGVLLYEFKRSKAAMdelrgelersgggd------edGIREKIESLKACFGVLRSGTE  136
                G+L++EF+RSKAAM+ELRGELE   G        E GIRE++E L+ CFG L SG+E
Sbjct  240   ERPGILVWEFRRSKAAMEELRGELEERRGSQGGVMDWESGIRERVEHLRECFGGLTSGSE  299

Query  135   NIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             NI+ QLDD FDEIVEGRKKLLDFCS HR
Sbjct  300   NIVSQLDDLFDEIVEGRKKLLDFCS-HR  326



>emb|CBI23760.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   395 bits (1014),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 219/324 (68%), Positives = 264/324 (81%), Gaps = 6/324 (2%)
 Frame = -3

Query  1017  MAMDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQK  838
             M    S+T SVNGFY+ LTRG+DDL+  F S NFMSIQFLQR L+ LRSFHSHL +LVQK
Sbjct  1     MGNPSSTTTSVNGFYTILTRGLDDLDRSFASHNFMSIQFLQRVLSSLRSFHSHLNILVQK  60

Query  837   LHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSR  658
             LHLPVGEKWLDEYMDESS+LWE CHVLKSG+S MENYYSAG N+ SSLD ++ LNPQ+SR
Sbjct  61    LHLPVGEKWLDEYMDESSRLWEACHVLKSGISAMENYYSAGTNIVSSLDGYYSLNPQISR  120

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             QV+RAI GCRRE +GLEEEN+ LMETRI+ L LRFD  +SV+   +NGFNGFRGVL+AMR
Sbjct  121   QVIRAIIGCRREIVGLEEENKNLMETRIQALSLRFDENISVESKFINGFNGFRGVLHAMR  180

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             NVSSLLL+ILL GLVYCWP +S+     ++G   FGS+FM+S SRLQQRVA E+N  ++ 
Sbjct  181   NVSSLLLMILLGGLVYCWP-KSSFCQGGHDGQAVFGSSFMVSTSRLQQRVAAELN--RID  237

Query  297   GGHGVLLYEFKRSKAAMdelrgelersgggd--edGIREKIESLKACFGVLRSGTENIIG  124
             G  G+LLYEF+++KAA +EL+ +LER+   +     I++K+ESLK+ FGVLR GTE+I+G
Sbjct  238   GQPGILLYEFRKAKAATEELKVQLERALEYEGGGGEIQDKVESLKSWFGVLRCGTESIVG  297

Query  123   QLDDFFDEIVEGRKKLLDFCSTHR  52
             QLDDFFDEIVEGRKKLLD C THR
Sbjct  298   QLDDFFDEIVEGRKKLLDMC-THR  320



>ref|XP_002268252.2| PREDICTED: uncharacterized protein LOC100266907 [Vitis vinifera]
Length=321

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 221/325 (68%), Positives = 266/325 (82%), Gaps = 7/325 (2%)
 Frame = -3

Query  1017  MAMDPSSTN-SVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQ  841
             M  +PSST  SVNGFY+ LTRG+DDL+  F S NFMSIQFLQR L+ LRSFHSHL +LVQ
Sbjct  1     MMGNPSSTTTSVNGFYTILTRGLDDLDRSFASHNFMSIQFLQRVLSSLRSFHSHLNILVQ  60

Query  840   KLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLS  661
             KLHLPVGEKWLDEYMDESS+LWE CHVLKSG+S MENYYSAG N+ SSLD ++ LNPQ+S
Sbjct  61    KLHLPVGEKWLDEYMDESSRLWEACHVLKSGISAMENYYSAGTNIVSSLDGYYSLNPQIS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAM  481
             RQV+RAI GCRRE +GLEEEN+ LMETRI+ L LRFD  +SV+   +NGFNGFRGVL+AM
Sbjct  121   RQVIRAIIGCRREIVGLEEENKNLMETRIQALSLRFDENISVESKFINGFNGFRGVLHAM  180

Query  480   RNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQM  301
             RNVSSLLL+ILL GLVYCWP +S+     ++G   FGS+FM+S SRLQQRVA E+N  ++
Sbjct  181   RNVSSLLLMILLGGLVYCWP-KSSFCQGGHDGQAVFGSSFMVSTSRLQQRVAAELN--RI  237

Query  300   GGGHGVLLYEFKRSKAAMdelrgelersgggd--edGIREKIESLKACFGVLRSGTENII  127
              G  G+LLYEF+++KAA +EL+ +LER+   +     I++K+ESLK+ FGVLR GTE+I+
Sbjct  238   DGQPGILLYEFRKAKAATEELKVQLERALEYEGGGGEIQDKVESLKSWFGVLRCGTESIV  297

Query  126   GQLDDFFDEIVEGRKKLLDFCSTHR  52
             GQLDDFFDEIVEGRKKLLD C THR
Sbjct  298   GQLDDFFDEIVEGRKKLLDMC-THR  321



>ref|XP_002529532.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32835.1| conserved hypothetical protein [Ricinus communis]
Length=319

 Score =   380 bits (976),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 254/323 (79%), Gaps = 7/323 (2%)
 Frame = -3

Query  1011  MDPS--STNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQK  838
             MDPS  +T SVNGFYSFLTRG+DDL+  FLS NFMSIQFLQ  L+ L+SFHS L +LVQ+
Sbjct  1     MDPSCTTTTSVNGFYSFLTRGLDDLDRCFLSNNFMSIQFLQSVLSSLQSFHSQLTILVQR  60

Query  837   LHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSR  658
             LHLP+GEKWLDEYMDESS+LWE C ++KSGVSGMEN YS+G N+ SSLD  H+LN Q+ R
Sbjct  61    LHLPIGEKWLDEYMDESSRLWEACVIMKSGVSGMENIYSSGANIASSLDGFHNLNAQVVR  120

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             QV+RAI GC+RE + LEE+N++LMETR   L L+FD  VS+ ESK N FNGFRGVLYAMR
Sbjct  121   QVIRAIMGCQREILVLEEDNKSLMETRARALSLQFDENVSI-ESKFNAFNGFRGVLYAMR  179

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             NVSSLLL+IL  GLVYCWP  S      Y G + FGS+FM+S++RLQ+RVA EM+  Q+G
Sbjct  180   NVSSLLLMILFGGLVYCWPETSFCQGGGYGGHVIFGSSFMVSMARLQERVANEMD--QIG  237

Query  297   GGHGVLLYEFKRSKAAMdelrg-elersgggdedGIREKIESLKACFGVLRSGTENIIGQ  121
             G  G++LYEF+++K AM+EL+           E  I++K+++LK+CFG+LR G E IIGQ
Sbjct  238   GQPGIMLYEFRQAKIAMEELKVDMESVMEYESELEIQDKVDNLKSCFGLLRCGVETIIGQ  297

Query  120   LDDFFDEIVEGRKKLLDFCSTHR  52
             LDDFFDEIVEGRKKLLD C THR
Sbjct  298   LDDFFDEIVEGRKKLLDMC-THR  319



>ref|XP_009344258.1| PREDICTED: uncharacterized protein LOC103936140 [Pyrus x bretschneideri]
Length=306

 Score =   379 bits (973),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 227/331 (69%), Positives = 257/331 (78%), Gaps = 36/331 (11%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGIDDLE VFLS NFMSIQFLQR                    
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDDLERVFLSNNFMSIQFLQR--------------------  40

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
              PVG+KWLDEYMDESSKLWE CHVLKS VS MENYY++G N+TS+LDSH HL PQLSRQV
Sbjct  41    -PVGDKWLDEYMDESSKLWEACHVLKSAVSAMENYYTSGLNITSTLDSHRHLTPQLSRQV  99

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI+GCRR+A GLEEENR LMETRI+PL L+FD  VS+ ESKLNGFNGFRGVLYAMRNV
Sbjct  100   VRAISGCRRQAFGLEEENRGLMETRIQPLSLKFDERVSI-ESKLNGFNGFRGVLYAMRNV  158

Query  471   ssllliillyglvYCWP-AESNHPPSSY-EGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             SSLLLIILLYGLV+CWP  ES+     Y EGC+ FGS+FM+S +RLQQRVA E+  RQ+ 
Sbjct  159   SSLLLIILLYGLVFCWPEEESSFCRGGYNEGCVIFGSSFMVSTARLQQRVAAEI--RQIR  216

Query  297   GGHGVLLYEFKRSKAAMdel---------rgelersgggdedGIREKIESLKACFGVLRS  145
                GVL++EF+RSKAAM+EL         +G  E+   G   GIRE +++L+ CFGVLRS
Sbjct  217   ERPGVLMWEFRRSKAAMEELRGDLERRGPQGGAEQEEEGGGGGIREGVDNLRECFGVLRS  276

Query  144   GTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             G ENI+ QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  277   GAENIVNQLDDFFDEIVEGRKKLLDFCS-HR  306



>gb|KDP38841.1| hypothetical protein JCGZ_04998 [Jatropha curcas]
Length=323

 Score =   374 bits (960),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 213/328 (65%), Positives = 261/328 (80%), Gaps = 13/328 (4%)
 Frame = -3

Query  1011  MDPS-------STNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLI  853
             MDPS       ST +VNGF +FLTRG+DDL+  FLS NFMSIQFLQ+ L+ L+SFHS L 
Sbjct  1     MDPSCTTTTTNSTTTVNGFCNFLTRGLDDLDRCFLSNNFMSIQFLQKVLSSLQSFHSQLT  60

Query  852   LLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLN  673
             LLVQ+LHLP+G+KWLDEYMDESS+LWE C +LKSGVSGMENYYS+G N+ SSLD  H LN
Sbjct  61    LLVQRLHLPIGDKWLDEYMDESSRLWEACLILKSGVSGMENYYSSGSNIASSLDGFHLLN  120

Query  672   PQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGV  493
              Q+SRQV RAI GC+RE + LEE+N++LMETR+  L L+FD  VSV ESKLN +NGFRGV
Sbjct  121   AQVSRQVYRAIMGCQREILVLEEDNKSLMETRVRALSLQFDENVSV-ESKLNAYNGFRGV  179

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMN  313
             LYAMRNVSSLLL+IL  GLVYCWP E++     YEG + FGS+FM+S++RLQ+RVA EM+
Sbjct  180   LYAMRNVSSLLLMILFGGLVYCWP-ETSFCQGGYEGHVIFGSSFMVSMARLQERVANEMD  238

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrgelersgg-gdedGIREKIESLKACFGVLRSGTE  136
               Q+GG  G++LYEF+++K +M+EL+ ELE       E  I++K+++LK CFG+LR G E
Sbjct  239   --QIGGQPGIMLYEFRQAKISMEELKVELESIMEYESEVEIQDKVDNLKGCFGLLRCGVE  296

Query  135   NIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              IIGQLDDFFDEIVEGRKKLLD C THR
Sbjct  297   TIIGQLDDFFDEIVEGRKKLLDMC-THR  323



>ref|XP_009771661.1| PREDICTED: uncharacterized protein LOC104222167 [Nicotiana sylvestris]
Length=323

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 208/326 (64%), Positives = 253/326 (78%), Gaps = 7/326 (2%)
 Frame = -3

Query  1017  MAMDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQK  838
             M    SST SVNGFY+FLTRG+D+L+ +FLS NFMS  FLQ  L+ LRSFHS L  LVQK
Sbjct  1     MMNHSSSTTSVNGFYNFLTRGLDNLDHLFLSQNFMSFHFLQHVLSSLRSFHSQLTFLVQK  60

Query  837   LHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSR  658
             LHLPVGEKWLDEYMDESS+LWE CHVLKS +S MENYY++G NL SSLD H+ LNP LSR
Sbjct  61    LHLPVGEKWLDEYMDESSRLWEACHVLKSAISSMENYYTSGANLASSLDDHNILNPLLSR  120

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             QV+RAI  C+RE + LEEEN++LMETR++ L LRFD  + +  SK NGF+GFRGVLYAM+
Sbjct  121   QVIRAINRCQRETVALEEENKSLMETRMQDLSLRFDENIMIG-SKFNGFSGFRGVLYAMK  179

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             NVSSLLL IL+ GLVYCWP  S +  + +EG + FGS+FM+S SRL QRV  E+NQ + G
Sbjct  180   NVSSLLLAILVSGLVYCWPQTSFYQGNGHEGNMVFGSSFMVSTSRLHQRVVAEVNQAE-G  238

Query  297   GGHGVLLYEFKRSKAAMdelrgelersg----ggdedGIREKIESLKACFGVLRSGTENI  130
                G+LL+E++R++ AM EL+ ELER+        +  I +KIE+LK CFG+L+ G E+I
Sbjct  239   QLPGILLFEYRRARVAMAELKVELERAKECGLVLTQIDIHDKIENLKDCFGMLKCGAESI  298

Query  129   IGQLDDFFDEIVEGRKKLLDFCSTHR  52
             IGQLDDFFDEIVEGRKKLLD C THR
Sbjct  299   IGQLDDFFDEIVEGRKKLLDMC-THR  323



>ref|XP_004230482.1| PREDICTED: uncharacterized protein LOC101250842 [Solanum lycopersicum]
Length=323

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 206/316 (65%), Positives = 249/316 (79%), Gaps = 7/316 (2%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            VNGFY+FLTRG+D+L+ +FLS NFMS  FLQ  L+ LRSFHS L LLVQKLHLPVGEKWL
Sbjct  11   VNGFYNFLTRGLDNLDHLFLSQNFMSFHFLQHVLSSLRSFHSQLTLLVQKLHLPVGEKWL  70

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCR  628
            DEYMDESS+LWE CHVLKS ++ MENYY+AG N  SSLD HH LNP LSRQV+RAI  C+
Sbjct  71   DEYMDESSRLWEACHVLKSAITSMENYYTAGANFASSLDDHHILNPLLSRQVIRAINRCQ  130

Query  627  REAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliil  448
            RE +GLEEEN++LMETR++ L L FD  V +  SK NGF+GFRGVLYAM+NVSSLLL+IL
Sbjct  131  REIVGLEEENKSLMETRMQDLSLNFDENVLIG-SKFNGFSGFRGVLYAMKNVSSLLLVIL  189

Query  447  lyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEF  268
            + GLVYCWP  S +   S EG + FGS+FM+S SRL QRVA E+NQ + G   G+LL+E+
Sbjct  190  VSGLVYCWPQTSFYQSGSNEGNMVFGSSFMVSTSRLYQRVAAEVNQAE-GQLPGILLFEY  248

Query  267  KRSKAAMdelrgelers----gggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDE  100
            +R++ AM EL+ E+ER+        +  I +KIE+LK CFG+L+ G E+IIGQLDDFFDE
Sbjct  249  RRARVAMAELKIEVERAKECGVVLSQVDIHDKIENLKDCFGMLKCGAESIIGQLDDFFDE  308

Query  99   IVEGRKKLLDFCSTHR  52
            IVEGRKKLLD C THR
Sbjct  309  IVEGRKKLLDLC-THR  323



>ref|XP_006349366.1| PREDICTED: uncharacterized protein LOC102603732 [Solanum tuberosum]
Length=323

 Score =   369 bits (948),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 208/316 (66%), Positives = 250/316 (79%), Gaps = 7/316 (2%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            VNGFY+FLTRG+D+L+ +FLS NFMS  FLQ  L+ LRSFHS L LLVQKLHLPVGEKWL
Sbjct  11   VNGFYNFLTRGLDNLDHLFLSQNFMSFHFLQHVLSSLRSFHSQLTLLVQKLHLPVGEKWL  70

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCR  628
            DEYMDESS+LWE CHVLKS ++ MENYY+AG N  SSLD HH LNP LSRQV+RAI  C+
Sbjct  71   DEYMDESSRLWEACHVLKSAITSMENYYTAGANFASSLDDHHILNPLLSRQVIRAINRCQ  130

Query  627  REAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliil  448
            RE +GLEEEN++LMETR++ L L FD  V +  SK NGF+GFRGVLYAM+NVSSLLL+IL
Sbjct  131  REIVGLEEENKSLMETRMQDLSLNFDENVLIG-SKFNGFSGFRGVLYAMKNVSSLLLVIL  189

Query  447  lyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEF  268
            L GLVYCWP  S +   S+EG + FGS+FM+S SRL QRVA E+NQ + G   G+LL+E+
Sbjct  190  LSGLVYCWPQTSFYQNGSHEGNMVFGSSFMVSTSRLYQRVAAEVNQAE-GQLPGILLFEY  248

Query  267  KRSKAAMdelrgelersg----ggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDE  100
            +R++ AM EL+ ELER+        +  I +KIE+LK CFG+L+ G E+IIGQLDDFFDE
Sbjct  249  RRARVAMAELKIELERAKECGVVLSQVDIHDKIENLKDCFGMLKCGAESIIGQLDDFFDE  308

Query  99   IVEGRKKLLDFCSTHR  52
            IVEGRKKLLD C THR
Sbjct  309  IVEGRKKLLDLC-THR  323



>ref|XP_007042253.1| Uncharacterized protein TCM_006929 [Theobroma cacao]
 gb|EOX98084.1| Uncharacterized protein TCM_006929 [Theobroma cacao]
Length=372

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 255/319 (80%), Gaps = 6/319 (2%)
 Frame = -3

Query  1011  MDPS-STNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKL  835
             MDPS +T+SVNGFY+ LTRG+++L+C FLS NFMSIQFLQ+ L+ LRSFHS L +LVQKL
Sbjct  1     MDPSCTTSSVNGFYNLLTRGLEELDCSFLSCNFMSIQFLQKVLSSLRSFHSQLTVLVQKL  60

Query  834   HLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQ  655
             HLPVGEKWLDEYMDESS+LWE C VLKSG+SGME+YYS+G N+ SSLD H H NPQ SRQ
Sbjct  61    HLPVGEKWLDEYMDESSRLWEACLVLKSGISGMESYYSSGGNIASSLDHHPHFNPQFSRQ  120

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
             V+RAI GC+RE +GLEEENR LM TR   + LRFD  V + ESKLNGFNGFRGVLYAMRN
Sbjct  121   VIRAIIGCQREIVGLEEENRNLMVTRARQVALRFDENVPI-ESKLNGFNGFRGVLYAMRN  179

Query  474   vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
             VSSLLL+ILL GLVY  P E +     +EG + FGSAFM+SI+RL QRV+ EM   Q+GG
Sbjct  180   VSSLLLMILLSGLVYYCP-ELSFVNREHEGNVIFGSAFMVSIARLHQRVSNEM--EQIGG  236

Query  294   GHGVLLYEFKRSKAAMdelrgelersggg-dedGIREKIESLKACFGVLRSGTENIIGQL  118
               G++LYEF+ ++ A++E+R ELER      E  I +KI +LK+CFG+LR G E IIGQ+
Sbjct  237   QPGIMLYEFREARIAVEEVREELERIVKYGSEVEIEDKINNLKSCFGLLRCGVETIIGQI  296

Query  117   DDFFDEIVEGRKKLLDFCS  61
             DDFFDEIVEGRKKLLD C+
Sbjct  297   DDFFDEIVEGRKKLLDMCT  315



>ref|XP_009603248.1| PREDICTED: uncharacterized protein LOC104098263 [Nicotiana tomentosiformis]
Length=322

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 251/322 (78%), Gaps = 7/322 (2%)
 Frame = -3

Query  1005  PSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLP  826
              SST SVNGFY+FLTRG+D+L+ +FLS NFMS  FLQ  L+ LRSFHS L  LVQKLHLP
Sbjct  4     SSSTTSVNGFYNFLTRGLDNLDHLFLSQNFMSFHFLQHVLSTLRSFHSQLTFLVQKLHLP  63

Query  825   VGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMR  646
             VGEKWLDEYMDESS+LWE CHVLKS +S MENYY++G NL SS D H+ LNP LSRQV+R
Sbjct  64    VGEKWLDEYMDESSRLWEACHVLKSAISSMENYYTSGANLASSFDDHNILNPLLSRQVIR  123

Query  645   AITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvss  466
             AI  C+RE + LEEEN++LMETR++ L LRFD  + +  SK NGF+GFRGVLYAM+NVSS
Sbjct  124   AINRCQREIVALEEENKSLMETRMQDLSLRFDENIMIG-SKFNGFSGFRGVLYAMKNVSS  182

Query  465   llliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHG  286
             LLL IL+ GLVY WP  S +  + +EG + FGS+FM+S SRL QRV  E+NQ + G   G
Sbjct  183   LLLAILVSGLVYFWPGTSFYQGNGHEGNMVFGSSFMVSTSRLHQRVVAEVNQAE-GQLPG  241

Query  285   VLLYEFKRSKAAMdelrgelersg----ggdedGIREKIESLKACFGVLRSGTENIIGQL  118
             +LL+E++R++ AM EL+ ELER+        +  I++KIE+LK CFG+L+ G E+IIGQL
Sbjct  242   ILLFEYQRARVAMAELKMELERAKECGLVLTQIDIQDKIENLKDCFGMLKCGAESIIGQL  301

Query  117   DDFFDEIVEGRKKLLDFCSTHR  52
             DDFFDEIVEGRKKLLD C THR
Sbjct  302   DDFFDEIVEGRKKLLDMC-THR  322



>ref|XP_010064988.1| PREDICTED: uncharacterized protein LOC104452178 [Eucalyptus grandis]
Length=397

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 230/408 (56%), Positives = 279/408 (68%), Gaps = 40/408 (10%)
 Frame = -3

Query  1200  LPIILSPP*ETSIIAPNNPFHNLYRNLSF*EIFIPSFSLFNLKFP-FSLN-TPNSLNFFL  1027
             L IILSPP ET IIAPN+PF +L           PS SL     P F+ N TP S + +L
Sbjct  5     LGIILSPPWETPIIAPNHPFQSLQ---------TPSLSLSLSLDPLFAFNSTPQSRSLYL  55

Query  1026  TSPMAMDPSSTNSVNGFYSFLTRGIDDLECVFLSTN------------FMSIQFLQRALA  883
               P  MDPSST+SVNGFY+FLTRGIDDLE  +L+++             +SIQFLQRALA
Sbjct  56    F-PCRMDPSSTSSVNGFYTFLTRGIDDLERSYLASSNGGGGGGGGGGGAVSIQFLQRALA  114

Query  882   LLRSFHSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLT  703
             LLRSFHS L LLVQKLHLPVG+KWLDEYMDESSKLW+ CH+LKSGVS +E++YS+  ++ 
Sbjct  115   LLRSFHSGLTLLVQKLHLPVGDKWLDEYMDESSKLWDACHLLKSGVSALESFYSSALDIV  174

Query  702   SSLDSHHHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLC-LRFD--GVVSVK  532
             +SLD H HL+PQLSRQ+ RAI  C REA GLEEENRAL+E R+  L  LRFD     +  
Sbjct  175   ASLDLHRHLSPQLSRQLARAIAACGREAAGLEEENRALVEARMGQLSRLRFDDCAAAAAV  234

Query  531   ESKLNGFNGFRGVLYAMRNvssllliillyglvYCWPAES--------NHPPSSYEGCLF  376
             E +LNGFNGFRGVLYAMRNVSSLLL +LL GLVY  P +S                 C  
Sbjct  235   EPRLNGFNGFRGVLYAMRNVSSLLLTVLLSGLVYHCPEQSFFSARPYGGGGGEYERPCTL  294

Query  375   FGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedG  196
             FGS  MIS +RL+QR+ EEMN+R  G    +++ E++R++A M+E+RG LE  G      
Sbjct  295   FGSGIMISAARLEQRIGEEMNRRGSGRRAMIMVEEYRRARAGMEEIRGCLEGGGAAAA--  352

Query  195   IREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
                ++E ++ C G LR G E ++GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  353   --ARVEEVRGCLGALRDGVEGVVGQLDDFFDEIVEGRKKLLDFCS-HR  397



>ref|XP_003543779.1| PREDICTED: uncharacterized protein LOC100805100 [Glycine max]
Length=313

 Score =   366 bits (939),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 208/325 (64%), Positives = 253/325 (78%), Gaps = 17/325 (5%)
 Frame = -3

Query  1011  MDP---SSTNSVNGFYSFLTRGIDDLECVFLSTN-FMSIQFLQRALALLRSFHSHLILLV  844
             MDP   S+TN+VNGFY+F++RG+++LE  FL+ N F+S+QFLQ+ ++LLRS H+ L LLV
Sbjct  1     MDPCPSSNTNTVNGFYTFVSRGMEELERAFLANNNFISVQFLQKVVSLLRSLHTQLTLLV  60

Query  843   QKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQL  664
              KL LP+G+KWLDEYMDE+SKLWE  H+LKS +S  E +YS GFNL SSLDS H   P L
Sbjct  61    HKLQLPLGDKWLDEYMDETSKLWETSHLLKSAISNFEPFYSQGFNLLSSLDSSH---PHL  117

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYA  484
             S Q++RAI+GCRREA+GLEE+NRALMETRI  LCLR D  VSV ESKLNGFNGFRGVLYA
Sbjct  118   SPQIVRAISGCRREALGLEEQNRALMETRIHTLCLRLDERVSV-ESKLNGFNGFRGVLYA  176

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGC-LFFGSAFMISISRLQQRVAEEMNQR  307
             MRNVSS+LL+ILL+GLVYCWP  S      YEG  +F GSA M+S +RL+QRVA EM   
Sbjct  177   MRNVSSMLLMILLHGLVYCWPETSELVAGGYEGGRMFLGSAVMVSAARLRQRVAVEM---  233

Query  306   QMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENII  127
             +   G G+LLYEF+R++ A+     EL       E G+RE++ES++ CFGVLRSG ENI+
Sbjct  234   RGAAGPGILLYEFRRARVAV----EELRGELEEAEGGVRERVESVRVCFGVLRSGAENIV  289

Query  126   GQLDDFFDEIVEGRKKLLDFCSTHR  52
              QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  290   CQLDDFFDEIVEGRKKLLDFCS-HR  313



>ref|XP_010930763.1| PREDICTED: uncharacterized protein LOC105051831 [Elaeis guineensis]
Length=319

 Score =   366 bits (939),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 214/321 (67%), Positives = 254/321 (79%), Gaps = 8/321 (2%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PS+T SVNGFYS L+ G+DDLE  F + NFMS+QFLQRA++LLRSFHS L  LVQKLH
Sbjct  1     MKPSAT-SVNGFYSSLSHGLDDLERCFAANNFMSLQFLQRAVSLLRSFHSQLTHLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSL-DSHHHLNPQLSRQ  655
             LPVGEKWLDEYMDESS+LW+ CHVLK GVS ME  YSAG ++ SSL D   HLNPQLSRQ
Sbjct  60    LPVGEKWLDEYMDESSRLWDACHVLKMGVSNMEKCYSAGADIVSSLEDGCRHLNPQLSRQ  119

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
             V RAI+ CRR A+GLEEENR ++ETR E L LRFD  V V ES+LNGFNGFRGVLYAMR+
Sbjct  120   VTRAISVCRRAAVGLEEENRVVVETRAESLSLRFDEKVPV-ESRLNGFNGFRGVLYAMRS  178

Query  474   vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
             VSS LL++LL+GLV  WP  S++  ++ EG +FFGS FM+S+SRLQQRV  E+   +M  
Sbjct  179   VSSFLLMLLLWGLVCWWPDPSSNAAAAMEGSVFFGSGFMVSMSRLQQRVVGEIE--RMDR  236

Query  294   GHGVLLYEFKRSKAAMdelrgelersgggded---GIREKIESLKACFGVLRSGTENIIG  124
               G+L+YEF+R +A M+ELR ELERS G + +    +RE++ES K  FG+LRSGTENI G
Sbjct  237   RPGILMYEFRRVRAGMEELREELERSRGCEAEGGGVLRERVESFKLWFGLLRSGTENITG  296

Query  123   QLDDFFDEIVEGRKKLLDFCS  61
             QLDDFFDEIVEGRKKLLD CS
Sbjct  297   QLDDFFDEIVEGRKKLLDICS  317



>ref|XP_008781573.1| PREDICTED: protein BPS1, chloroplastic-like [Phoenix dactylifera]
Length=318

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 211/320 (66%), Positives = 251/320 (78%), Gaps = 7/320 (2%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PSST SVNGFYS L++G+D+LE  F S NFMS+QFLQRA++LLRSFHS L  LVQKLH
Sbjct  1     MKPSST-SVNGFYSSLSQGLDELERCFASNNFMSLQFLQRAVSLLRSFHSQLTHLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSL-DSHHHLNPQLSRQ  655
             LPVGEKWLDEYMDESS+L + CHVLK GV  ME YYS G ++ SSL D   HL+PQ SRQ
Sbjct  60    LPVGEKWLDEYMDESSRLLDACHVLKMGVCSMEKYYSTGADIVSSLEDGCRHLSPQNSRQ  119

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
             VMRAI+ CRR A+GLEEENR ++ETR E L LRFD  V V ES+LNGFNGFRGVLYAMR+
Sbjct  120   VMRAISVCRRAAVGLEEENRVVVETRAESLSLRFDEKVPV-ESRLNGFNGFRGVLYAMRS  178

Query  474   vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
             VSS LL++LL+GLV  WP  S+   ++ EG LFFGS FM+S++RLQQRV  E+   +M  
Sbjct  179   VSSFLLMLLLWGLVCWWPDRSSDASAAIEGSLFFGSGFMVSMARLQQRVVGEIE--RMDR  236

Query  294   GHGVLLYEFKRSKAAMdelrgelersg--ggdedGIREKIESLKACFGVLRSGTENIIGQ  121
               G+L+YEF+R +A M++LR ELERS     +  G+RE++ES K  FG+LRSGTENI GQ
Sbjct  237   RPGILMYEFRRVRAGMEDLREELERSRGCEAEGGGLRERVESFKLWFGLLRSGTENITGQ  296

Query  120   LDDFFDEIVEGRKKLLDFCS  61
             LDDFFDEIVEGRKKLLD CS
Sbjct  297   LDDFFDEIVEGRKKLLDICS  316



>ref|XP_003614891.1| hypothetical protein MTR_5g060880 [Medicago truncatula]
 gb|AES97849.1| hypothetical protein MTR_5g060880 [Medicago truncatula]
Length=403

 Score =   362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 206/313 (66%), Positives = 248/313 (79%), Gaps = 12/313 (4%)
 Frame = -3

Query  981  GFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLDE  802
            GFY+FL RGIDDLE  FLS N MSIQFLQR L++LRSFH+ L+LLVQKLHLPVG+KWLDE
Sbjct  19   GFYTFLNRGIDDLERAFLSNNLMSIQFLQRVLSILRSFHTQLVLLVQKLHLPVGDKWLDE  78

Query  801  YMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRRE  622
            YMDESSKLWE CH+LKSG+SG + YYSAG N+T+  DSH    PQL RQV+R I+ CRRE
Sbjct  79   YMDESSKLWETCHLLKSGISGFDGYYSAGINVTNFFDSHARFTPQLWRQVLRGISRCRRE  138

Query  621  AMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliilly  442
            AMGLEEENRALMETR++ L L FD  VSV ESKLNGFNGFRGVLYAMRN+SS+LL ILL+
Sbjct  139  AMGLEEENRALMETRVQLLSLCFDERVSV-ESKLNGFNGFRGVLYAMRNISSMLLTILLH  197

Query  441  glvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKR  262
            GLVY  P  S+   + YEG +F GS  M+S +RLQQRVA EM++ +     G+LLYEF+ 
Sbjct  198  GLVYRCPVTSD-TVARYEGWMFHGSGLMMSAARLQQRVAAEMSEAE----PGMLLYEFRH  252

Query  261  SKAAMdelrgelersgggdedG------IREKIESLKACFGVLRSGTENIIGQLDDFFDE  100
            ++A+++ELRGELER+             +RE++E ++ CFGVL+SG +NI+ QLDDFFDE
Sbjct  253  ARASVEELRGELERNVSSQVVQWEMEDGLRERVECVRMCFGVLKSGADNIVSQLDDFFDE  312

Query  99   IVEGRKKLLDFCS  61
            IVEGRKKLLDFCS
Sbjct  313  IVEGRKKLLDFCS  325



>ref|XP_010910922.1| PREDICTED: uncharacterized protein LOC105036897 [Elaeis guineensis]
Length=321

 Score =   358 bits (919),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 210/327 (64%), Positives = 249/327 (76%), Gaps = 13/327 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PS T +  GFYSFLT G+DDL+  F S  FMS+QFLQ A+ LLRS HSHL  LVQKLH
Sbjct  1     MKPSCT-TAGGFYSFLTHGLDDLDRSFSSNAFMSLQFLQHAVTLLRSLHSHLTHLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHH-HLNPQLSRQ  655
             LPVGEKWLDEYMDESS+LW+ CHV+K GVSG+ENY S G ++ SSLD    + +P L+RQ
Sbjct  60    LPVGEKWLDEYMDESSRLWDACHVIKLGVSGIENYCSTGADMVSSLDEWRCNPSPHLTRQ  119

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
             VMRAI+ CRREAMGLEEENR L+ETR+EPL LRFD    + ESKLNGFNGFRGVLYA+RN
Sbjct  120   VMRAISVCRREAMGLEEENRVLVETRVEPLSLRFDDRGPM-ESKLNGFNGFRGVLYALRN  178

Query  474   vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
              SS LL+ILL G V CWP  S H  ++ E  LFFGS +M+S++RLQQRV  EM    M G
Sbjct  179   ASSFLLMILLTGSVSCWPKLSCH-HAAMESSLFFGSGYMVSMARLQQRVMREME--GMNG  235

Query  294   GHGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTEN  133
               G+L+YEF+R++AA +ELR ELER  G          G+RE++E LK  FG+LRSGTE+
Sbjct  236   RSGILMYEFRRARAATEELREELERGEGMGCDSEGIAGGLRERVEGLKGWFGMLRSGTES  295

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             ++GQLDDFFDEIVEGRKKLLD CS HR
Sbjct  296   LVGQLDDFFDEIVEGRKKLLDLCS-HR  321



>ref|XP_006596310.1| PREDICTED: uncharacterized protein LOC100775339 [Glycine max]
Length=304

 Score =   353 bits (906),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 247/324 (76%), Gaps = 24/324 (7%)
 Frame = -3

Query  1011  MDP---SSTNSVNGFYSFLTRGIDDLECVFLSTN-FMSIQFLQRALALLRSFHSHLILLV  844
             MDP   S+TN+VNGFY+F++RG+++LE  FL+ N F+S+QFLQ+ L+LLRS H+ L LLV
Sbjct  1     MDPCPSSNTNTVNGFYTFVSRGMEELERAFLANNSFISLQFLQKVLSLLRSLHTQLTLLV  60

Query  843   QKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQL  664
              KLHLP+G+KWLDEYMDE+SKLWE  H+LKS +S  E +YS GFNL SSLDS H      
Sbjct  61    HKLHLPLGDKWLDEYMDETSKLWETSHLLKSAISNFEPFYSQGFNLLSSLDSSHP-----  115

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYA  484
               QV+RAI+GCRREA+GLEE+NRALMETR+  LCLR D  VSV ESKLNGFNGFRGVLYA
Sbjct  116   --QVVRAISGCRREALGLEEQNRALMETRVHTLCLRLDERVSV-ESKLNGFNGFRGVLYA  172

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
             MRNVSS+LL+ILL+GLVYCWP  S      YEG    G  F+ S +RL+QRVA EM   +
Sbjct  173   MRNVSSMLLMILLHGLVYCWPETSELVSGGYEG----GRMFLGSAARLRQRVAAEM---R  225

Query  303   MGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIG  124
                G G+LLYEF+R++ A+     EL       E G+RE++ES++ CFGVLRSG ENI+ 
Sbjct  226   GAAGPGILLYEFRRARVAV----EELRGELEEAEGGVRERVESVRVCFGVLRSGAENIVC  281

Query  123   QLDDFFDEIVEGRKKLLDFCSTHR  52
             QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  282   QLDDFFDEIVEGRKKLLDFCS-HR  304



>emb|CDO97568.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   353 bits (906),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 196/313 (63%), Positives = 240/313 (77%), Gaps = 6/313 (2%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            VNGFY+FLTRG+D+L+ +FLS NFMS QFLQ+ L+LL+SFHS L  L+QKLHLPVGEKWL
Sbjct  11   VNGFYNFLTRGLDNLDHLFLSQNFMSFQFLQQVLSLLQSFHSQLTFLIQKLHLPVGEKWL  70

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCR  628
            DEYMDESS+LWE CH+LKSGV  MENYYSAG N+ SSLD H  LN QLSRQV RA+TGC+
Sbjct  71   DEYMDESSRLWEACHILKSGVCNMENYYSAGTNIASSLDDHAILNMQLSRQVFRALTGCQ  130

Query  627  REAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliil  448
            RE + LEEEN++LME+R + L LRFD  V + ESK NGF GFRGVLYAMRNVSSLLL+I+
Sbjct  131  REIVALEEENKSLMESRAQHLALRFDENVLI-ESKFNGFTGFRGVLYAMRNVSSLLLLIM  189

Query  447  lyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEF  268
            L GLVY WP  ++     YEG + FGSAFM+S +RL QRVA E+N  Q  G   +LL+EF
Sbjct  190  LSGLVYYWP-HTSLWQGDYEGNMVFGSAFMVSTARLHQRVAAEINHIQ--GQPRILLHEF  246

Query  267  KRSKAAMde-lrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVE  91
            +R++ AMDE       +     E  +++K E+ K CF +L++G E+++ QLDDFFDEIVE
Sbjct  247  QRARIAMDELKEDLERKMMYESEIDVQDKAENFKNCFDMLKAGAESMVAQLDDFFDEIVE  306

Query  90   GRKKLLDFCSTHR  52
            GRKKL D C THR
Sbjct  307  GRKKLSDMC-THR  318



>ref|XP_006431830.1| hypothetical protein CICLE_v10001863mg [Citrus clementina]
 gb|ESR45070.1| hypothetical protein CICLE_v10001863mg [Citrus clementina]
Length=320

 Score =   353 bits (906),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 247/324 (76%), Gaps = 8/324 (2%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS + SVN FY+ L   +DDL   F + NFMSIQFLQ+ L+ L  FHS L +LVQKLH
Sbjct  1     MDPSFS-SVNDFYTLLNHELDDLGHSFNTHNFMSIQFLQKVLSSLCYFHSQLTVLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVGEKWLDEYMDESS+LWE CHVLK+GVS MENYYS+G N+ SS D  HH NPQ+SRQ 
Sbjct  60    LPVGEKWLDEYMDESSRLWEACHVLKTGVSSMENYYSSGANIASSFDGLHHFNPQVSRQA  119

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             +RAI GC+RE + LEEEN++LMETR+  L L+ D    ++ESK N FNGFRGVLYAMRNV
Sbjct  120   IRAIMGCQREIVVLEEENKSLMETRVGQLSLKLDDENIMQESKFNAFNGFRGVLYAMRNV  179

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             S+LLL+ILL GLV+ WP +S+     YEG + FGS FMIS++RLQQRVA E++  Q+GG 
Sbjct  180   STLLLMILLSGLVFYWP-KSSFCQEGYEGHIIFGSGFMISLARLQQRVANEIDH-QIGGQ  237

Query  291   HGVLLYEFKRSKAAMdelrgelersgggde----dGIREKIESLKACFGVLRSGTENIIG  124
              G++L+EF+++K AM++L+ ELE+    +     + I+EKIE LK CFG+LR G E I+G
Sbjct  238   PGLMLFEFRKAKTAMEDLKEELEKVVEFESEEFDEQIQEKIECLKNCFGLLRCGVETIVG  297

Query  123   QLDDFFDEIVEGRKKLLDFCSTHR  52
             Q+DD FDEIVEGRKKLLD C  HR
Sbjct  298   QIDDLFDEIVEGRKKLLDMCG-HR  320



>ref|XP_008799181.1| PREDICTED: uncharacterized protein LOC103713907 [Phoenix dactylifera]
Length=321

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 207/324 (64%), Positives = 244/324 (75%), Gaps = 12/324 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M P ST +VN FYSFLT G+DDL+  F S  FMS+QFLQ A+ALLRS HSHL  LVQKLH
Sbjct  1     MKPYST-TVNSFYSFLTHGLDDLDRSFSSNAFMSLQFLQHAVALLRSLHSHLTHLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHH-HLNPQLSRQ  655
             LPVGEKWLDEYMDESS+L + CHV+K GVSG+ENY SAG  + SSLD    + +P L+RQ
Sbjct  60    LPVGEKWLDEYMDESSRLRDACHVIKLGVSGIENYCSAGAGMVSSLDEWRCNPSPHLTRQ  119

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
             VMRAI+ CRRE MGLEEENR LMETR+EPL LRFD    + ESKL GFNGFRGVLYA RN
Sbjct  120   VMRAISVCRREGMGLEEENRVLMETRVEPLSLRFDDRAPM-ESKLVGFNGFRGVLYAFRN  178

Query  474   vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
              SS LL+ILL+G V CWP  S H  ++ E  LFFGS +M+S++RLQQRV EEM    M G
Sbjct  179   ASSFLLMILLWGSVSCWPEPSCHSAAT-ESSLFFGSGYMVSMARLQQRVVEEME--GMNG  235

Query  294   GHGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTEN  133
               G L+YEF+R++AA +ELR +LER G           G+RE++E LK  FG+LRSG E 
Sbjct  236   RPGTLMYEFRRARAATEELREDLERGGRMGCEPEGIAGGLRERVEGLKGWFGMLRSGIEG  295

Query  132   IIGQLDDFFDEIVEGRKKLLDFCS  61
             ++GQLDDFFD+IVEGRKKLLD CS
Sbjct  296   LVGQLDDFFDDIVEGRKKLLDLCS  319



>ref|XP_003539403.2| PREDICTED: uncharacterized protein LOC100818401 [Glycine max]
 gb|KHN45472.1| hypothetical protein glysoja_038668 [Glycine soja]
Length=313

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 192/316 (61%), Positives = 249/316 (79%), Gaps = 6/316 (2%)
 Frame = -3

Query  999  STNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVG  820
            +  SV+GFY+FLT+G+++L   FLS +FMS QFL + ++ L+SFHS L +LV+KL LPVG
Sbjct  4    TNTSVSGFYNFLTQGLNELHQSFLSHSFMSFQFLSQVISSLQSFHSQLTILVRKLRLPVG  63

Query  819  EKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAI  640
             KWLDEYMDESS+LW+ CHVLKS +SGMENYYSA  N+ SSLD +HH  P+LSRQV+RAI
Sbjct  64   GKWLDEYMDESSRLWDACHVLKSAISGMENYYSAASNIASSLDGYHHFTPELSRQVIRAI  123

Query  639  TGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssll  460
              C+R+ +GLEEEN++LMETRIEPL       +S+ ESKLNGF+GFRGVLYAMR+VSSLL
Sbjct  124  NVCQRDILGLEEENKSLMETRIEPLSQCLIQNISM-ESKLNGFSGFRGVLYAMRSVSSLL  182

Query  459  liillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVL  280
            L+ILL GL YCW +   H    Y+G + FGS FM+S++ LQQ+VAEE++  Q+ G  G+L
Sbjct  183  LMILLNGLAYCWSSCCFHQ--GYDGHMVFGSDFMVSMAILQQKVAEEID--QIEGQPGIL  238

Query  279  LYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDE  100
            L+EF+++K+AM+EL+ ELER        I+EK++++K+CFG+LR G + I GQLDDFFDE
Sbjct  239  LFEFQQAKSAMEELKVELERIASLSYAEIQEKVDNVKSCFGLLRCGVDTITGQLDDFFDE  298

Query  99   IVEGRKKLLDFCSTHR  52
            IVEGRKKLLD CS HR
Sbjct  299  IVEGRKKLLDMCS-HR  313



>ref|XP_002299665.1| hypothetical protein POPTR_0001s21940g [Populus trichocarpa]
 gb|EEE84470.1| hypothetical protein POPTR_0001s21940g [Populus trichocarpa]
Length=330

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 251/334 (75%), Gaps = 16/334 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS   SVNGFY+ LTR +D+L+  FLS NF+SIQFL + L+ L+SF+S +  LVQKLH
Sbjct  1     MDPSCNLSVNGFYNLLTRELDELDQSFLSHNFISIQFLSKVLSSLQSFYSQITTLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHH-HLNPQLSRQ  655
             LPVGEKWLDEYMDESS+LWE CHVLKSGV GMENY+S+G N+TSS+D  H HLN Q+SRQ
Sbjct  61    LPVGEKWLDEYMDESSRLWEACHVLKSGVLGMENYHSSGTNITSSIDGFHPHLNAQVSRQ  120

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG-----VVSVKESKLNGFNGFRGVL  490
             V+RAI GC+RE  GLEE+N++L+ETR+E L L+F+G     V++ + S  N FNGFRGVL
Sbjct  121   VIRAIMGCQREIRGLEEDNKSLIETRVEALSLQFEGNKRNMVMTDQSSWFNSFNGFRGVL  180

Query  489   YAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQ  310
             YAMR V+SLLL+IL  GLVYCWP+         + C   GSAFM S++RLQ+RVA EM Q
Sbjct  181   YAMRIVNSLLLMILFAGLVYCWPSSWQDAA---DQCEEAGSAFMASMARLQRRVASEMEQ  237

Query  309   --RQMGGGHGVLLYEFKRSKAAMdelrgelersgggde----dGIREKIESLKACFGVLR  148
                Q     G++LYEF+++K AM+EL+ ELE +   D+      I++K++ L++CFG+L 
Sbjct  238   IGGQSSASEGIMLYEFRQAKIAMEELKVELESTVVDDQYELEIDIQDKVDRLRSCFGLLA  297

Query  147   SGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR*R  46
              G E+IIGQLDDFFDEIVEGRKKLL  C TH+ R
Sbjct  298   CGVESIIGQLDDFFDEIVEGRKKLLGMC-THQPR  330



>ref|XP_007148522.1| hypothetical protein PHAVU_006G215900g [Phaseolus vulgaris]
 gb|ESW20516.1| hypothetical protein PHAVU_006G215900g [Phaseolus vulgaris]
Length=314

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 246/319 (77%), Gaps = 8/319 (3%)
 Frame = -3

Query  1002  SSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV  823
             ++ +SV GFY+ LT+G+++L   F+S  FMSIQFL +  + L SFHS L LLV+KL LPV
Sbjct  2     ATNSSVTGFYNLLTQGLNELHQSFISPTFMSIQFLSQVFSSLHSFHSQLTLLVRKLRLPV  61

Query  822   GEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRA  643
             G KWLDEYMDESS+LW+ CHVLKS +SGMENYYSA  N+ SSLD +HH  P+LSRQV+RA
Sbjct  62    GGKWLDEYMDESSRLWDACHVLKSAISGMENYYSAASNIASSLDDYHHFTPELSRQVVRA  121

Query  642   ITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssl  463
             I  C+RE +GLEEEN++LMETRIEPL       +S+ ESKLNGF+GFRGVLYAMR+VSSL
Sbjct  122   INVCQREILGLEEENKSLMETRIEPLAQCLIQNISM-ESKLNGFSGFRGVLYAMRSVSSL  180

Query  462   lliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGV  283
             LL+ILL GL YCW +   H    YEG + FGS  M+S++ LQQ+VAE++   Q+ G  G+
Sbjct  181   LLMILLCGLAYCWSSSCFH--QGYEGHMVFGSGLMVSMAMLQQKVAEDI--EQIEGQPGI  236

Query  282   LLYEFKRSKAAMdelrgelersg--ggdedGIREKIESLKACFGVLRSGTENIIGQLDDF  109
             +L+EF+++K+AM+EL+ ELER      +   I+EK++++K+CFG+LR G E I GQLDDF
Sbjct  237   VLFEFQQAKSAMEELKVELERIAGYEEEHAEIQEKVDNVKSCFGLLRCGVETITGQLDDF  296

Query  108   FDEIVEGRKKLLDFCSTHR  52
             FDEIVEGRKKLLD CS HR
Sbjct  297   FDEIVEGRKKLLDMCS-HR  314



>ref|XP_008807663.1| PREDICTED: uncharacterized protein LOC103719952 [Phoenix dactylifera]
Length=315

 Score =   341 bits (874),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 200/319 (63%), Positives = 244/319 (76%), Gaps = 8/319 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PSST SV+GFYS LTRG+DDL+  F S +FMS+QFLQ+A++ LRSFHS LI LV+KLH
Sbjct  1     MKPSST-SVDGFYSSLTRGLDDLDRCFASNSFMSLQFLQQAVSFLRSFHSQLIHLVRKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENY-YSAGFNLTSSL-DSHHHLNPQLSR  658
             LPVGEKWLDEYMDESS+LWE CHVLK+G+S ME+Y YS G +   SL D   HL+PQL+R
Sbjct  60    LPVGEKWLDEYMDESSRLWEACHVLKTGISNMESYCYSTGADTIFSLEDGCRHLHPQLTR  119

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             QVMRAI+ CRREA+ LEEENR L+ETR E L L  D  V V ESKL+GF+GFRG LYAMR
Sbjct  120   QVMRAISVCRREAVRLEEENRVLVETRAESLSLPLDEKVPV-ESKLHGFDGFRGALYAMR  178

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             +V S LL++LL+GLV  W   S++  ++ EG LFFGS FM+S++RLQQRV  E+   +M 
Sbjct  179   SVGSFLLMLLLWGLVCWWQDPSSNGLAAIEGSLFFGSGFMVSMARLQQRVVGEIG--RMD  236

Query  297   GGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQL  118
                G+L+YEF+R +A ++EL        GG   G  E++ESLK  FG+LRSGTENI GQL
Sbjct  237   HRPGILMYEFRRVRAGLEELERSRGCEAGGGGLG--ERVESLKLWFGLLRSGTENITGQL  294

Query  117   DDFFDEIVEGRKKLLDFCS  61
             DDFFDE+VEGRKKLLD CS
Sbjct  295   DDFFDEVVEGRKKLLDICS  313



>ref|XP_011087730.1| PREDICTED: uncharacterized protein LOC105169126 [Sesamum indicum]
Length=318

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 192/311 (62%), Positives = 237/311 (76%), Gaps = 6/311 (2%)
 Frame = -3

Query  981  GFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLDE  802
            GFYSFL + +D+L+ +FLS NFMSI+FLQ  L+ LRSFHS L LLVQKL+LPVGEKWLDE
Sbjct  13   GFYSFLAQELDNLDHLFLSQNFMSIKFLQHVLSSLRSFHSQLTLLVQKLNLPVGEKWLDE  72

Query  801  YMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRRE  622
            YMDESS+LWE CHVLKSGVS MENYYS+G N+ SSLD    LN Q+SRQV+RAI+GC+RE
Sbjct  73   YMDESSRLWEACHVLKSGVSSMENYYSSGANILSSLDDRRVLNSQVSRQVIRAISGCQRE  132

Query  621  AMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliilly  442
             + L+EEN+++ ETR++ LCLRFD  V + ESK N +NGFRGVLYAMR VS+LLL+ILL 
Sbjct  133  MIALQEENKSIAETRVQNLCLRFDDNV-LTESKFNKYNGFRGVLYAMRKVSTLLLVILLS  191

Query  441  glvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKR  262
            GLVY WP E++     YEG    GSAFM+S + L QRV+  MN  ++    G+LL+E ++
Sbjct  192  GLVYFWP-ETSFFQGRYEGDSLSGSAFMVSSATLHQRVSNAMN--RLECQPGILLHELQQ  248

Query  261  SKAAMde-lrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGR  85
            ++ AMDE             E  I +K+E+LK+CFGVL+ G E+IIGQLDDFFDEIVEGR
Sbjct  249  ARTAMDELRTDMESTMEYETEIDIHDKVENLKSCFGVLQCGAESIIGQLDDFFDEIVEGR  308

Query  84   KKLLDFCSTHR  52
            KKLLD CS HR
Sbjct  309  KKLLDMCS-HR  318



>ref|XP_009414883.1| PREDICTED: uncharacterized protein LOC103995880 [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/319 (62%), Positives = 240/319 (75%), Gaps = 6/319 (2%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PSS+ SVNGFY+FL  G+DDLE  F S NFMS+QFL++A+ALLRS H++L  LVQKLH
Sbjct  1     MKPSSS-SVNGFYAFLAHGLDDLESSFESNNFMSLQFLEKAIALLRSVHANLTHLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LP GEKWLDE MDESS+LWE CH LK+G+S ME +Y+AG  + S+LD  H  NPQL+RQV
Sbjct  60    LPAGEKWLDECMDESSRLWEACHALKTGISSMETFYAAGAGMISALDDSHRSNPQLTRQV  119

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             MRAI+ CRR  +GLE ENR ++ETRI PL LRFD  +   ESKLNGFNGF GVL A R+V
Sbjct  120   MRAISVCRRGLVGLEGENRVMVETRIAPLSLRFDEKIPA-ESKLNGFNGFTGVLLASRSV  178

Query  471   ssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGG  292
             S  LL IL++GLV+ WP  S+   ++ EG LF GS FM+S SRLQQRV  E    + GG 
Sbjct  179   SCFLLTILVWGLVHWWPNSSSTTSAAGEGSLFSGSGFMVSTSRLQQRV--EAGVERAGGR  236

Query  291   HGVLLYEFKRSKAAMdelrgelersg--ggdedGIREKIESLKACFGVLRSGTENIIGQL  118
              G+LL+EF+R +A ++ELR ELERSG    +   I+E++ESLK  FG+LR+GTENI  QL
Sbjct  237   PGILLFEFQRVRACLEELREELERSGGHDAESGSIQERVESLKVSFGLLRNGTENIALQL  296

Query  117   DDFFDEIVEGRKKLLDFCS  61
             DDF DEIV GRKKLLD CS
Sbjct  297   DDFLDEIVAGRKKLLDVCS  315



>ref|XP_011009739.1| PREDICTED: uncharacterized protein LOC105114771 [Populus euphratica]
Length=330

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 248/334 (74%), Gaps = 16/334 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS   SVNGFY+ LTR +D+L+  FL  NF+SIQFL + L+ L+SF+S L  LVQKLH
Sbjct  1     MDPSCNLSVNGFYNLLTRELDELDQSFLFHNFISIQFLSKVLSSLQSFYSQLTTLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHH-HLNPQLSRQ  655
             LPVGEKWLDEYMDESS+LWE CHVLKSGV GMENY+S+G N+TSS+D  H HLN Q+SRQ
Sbjct  61    LPVGEKWLDEYMDESSRLWEACHVLKSGVLGMENYHSSGTNITSSVDGFHPHLNAQVSRQ  120

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG-----VVSVKESKLNGFNGFRGVL  490
             V+RAI GC+RE  GLEE+N++L+ETR+E L L+F+G     V++ + S  N FNGFRGVL
Sbjct  121   VIRAIMGCQREIRGLEEDNKSLIETRVEALSLQFEGNKRNMVMTDQSSWFNSFNGFRGVL  180

Query  489   YAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQ  310
             YAM+ V+SLLL+IL  GLVYCWP+         + C   GSAFM S++RLQ+RVA EM Q
Sbjct  181   YAMKIVNSLLLMILFAGLVYCWPSSWQDAA---DQCEEAGSAFMASMARLQRRVASEMEQ  237

Query  309   --RQMGGGHGVLLYEFKRSKAAMdelrgelersgg----gdedGIREKIESLKACFGVLR  148
                Q     G++LYEF+++K AM+EL+ ELE +        E  I++K++ L++CFG L 
Sbjct  238   IGGQSSASEGIMLYEFRQAKIAMEELKVELESTLVDDRYELEIDIQDKVDRLRSCFGFLA  297

Query  147   SGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR*R  46
              G E+IIGQLDDFFDEIVEGRKKLL  C TH+ R
Sbjct  298   CGVESIIGQLDDFFDEIVEGRKKLLGMC-THQPR  330



>ref|XP_010912534.1| PREDICTED: uncharacterized protein LOC105038420 [Elaeis guineensis]
Length=315

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/319 (61%), Positives = 239/319 (75%), Gaps = 8/319 (3%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PSST SV+GF+S LT G+DDL+  F S NFMS+QFLQRA++LLRSFHS LI LVQKLH
Sbjct  1     MKPSST-SVDGFFSSLTHGLDDLDRCFASDNFMSLQFLQRAVSLLRSFHSQLIQLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYY-SAGFNLTSSL-DSHHHLNPQLSR  658
             LPVGEKWLDEYMDESS+L E CHVLK G S ME+YY S G +   SL D   HL+PQL++
Sbjct  60    LPVGEKWLDEYMDESSRLSEACHVLKRGASNMESYYHSTGADTIFSLEDGFRHLHPQLTK  119

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             QVMRA++ C+REA+ +EEENR L+ETRIE L LR D  V V ESKL+GF+GFRG LYAMR
Sbjct  120   QVMRAVSVCQREAVRVEEENRVLVETRIESLSLRLDEKVPV-ESKLHGFDGFRGALYAMR  178

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
              V S L+++LL+GLV  W   S    ++ EG +FFGS FM++++RLQQRV  EM   +M 
Sbjct  179   RVGSFLVMLLLWGLVCWWQYPSPSGVAAIEGSVFFGSGFMVAMARLQQRVVGEME--RMD  236

Query  297   GGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQL  118
                G+L+YEF+R +A +     E  R      +G+RE++E LK  FG+LRSGTENI GQL
Sbjct  237   RRPGILMYEFRRVRAGL--EELERSRGCEDGGEGLRERVEGLKLWFGLLRSGTENITGQL  294

Query  117   DDFFDEIVEGRKKLLDFCS  61
             DDFFDEIVEGRKKLLD CS
Sbjct  295   DDFFDEIVEGRKKLLDICS  313



>ref|XP_008780600.1| PREDICTED: uncharacterized protein LOC103700435, partial [Phoenix 
dactylifera]
Length=305

 Score =   335 bits (859),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 196/309 (63%), Positives = 234/309 (76%), Gaps = 12/309 (4%)
 Frame = -3

Query  957  GIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLDEYMDESSKL  778
            G+DDL+  F S  FMS+QFLQ A  LLRS HSHL  LVQKLHLPVGEKWLDEYMDESS+L
Sbjct  2    GLDDLDRSFSSNAFMSLQFLQHAATLLRSLHSHLTHLVQKLHLPVGEKWLDEYMDESSRL  61

Query  777  WEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSRQVMRAITGCRREAMGLEEE  601
            W+ CHV+K G+SG+ENY SAG ++ SSLD    +  P L+RQVMRAI+ CRREAMGLEEE
Sbjct  62   WDACHVIKLGISGIENYCSAGADMVSSLDEWRRNPTPHLTRQVMRAISVCRREAMGLEEE  121

Query  600  NRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvYCWP  421
            NR L+ETR+EPL LRFD    + ESK+NGFNGFRGVL A+RN SS LL+ILL G V CWP
Sbjct  122  NRVLVETRVEPLSLRFDDRGPM-ESKINGFNGFRGVLNALRNASSFLLVILLTGSVSCWP  180

Query  420  AESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMde  241
              S H  +  E  LFFGS +M+S++RLQQRV  EM    M G  G+L+YEF+R++AA +E
Sbjct  181  KLSCH-HAIIESSLFFGSGYMVSMARLQQRVVREME--GMNGRPGILMYEFQRARAATEE  237

Query  240  lrgeler------sgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKK  79
            LR ELE+         G   G+RE++E LK  FG+LRSGTE+++GQLDDFFDEIVEGRKK
Sbjct  238  LREELEKGGGMGCDSEGVAGGLRERVEGLKGWFGMLRSGTESLVGQLDDFFDEIVEGRKK  297

Query  78   LLDFCSTHR  52
            LLD CS HR
Sbjct  298  LLDLCS-HR  305



>gb|KHN11239.1| hypothetical protein glysoja_023303 [Glycine soja]
Length=322

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 249/324 (77%), Gaps = 12/324 (4%)
 Frame = -3

Query  999  STNSVNGFYSFLTRGIDDLECVFLS-TNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV  823
            S +SV+GFY+ LT+G+++L   FLS ++FMS QFL + ++ L+SFHS L +LV+KL LPV
Sbjct  3    SNSSVSGFYNLLTQGLNELHQSFLSHSSFMSFQFLSQVISSLQSFHSQLTILVRKLWLPV  62

Query  822  GEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRA  643
            G KWLDEYMDESS+LW+ CHVLKS +SGMENYY A  N+ SSLD++H+  PQLSRQV+RA
Sbjct  63   GGKWLDEYMDESSRLWDACHVLKSAISGMENYYLAASNIASSLDAYHYFTPQLSRQVIRA  122

Query  642  ITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssl  463
            I  C+RE +GLEEENR+LMETRIEPL       +S+ ESKLNGF+GFRGVLYAMR+VSSL
Sbjct  123  INVCQREILGLEEENRSLMETRIEPLSQCLIQNISM-ESKLNGFSGFRGVLYAMRSVSSL  181

Query  462  lliillyglvYCWPAESNHPPSSYEGCLFFGS-AFMISISRLQQRVAEEMNQRQMGGGHG  286
            LL+ILL GL YCW +   H    Y+G + FGS  FM+S++ LQQ+VAEE++Q   GG  G
Sbjct  182  LLMILLSGLAYCWSSSCFHQ--GYDGHMVFGSTGFMVSMAILQQKVAEEIDQNIEGGQPG  239

Query  285  VLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTENIIG  124
            +LL+EF+++K AM+EL+ ELER           +  I+EKI ++K+CFG+LR G E I G
Sbjct  240  ILLFEFQKAKNAMEELKLELERIAISCYEEGHADHEIQEKIHNVKSCFGLLRCGVETITG  299

Query  123  QLDDFFDEIVEGRKKLLDFCSTHR  52
            QLDDFFDEIVEGRKKLLD CS HR
Sbjct  300  QLDDFFDEIVEGRKKLLDMCS-HR  322



>ref|XP_003532991.2| PREDICTED: uncharacterized protein LOC100798952 [Glycine max]
Length=323

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 249/324 (77%), Gaps = 12/324 (4%)
 Frame = -3

Query  999  STNSVNGFYSFLTRGIDDLECVFLS-TNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV  823
            S +SV+GFY+ LT+G+++L   FLS ++FMS QFL + ++ L+SFHS L +LV+KL LPV
Sbjct  4    SNSSVSGFYNLLTQGLNELHQSFLSHSSFMSFQFLSQVISSLQSFHSQLTILVRKLWLPV  63

Query  822  GEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRA  643
            G KWLDEYMDESS+LW+ CHVLKS +SGMENYY A  N+ SSLD++H+  PQLSRQV+RA
Sbjct  64   GGKWLDEYMDESSRLWDACHVLKSAISGMENYYLAASNIASSLDAYHYFTPQLSRQVIRA  123

Query  642  ITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssl  463
            I  C+RE +GLEEENR+LMETRIEPL       +S+ ESKLNGF+GFRGVLYAMR+VSSL
Sbjct  124  INVCQREILGLEEENRSLMETRIEPLSQCLIQNISM-ESKLNGFSGFRGVLYAMRSVSSL  182

Query  462  lliillyglvYCWPAESNHPPSSYEGCLFFGS-AFMISISRLQQRVAEEMNQRQMGGGHG  286
            LL+ILL GL YCW +   H    Y+G + FGS  FM+S++ LQQ+VAEE++Q   GG  G
Sbjct  183  LLMILLSGLAYCWSSSCFHQ--GYDGHMVFGSTGFMVSMAILQQKVAEEIDQNIEGGQPG  240

Query  285  VLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTENIIG  124
            +LL+EF+++K AM+EL+ ELER           +  I+EKI ++K+CFG+LR G E I G
Sbjct  241  ILLFEFQKAKNAMEELKLELERIAISCYEEGHADHEIQEKIHNVKSCFGLLRCGVETITG  300

Query  123  QLDDFFDEIVEGRKKLLDFCSTHR  52
            QLDDFFDEIVEGRKKLLD CS HR
Sbjct  301  QLDDFFDEIVEGRKKLLDMCS-HR  323



>ref|XP_010539615.1| PREDICTED: uncharacterized protein LOC104813637 [Tarenaya hassleriana]
Length=318

 Score =   331 bits (849),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 197/327 (60%), Positives = 241/327 (74%), Gaps = 16/327 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R ++DLE V+ S NFMS+ FLQR L LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSVNSVNGFYSFLNRSMEDLERVYHSNNFMSVHFLQRVLCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDE+SKLW+  +V+KS VS MEN+ SAG ++ SSLD H  L+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDETSKLWDAFNVIKSAVSAMENFCSAGISIASSLDGHRRLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS--VKESKL-NGFNGFRGVLYAM  481
              RAI+GC REA GLE+ENRALME RI  L    D   S  ++ SK+ NGF+GFRGVL A 
Sbjct  121   NRAISGCSREAFGLEQENRALMENRIRTLPFWLDQTSSAAMESSKVQNGFSGFRGVLNAT  180

Query  480   RNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQM  301
             RN+SSLLL+IL+YGLVY +P E+  PP    GC   G  F  ++ R+QQRVA E   R+ 
Sbjct  181   RNMSSLLLMILMYGLVYFFPGEATAPPQPAGGC---GGGFAEAMGRVQQRVAGEAGMRK-  236

Query  300   GGGHGVLLYEFKRSKAAMdelrgelersgggdedG----IREKIESLKACFGVLRSGTEN  133
                 G+LLYE++RSKAAM+EL+ E+ER   G        + E++E++K  FG LR+ TE 
Sbjct  237   ----GILLYEYRRSKAAMEELKAEVERRSNGGAAAEERGLSERVENVKGQFGNLRNVTEG  292

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             I+ Q+DDFFDEIVEGR+KLLDFCS HR
Sbjct  293   IVSQIDDFFDEIVEGRRKLLDFCS-HR  318



>ref|XP_010534596.1| PREDICTED: uncharacterized protein LOC104810096 [Tarenaya hassleriana]
Length=322

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 195/329 (59%), Positives = 244/329 (74%), Gaps = 16/329 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M+PSS NSVNGFYSFL R ++DLE    S NFMS+QFLQR L LLR+ HSHL LLVQKL 
Sbjct  1     MEPSSANSVNGFYSFLNRSMEDLERAHQSNNFMSVQFLQRVLCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDE+SKLW+ CHV+KS VS MEN+ SAG ++ SSLD    L+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDETSKLWDACHVIKSAVSAMENFCSAGISIASSLDGQRRLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFD---GVVSVKESKL-NGFNGFRGVLYA  484
             +RAI+G RREA+GLEEENRALME R++ L    D      +++ SK+ NGF+GFRGVLYA
Sbjct  121   IRAISGWRREALGLEEENRALMENRVQTLPFWSDQTSAAATMESSKVQNGFSGFRGVLYA  180

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
              R+++SLLL IL++GLVYC P ++  P S        G     ++ RLQ+RVA E    +
Sbjct  181   TRDMNSLLLTILMHGLVYCIPGDATPPQSPGG--GGGGVGLAAAMGRLQERVAGE----E  234

Query  303   MGGGHGVLLYEFKRSKAAMdelrgelersgggdedG-----IREKIESLKACFGVLRSGT  139
             +G   G+LL E++RSKAAM+EL+ E+ER  GG         +REK+E++K C G LR+GT
Sbjct  235   VGVRKGILLNEYRRSKAAMEELKAEVERRSGGGGGEETERWLREKVENVKGCIGSLRNGT  294

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             E+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  295   ESIVSQIDDFFDEIVEGRKKLLDFCS-HR  322



>ref|XP_010101159.1| hypothetical protein L484_016724 [Morus notabilis]
 gb|EXB87377.1| hypothetical protein L484_016724 [Morus notabilis]
Length=339

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 197/341 (58%), Positives = 249/341 (73%), Gaps = 21/341 (6%)
 Frame = -3

Query  1011  MDPSS--TNSVNGFYSFLTRGIDDLECVFLS-TNFMSIQFLQRALALLRSFHSHLILLVQ  841
             MDP+S  TNSV+GFY+ L+R +++L+  FLS  NFMSIQFLQ+ L+ L+SF+S L LLVQ
Sbjct  1     MDPNSCTTNSVSGFYNLLSRELNNLDQNFLSHNNFMSIQFLQQVLSSLQSFNSQLTLLVQ  60

Query  840   KLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLS  661
             KLHLP GEKWLDEYMDESS+LWE C VLKSGVS +EN+ ++  N+ SSLD++HHLNP +S
Sbjct  61    KLHLPTGEKWLDEYMDESSRLWEACQVLKSGVSAVENFIASATNIVSSLDNYHHLNPVMS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKESKLNGFNGFRGVLY  487
             RQV+RAI+ C+RE +GLEE+NR LMETRI+   LC   + +    +SK NGF+GFRGVL+
Sbjct  121   RQVIRAISICQRETVGLEEDNRVLMETRIQQLSLCDDLNWIDVPMDSKFNGFSGFRGVLH  180

Query  486   AMRNvssllliillyglvYCWPAES--NHPPSSYEGCLFFGSA-FMISISRLQQRVAEEM  316
             AMR VSS LL+IL  GLV+C P  S  N    +YE     GSA FM+S++RL+QRVA EM
Sbjct  181   AMRKVSSFLLLILFNGLVFCLPESSSFNDQGDNYEANAILGSAGFMVSMARLRQRVANEM  240

Query  315   NQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedG-----------IREKIESLK  169
                Q  G  G+LLYEF+ SK  M+EL+  LER    +E+            ++ +IE L+
Sbjct  241   --EQFYGQSGILLYEFRGSKTTMEELKVVLERMAEFEEESNDDDHNINNDDLQYQIEKLR  298

Query  168   ACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR*R  46
             + FG+LRSG E IIGQLDDFFDEIVEGRKKLLD CS+H  R
Sbjct  299   SGFGLLRSGVETIIGQLDDFFDEIVEGRKKLLDMCSSHSHR  339



>ref|XP_008218945.1| PREDICTED: uncharacterized protein LOC103319200 [Prunus mume]
Length=322

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 240/324 (74%), Gaps = 6/324 (2%)
 Frame = -3

Query  1011  MDPSSTN-SVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKL  835
             MDPS T+ SV+GFY+FLT  +++L+  FLS +FMSIQFLQ+ L+ L+SFHS L  LVQKL
Sbjct  1     MDPSCTSTSVSGFYNFLTHELNNLDQSFLSHSFMSIQFLQKVLSSLKSFHSQLTTLVQKL  60

Query  834   HLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSR  658
             HLP+GEKWLDEYMDESS+LWE C+VLK GVS MEN ++AG N+ SS D  H+HLN Q S 
Sbjct  61    HLPIGEKWLDEYMDESSRLWEACNVLKLGVSCMENVFAAGANVLSSTDEFHYHLNEQTSN  120

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             QV+RA++  + E +GLE +N+ALMETRIE L LR +  +    SK NGF+GFRGV+YAMR
Sbjct  121   QVIRAVSAYQMEIIGLEHDNKALMETRIEQLSLRINENIISMGSKFNGFSGFRGVMYAMR  180

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             NVSSLLL+ILL G+VY  P  S       EG + FGS FM+S++RLQ+RVA    Q   G
Sbjct  181   NVSSLLLMILLSGIVYYLPGSSFQKEGGLEGSVIFGSNFMVSVARLQRRVANVFEQIP-G  239

Query  297   GGHGVLLYEFKRSKAAMdel--rgelersgggdedGIREKIESLKACFGVLRSGTENIIG  124
               HG+LL+EF+ +K+AM+E+    E       +   I+++++ LK+CFG+LRSG E II 
Sbjct  240   PPHGLLLHEFQETKSAMEEVRGELERMVEHEAEIHDIQDRVDKLKSCFGLLRSGVEAIIE  299

Query  123   QLDDFFDEIVEGRKKLLDFCSTHR  52
             QLDDFFDEIVEGRKKLLD C THR
Sbjct  300   QLDDFFDEIVEGRKKLLDMC-THR  322



>ref|XP_010477455.1| PREDICTED: uncharacterized protein LOC104756547 [Camelina sativa]
Length=335

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 249/338 (74%), Gaps = 21/338 (6%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R ++DLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSANSVNGFYSFLNRSMEDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD HHH   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSVENFSSAGISIASTLDGHHHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKES-KL-NGFNGFRGV  493
             RQV+RAI+GCRREA+G+EEENRALME R++  P         +++ S KL NGF+GFRGV
Sbjct  121   RQVIRAISGCRREAIGIEEENRALMENRVQRFPFWSEQTSATAIESSTKLQNGFSGFRGV  180

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMN  313
             LYA R++SSLLL++L+ GLVYC+P ++     +          F  ++ RLQQRVA E+ 
Sbjct  181   LYATRSMSSLLLMVLMNGLVYCFPGDATTQTQTQIITQSQAGGFAGAMGRLQQRVAAEVG  240

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrge-----------lersgggdedGIREKIESLKA  166
               +MG   G+L++E++RSKAA++EL+ E            E     + + +RE++E+LK 
Sbjct  241   --RMGMRKGILMHEYRRSKAALEELKAELERRFCGGGGEREEGEEEERELLRERVENLKG  298

Query  165   CFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              FG LR+GTE+I+ Q+DDFF+EIVEGRKKLLDFCS HR
Sbjct  299   YFGNLRNGTESIVAQIDDFFEEIVEGRKKLLDFCS-HR  335



>emb|CDY41498.1| BnaA08g21000D [Brassica napus]
Length=328

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 251/332 (76%), Gaps = 16/332 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS  SVNG+YSFL R +DDLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSATSVNGYYSFLNRSMDDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+K+ VS +E++ SAG ++ S+LD H+H   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKTAVSSVESFSSAGISIASTLDGHYHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKES-KL-NGFNGFRGVLY  487
             RQV+RAITGCRREA+G+EEENRALME R++      +   +++ S KL NGF+GFRGVLY
Sbjct  121   RQVIRAITGCRREAIGIEEENRALMENRVQRFPFWSEQTAAMESSTKLQNGFSGFRGVLY  180

Query  486   AMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQR  307
             A RN+SSLLL++L++GLVYC+PA++    +  +     G  F+ ++ RLQQRVA E+   
Sbjct  181   ATRNMSSLLLMVLVHGLVYCFPADATLSQTQTQTQNQVG-GFVGAMGRLQQRVAAEVG--  237

Query  306   QMGGGHGVLLYEFKRSKAAMdelrg-------elersgggdedGIREKIESLKACFGVLR  148
             +MG   G+L++E++RSKAA++EL+            S    E  +RE++E+LK CFG LR
Sbjct  238   RMGVRKGMLMHEYRRSKAALEELKAELERRFCGGGESEEEGERELRERVENLKGCFGNLR  297

Query  147   SGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             +GTE+I+ Q+DD FDEIVEGRKKLLDFCS HR
Sbjct  298   NGTESIVAQIDDLFDEIVEGRKKLLDFCS-HR  328



>ref|XP_002304062.1| hypothetical protein POPTR_0003s01260g [Populus trichocarpa]
 gb|EEE79041.1| hypothetical protein POPTR_0003s01260g [Populus trichocarpa]
Length=336

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 194/331 (59%), Positives = 244/331 (74%), Gaps = 12/331 (4%)
 Frame = -3

Query  1017  MAMDPS-STNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQ  841
             M MDP  +   V+GFYS L+R +DDL+  FLS NF+S+QFL + L+ L+SFHS L  LVQ
Sbjct  1     MFMDPPCNLAPVSGFYSMLSRELDDLDQSFLSHNFISVQFLSKVLSSLQSFHSQLTTLVQ  60

Query  840   KLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSH-HHLNPQL  664
             +LHLPVGEKWLDEYMDESS+LWE C VLKSGV  MEN++S+G N+ SSLD + HH N Q+
Sbjct  61    ELHLPVGEKWLDEYMDESSRLWEACLVLKSGVLAMENHHSSGANIASSLDGYRHHSNAQV  120

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG----VVSVKESKLNGFNGFRG  496
             SRQV+RAI GC+RE + LEEEN+ LMETR+E L L+F+G    V+ ++ S  N FNGFRG
Sbjct  121   SRQVIRAIVGCQREVIVLEEENKRLMETRVEALSLKFEGNFNTVLMIESSWFNAFNGFRG  180

Query  495   VLYAMRNvssllliillyglvYCWPAESNHPPS-SYEGCLFFGSAFMISISRLQQRVAEE  319
             VL+AMRNV+SLLL+ILL GLVYCWP       +   E  + FGSA M SI+RLQ+RV   
Sbjct  181   VLHAMRNVNSLLLLILLAGLVYCWPPFWQGAAAFREERQMTFGSALMDSIARLQRRVKNG  240

Query  318   MNQ--RQMGGGHGVLLYEFKRSKAAMdelrgelersggg---dedGIREKIESLKACFGV  154
             M+Q   Q     G++LYEF++++ AM+EL+ ELE  G         I++K++SLK+CFG+
Sbjct  241   MDQIGGQSASSAGIMLYEFRQARIAMEELKAELESGGAVECESGMDIQDKVDSLKSCFGL  300

Query  153   LRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
             LR G E IIGQLDDFFDEIVEGRKKLL  CS
Sbjct  301   LRCGVETIIGQLDDFFDEIVEGRKKLLGMCS  331



>ref|XP_002893207.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69466.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 248/338 (73%), Gaps = 22/338 (7%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R ++DLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSANSVNGFYSFLNRSMEDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD HHH   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSVENFSSAGISIASTLDGHHHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKES-KL-NGFNGFRGV  493
             RQV+RAI+GCRREA+G+EEENRALME R++  P         +++ S KL NGF+GFRGV
Sbjct  121   RQVIRAISGCRREAIGIEEENRALMENRVQRFPFWSEQTSATAMESSTKLQNGFSGFRGV  180

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMN  313
             LYA RN+SSLLL++L+ GLVYC+P ++       +     G  F  ++ RLQQRVA E+ 
Sbjct  181   LYATRNMSSLLLMVLMNGLVYCFPGDAATQTQITQTQSQVG-GFAGAMGRLQQRVAAEVG  239

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrg-----------elersgggdedGIREKIESLKA  166
               +MG   G+L++E++RSKAA++EL+                    +E  +RE++E+LK 
Sbjct  240   --RMGIRKGILMHEYRRSKAALEELKAELERRFCGGGGGGGEREEEEERELRERVENLKG  297

Query  165   CFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              FG LR+GTE+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  298   YFGNLRNGTESIVAQIDDFFDEIVEGRKKLLDFCS-HR  334



>gb|EYU23938.1| hypothetical protein MIMGU_mgv1a012516mg [Erythranthe guttata]
Length=248

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 216/253 (85%), Gaps = 9/253 (4%)
 Frame = -3

Query  798  MDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRREA  619
            MDESSKLW+VCHV+KSGVS +ENYYSAG N+TSSLD H  L PQLSRQ++RAI+GCRREA
Sbjct  1    MDESSKLWDVCHVIKSGVSSLENYYSAGVNITSSLDGHRRLTPQLSRQIIRAISGCRREA  60

Query  618  MGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyg  439
            +GLEEENR+LMETRI+PL L+FD  VSV ESKLNG+ GFRGVLYAMRNVSSLLL+ILLYG
Sbjct  61   VGLEEENRSLMETRIDPLLLKFDDKVSV-ESKLNGYTGFRGVLYAMRNVSSLLLMILLYG  119

Query  438  lvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRS  259
            LVYCWP ESN   +  +GCLFFGSA MIS +RLQQRVA E+N  Q+ GG GVLLYEF+RS
Sbjct  120  LVYCWP-ESNLSINGLDGCLFFGSAIMISTARLQQRVASEIN--QISGGAGVLLYEFRRS  176

Query  258  KAAMdelrgelersgggd----edGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVE  91
            KAAMDELRGELER  G      E GIRE++E+LK CFGV+R+GTENI+GQLDDFFDEIVE
Sbjct  177  KAAMDELRGELERRQGVVEWELEVGIRERVENLKGCFGVIRAGTENIVGQLDDFFDEIVE  236

Query  90   GRKKLLDFCSTHR  52
            GRK L DFC THR
Sbjct  237  GRKMLSDFC-THR  248



>emb|CDY30644.1| BnaAnng04190D [Brassica napus]
Length=332

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 246/340 (72%), Gaps = 28/340 (8%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS +SVNG+YSFL R +DDLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL+
Sbjct  1     MDPSSASSVNGYYSFLNRSMDDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD H+H   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSIENFSSAGISIASTLDGHYHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRF-----DGVVSVKESKL---NGFNG  505
             RQV+RAITGCRREA+G+E ENRALME R++    RF         +V ES     NGF+G
Sbjct  121   RQVIRAITGCRREAIGIEAENRALMENRVQ----RFPFWSEQAAATVMESSTKLQNGFSG  176

Query  504   FRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVA  325
             FRGVLYA RN+SSLLL++L+ GLVYC P+++    +  +      S F  ++ RLQQRVA
Sbjct  177   FRGVLYATRNMSSLLLMVLMNGLVYCVPSDATLSQTQTQTQNQV-SGFAGAMGRLQQRVA  235

Query  324   EEMNQRQMGGGHGVLLYEFKRSKAAMdelrg---------elersgggdedGIREKIESL  172
              E+   + G   G+L++E++RSKAA++EL+                   E  +RE++E+L
Sbjct  236   AEVG--RTGMRKGILMHEYRRSKAALEELKAELERRGGGGGGSEEEEEGERELRERVENL  293

Query  171   KACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             K  FG LR+GTE+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  294   KGYFGNLRNGTESIVSQIDDFFDEIVEGRKKLLDFCS-HR  332



>ref|XP_009384220.1| PREDICTED: uncharacterized protein LOC103971817 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 233/327 (71%), Gaps = 16/327 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PSS+ SVNGF+SFL  G+DDL+    S  FMS+QFL RA  LLR+ HS L  LV KLH
Sbjct  1     MKPSSS-SVNGFFSFLAHGLDDLDRSLASDAFMSLQFLYRAAGLLRALHSQLTYLVPKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSRQ  655
             LPVG KWLDEYMDESS+LW+VCHV+K GVSGMENY SAG ++ SSL+    + N   +RQ
Sbjct  60    LPVGGKWLDEYMDESSRLWDVCHVIKLGVSGMENYCSAGADMVSSLEEWRRNPNSHHARQ  119

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
             V RAI+ CRREAMGLEEENR LMETRIEP+ LRFD    ++    NG+NGFRGVLYA++N
Sbjct  120   VKRAISICRREAMGLEEENRVLMETRIEPMSLRFDDRAPMESRYNNGYNGFRGVLYALKN  179

Query  474   vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
              SSLLL+ILL+G V CWP      P+  E  LFFG  FM SI+RLQQRV EE        
Sbjct  180   SSSLLLMILLWGSVSCWPE-----PAVMEDSLFFGPGFMASIARLQQRVVEETEGTD--A  232

Query  294   GHGVLLYEFKRSKAAMdelrgelersggg------dedGIREKIESLKACFGVLRSGTEN  133
               G+L++EF++++AA +EL  ELER+              + K+E LK  FG+LR+GT+ 
Sbjct  233   RPGILMHEFRQARAATEELLQELERAAAMGCESDIMGGSPKGKVEGLKEWFGMLRTGTDM  292

Query  132   IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             ++GQ+DDFFDEIVEGRKKLLD CS HR
Sbjct  293   LVGQIDDFFDEIVEGRKKLLDICS-HR  318



>ref|XP_011006544.1| PREDICTED: uncharacterized protein LOC105112516 [Populus euphratica]
Length=337

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 245/332 (74%), Gaps = 13/332 (4%)
 Frame = -3

Query  1017  MAMDPSS--TNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLV  844
             M MDP      +V+GFYS L+R +DDL+  FLS NF+S+QFL + L+ L+SFHS L  LV
Sbjct  1     MFMDPPCNLAPAVSGFYSMLSRELDDLDQSFLSHNFISVQFLSKVLSSLQSFHSQLTTLV  60

Query  843   QKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHH-HLNPQ  667
             Q+LHLPVGEKWLDEYMDESS+LWE C VLKSGV  MEN++S+G N+ SSLD +  H N Q
Sbjct  61    QELHLPVGEKWLDEYMDESSRLWEACLVLKSGVLAMENHHSSGANIASSLDGYRLHSNAQ  120

Query  666   LSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG----VVSVKESKLNGFNGFR  499
             +SRQV+RAI GC+RE + LEEEN++LMET++E L L+F+G    ++ ++ S  N FNGFR
Sbjct  121   VSRQVIRAIVGCQREVIVLEEENKSLMETKVEALSLKFEGKCNSLLMIESSWFNAFNGFR  180

Query  498   GVLYAMRNvssllliillyglvYCWPAESNHPPSSYEG-CLFFGSAFMISISRLQQRVAE  322
             G L+AMRNV+SLLL+ILL GLVYCWP       +  EG  + FGSAFM SI+RLQ+RV  
Sbjct  181   GALHAMRNVNSLLLLILLAGLVYCWPPFWQGAAAFREGEQMTFGSAFMDSIARLQRRVEN  240

Query  321   EMNQ--RQMGGGHGVLLYEFKRSKAAMdelrgelersggg---dedGIREKIESLKACFG  157
              M+Q   Q     G++LYEF++++ AM+EL+ ELE  G         I++K++SLK+CFG
Sbjct  241   GMDQIGGQSASSAGIMLYEFRQARIAMEELKAELESGGAVECGSGMDIQDKVDSLKSCFG  300

Query  156   VLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
             +LR G E IIGQ+DDFFDEIVEGRKKLL  CS
Sbjct  301   LLRCGVETIIGQVDDFFDEIVEGRKKLLGMCS  332



>ref|XP_009145382.1| PREDICTED: uncharacterized protein LOC103869083 [Brassica rapa]
Length=334

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 246/342 (72%), Gaps = 30/342 (9%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS +SVNG+YSFL R +DDLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL+
Sbjct  1     MDPSSASSVNGYYSFLNRSMDDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD H+H   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSIENFSSAGISIASTLDGHYHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRF-----DGVVSVKESKL---NGFNG  505
             RQV+RAITGCRREA+G+E ENRALME R++    RF         +V ES     NGF+G
Sbjct  121   RQVIRAITGCRREAIGIEAENRALMENRVQ----RFPFWSEQAAATVMESSTKLQNGFSG  176

Query  504   FRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVA  325
             FRGVLYA RN+SSLLL++L+ GLVYC P+++    +  +      S F  ++ RLQQRVA
Sbjct  177   FRGVLYATRNMSSLLLMVLMNGLVYCVPSDATLSQTQTQTQNQV-SGFAGAMGRLQQRVA  235

Query  324   EEMNQRQMGGGHGVLLYEFKRSKAAMdelrg-----------elersgggdedGIREKIE  178
              E+   + G   G+L++E++RSKAA++EL+                     E  +RE++E
Sbjct  236   AEVG--RTGMRKGILMHEYRRSKAALEELKAELERRGGGGGGGGSEEEEEGERELRERVE  293

Query  177   SLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             +LK  FG LR+GTE+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  294   NLKGYFGNLRNGTESIVSQIDDFFDEIVEGRKKLLDFCS-HR  334



>ref|XP_009399170.1| PREDICTED: uncharacterized protein LOC103983642 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 186/312 (60%), Positives = 230/312 (74%), Gaps = 17/312 (5%)
 Frame = -3

Query  963  TRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLDEYMDESS  784
            T G+DDL+  F +  FMS+Q LQRA+ALLRS HS L  LVQKLHLPVG  WLDEYMDESS
Sbjct  16   THGLDDLDQSFAAEAFMSLQLLQRAVALLRSLHSQLTHLVQKLHLPVGGTWLDEYMDESS  75

Query  783  KLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSRQVMRAITGCRREAMGLE  607
            +LW+VCHV+K G+SGME Y S    + SSLD    + +P L+RQV+RAI+ CRREAMGLE
Sbjct  76   RLWDVCHVIKHGISGMEKYCSTAAAMISSLDEWRRNPSPHLTRQVVRAISICRREAMGLE  135

Query  606  EENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvYC  427
            EENRAL ETRIEP+ LRFD    + ES+ NGFNGFRGVLYA+RN SSLLL ILL+G V C
Sbjct  136  EENRALAETRIEPVSLRFDDRAPM-ESRYNGFNGFRGVLYALRNTSSLLLTILLWGSVAC  194

Query  426  WPAESNHPPSSYEGC-LFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAA  250
            WP       ++ EGC LFFGS FM S++RL+QR+  E     MGG  G+L++EF++++AA
Sbjct  195  WP-----ELAAIEGCSLFFGSGFMASMARLRQRLVGETE--TMGGRPGILMHEFRQTRAA  247

Query  249  Mdelrgelersgg------gdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEG  88
            ++EL  ELE               ++EK+E+LK  FG+LR+GTEN++GQ+DDFFDEIVE 
Sbjct  248  VEELLEELEGDAAMGCDSQTTGGSLKEKVEALKGWFGMLRTGTENLVGQMDDFFDEIVEA  307

Query  87   RKKLLDFCSTHR  52
            RKKLLD CS HR
Sbjct  308  RKKLLDLCS-HR  318



>ref|XP_007222723.1| hypothetical protein PRUPE_ppa008717mg [Prunus persica]
 gb|EMJ23922.1| hypothetical protein PRUPE_ppa008717mg [Prunus persica]
Length=322

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 238/324 (73%), Gaps = 6/324 (2%)
 Frame = -3

Query  1011  MDPSSTN-SVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKL  835
             MDPS T+ SV+GFY+FLT  +++L+  FLS +FMSIQFLQ+ L+ L+SFHS L  LVQKL
Sbjct  1     MDPSCTSTSVSGFYNFLTHELNNLDQSFLSHSFMSIQFLQKVLSSLKSFHSQLTTLVQKL  60

Query  834   HLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSR  658
             HLP+GEKWLDEYMDESS+LWE C+VLK GVS MEN ++AG N+ SS D  H++LN Q S 
Sbjct  61    HLPIGEKWLDEYMDESSRLWEACNVLKLGVSCMENVFAAGANVLSSTDEFHYYLNEQTSN  120

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             QV+RA++  + E +GLE +N+ALMETR+E L LR +  +    SK NGF+GFRGV+YAMR
Sbjct  121   QVIRAVSAYQMEIIGLEHDNKALMETRVEQLSLRINENIVSMGSKFNGFSGFRGVMYAMR  180

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             NVSSLLL+ILL G+VY  P  S       EG + FGS FM+S++RLQ+RVA    Q   G
Sbjct  181   NVSSLLLMILLSGIVYYLPGSSFQEEGGLEGSVIFGSNFMVSVARLQRRVANVFEQIP-G  239

Query  297   GGHGVLLYEFKRSKAAMdel--rgelersgggdedGIREKIESLKACFGVLRSGTENIIG  124
               HG+LL+EF+ +K+ M+E+    E       +   I++ ++ LK+CFG+LRSG E II 
Sbjct  240   PPHGLLLHEFRETKSLMEEVRGELERMVEHEAEIHDIQDSVDKLKSCFGLLRSGVEAIIE  299

Query  123   QLDDFFDEIVEGRKKLLDFCSTHR  52
             QLDDFFDEIVEGRKKLLD C THR
Sbjct  300   QLDDFFDEIVEGRKKLLDMC-THR  322



>ref|XP_006305285.1| hypothetical protein CARUB_v10009660mg [Capsella rubella]
 gb|EOA38183.1| hypothetical protein CARUB_v10009660mg [Capsella rubella]
Length=338

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 197/341 (58%), Positives = 250/341 (73%), Gaps = 24/341 (7%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R ++DLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSANSVNGFYSFLNRSMEDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD HHH   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSVENFSSAGISIASTLDGHHHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKES-KL-NGFNGFRGV  493
             RQV+RAI+GCRREA+G+EEENRALME R++  P         +++ S KL NGF+GFRGV
Sbjct  121   RQVIRAISGCRREAIGIEEENRALMENRVQRFPFWSEQTSATAIESSTKLQNGFSGFRGV  180

Query  492   LYAMRNvssllliillyglvYCWPAE-SNHPPSSYEGCLFFGSAFMISISRLQQRVAEEM  316
             LYA RN+SSLLL++L+ GLVYC+P + +    +        G  F  ++ RLQQRVA E+
Sbjct  181   LYATRNMSSLLLMVLMNGLVYCFPGDTTTQTQTQITQTQSQGGGFAGAMGRLQQRVAAEV  240

Query  315   NQRQMGGGHGVLLYEFKRSKAAMdelrge-------------lersgggdedGIREKIES  175
                +MG   G+L++E++RSK+A++EL+ E              E     +E  +RE++E+
Sbjct  241   G--RMGMRKGILMHEYRRSKSALEELKAELERRFCNGGGGGEREEEAEEEERELRERVEN  298

Query  174   LKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             LK  FG LR+GTE+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  299   LKGYFGNLRNGTESIVAQIDDFFDEIVEGRKKLLDFCS-HR  338



>ref|XP_010498663.1| PREDICTED: uncharacterized protein LOC104776321 [Camelina sativa]
Length=333

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 246/336 (73%), Gaps = 19/336 (6%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R ++DLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSANSVNGFYSFLNRSMEDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD HHH   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSVENFSSAGISIASTLDGHHHHLRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKES-KL-NGFNGFRGV  493
             RQV+RAI+GCRREA+G+EE NRALME R++  P         +++ S KL NGF+GFRGV
Sbjct  121   RQVIRAISGCRREAIGIEEVNRALMENRVQRFPFWSEQTSATAIESSTKLQNGFSGFRGV  180

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMN  313
             LYA R++SSLLL++L+ GLVYC+P ++     +          F  ++ RLQQRVA E+ 
Sbjct  181   LYATRSMSSLLLMVLMNGLVYCFPGDATTQTQTQIITQSQAGGFAGAMGRLQQRVAAEVG  240

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrg---------elersgggdedGIREKIESLKACF  160
               +MG   G+L++E++RSKAA++EL+               G  +E  +RE++E+LK  F
Sbjct  241   --RMGMRKGILMHEYRRSKAALEELKAELERRFCGVGEREEGEEEERELRERVENLKGYF  298

Query  159   GVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
               LR+GTE+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  299   SNLRNGTESIVAQIDDFFDEIVEGRKKLLDFCS-HR  333



>ref|XP_009110156.1| PREDICTED: uncharacterized protein LOC103835713 [Brassica rapa]
Length=329

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 248/335 (74%), Gaps = 21/335 (6%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS  SVNG+YSFL R +DDLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSATSVNGYYSFLNRSMDDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+K+ VS +E++ SAG ++ S+LD H+H   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKTAVSSVESFSSAGISIASTLDGHYHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKES-KL-NGFNGFRGVLY  487
             RQV+RAI GC REA+G+EEENRALME R++      +   +++ S KL NGF+GFRGVLY
Sbjct  121   RQVIRAIAGCGREAIGIEEENRALMENRVQRFPFWSEQTAAMESSTKLQNGFSGFRGVLY  180

Query  486   AMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQR  307
             A RN+SSLLL++L++GLVYC+P ++    +  +  +     F+ ++ RLQQRVA E+   
Sbjct  181   ATRNMSSLLLMVLIHGLVYCFPGDATLSQTHTQNQV---GGFVGAMGRLQQRVAAEVG--  235

Query  306   QMGGGHGVLLYEFKRSKAAMdelrg----------elersgggdedGIREKIESLKACFG  157
             +MG   G+L++E++RSKAA++EL+               S    E  +RE++E+LK CFG
Sbjct  236   RMGVRKGMLMHEYRRSKAALEELKAELERRFCGGGGGGESEEEGERELRERVENLKGCFG  295

Query  156   VLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              LR+GTE+I+ Q+DD FDEIVEGRKKLLDFCS HR
Sbjct  296   NLRNGTESIVAQIDDLFDEIVEGRKKLLDFCS-HR  329



>ref|XP_004485487.1| PREDICTED: uncharacterized protein LOC101512752 [Cicer arietinum]
Length=329

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 177/329 (54%), Positives = 238/329 (72%), Gaps = 11/329 (3%)
 Frame = -3

Query  1017  MAMDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQK  838
             M+ +  + +S+NGFY+ L +G+++L   FLS NFMS QFL + ++ L+SFHS L LLV+K
Sbjct  2     MSSNSCTNSSINGFYNMLNQGLNELHQSFLSHNFMSFQFLSQVISSLQSFHSQLTLLVRK  61

Query  837   LHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSR  658
             L LPVG KWLDEYMDESS+LW+  H+LKS +SGM+NYYS+  N+ SSLD +HH  P+ SR
Sbjct  62    LRLPVGGKWLDEYMDESSRLWDASHLLKSAISGMDNYYSSAINIASSLDGYHHFTPEFSR  121

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPL--CLRFD-GVVSVKESKLNGFNGFRGVLY  487
             QV+RAI  C+RE +G+EEEN++L ETRI+PL  CL  +  +     SKLNGF+GFRGVL+
Sbjct  122   QVIRAINVCQREILGMEEENKSLTETRIQPLSQCLNQNMNICMDSNSKLNGFSGFRGVLF  181

Query  486   AMRNvssllliillyglvYCWPAESNHPP---SSYEGCLFFGSAFMISISRLQQRVAEEM  316
             AMR+V SLL++ILL GL YCW +   H     S +EG + FGS FM+S++ LQQ+VAEE+
Sbjct  182   AMRSVGSLLVMILLCGLSYCWSSSCFHQVGGGSYHEGHMVFGSGFMVSMAILQQKVAEEI  241

Query  315   NQRQMGGGHGVLLYEFKRSKAAMdelrgelersg---ggdedGIREKIESLKACFGVLRS  145
             +  +  G  G+L +EF+++K AM+EL+  LE            I+EK+E++K CF +LR 
Sbjct  242   DNNE--GHPGILFFEFQQAKIAMEELKVMLETIACYNNEQNGEIQEKVENVKNCFELLRC  299

Query  144   GTENIIGQLDDFFDEIVEGRKKLLDFCST  58
               E I GQLDDFFDEIVEGRKKLLD C+ 
Sbjct  300   SVETITGQLDDFFDEIVEGRKKLLDMCTN  328



>ref|XP_010459927.1| PREDICTED: uncharacterized protein LOC104740901 [Camelina sativa]
Length=334

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 245/337 (73%), Gaps = 20/337 (6%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R ++DLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSANSVNGFYSFLNRSMEDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LP G+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD HHH   L+PQLS
Sbjct  61    LPAGDKWLDEYMDESSKLWEACLVIKSAVSSVENFSSAGISIASTLDGHHHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKES-KL-NGFNGFRGV  493
             RQV+RAI+GCRREA+G+EE NRA+ME R++  P         +++ S KL NGF+GFRGV
Sbjct  121   RQVIRAISGCRREAIGIEEVNRAVMENRVQRFPFWSEQTSATAIESSTKLQNGFSGFRGV  180

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMN  313
             LYA R++SSLLL++L+ GLVYC+P ++     +          F  ++ RLQQRVA E+ 
Sbjct  181   LYATRSMSSLLLMVLMNGLVYCFPGDATTQTQTQIITQSQAGGFAGAMGRLQQRVAAEVG  240

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrge----------lersgggdedGIREKIESLKAC  163
               +MG   G+L++E++RSKAA++EL+ E           E     + + +RE++E+LK  
Sbjct  241   --RMGMRKGILMHEYRRSKAALEELKAELERRFCGGGEREEGEEEERELLRERVENLKGY  298

Query  162   FGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             F  LR+GTE+I  Q+DDFF+EIVEGRKKLLDFCS HR
Sbjct  299   FSNLRNGTESIAAQIDDFFEEIVEGRKKLLDFCS-HR  334



>ref|XP_007159581.1| hypothetical protein PHAVU_002G249400g [Phaseolus vulgaris]
 gb|ESW31575.1| hypothetical protein PHAVU_002G249400g [Phaseolus vulgaris]
Length=318

 Score =   318 bits (814),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 240/322 (75%), Gaps = 9/322 (3%)
 Frame = -3

Query  1017  MAMDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQK  838
             M+    + +SVNGFY+FLT+G+++L   FLS +FMSIQF+   L+ L+SFHS L + +Q+
Sbjct  1     MSTSSCTNSSVNGFYNFLTQGLNELHQSFLSHDFMSIQFISEVLSSLQSFHSKLTIFIQR  60

Query  837   LHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSR  658
             L LPVG KWLDEYMDESS+LW++CHVLKS + G+ENY S   N+TS +D +HH  P+LS 
Sbjct  61    LCLPVGGKWLDEYMDESSRLWDICHVLKSAIYGIENYSSTASNITSLVDGYHHFTPELSH  120

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPL--CLRFDGVVSVKESKLNGFNGFRGVLYA  484
             QV+RAI  C+RE++GL EEN+++METRI+ L  CL  +  +   ESKLN FNGFRGVL A
Sbjct  121   QVVRAINICQRESLGLVEENKSMMETRIQALSQCLNQNMCM---ESKLNEFNGFRGVLCA  177

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
             MR+VSSLLL+ILL G+ YCW + S      YEG + FGS F++S++RLQQ+VA+E++   
Sbjct  178   MRSVSSLLLMILLCGVAYCWSS-SCFEQQGYEGHMVFGSGFVVSMARLQQKVAQEIDHN-  235

Query  303   MGGGHGVLLYEFKRSKAAMdelrgelersg-ggdedGIREKIESLKACFGVLRSGTENII  127
               G  G+LL EF+++K AM+EL+ ELER      +  I+ K+++LK CFG+LR G E I 
Sbjct  236   -NGQPGILLLEFQQAKIAMEELKIELERMVGYDAQYEIQSKVDNLKRCFGLLRCGVETIT  294

Query  126   GQLDDFFDEIVEGRKKLLDFCS  61
             GQLDDFFDEIVEGRKKLLD CS
Sbjct  295   GQLDDFFDEIVEGRKKLLDMCS  316



>gb|KFK44306.1| hypothetical protein AALP_AA1G240800 [Arabis alpina]
Length=322

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 189/328 (58%), Positives = 242/328 (74%), Gaps = 14/328 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYS+L + ++DLE V+LS NFMS+QFLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSANSVNGFYSYLNKSMEDLERVYLSNNFMSVQFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE C VLKS VS +E++ S G ++ SSLD H  L+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVLKSAVSSVESFSSNGISIASSLDHHRRLSPQLSRQV  120

Query  651   MRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             +RAI+GCRREA+G+EEENRALME R++  P    +   +       NGF+GFRGVLYAMR
Sbjct  121   IRAISGCRREAIGIEEENRALMENRVQRFPFWSEYTSEMESSTKLQNGFSGFRGVLYAMR  180

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             N+SSLLL++L+ GLVYC   ++     +    +     F  ++ RLQQRV  E+   +MG
Sbjct  181   NMSSLLLMVLMNGLVYCDATQTQTQTQTQNQVV---GGFAGAMGRLQQRVVTEV--VRMG  235

Query  297   GGHGVLLYEFKRSKAAMdelrg------elersgggdedGIREKIESLKACFGVLRSGTE  136
                G+L++E++RSK+A++EL+         ER    +E  +RE++E+LK  FG LR+GTE
Sbjct  236   LRKGILMHEYRRSKSALEELKAELERRGGGEREEEEEEKELRERVENLKGYFGNLRNGTE  295

Query  135   NIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             +I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  296   SIVAQIDDFFDEIVEGRKKLLDFCS-HR  322



>ref|XP_009420185.1| PREDICTED: uncharacterized protein LOC103999984 [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 187/312 (60%), Positives = 233/312 (75%), Gaps = 16/312 (5%)
 Frame = -3

Query  966  LTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLDEYMDES  787
            L  GIDDL+    S  FMS+QFLQRA+ALLRS HS L  LVQKLHLPVGE+WLDEYMDES
Sbjct  15   LAHGIDDLDESLTSNTFMSLQFLQRAVALLRSLHSRLTNLVQKLHLPVGERWLDEYMDES  74

Query  786  SKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSRQVMRAITGCRREAMGL  610
            S+L +VCHV+K GVSG+ENY SA  ++ SSLD   H+ +P L+RQVMRA++ CRREAMGL
Sbjct  75   SRLLDVCHVIKLGVSGIENYCSAAADMISSLDEWRHNPSPHLARQVMRAVSICRREAMGL  134

Query  609  EEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvY  430
            EEENR L+ETRIEP+  RFD  +S+ ES+ NGFNGFRGVLYA+RN SSLLL+ILL+G V 
Sbjct  135  EEENRVLVETRIEPMSFRFDDRLSM-ESRYNGFNGFRGVLYALRNASSLLLLILLWGSVS  193

Query  429  CWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAA  250
            C P       +  +G LFFGS  M+S++ LQQRV  E+    + G  G+L+ EF++++AA
Sbjct  194  CCP-----ELAVTDGSLFFGSELMVSMASLQQRVVGEVE--GLDGRSGILMLEFRQARAA  246

Query  249  Mdelrgelersggg------dedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEG  88
             +ELR ELE +            G++EK+E LK  FG+LRSGTEN++GQ+DDFFDEIVEG
Sbjct  247  TEELRDELETAAAMRCGPEIAGGGLKEKVEELKGWFGMLRSGTENLVGQMDDFFDEIVEG  306

Query  87   RKKLLDFCSTHR  52
            R+KLL  CS HR
Sbjct  307  RRKLLHLCS-HR  317



>ref|XP_007141119.1| hypothetical protein PHAVU_008G168900g [Phaseolus vulgaris]
 gb|ESW13113.1| hypothetical protein PHAVU_008G168900g [Phaseolus vulgaris]
Length=318

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 200/328 (61%), Positives = 249/328 (76%), Gaps = 18/328 (5%)
 Frame = -3

Query  1020  PMAMD--PSST-NSVNGFYSFLTRGIDDLECVFLSTN-FMSIQFLQRALALLRSFHSHLI  853
             P +M+  PSS  N+V GFY+ ++RG+++LE   +S N  +S+ FLQR L+LLRSFH+HL 
Sbjct  4     PFSMEACPSSNGNTVGGFYAVVSRGMEELERTLVSNNNAISLSFLQRLLSLLRSFHTHLT  63

Query  852   LLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLN  673
             LLV  LHLP+G+KWLDEYMDE+SKLWE  H+LK+ +S  E +YSAGF+L SSL   H   
Sbjct  64    LLVHSLHLPLGDKWLDEYMDETSKLWETSHLLKNALSNFEPFYSAGFSLASSL---HDSL  120

Query  672   PQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGV  493
             P LS QV+RAI+GCRREA+GLEE+NR+LMETRI+ LCLR D  V+V ES+LNGFNGFRGV
Sbjct  121   PHLSPQVVRAISGCRREALGLEEQNRSLMETRIQTLCLRLDERVAV-ESRLNGFNGFRGV  179

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGC-LFFGSAFMISISRLQQRVAEEM  316
             LYAMRNVSS+LL+ILL+GLVYCWP  S       EG  LF GSA M+S +R++QRVA EM
Sbjct  180   LYAMRNVSSMLLMILLHGLVYCWPETSELVVGGCEGGRLFLGSAVMVSAARVRQRVAAEM  239

Query  315   NQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTE  136
                    G G+LLYEF+R++ A+     EL      +E G+ E++ES++ CFGVL+SG E
Sbjct  240   GS----AGSGILLYEFRRARVAV----EELRGQLEREEGGVMERVESVRMCFGVLKSGIE  291

Query  135   NIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             NII QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  292   NIICQLDDFFDEIVEGRKKLLDFCS-HR  318



>ref|XP_007141118.1| hypothetical protein PHAVU_008G168900g [Phaseolus vulgaris]
 gb|ESW13112.1| hypothetical protein PHAVU_008G168900g [Phaseolus vulgaris]
Length=323

 Score =   315 bits (807),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 200/328 (61%), Positives = 249/328 (76%), Gaps = 18/328 (5%)
 Frame = -3

Query  1020  PMAMD--PSST-NSVNGFYSFLTRGIDDLECVFLSTN-FMSIQFLQRALALLRSFHSHLI  853
             P +M+  PSS  N+V GFY+ ++RG+++LE   +S N  +S+ FLQR L+LLRSFH+HL 
Sbjct  4     PFSMEACPSSNGNTVGGFYAVVSRGMEELERTLVSNNNAISLSFLQRLLSLLRSFHTHLT  63

Query  852   LLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLN  673
             LLV  LHLP+G+KWLDEYMDE+SKLWE  H+LK+ +S  E +YSAGF+L SSL   H   
Sbjct  64    LLVHSLHLPLGDKWLDEYMDETSKLWETSHLLKNALSNFEPFYSAGFSLASSL---HDSL  120

Query  672   PQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGV  493
             P LS QV+RAI+GCRREA+GLEE+NR+LMETRI+ LCLR D  V+V ES+LNGFNGFRGV
Sbjct  121   PHLSPQVVRAISGCRREALGLEEQNRSLMETRIQTLCLRLDERVAV-ESRLNGFNGFRGV  179

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGC-LFFGSAFMISISRLQQRVAEEM  316
             LYAMRNVSS+LL+ILL+GLVYCWP  S       EG  LF GSA M+S +R++QRVA EM
Sbjct  180   LYAMRNVSSMLLMILLHGLVYCWPETSELVVGGCEGGRLFLGSAVMVSAARVRQRVAAEM  239

Query  315   NQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTE  136
                    G G+LLYEF+R++ A+     EL      +E G+ E++ES++ CFGVL+SG E
Sbjct  240   GS----AGSGILLYEFRRARVAV----EELRGQLEREEGGVMERVESVRMCFGVLKSGIE  291

Query  135   NIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             NII QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  292   NIICQLDDFFDEIVEGRKKLLDFCS-HR  318



>ref|XP_006390046.1| hypothetical protein EUTSA_v10018874mg [Eutrema salsugineum]
 gb|ESQ27332.1| hypothetical protein EUTSA_v10018874mg [Eutrema salsugineum]
Length=323

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 242/337 (72%), Gaps = 31/337 (9%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS TNSVNGFYSFL R ++DLE V+LS NFMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDPSCTNSVNGFYSFLNRSMEDLERVYLSNNFMSVQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLD+YMDE+SKLW+VCHV+KS +S ME + SA  ++ S+LD HHH + Q+SRQV
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKSSLSSMETFCSAAISIASTLDGHHH-HRQISRQV  119

Query  651   MRAITGCRREAMGLEEENRALMETRIEP---LCLRFDGVVSVKESKL-NGFNGFRGVLYA  484
             +RAI+GCRREA+GLEEENRALME RI+    L  +     +++ SK+ NGF+GFRGV+  
Sbjct  120   IRAISGCRREAVGLEEENRALMENRIQRFPFLSEQITTTAAMESSKIQNGFSGFRGVMNT  179

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
             M+N++S LL+IL+ GL+YC P E+    +     L           RL+QRVA EM   +
Sbjct  180   MKNINSRLLMILMQGLIYCIPGETTATVTMTATALV----------RLKQRVAAEME--R  227

Query  303   MGGGHGVLLYEFKRSKAAMdelrgelers-------------gggdedGIREKIESLKAC  163
              G   GV++YEF+RSK AM+EL+ ELER                  E G+RE++E++K  
Sbjct  228   TGIKKGVMMYEFRRSKTAMEELKAELERRWCGGGGEREEEAAEAAAEKGLRERVENVKVN  287

Query  162   FGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              G LR+G+E+I+ Q+DDFFDEIV+GRK LLDFCS HR
Sbjct  288   IGNLRNGSESIVAQIDDFFDEIVDGRKMLLDFCS-HR  323



>ref|XP_006586379.1| PREDICTED: uncharacterized protein LOC100811367 [Glycine max]
Length=318

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 237/312 (76%), Gaps = 9/312 (3%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            VNGFY+FLT+G+++L   FLS +FMSIQF+    + L+SFHS L +LVQ+L L VG KWL
Sbjct  11   VNGFYNFLTQGLNELHQSFLSHDFMSIQFISEVFSSLQSFHSQLTILVQRLCLSVGGKWL  70

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCR  628
            +EYMDESS+LW++CHVLKS +SG+ENY S G N+ SS+D +H+L P+LS QV+RAI  C+
Sbjct  71   NEYMDESSRLWDICHVLKSAISGIENYSSTGSNIASSVDGYHNLTPELSHQVIRAINICQ  130

Query  627  REAMGLEEENRALMETRIEPL--CLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllli  454
            RE++GL EEN++LMETR + L  CL  +  +   ESKLN FNGFRGVL AMR+VSSLLL+
Sbjct  131  RESLGLVEENKSLMETRTQALSQCLNQNMCM---ESKLNEFNGFRGVLCAMRSVSSLLLM  187

Query  453  illyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLY  274
            ILL G+ YCW + S      YEG + FGS F++S++RLQQ+VA+E++Q    G  G+LL 
Sbjct  188  ILLCGVAYCWSS-SCFDQQGYEGHMVFGSGFVVSMARLQQKVAQEIDQN--NGQQGILLL  244

Query  273  EFKRSKAAMdelrgelersg-ggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEI  97
            EF+++K +M+EL+ ELER      +  I+ K+++LK CFG+LR G E I GQLDDFFDEI
Sbjct  245  EFQQAKISMEELKVELERMVGYDAQHEIQAKVDNLKRCFGLLRCGVETITGQLDDFFDEI  304

Query  96   VEGRKKLLDFCS  61
            VEGRKKLL+ CS
Sbjct  305  VEGRKKLLNMCS  316



>ref|XP_003629964.1| hypothetical protein MTR_8g088750 [Medicago truncatula]
 gb|AET04440.1| DUF793 family protein [Medicago truncatula]
Length=320

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 238/309 (77%), Gaps = 6/309 (2%)
 Frame = -3

Query  981  GFYSFLTRGIDDL-ECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLD  805
            GFY+FLT+G++ L + + LS NFMSIQF+   L+ L+SFHS L LLVQ L LP+G KWLD
Sbjct  14   GFYTFLTQGLNVLHQSLILSHNFMSIQFISEVLSSLQSFHSQLTLLVQNLCLPIGGKWLD  73

Query  804  EYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRR  625
            EYMDESS+LW++CHVLKS +SG+ENY SAG N+ +SLD  HHL P++S QV+RA+  C+R
Sbjct  74   EYMDESSRLWDICHVLKSSISGIENYSSAGSNIATSLDVFHHLTPEVSHQVIRAMNICQR  133

Query  624  EAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliill  445
            E +G+EEEN+++METRI+ L    +  +S+ ES LN +N FRGVLYAMR VSSLLL+ILL
Sbjct  134  EIIGMEEENKSMMETRIQALSQSLNQNMSL-ESNLNEYNSFRGVLYAMRRVSSLLLMILL  192

Query  444  yglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFK  265
             G+ YCW + S      YEG L FGS+FM+S++RLQ +V +E++  ++    GVLL+EF+
Sbjct  193  SGVAYCWSS-SCFDHQGYEGNLVFGSSFMVSMARLQHKVGKEID--RINVQPGVLLFEFQ  249

Query  264  RSKAAMdelrgelersgggded-GIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEG  88
            ++K AM+EL+ ELER    D +  I+ K++ LK+CFG+L+ G EN+IG++DDFFDEIVEG
Sbjct  250  QAKVAMEELKVELERIVVYDAEFEIQAKVDKLKSCFGLLKCGVENLIGKVDDFFDEIVEG  309

Query  87   RKKLLDFCS  61
            RKKLLD CS
Sbjct  310  RKKLLDMCS  318



>emb|CDY38838.1| BnaC08g20120D [Brassica napus]
Length=311

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 240/325 (74%), Gaps = 19/325 (6%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS  SVNG+YSFL R +DDLE V+LS NFMS+ FLQR L LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSATSVNGYYSFLNRSMDDLERVYLSNNFMSVHFLQRTLCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD H+H   L+PQLS
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSIENFSSAGISIASTLDGHYHHRRLSPQLS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKES-KL-NGFNGFRGVLY  487
             RQV+RAITGCRREA+G+EEENRALME R++      +   +++ S KL NGF+GFRGVLY
Sbjct  121   RQVIRAITGCRREAIGIEEENRALMENRVQRFPFWSEQTAAMESSTKLQNGFSGFRGVLY  180

Query  486   AMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQR  307
             A RN+SSLLL++L++GLVYC P ++    +  +  +     F+ ++ RLQQRVA E+   
Sbjct  181   ATRNMSSLLLMVLIHGLVYCLPGDATLSQTQTQNQV---GGFVGAMGRLQQRVAAEVG--  235

Query  306   QMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENII  127
             +MG   G+L++E++RSKAA++EL+ ELER   G      E+ E          +GTE+I+
Sbjct  236   RMGVRKGMLMHEYRRSKAALEELKAELERRFCGGGGESEEEGERA--------NGTESIV  287

Query  126   GQLDDFFDEIVEGRKKLLDFCSTHR  52
              Q+DD FDEIVEGRKKLLDFCS HR
Sbjct  288   AQIDDLFDEIVEGRKKLLDFCS-HR  311



>gb|AAM65421.1| unknown [Arabidopsis thaliana]
Length=333

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 243/338 (72%), Gaps = 23/338 (7%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS  NSVNGFYSFL R ++DLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSYANSVNGFYSFLNRSMEDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD    L+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSVENFSSAGISIASTLD--RRLSPQLSRQV  118

Query  651   MRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKES-KL-NGFNGFRGVLYA  484
             +RAI+GCRREA+G+EEENRALME R++  P         +++ S KL NGF+GFRGVLYA
Sbjct  119   IRAISGCRREAIGIEEENRALMENRVQRFPFWTEQTSATAMESSTKLQNGFSGFRGVLYA  178

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFG-SAFMISISRLQQRVAEEMNQR  307
              RN+SSLLL++L+ GLVYC+P ++     +           F  ++ RLQQRVA E+   
Sbjct  179   TRNMSSLLLMVLMNGLVYCFPGDAATQTQTQITQTQSQVGGFAGAMGRLQQRVAAEVG--  236

Query  306   QMGGGHGVLLYEFKRSKAAMdelrg-------------elersgggdedGIREKIESLKA  166
             +MG   G+L++E++RSKAA++EL+                      DE  +RE++E+LK 
Sbjct  237   RMGIRKGILMHEYRRSKAALEELKAELERRFCGGGGGGGEREEEEEDERELRERVENLKG  296

Query  165   CFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              FG LR+GTE+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  297   YFGNLRNGTESIVAQIDDFFDEIVEGRKKLLDFCS-HR  333



>ref|NP_564155.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF86562.1|AC069252_21 F2E2.8 [Arabidopsis thaliana]
 dbj|BAC42771.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40356.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30187.1| uncharacterized protein AT1G22030 [Arabidopsis thaliana]
Length=333

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 243/338 (72%), Gaps = 23/338 (7%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS  NSVNGFYSFL R ++DLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSCANSVNGFYSFLNRSMEDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD    L+PQLSRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSVENFSSAGISIASTLD--RRLSPQLSRQV  118

Query  651   MRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKES-KL-NGFNGFRGVLYA  484
             +RAI+GCRREA+G+EEENRALME R++  P         +++ S KL NGF+GFRGVLYA
Sbjct  119   IRAISGCRREAIGIEEENRALMENRVQRFPFWSEQTSATAMESSTKLQNGFSGFRGVLYA  178

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFG-SAFMISISRLQQRVAEEMNQR  307
              RN+SSLLL++L+ GLVYC+P ++     +           F  ++ RLQQRVA E+   
Sbjct  179   TRNMSSLLLMVLMNGLVYCFPGDAATQTQTQITQTQSQVGGFAGAMGRLQQRVAAEVG--  236

Query  306   QMGGGHGVLLYEFKRSKAAMdelrg-------------elersgggdedGIREKIESLKA  166
             +MG   G+L++E++RSKAA++EL+                      DE  +RE++E+LK 
Sbjct  237   RMGIRKGILMHEYRRSKAALEELKAELERRFCGGGGGGGEREEEEEDERELRERVENLKG  296

Query  165   CFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              FG LR+GTE+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  297   YFGNLRNGTESIVAQIDDFFDEIVEGRKKLLDFCS-HR  333



>emb|CDY04696.1| BnaC05g17340D [Brassica napus]
Length=318

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 242/331 (73%), Gaps = 24/331 (7%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNG+YSFL R +DDLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL+
Sbjct  1     MDPSSANSVNGYYSFLNRSMDDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LPVG+KWLDEYMDESSKLWE C V+KS VS +EN+ SAG ++ S+LD H+H   L+PQ+S
Sbjct  61    LPVGDKWLDEYMDESSKLWEACLVIKSAVSSIENFSSAGISIASTLDGHYHHRRLSPQVS  120

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRF-----DGVVSVKESKL---NGFNG  505
             RQV+RAITGCRREA+G+E ENRALMETR++    RF         +V ES     NGF+G
Sbjct  121   RQVIRAITGCRREAIGIEAENRALMETRVQ----RFPFWSEQSAATVMESSTKLQNGFSG  176

Query  504   FRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVA  325
             FRGVLYA RN+SSLLL++L+ GLVYC P+++    +  +      S F  ++ RLQQRVA
Sbjct  177   FRGVLYATRNMSSLLLMVLMNGLVYCVPSDATLSQTQTQTQNQV-SGFAGAMGRLQQRVA  235

Query  324   EEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRS  145
              E+   + G   G+L++E++RSKAA++EL+ ELER GGG+ +    + E  +    +   
Sbjct  236   AEVG--RTGMRKGILMHEYRRSKAALEELKAELERRGGGESEEEEGEREFRERVENL---  290

Query  144   GTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
               + I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  291   --KGIVSQIDDFFDEIVEGRKKLLDFCS-HR  318



>ref|XP_006302561.1| hypothetical protein CARUB_v10020667mg [Capsella rubella]
 gb|EOA35459.1| hypothetical protein CARUB_v10020667mg [Capsella rubella]
Length=318

 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 237/333 (71%), Gaps = 28/333 (8%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S TNSVNGFYSFL R ++DLE V+LS NFMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDQSCTNSVNGFYSFLNRSMEDLERVYLSDNFMSLQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH----LNPQL  664
             LPVG+KWLD+YMDE+SKLW+VCHV+KS +S +E++ S+  ++ S+LD H+H    L+PQ+
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKSALSSLESFCSSAISIASTLDGHYHHRRLLSPQI  120

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKL-NGFNGFRGVLY  487
             SRQV+RAI+GCRREA+G+EEENRAL+E RI+          +++ SK+ NGF+GFRGV+ 
Sbjct  121   SRQVIRAISGCRREAVGIEEENRALLENRIQRFPFWSKQTTAMESSKIQNGFSGFRGVMN  180

Query  486   AMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQR  307
              M N++SLLL+IL+ GLVY  P ++    +               ++RL+QRVA EM   
Sbjct  181   TMTNMNSLLLVILMQGLVYYIPGDTGTAATG------------TMMARLKQRVAAEME--  226

Query  306   QMGGGHGVLLYEFKRSKAAMdelrg--------elersgggdedGIREKIESLKACFGVL  151
             ++G   G+++YE++RSK AMDEL+                  E  +RE++ES+K   G L
Sbjct  227   RIGTRKGMMMYEYRRSKTAMDELKAELERRCCGGGGGEEEAAEKRLRERVESMKGDIGSL  286

Query  150   RSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             R+GTE+++ Q+DD FD+IV+GRK LLD+CS HR
Sbjct  287   RNGTESVVAQIDDLFDDIVDGRKMLLDYCS-HR  318



>ref|XP_004151123.1| PREDICTED: uncharacterized protein LOC101222277 [Cucumis sativus]
Length=267

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 183/246 (74%), Positives = 207/246 (84%), Gaps = 14/246 (6%)
 Frame = -3

Query  762  VLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRREAMGLEEENRALME  583
            VLKSG+SG+EN+YSAGFN+TSSL++H HL+PQLSRQV+RAI+GCRREA+GLEEENRALME
Sbjct  27   VLKSGISGIENFYSAGFNITSSLETHRHLSPQLSRQVIRAISGCRREAVGLEEENRALME  86

Query  582  TRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHP  403
             RI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMRNVSSLLL+ILLYGLVYCWP ESN  
Sbjct  87   ARIQPLSLRFDEKVSI-ESKLNGFNGFRGVLYAMRNVSSLLLMILLYGLVYCWP-ESNFV  144

Query  402  PSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgele  223
               YEGCLFFGSAFMIS +RLQ+RVA E+N  QM G  G+LLYEF+RSK AM+ELR ELE
Sbjct  145  RGGYEGCLFFGSAFMISTARLQERVAGEIN--QMNGRPGILLYEFRRSKMAMEELRAELE  202

Query  222  rsggg---------dedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLD  70
            R  G           E GIRE++E+L+ACFGVLRSG ENI+ QLDDF DEIVEGRKKLLD
Sbjct  203  RRVGMGSQGLVEWETEIGIRERVENLRACFGVLRSGAENIVCQLDDFIDEIVEGRKKLLD  262

Query  69   FCSTHR  52
            FCS HR
Sbjct  263  FCS-HR  267



>ref|XP_009393453.1| PREDICTED: uncharacterized protein LOC103979128 [Musa acuminata 
subsp. malaccensis]
Length=334

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 243/333 (73%), Gaps = 20/333 (6%)
 Frame = -3

Query  1020  PMAMDPSST------NSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSH  859
             P+++ PSS+      NSV  F+SFL+ G+D+L+  F S  FMS+Q LQRA+ALLRS HS 
Sbjct  7     PISLTPSSSTMRPCSNSVTNFFSFLSGGLDELDRCFASNAFMSLQSLQRAVALLRSLHSR  66

Query  858   LILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HH  682
             LI LVQKLHLP GE+WLDEYMDESS+LW+VCHV+K G+SGMENY S G ++ +SL+    
Sbjct  67    LIGLVQKLHLPAGERWLDEYMDESSRLWDVCHVIKLGISGMENYNSRGADMVASLEEWRR  126

Query  681   HLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGF  502
             +  P+L+ QVMRAI+ CRREAM L+EENR L+ET+IEP  LRFD   +  ES+L+GFNGF
Sbjct  127   NPTPRLALQVMRAISVCRREAMRLDEENRVLVETKIEPASLRFDDERAFTESRLHGFNGF  186

Query  501   RGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAE  322
             RGVLYA+RNVSSLLL+ILL+G V+C P +     S+     F  S + +S+ RL++R+  
Sbjct  187   RGVLYALRNVSSLLLLILLWGSVHCCPEQGVSEEST-----FLSSGYAVSVGRLRRRLVG  241

Query  321   EMNQRQMGGGHGVLLYEFKRSKAAMdelrgelers------gggdedGIREKIESLKACF  160
             E+   ++GG  G+L++EF+ ++AA +ELR E+E++       G     ++EK+E LK   
Sbjct  242   EVE--ELGGRPGILMHEFRAARAAAEELREEMEKAGTEGGDTGATAGKLKEKVEGLKGWL  299

Query  159   GVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
             G LRSGTEN++ QLDD FDEIVEGRK+LLD CS
Sbjct  300   GTLRSGTENLVAQLDDLFDEIVEGRKELLDICS  332



>ref|XP_010521221.1| PREDICTED: uncharacterized protein LOC104800173 isoform X2 [Tarenaya 
hassleriana]
Length=312

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 235/323 (73%), Gaps = 17/323 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R ++DLE V+ S NFMS+QFLQR + LLR+ HS LILLVQKL 
Sbjct  1     MDPSSANSVNGFYSFLNRSMEDLERVYHSNNFMSVQFLQRVICLLRTSHSRLILLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDE+SK W+ CHV+KS VS M+N+ SAG ++ SSL SH ++      QV
Sbjct  61    LPVGDKWLDEYMDETSKFWDACHVIKSAVSAMDNFCSAGISIVSSLSSHFYV---CCFQV  117

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS---VKESKL-NGFNGFRGVLYA  484
             +RAI+GCRREA+GLE+ENRALME R++ L    D   S   ++ SK+ NGF+GFRGVL A
Sbjct  118   IRAISGCRREAVGLEQENRALMENRVQALPFWSDPTSSAGVMESSKVQNGFSGFRGVLNA  177

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
              RN+SSLLL+IL+ GLVYC+P +   P +  +     G  F  ++ R++QRVA E+  R+
Sbjct  178   TRNMSSLLLMILMQGLVYCFPGD---PTTPQQTAAGGGGGFTAAMGRMKQRVAAEVRLRK  234

Query  303   MGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIG  124
                  G+ LYE++RSKAAM+EL  ELER  G + +  REK+E +K   G LR GTE+I+ 
Sbjct  235   -----GIQLYEYRRSKAAMEELEEELERRSGEEME--REKVERVKGLIGGLRDGTESILF  287

Query  123   QLDDFFDEIVEGRKKLLDFCSTH  55
             Q+DDF DEIVEGRKKLLD  S H
Sbjct  288   QIDDFLDEIVEGRKKLLDLASHH  310



>ref|XP_010521220.1| PREDICTED: uncharacterized protein LOC104800173 isoform X1 [Tarenaya 
hassleriana]
Length=314

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 234/323 (72%), Gaps = 15/323 (5%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R ++DLE V+ S NFMS+QFLQR + LLR+ HS LILLVQKL 
Sbjct  1     MDPSSANSVNGFYSFLNRSMEDLERVYHSNNFMSVQFLQRVICLLRTSHSRLILLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDE+SK W+ CHV+KS VS M+N+ SAG ++ SSL    + +P    QV
Sbjct  61    LPVGDKWLDEYMDETSKFWDACHVIKSAVSAMDNFCSAGISIVSSL-QKLNCSPPPETQV  119

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS---VKESKL-NGFNGFRGVLYA  484
             +RAI+GCRREA+GLE+ENRALME R++ L    D   S   ++ SK+ NGF+GFRGVL A
Sbjct  120   IRAISGCRREAVGLEQENRALMENRVQALPFWSDPTSSAGVMESSKVQNGFSGFRGVLNA  179

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
              RN+SSLLL+IL+ GLVYC+P +   P +  +     G  F  ++ R++QRVA E+  R+
Sbjct  180   TRNMSSLLLMILMQGLVYCFPGD---PTTPQQTAAGGGGGFTAAMGRMKQRVAAEVRLRK  236

Query  303   MGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIG  124
                  G+ LYE++RSKAAM+EL  ELER  G + +  REK+E +K   G LR GTE+I+ 
Sbjct  237   -----GIQLYEYRRSKAAMEELEEELERRSGEEME--REKVERVKGLIGGLRDGTESILF  289

Query  123   QLDDFFDEIVEGRKKLLDFCSTH  55
             Q+DDF DEIVEGRKKLLD  S H
Sbjct  290   QIDDFLDEIVEGRKKLLDLASHH  312



>ref|XP_003593017.1| hypothetical protein MTR_2g006850 [Medicago truncatula]
Length=303

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 224/314 (71%), Gaps = 19/314 (6%)
 Frame = -3

Query  1002  SSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV  823
             SS +S+NGFY+ L +G+ DL   F+S NFMS QFL + ++ L+SFHS L LLV+KL LPV
Sbjct  2     SSNSSINGFYNMLNQGLIDLHQTFISHNFMSFQFLSQVISSLQSFHSQLTLLVRKLRLPV  61

Query  822   GEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSRQVMR  646
             G KWLDEYMDESS+LW+ CHVLKS +SG++NYYS+  N+ SSL   +HH+ P+ SRQV+R
Sbjct  62    GGKWLDEYMDESSRLWDSCHVLKSAISGIDNYYSSATNIVSSLHGYYHHVTPEFSRQVIR  121

Query  645   AITGCRREAMGLEEENRALMETRIEPL--CLRFD-GVVSVKESKLNGFNGFRGVLYAMRN  475
             AI  C+RE +G+EEEN+ L ETRI+ L  CL  +  + S   SKLNGF+GFRGVL+AMR+
Sbjct  122   AINVCQREILGMEEENKNLTETRIQQLSQCLNQNTNICSNSNSKLNGFSGFRGVLFAMRS  181

Query  474   vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
             VSSLLL+ILL GL YCW +   H    +EG        M+S+  LQQ+VAEE++      
Sbjct  182   VSSLLLMILLSGLAYCWSSSCFH----HEGQ-------MVSMEMLQQKVAEEIDNND---  227

Query  294   GHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLD  115
             G G+LL+EF+++K AM E       +     + I+EK+E++K CFG+LR G + I GQLD
Sbjct  228   GQGILLFEFQKAKIAM-EELKVELENITYGGNEIQEKVENVKNCFGLLRCGVDTITGQLD  286

Query  114   DFFDEIVEGRKKLL  73
             DFFDEIVEGRKKL 
Sbjct  287   DFFDEIVEGRKKLF  300



>gb|AES63268.2| hypothetical protein MTR_2g006850 [Medicago truncatula]
Length=304

 Score =   296 bits (758),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 224/314 (71%), Gaps = 19/314 (6%)
 Frame = -3

Query  1002  SSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV  823
             SS +S+NGFY+ L +G+ DL   F+S NFMS QFL + ++ L+SFHS L LLV+KL LPV
Sbjct  3     SSNSSINGFYNMLNQGLIDLHQTFISHNFMSFQFLSQVISSLQSFHSQLTLLVRKLRLPV  62

Query  822   GEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSRQVMR  646
             G KWLDEYMDESS+LW+ CHVLKS +SG++NYYS+  N+ SSL   +HH+ P+ SRQV+R
Sbjct  63    GGKWLDEYMDESSRLWDSCHVLKSAISGIDNYYSSATNIVSSLHGYYHHVTPEFSRQVIR  122

Query  645   AITGCRREAMGLEEENRALMETRIEPL--CLRFD-GVVSVKESKLNGFNGFRGVLYAMRN  475
             AI  C+RE +G+EEEN+ L ETRI+ L  CL  +  + S   SKLNGF+GFRGVL+AMR+
Sbjct  123   AINVCQREILGMEEENKNLTETRIQQLSQCLNQNTNICSNSNSKLNGFSGFRGVLFAMRS  182

Query  474   vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
             VSSLLL+ILL GL YCW +   H    +EG        M+S+  LQQ+VAEE++      
Sbjct  183   VSSLLLMILLSGLAYCWSSSCFH----HEGQ-------MVSMEMLQQKVAEEIDNND---  228

Query  294   GHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLD  115
             G G+LL+EF+++K AM E       +     + I+EK+E++K CFG+LR G + I GQLD
Sbjct  229   GQGILLFEFQKAKIAM-EELKVELENITYGGNEIQEKVENVKNCFGLLRCGVDTITGQLD  287

Query  114   DFFDEIVEGRKKLL  73
             DFFDEIVEGRKKL 
Sbjct  288   DFFDEIVEGRKKLF  301



>ref|XP_009390144.1| PREDICTED: uncharacterized protein LOC103976603 [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 185/326 (57%), Positives = 228/326 (70%), Gaps = 14/326 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PS   SVNGFY+F+  G+DDL     STNFMS+ FLQR +ALLRS HS  + LVQKLH
Sbjct  1     MKPS-CGSVNGFYAFVAHGVDDLGRCLTSTNFMSVTFLQRCVALLRSVHSQFMSLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LP GEKW DEYMDES+++W+ CHVLK G++ ME+Y + G ++ S L+ H   NPQL RQ 
Sbjct  60    LPPGEKWFDEYMDESARVWDACHVLKLGLASMESYCATGADMISILERHRS-NPQLVRQA  118

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNv  472
             MRAI+ CRR A G++EENR L ETRIE L LR  G     ESKLNGFNGFRGVL+AMRNV
Sbjct  119   MRAISVCRRAAAGMQEENRVLTETRIEALSLR-TGEKVPSESKLNGFNGFRGVLHAMRNV  177

Query  471   ssllliillyglvYCWP-AESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
             SS LL++LL+GLV+ WP   S+   ++      F   +M+SI+RLQQRV  E+ +   G 
Sbjct  178   SSFLLMVLLWGLVHWWPCCSSSQAATASSSSSSFEPTYMLSIARLQQRVVGEI-EGTGGR  236

Query  294   GHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLD  115
               GVLLYEF+R++AA +ELR      G        E  ESLK  FG+LRSGT++I GQLD
Sbjct  237   RQGVLLYEFRRARAATEELREGPGDGG--------EMEESLKLWFGLLRSGTDSIAGQLD  288

Query  114   DFFDEIVEGRKKLLDFCSTHR*RKEE  37
             DF DEIVEGRKKL+D CS H  ++EE
Sbjct  289   DFLDEIVEGRKKLVDLCS-HSLQQEE  313



>emb|CDX88393.1| BnaC06g38370D [Brassica napus]
Length=319

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 233/334 (70%), Gaps = 29/334 (9%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S TNSVNGFY+FL + ++DLE V+LS +FMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDSSCTNSVNGFYTFLNKSMEDLERVYLSNSFMSLQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLD+YMDE+SKLW+VCHV+KS +S ME++ SA  ++TS+LD HHH N    RQV
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKSSLSSMESFCSAAISVTSALDGHHHHNH---RQV  117

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS---VKESKL-NGFNGFRGVLYA  484
             MRAITGCRREA+G+EEENRALME R++      + V +   ++ SK+ NGF+GFRGV+  
Sbjct  118   MRAITGCRREAVGIEEENRALMENRVQRFPFWSEQVTTTAAMESSKIQNGFSGFRGVMNT  177

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
              +++++L L IL  GLVY  P E+    +              ++ RL+QRVA EM   +
Sbjct  178   TKSMNTLFLTILTQGLVYSIPGEAAAAAT---------VTTATAMVRLKQRVAAEME--R  226

Query  303   MGGGHGVLLYEFKRSKAAMdelrge----------lersgggdedGIREKIESLKACFGV  154
              G   GV++YE++RSK A++EL+ E                  E G+RE++ES+K   G 
Sbjct  227   TGVKKGVMMYEYRRSKTAVEELKAELERRWCGGGGRGEEEEEAEKGLRERVESVKVSVGS  286

Query  153   LRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             LRSGTE+++ Q+DDFFDEIV+GRK LL FCS HR
Sbjct  287   LRSGTESVVAQIDDFFDEIVDGRKMLLAFCS-HR  319



>ref|XP_009411904.1| PREDICTED: uncharacterized protein LOC103993535 [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 230/330 (70%), Gaps = 18/330 (5%)
 Frame = -3

Query  1014  AMDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKL  835
              M PSS ++V  F+SFL+ G+D+L+    S  FMS+  LQRA+ALLRS +S L+ LVQKL
Sbjct  74    TMRPSS-DAVRSFFSFLSSGLDELDRCLASNAFMSLHVLQRAVALLRSLNSQLVSLVQKL  132

Query  834   HLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS-HHHLNPQLSR  658
              LP GE+WLDEYMDESS LW+VCHV+K G+SGME+Y S G ++ SSL+    + NP L+ 
Sbjct  133   RLPPGERWLDEYMDESSLLWDVCHVIKLGISGMESYNSHGAHVVSSLEEWRRNPNPHLTL  192

Query  657   QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
             QV RAI+ CRREA+ LEEENR L+ET+  P  LRFD    + +S+LNGFNGFRGVLYA+R
Sbjct  193   QVTRAISVCRREAVRLEEENRVLVETKTNPASLRFDDERVLTDSRLNGFNGFRGVLYALR  252

Query  477   NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
             N SSLLL ILL+G VYC P +       + G     SA+ +S++RL+QR+  E+    +G
Sbjct  253   NASSLLLQILLWGSVYCSPEQ-----GVFHGPACSSSAYAVSVARLRQRLHGEVE--GLG  305

Query  297   GGHGVLLYEFKRSKAAMdelrgeler---------sgggdedGIREKIESLKACFGVLRS  145
             G  G+L++EF+ ++A+ +ELR E+E+            G   G+REK+E LK     LRS
Sbjct  306   GRPGILMHEFRAARASAEELREEMEKGETEGREPEGTAGRGSGLREKVERLKGWLATLRS  365

Query  144   GTENIIGQLDDFFDEIVEGRKKLLDFCSTH  55
             GTEN++ QLDD FDEIVEGRKKLLD CS H
Sbjct  366   GTENLVAQLDDLFDEIVEGRKKLLDICSHH  395



>emb|CDX87498.1| BnaA07g33750D [Brassica napus]
Length=320

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 233/335 (70%), Gaps = 30/335 (9%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S TNSVNGFY+FL + ++DLE V+LS +FMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDSSCTNSVNGFYTFLNKSMEDLERVYLSNSFMSLQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLD+YMDE+SKLW+VCHV+KS +S ME++ SA  ++TSSLD HHH      RQV
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKSSLSSMESFCSAAISVTSSLDGHHH--HHNHRQV  118

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS---VKESKL-NGFNGFRGVLYA  484
             MRAITGCRREA+G+EEENRALME R++      + V +   ++ SK+ NGF+GFRGV+  
Sbjct  119   MRAITGCRREAVGIEEENRALMENRVQRFPFWSEQVTTTAAMESSKIQNGFSGFRGVMNT  178

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
             M+++++L L IL  GLVY  P E+    +     +           RL+QRVA EM   +
Sbjct  179   MKSMNTLFLTILTQGLVYSIPGEAATTVTVTATAMV----------RLKQRVAAEME--R  226

Query  303   MGGGHGVLLYEFKRSKAAMdelrg-----------elersgggdedGIREKIESLKACFG  157
              G   GV++YE++RSK A++EL+              E  G   E G+RE++ES+K   G
Sbjct  227   TGVKKGVMMYEYRRSKTAVEELKAELERRWCCGGGRGEEEGEEAEKGLRERVESVKVSVG  286

Query  156   VLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              LRSGTE+++ Q+DDFFDEIV+GRK LL FCS HR
Sbjct  287   SLRSGTESVVAQIDDFFDEIVDGRKMLLAFCS-HR  320



>ref|XP_002889164.1| hypothetical protein ARALYDRAFT_316696 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65423.1| hypothetical protein ARALYDRAFT_316696 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 182/337 (54%), Positives = 246/337 (73%), Gaps = 34/337 (10%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S TNSVNGFYSFL R ++DLE V+LS NFMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDQSCTNSVNGFYSFLNRSMEDLERVYLSNNFMSLQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH----LNPQL  664
             LPVG+KWLD+YMDE+SKLW+VCHV+KS +S +E++ S+  ++TS+LD H+H    L+PQ+
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKSAISSIESFCSSAISITSTLDGHYHHRRLLSPQI  120

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIE--PLCLRFDGVVSVKESKL-NGFNGFRGV  493
             SRQV+RAI+GCRREA+G+EEENRALME RI+  P         +++ SK+ NGF+GFRGV
Sbjct  121   SRQVIRAISGCRREAVGIEEENRALMENRIQRFPFWSEQVTTTAMESSKIQNGFSGFRGV  180

Query  492   LYAMRNvssllliillyglvYCWPAESNH---PPSSYEGCLFFGSAFMISISRLQQRVAE  322
             +  M+N++SLLL+IL+ GLVY  P ++     PP               ++ RL+QRVA 
Sbjct  181   MNTMKNINSLLLVILMQGLVYYIPGDTTAATVPPG--------------TMVRLKQRVAA  226

Query  321   EMNQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedG-------IREKIESLKAC  163
             EM   ++G   G+++YE++RSK AM+EL+ ELER   G           +RE++E+LK  
Sbjct  227   EME--RIGMRKGMMMYEYRRSKTAMEELKAELERRCCGGGGEEEAAEKGLRERVENLKGS  284

Query  162   FGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              G LR+GTE+I+ Q+DDFFD+IV+GRK LLD+CS HR
Sbjct  285   VGNLRNGTESIVAQIDDFFDDIVDGRKMLLDYCS-HR  320



>ref|XP_011092344.1| PREDICTED: uncharacterized protein LOC105172557 [Sesamum indicum]
Length=325

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 224/322 (70%), Gaps = 12/322 (4%)
 Frame = -3

Query  993  NSVNGFYSFLTRGIDDLECVFLSTNF-MSIQFLQRALALLRSFHSHLILLVQKLHLPVGE  817
            +SV+ F +FL R +D+L+ +FLS NF +S  FLQ  L+ LRSFHSHL LLV  L+LP+G+
Sbjct  8    SSVHAFLNFLARDLDNLDHLFLSHNFILSAAFLQHVLSSLRSFHSHLTLLVHNLNLPLGD  67

Query  816  KWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAIT  637
            KWLDEYMDESS+LWE  H+LKSG+S  E Y S+  N+ S L  H  LNPQLSRQV+RAI 
Sbjct  68   KWLDEYMDESSRLWEASHLLKSGLSATEKYSSSAANIPSLLHDHRALNPQLSRQVIRAIN  127

Query  636  GCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvsslll  457
            GC+RE   L+EEN++  E +++ L LR    V + ESK N +NGFRGVL+AMRNV++LLL
Sbjct  128  GCQREITALQEENKSTAEAKLQTLSLRLKETV-LAESKFNKYNGFRGVLHAMRNVNTLLL  186

Query  456  iillyglvYCWPAESNHPPSSYEGCLFFGSA-FMISISRLQQRVAEEMNQRQMGGGHGVL  280
            +ILL GLVY WP  S +  + +EG   FGS  FM+S  +L QR+A  M++ Q+    G+L
Sbjct  187  LILLSGLVYYWPEMSFYQSTHHEGSSLFGSTKFMVSTGKLHQRIANAMSRLQVQP--GIL  244

Query  279  LYEFKRSKAAMdelrgelers------gggdedGIREKIESLKACFGVLRSGTENIIGQL  118
            LYE +R+K AMDE++ E+ER            D I EK+  L++C   L+ G E I+GQ+
Sbjct  245  LYELQRAKFAMDEVKMEMERVLDHDYEVDDQSDVIDEKVGELRSCLAGLQCGVEEIVGQV  304

Query  117  DDFFDEIVEGRKKLLDFCSTHR  52
            DD  DEIVEGRKKLLD CS HR
Sbjct  305  DDLLDEIVEGRKKLLDMCS-HR  325



>ref|NP_683505.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE36035.1| uncharacterized protein AT1G77855 [Arabidopsis thaliana]
Length=317

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 243/334 (73%), Gaps = 31/334 (9%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S +NSVNGFYSFL R ++DLE V++S NFMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDQSCSNSVNGFYSFLNRSMEDLERVYISNNFMSLQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH----LNPQL  664
             LPVG+KWLD+YMDE+SKLW+VCHV+KS +S +E++ S+  ++TS+LD H+H    L+PQ+
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKSAISTIESFCSSAISITSTLDGHYHHRRLLSPQI  120

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS--VKESKL-NGFNGFRGV  493
             SRQV+RAI+GCRREA+G+EEENRALME RI+      + V +  ++ SK+ NGF+GFRGV
Sbjct  121   SRQVIRAISGCRREAVGIEEENRALMENRIQRFPFWSEQVTTTGMESSKIQNGFSGFRGV  180

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMN  313
             +  M+N++SLLL+IL+ GLVY  P ++  P                ++ RL+QRVA EM 
Sbjct  181   MNTMKNINSLLLVILMQGLVYYIPGDTTVPTG--------------TMMRLKQRVAAEME  226

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrg-------elersgggdedGIREKIESLKACFGV  154
               ++G   G+++YE++RSK AM+EL+                 E G+RE+IE+LK   G 
Sbjct  227   --RIGVRKGMMMYEYRRSKTAMEELKVELERRCCGGGGEEEAVEKGLRERIENLKGSVGS  284

Query  153   LRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             LR+GTE+I+ Q+DDFFD+IV+GRK LLD+CS HR
Sbjct  285   LRNGTESIVAQIDDFFDDIVDGRKMLLDYCS-HR  317



>gb|AAT06471.1| At1g77855 [Arabidopsis thaliana]
 dbj|BAD94206.1| putative protein [Arabidopsis thaliana]
Length=317

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 243/334 (73%), Gaps = 31/334 (9%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S +NSVNGFYSFL R ++DLE V++S NFMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDQSCSNSVNGFYSFLNRSMEDLERVYISNNFMSLQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH----LNPQL  664
             LPVG+KWLD+YMDE+SKLW+VCHV++S +S +E++ S+  ++TS+LD H+H    L+PQ+
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIRSAISTIESFCSSAISITSTLDGHYHHRRLLSPQI  120

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS--VKESKL-NGFNGFRGV  493
             SRQV+RAI+GCRREA+G+EEENRALME RI+      + V +  ++ SK+ NGF+GFRGV
Sbjct  121   SRQVIRAISGCRREAVGIEEENRALMENRIQRFPFWSEQVTTTGMESSKIQNGFSGFRGV  180

Query  492   LYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMN  313
             +  M+N++SLLL+IL+ GLVY  P ++  P                ++ RL+QRVA EM 
Sbjct  181   MNTMKNINSLLLVILMQGLVYYIPGDTTVPTG--------------TMMRLKQRVAAEME  226

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrg-------elersgggdedGIREKIESLKACFGV  154
               ++G   G+++YE++RSK AM+EL+                 E G+RE+IE+LK   G 
Sbjct  227   --RIGVRKGMMMYEYRRSKTAMEELKVELERRCCGGGGEEEAVEKGLRERIENLKGSVGS  284

Query  153   LRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             LR+GTE+I+ Q+DDFFD+IV+GRK LLD+CS HR
Sbjct  285   LRNGTESIVAQIDDFFDDIVDGRKMLLDYCS-HR  317



>gb|KHN48097.1| hypothetical protein glysoja_015567 [Glycine soja]
Length=284

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 217/288 (75%), Gaps = 9/288 (3%)
 Frame = -3

Query  915  MSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGM  736
            MSIQF+    + L+SFHS L +LVQ+L L VG KWL+EYMDESS+LW++CHVLKS +SG+
Sbjct  1    MSIQFISEVFSSLQSFHSQLTILVQRLCLSVGGKWLNEYMDESSRLWDICHVLKSAISGI  60

Query  735  ENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPL--C  562
            ENY S G N+ SS+D +H+L P+LS QV+RAI  C+RE++GL EEN++LMETR + L  C
Sbjct  61   ENYSSTGSNIASSVDGYHNLTPELSHQVIRAINICQRESLGLVEENKSLMETRTQALSQC  120

Query  561  LRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGC  382
            L  +  +   ESKLN FNGFRGVL AMR+VSSLLL+ILL G+ YCW + S      YEG 
Sbjct  121  LNQNMCM---ESKLNEFNGFRGVLCAMRSVSSLLLMILLCGVAYCWSS-SCFDQQGYEGH  176

Query  381  LFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelersg-ggd  205
            + FGS F++S++RLQQ+VA+E++Q    G  G+LL EF+++K +M+EL+ ELER      
Sbjct  177  MVFGSGFVVSMARLQQKVAQEIDQN--NGQQGILLLEFQQAKISMEELKVELERMVGYDA  234

Query  204  edGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
            +  I+ K+++LK CFG+LR G E I GQLDDFFDEIVEGRKKLL+ CS
Sbjct  235  QHEIQAKVDNLKRCFGLLRCGVETITGQLDDFFDEIVEGRKKLLNMCS  282



>ref|XP_009106428.1| PREDICTED: uncharacterized protein LOC103832214 [Brassica rapa]
Length=320

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 232/334 (69%), Gaps = 28/334 (8%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S TNSVNGFY+FL + ++DLE V+LS +FMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDSSCTNSVNGFYTFLNKSMEDLERVYLSNSFMSLQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLD+YMDE+SKLW+VCHV+KS +S ME++ SA  ++ SSLD HHH      RQV
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKSSLSSMESFCSAAISVASSLDGHHH--HHNHRQV  118

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS---VKESKL-NGFNGFRGVLYA  484
             MRAITGCRREA+G+EEENRALME R++      + V +   ++ SK+ NGF+GFRGV+  
Sbjct  119   MRAITGCRREAVGIEEENRALMENRVQRFPFWSEQVTTTAAMESSKIQNGFSGFRGVMNT  178

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQ  304
             M+++++L L IL  GLVY  P E+              +    ++ RL+QRVA EM   +
Sbjct  179   MKSMNTLFLTILTQGLVYSIPGETTATVM---------ATTATAMVRLKQRVAAEME--R  227

Query  303   MGGGHGVLLYEFKRSKAAMdelrg----------elersgggdedGIREKIESLKACFGV  154
              G   GV++YE++RSK A++EL+                G   E G+RE++ES+K   G 
Sbjct  228   TGVKKGVMMYEYRRSKTAVEELKAELERRWCCGGGRGEEGEEAERGLRERVESVKVSVGS  287

Query  153   LRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             LRSGTE+++ Q+DDFFDEIV+GRK LL FCS HR
Sbjct  288   LRSGTESVVAQIDDFFDEIVDGRKMLLAFCS-HR  320



>ref|XP_010471985.1| PREDICTED: protein BPS1, chloroplastic-like [Camelina sativa]
Length=322

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 242/335 (72%), Gaps = 28/335 (8%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S TNSVNGFYSFL R ++DLE V+LS NFMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDQSYTNSVNGFYSFLNRSMEDLERVYLSDNFMSVQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH----LNPQL  664
             LPVG+KWLD+YMDE+SKLW+VCHV+KS +S +E++ S+  ++ S+LD H+H    L+PQ+
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKSAISSVESFCSSALSIASTLDGHYHHRRLLSPQI  120

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESK--LNGFNGFRGVL  490
             SRQV+RAITGCRREA+G+EEENRALME RI+      + V +  ES    NGF+GFRGV+
Sbjct  121   SRQVIRAITGCRREAVGIEEENRALMENRIQRFPFWSEQVTTTMESSKIQNGFSGFRGVM  180

Query  489   YAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQ  310
               M+N++SLLL+IL+ GLVY  P ++    ++           M+   RL+QRVA EM  
Sbjct  181   NTMKNINSLLLVILMQGLVYYIPGDTTAAAAAT-------GTMMV---RLKQRVAAEME-  229

Query  309   RQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedG---------IREKIESLKACFG  157
              ++G   G+++YE++RSK AM+EL+ ELER   G             +RE++ESLK   G
Sbjct  230   -RIGTRKGMMMYEYRRSKTAMEELKAELERRCCGGGGRGEEEAAEKGLRERVESLKGYIG  288

Query  156   VLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              LR+GTE+ + Q+DDFFD+IV+GRK LLD+CS HR
Sbjct  289   NLRNGTESFVAQIDDFFDDIVDGRKLLLDYCS-HR  322



>gb|KCW70533.1| hypothetical protein EUGRSUZ_F03734, partial [Eucalyptus grandis]
Length=267

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/261 (61%), Positives = 189/261 (72%), Gaps = 23/261 (9%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTN------------FMSIQFLQRALALLRSF  868
             MDPSST+SVNGFY+FLTRGIDDLE  +L+++             +SIQFLQRALALLRSF
Sbjct  1     MDPSSTSSVNGFYTFLTRGIDDLERSYLASSNGGGGGGGGGGGAVSIQFLQRALALLRSF  60

Query  867   HSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDS  688
             HS L LLVQKLHLPVG+KWLDEYMDESSKLW+ CH+LKSGVS +E++YS+  ++ +SLD 
Sbjct  61    HSGLTLLVQKLHLPVGDKWLDEYMDESSKLWDACHLLKSGVSALESFYSSALDIVASLDL  120

Query  687   HHHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLC-LRFD--GVVSVKESKLN  517
             H HL+PQLSRQ+ RAI  C REA GLEEENRAL+E R+  L  LRFD     +  E +LN
Sbjct  121   HRHLSPQLSRQLARAIAACGREAAGLEEENRALVEARMGQLSRLRFDDCAAAAAVEPRLN  180

Query  516   GFNGFRGVLYAMRNvssllliillyglvYCWPAES--------NHPPSSYEGCLFFGSAF  361
             GFNGFRGVLYAMRNVSSLLL +LL GLVY  P +S                 C  FGS  
Sbjct  181   GFNGFRGVLYAMRNVSSLLLTVLLSGLVYHCPEQSFFSARPYGGGGGEYERPCTLFGSGI  240

Query  360   MISISRLQQRVAEEMNQRQMG  298
             MIS +RL+QR+ EEMN+R  G
Sbjct  241   MISAARLEQRIGEEMNRRGSG  261



>ref|XP_010416747.1| PREDICTED: uncharacterized protein LOC104702570 [Camelina sativa]
Length=324

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 179/338 (53%), Positives = 242/338 (72%), Gaps = 32/338 (9%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S TNSVNGFYSFL R ++DLE V+LS NFMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDQSYTNSVNGFYSFLNRSMEDLERVYLSDNFMSVQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH----LNPQL  664
             LPVG+KWLD+YMDE+SKLW+VCHV+K  +S +E++ S+  ++ S+LD H+H    L+PQ+
Sbjct  61    LPVGDKWLDDYMDETSKLWDVCHVIKPAISSVESFCSSALSIASTLDGHYHHRRLLSPQI  120

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESK--LNGFNGFRGVL  490
             SRQV+RAITGCRREA+G+EEENRALME RI+      + V +  ES    NGF+GFRGV+
Sbjct  121   SRQVIRAITGCRREAVGIEEENRALMENRIQRFPFWSEQVTTTMESSKIQNGFSGFRGVM  180

Query  489   YAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQ  310
               M+N++SLLL+IL+ GLVY  P ++    ++           M+   RL+QRVA EM  
Sbjct  181   NTMKNINSLLLVILMQGLVYYIPGDTTTAATT--------GTMMV---RLKQRVAAEME-  228

Query  309   RQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedG------------IREKIESLKA  166
              ++G   G+++YE++RSK AM+EL+ ELER   G                ++E++ESLK 
Sbjct  229   -RIGTRKGMMMYEYRRSKTAMEELKAELERRCCGGGGRGEEEEEEAAEKGLKERVESLKG  287

Query  165   CFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
               G LR+GTE+++ Q+DDFFD+IV+GRK LLD+CS HR
Sbjct  288   YIGNLRNGTESVVAQIDDFFDDIVDGRKLLLDYCS-HR  324



>ref|XP_010428871.1| PREDICTED: uncharacterized protein LOC104713461 [Camelina sativa]
Length=320

 Score =   279 bits (713),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 237/338 (70%), Gaps = 36/338 (11%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD S TNSVNGFYSFL R ++DLE V+LS NFMS+QFLQR + LLR+ HSHL LLVQKL+
Sbjct  1     MDQSYTNSVNGFYSFLNRSMEDLERVYLSDNFMSVQFLQRVICLLRTSHSHLTLLVQKLN  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH----LNPQL  664
             LPVG+KWLD+YMDE+SKLW+V HV+KS +S +E++ S+  ++ S+LD H+H    L+PQ+
Sbjct  61    LPVGDKWLDDYMDETSKLWDVFHVIKSAISSIESFCSSALSIASTLDGHYHHRRLLSPQI  120

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESK--LNGFNGFRGVL  490
             SRQV+RAI+GCRREA+G+EEENRALME RI+      + V +  ES    NGF+GFRGV+
Sbjct  121   SRQVIRAISGCRREAVGVEEENRALMENRIQRFPFWSEQVTTTMESSKIQNGFSGFRGVM  180

Query  489   YAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQ  310
               M+N++SLLL+IL+ GLVY  P ++                 M+   RL+QRVA EM  
Sbjct  181   NTMKNINSLLLVILMQGLVYYIPGDTT------------TGTMMV---RLKQRVAAEME-  224

Query  309   RQMGGGHGVLLYEFKRSKAAMdelrg------------elersgggdedGIREKIESLKA  166
              ++G   G+++YE++RSK AM+EL+               E      E  +RE++ESLK 
Sbjct  225   -RIGTRKGMMMYEYRRSKTAMEELKAELERRCCGGGGRGEEEEEEAAEKRLRERVESLKW  283

Query  165   CFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
               G LR+GTE+++ Q+DDFFD+IV+GRK LLD+CS HR
Sbjct  284   YIGNLRNGTESVVAQIDDFFDDIVDGRKLLLDYCS-HR  320



>ref|XP_006471021.1| PREDICTED: uncharacterized protein LOC102611551 [Citrus sinensis]
Length=250

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 194/253 (77%), Gaps = 7/253 (3%)
 Frame = -3

Query  798  MDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRREA  619
            MDESS+LWE CHVLK+GVS MENYYS+G N+ SS D  HH NPQ+SRQ +RAI GC+RE 
Sbjct  1    MDESSRLWEACHVLKTGVSSMENYYSSGANIASSFDGLHHFNPQVSRQAIRAIMGCQREI  60

Query  618  MGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyg  439
            + LEEEN++LMETR+  L L+ D    ++ESK N FNGFRGVLYAMRNVS+LLL+ILL G
Sbjct  61   VVLEEENKSLMETRVGQLSLKLDDENIMQESKFNAFNGFRGVLYAMRNVSTLLLMILLSG  120

Query  438  lvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRS  259
            LV+ WP +S+     YEG + FGS FM+S++RLQQRVA E++  Q+GG  G++L+EF+++
Sbjct  121  LVFYWP-KSSFCQEGYEGHIIFGSGFMVSLARLQQRVANEIDH-QIGGQPGLMLFEFRKA  178

Query  258  KAAMdelrgelersgggde----dGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVE  91
            K AM++L+ ELE+    +     + I+EKIE LK CFG+LR G E I+GQ+DD FDEIVE
Sbjct  179  KTAMEDLKEELEKVVEFESEEFDEQIQEKIECLKNCFGLLRCGVETIVGQIDDLFDEIVE  238

Query  90   GRKKLLDFCSTHR  52
            GRKKLLD C  HR
Sbjct  239  GRKKLLDMCG-HR  250



>ref|XP_006416238.1| hypothetical protein EUTSA_v10010029mg [Eutrema salsugineum]
 gb|ESQ34591.1| hypothetical protein EUTSA_v10010029mg [Eutrema salsugineum]
Length=320

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 234/339 (69%), Gaps = 38/339 (11%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSS NSVNGFYSFL R +DDLE V+LS NFMS+ FLQRAL LLR+ HSHL LLVQKL 
Sbjct  1     MDPSSANSVNGFYSFLNRSMDDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKLQ  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH---LNPQLS  661
             LP+                + C V+KS VS +EN+ SAG ++ S+LD HH+   L+PQLS
Sbjct  61    LPL----------------KACLVIKSAVSSIENFSSAGISIASTLDGHHNHRRLSPQLS  104

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVS-----VKESKL-NGFNGFR  499
             RQV+RAI+ CRR+A+G+EEENRALME R++      +  V+        +KL NGF GFR
Sbjct  105   RQVIRAISVCRRDAIGIEEENRALMENRVQRFPFWSEQTVANATAIESSTKLQNGFCGFR  164

Query  498   GVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFG-SAFMISISRLQQRVAE  322
             GVLYA RN+SSLLL++L+ GLVYC+P ++    +  +     G   F  ++ RLQQRVA 
Sbjct  165   GVLYATRNMSSLLLMVLINGLVYCFPGDATMSQTQTQTQTQVGVGGFAGAMGRLQQRVAA  224

Query  321   EMNQRQMGGGHGVLLYEFKRSKAAMdelrgeler---------sgggdedGIREKIESLK  169
             E+   +MG   G+L++E++RSKAA++EL+ ELER         S   +E  +RE++E+LK
Sbjct  225   EVG--RMGVRKGILMHEYRRSKAALEELKAELERRFYGGGGGDSEVEEERELRERVENLK  282

Query  168   ACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
               FG LR+ TE+I+ Q+DDFFDEIVEGRKKLLDFCS HR
Sbjct  283   GYFGNLRNVTESIVAQIDDFFDEIVEGRKKLLDFCS-HR  320



>ref|XP_008456067.1| PREDICTED: uncharacterized protein LOC103496110 [Cucumis melo]
Length=394

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 226/336 (67%), Gaps = 25/336 (7%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            ++GFY FL+  +DDL+  FLS++FMS+ FLQ+ L+LLR+ HS LI L Q+LHLPVG KWL
Sbjct  60   LHGFYHFLSHELDDLDHAFLSSDFMSLHFLQKVLSLLRTLHSQLIQLGQRLHLPVGGKWL  119

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHL--NPQLSRQVMRAITG  634
            DEYMDESS+LWE   VLKSG+S ME ++     + SSL   H L  NP+ SR+V+RAIT 
Sbjct  120  DEYMDESSRLWEASQVLKSGISRMEVFHVEASAIASSLQDPHFLRFNPRASRRVLRAITD  179

Query  633  CRREAMGLEEENRALMETRIEPLCLR-FDGVVSV-----KESKLNGFNGFRGVLYAMRNv  472
              R   GLEEENR+LM TRI PL L  F+G  S+       SKLN FNGFRGVL+A++N+
Sbjct  180  FERNVFGLEEENRSLMNTRIPPLSLLCFNGGSSMSTGMGSTSKLNAFNGFRGVLHAVKNI  239

Query  471  ssllliillyglvYCWPAESNHPPSSYEG------CLFFGSAFMISISRLQQRVAEEMNQ  310
            SSLLL+ILL GLVYCWP  S H  +  E          F S+F+ S+ RL+QRVA E+ +
Sbjct  240  SSLLLMILLCGLVYCWPESSFHGSNGIENEEDQHQRTMFSSSFVASMERLKQRVANEIER  299

Query  309  RQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIES----------LKACF  160
              +    G+LL+EF+ +KAAM+ L+ ELE+    DE+   E+ E           L + F
Sbjct  300  VDVQPV-GILLFEFREAKAAMEGLKVELEKGLEEDEEEEEEEEEEKVEIEEKIERLNSWF  358

Query  159  GVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
            G LR G + IIGQLDDFFDEIVEGRKKLLD C+ +R
Sbjct  359  GSLRIGVDAIIGQLDDFFDEIVEGRKKLLDMCTHNR  394



>ref|XP_004146285.1| PREDICTED: uncharacterized protein LOC101211523 [Cucumis sativus]
 ref|XP_004159884.1| PREDICTED: uncharacterized protein LOC101227273 [Cucumis sativus]
 gb|KGN57591.1| hypothetical protein Csa_3G221740 [Cucumis sativus]
Length=339

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 174/340 (51%), Positives = 219/340 (64%), Gaps = 19/340 (6%)
 Frame = -3

Query  1017  MAMDPSST-NSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQ  841
             MA   S T  S++GFY FL+  +DDL+  F+S++FMS+ FLQ+ L+LLR+ HS LI L Q
Sbjct  1     MATSSSCTATSLHGFYHFLSHELDDLDHAFVSSDFMSLHFLQKVLSLLRTLHSQLIQLGQ  60

Query  840   KLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHL--NPQ  667
             +LHLPVG KWLDEYMDESS+LWE   VLKSG+S ME ++     + SSL   H L  NP+
Sbjct  61    RLHLPVGGKWLDEYMDESSRLWEASQVLKSGISRMEVFHVEASAIASSLQDPHFLRFNPR  120

Query  666   LSRQVMRAITGCRREAMGLEEENRALMETRIEPLCL------RFDGVVSVKESKLNGFNG  505
              SR+V+RAIT   R   GLEEENR+LM TRI PL L                SKLN FNG
Sbjct  121   ASRRVLRAITDFERNVFGLEEENRSLMNTRIPPLSLLCFNGSSSVSSGMGSTSKLNAFNG  180

Query  504   FRGVLYAMRNvssllliillyglvYCWPAESNHPPS------SYEGCLFFGSAFMISISR  343
             FRGVL+A++N+SSLLL+ILL GLVYCWP    H  +             F S+F+ S+ R
Sbjct  181   FRGVLHAVKNISSLLLMILLCGLVYCWPESIFHGSNGIGNEEDQHQRTMFSSSFIASMER  240

Query  342   LQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAM---delrgelersgggdedGIREKIESL  172
             L+QRVA E+ +  +    G+LL+EF+ +KAAM        +       +E  I EKIE L
Sbjct  241   LKQRVANEIERVDVQPV-GILLFEFREAKAAMEGLKVELEKGLEEDDEEEVEIEEKIERL  299

Query  171   KACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
              + FG LR G + IIGQLDDFFDEIVEGRKKLLD C+ +R
Sbjct  300   NSWFGSLRIGVDAIIGQLDDFFDEIVEGRKKLLDMCTHNR  339



>gb|EMT16172.1| hypothetical protein F775_05383 [Aegilops tauschii]
Length=314

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 213/324 (66%), Gaps = 22/324 (7%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLST---NFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGE  817
            +NGFYS +  G+D L     S+    FMS  FLQ+A ALLRS HS L+ LVQ+LHLP GE
Sbjct  1    MNGFYSSIAHGLDALHATLASSPDAAFMSAPFLQQAAALLRSLHSQLVHLVQRLHLPPGE  60

Query  816  KWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHH-HLNPQLSRQVMRAI  640
             WLDEYMDE+S+LWE C V+K+G S ++ Y ++   + ++LD    + NP  +RQVMRAI
Sbjct  61   SWLDEYMDETSRLWEACQVVKAGASALDTYCASAARIDAALDDWLCNPNPHTARQVMRAI  120

Query  639  TGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssll  460
               RR+A+GLE+ENRAL ETRI+P  L  D    V E KLN FNGFRGVLYA+RN SS L
Sbjct  121  NAPRRQAVGLEQENRALAETRIDPASLLLDDRSPV-EFKLNAFNGFRGVLYALRNASSFL  179

Query  459  liillyglvYCWP--AESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGH-  289
            L++L+ G V C P  A   HP  +       G+ ++ S+ RL+QRVAEEM    + G H 
Sbjct  180  LMLLVSGTVSCLPDLACCAHPFRTS------GAGYVSSMGRLRQRVAEEME--AVAGEHS  231

Query  288  --GVLLYEFKRSKAAMdelrgelersggg---dedGIREKIESLKACFGVLRSGTENIIG  124
              G+++YEF++++A ++ L+ E +R       D   I E++E +K    +LRSG E ++G
Sbjct  232  GSGIMMYEFRQARAGIESLKTEFDRIVAMGYGDPGEITERVEIIKGWVRMLRSGAEGVVG  291

Query  123  QLDDFFDEIVEGRKKLLDFCSTHR  52
            +LDDFFDEIVEGRK L D CS HR
Sbjct  292  ELDDFFDEIVEGRKMLSDLCS-HR  314



>ref|XP_010236397.1| PREDICTED: uncharacterized protein LOC100827395 [Brachypodium 
distachyon]
Length=316

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 212/325 (65%), Gaps = 22/325 (7%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTN------FMSIQFLQRALALLRSFHSHLILLVQKLHLP  826
            +NGFYS +  G+D+L     +++      F+S  FLQ+A ALLRS HS L+ LVQ+LHLP
Sbjct  1    MNGFYSSIAHGLDELHGTLAASSSSPEGAFVSAPFLQQAAALLRSLHSQLVHLVQRLHLP  60

Query  825  VGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHH-HLNPQLSRQVM  649
             GE WLDEYMDE+S+LWE C V+K+G + ++ Y ++   + ++ D      NP  +RQVM
Sbjct  61   PGESWLDEYMDETSRLWEACQVVKAGATALDTYCASATRIDAAFDDWLCSPNPHTARQVM  120

Query  648  RAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvs  469
            RAI   RR+A+GLE+ENRAL E RI+P  L  D    V E KLN FNGFRGVLYA+RN S
Sbjct  121  RAINAPRRQAVGLEQENRALAEARIDPASLLLDDRSPV-EFKLNAFNGFRGVLYALRNAS  179

Query  468  sllliillyglvYCWPAESNHPPSSYEGCLF--FGSAFMISISRLQQRVAEEMNQ-RQMG  298
            S LL+IL+ G V C P     P       +F   G+ ++ S+ RL+QRVAEEM       
Sbjct  180  SFLLMILISGTVSCLPDLGCAP-------MFRATGAGYVSSMGRLRQRVAEEMEAVAGQH  232

Query  297  GGHGVLLYEFKRSKAAMdelrge---lersgggdedGIREKIESLKACFGVLRSGTENII  127
             G GV++YEF++++A ++ L+ E   +  +G  D   I E++E +K   GVL+SG E+++
Sbjct  233  SGSGVMMYEFRQARAGIESLKAEFDRVIATGYADPGEIAERVEIIKGWVGVLQSGAESVV  292

Query  126  GQLDDFFDEIVEGRKKLLDFCSTHR  52
            G+LDDFFDEIVEGRK L D CS HR
Sbjct  293  GELDDFFDEIVEGRKMLSDLCS-HR  316



>ref|XP_010065458.1| PREDICTED: uncharacterized protein LOC104452690 [Eucalyptus grandis]
 gb|KCW62964.1| hypothetical protein EUGRSUZ_G00561 [Eucalyptus grandis]
Length=349

 Score =   257 bits (656),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 223/340 (66%), Gaps = 31/340 (9%)
 Frame = -3

Query  1002  SSTNSVNGFYSFLTRGIDDLECVF------------------LSTNFMSIQFLQRALALL  877
             ++T+SV+GFY+FLT+ +DDL   F                     +FMSIQ+LQ+ L  L
Sbjct  13    ATTSSVSGFYNFLTQALDDLNSSFPSSSSSSSSSSSSSSSSAYGNSFMSIQYLQQVLHSL  72

Query  876   RSFHSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSS  697
             RS HS L  LV +L LPVGEKWLDEYMDES+++WE C+V+K G+S ME Y +   N+ SS
Sbjct  73    RSVHSRLTSLVHELRLPVGEKWLDEYMDESARIWEACNVIKFGLSRMERYCTTASNVVSS  132

Query  696   -LDSH-HHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESK  523
              L  H HHL+    RQ +RAI  CRREA+ LEEEN+ LME R++PL L F+  VS+ ES 
Sbjct  133   ILGLHDHHLD---RRQALRAIDECRREALVLEEENKHLMEARVQPLSLCFNENVSL-ESN  188

Query  522   LNGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISR  343
              NGF+GFRG L+AMRNVSSLLL++LL GLVY WP ES       EG   FGS FMIS SR
Sbjct  189   FNGFSGFRGALFAMRNVSSLLLMVLLAGLVYTWP-ESIFHQGGNEGHAVFGSNFMISSSR  247

Query  342   LQQRVAEEMNQ-RQMGGGHGVLLYEFKRSKAAMde-----lrgelersgggdedGIREKI  181
             +QQR+A E+++  +      +LLYEF+R++  M+E      RGE        ++ ++++ 
Sbjct  248   IQQRMASEIHRMSRRSPPPPILLYEFRRARHGMEELRGVLERGEEGEHHQLGQEHVQDRA  307

Query  180   ESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
             E+LK   G LRSG E+++ QLDD FDEIVE RK LLD CS
Sbjct  308   ENLKGLIGCLRSGVESVMVQLDDLFDEIVEARKNLLDLCS  347



>gb|AAF17700.1|AC009243_27 F28K19.7 [Arabidopsis thaliana]
Length=735

 Score =   266 bits (681),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 241/356 (68%), Gaps = 56/356 (16%)
 Frame = -3

Query  1002  SSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV  823
             S +NSVNGFYSFL R ++DLE V++S NFMS+QFLQR + LLR+ HSHL LLVQKL+LPV
Sbjct  397   SCSNSVNGFYSFLNRSMEDLERVYISNNFMSLQFLQRVICLLRTSHSHLTLLVQKLNLPV  456

Query  822   GEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHH----LNPQLSR-  658
             G+KWLD+YMDE+SKLW+VCHV+KS +S +E++ S+  ++TS+LD H+H    L+PQ+SR 
Sbjct  457   GDKWLDDYMDETSKLWDVCHVIKSAISTIESFCSSAISITSTLDGHYHHRRLLSPQISRQ  516

Query  657   ------------------------QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFD  550
                                     QV+RAI+GCRREA+G+EEENRALME RI+      +
Sbjct  517   VYTRKTMLFFWTVTNYFWNIFDMGQVIRAISGCRREAVGIEEENRALMENRIQRFPFWSE  576

Query  549   GVVS--VKESKL-NGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCL  379
              V +  ++ SK+ NGF+GFRGV+  M+N++SLLL+IL+ GLVY  P ++  P        
Sbjct  577   QVTTTGMESSKIQNGFSGFRGVMNTMKNINSLLLVILMQGLVYYIPGDTTVPTG------  630

Query  378   FFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrg-------eler  220
                     ++ RL+QRVA EM   ++G   G+++YE++RSK AM+EL+            
Sbjct  631   --------TMMRLKQRVAAEM--ERIGVRKGMMMYEYRRSKTAMEELKVELERRCCGGGG  680

Query  219   sgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
                  E G+RE+IE+LK   G LR+GTE+I+ Q+DDFFD+IV+GRK LLD+CS HR
Sbjct  681   EEEAVEKGLRERIENLKGSVGSLRNGTESIVAQIDDFFDDIVDGRKMLLDYCS-HR  735



>gb|EYU35452.1| hypothetical protein MIMGU_mgv1a010516mg [Erythranthe guttata]
Length=310

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 210/312 (67%), Gaps = 18/312 (6%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLS-TNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKW  811
            V  F +FLT+ +D+L+ +FLS TNF+S +FLQ+ L+ LR+FHS L +LVQKL+LP+GEKW
Sbjct  12   VTSFLNFLTKEVDNLDNLFLSHTNFLSSKFLQQVLSSLRNFHSELTILVQKLNLPIGEKW  71

Query  810  LDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGC  631
            LDEYMDE+S LWE CHVLK+GVS MENY S+G N+ S L     +N QLS QV+R+I  C
Sbjct  72   LDEYMDETSMLWESCHVLKAGVSSMENYISSGANIASLL-----VNRQLSSQVIRSIDRC  126

Query  630  RREAMGLEEENRALMETR-IEPL-CLRFDGVVSVKESKLNGFNGFRGVLYAMRNvsslll  457
            +RE   L+EEN++++ET+ I+ L  LRF GV    ESK N +NGFRGVL AMR+VS+LLL
Sbjct  127  QREMTALQEENKSIVETKLIQTLSSLRF-GVNKENESKFNKYNGFRGVLCAMRSVSTLLL  185

Query  456  iillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLL  277
             IL+ GLVY  P + +    S EG    G  + I  + L +R+ E M  R  G G G+LL
Sbjct  186  EILISGLVYFLPEKMSF---SQEGLTCTG-GYQIG-ANLHRRMVEGM-IRFNGSGPGILL  239

Query  276  YEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEI  97
            +E ++++ A+             +   I EK+  LK CF  L+ G E IIGQLDDFFDEI
Sbjct  240  FELQKARFAV---DEVKMEVEMENYSDIDEKVGKLKNCFDDLKCGVEGIIGQLDDFFDEI  296

Query  96   VEGRKKLLDFCS  61
            V+GRK + D CS
Sbjct  297  VDGRKMVFDMCS  308



>ref|XP_010538968.1| PREDICTED: uncharacterized protein LOC104813135 [Tarenaya hassleriana]
Length=311

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 159/326 (49%), Positives = 209/326 (64%), Gaps = 26/326 (8%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MD  S NS NGFYSF+ RG++DLE V+ S +FMS+QFLQ +L+LLRSFH+ L  L  KLH
Sbjct  1     MDFPSANSANGFYSFMARGLEDLERVYTSNSFMSVQFLQSSLSLLRSFHAQLTRLALKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LP G KWLDEYMDESS+LW+ CHV+KSGVS +E + +A   L   LD           ++
Sbjct  61    LPAGGKWLDEYMDESSRLWDACHVIKSGVSAVEGFSTAALGL---LDRRQ--------EM  109

Query  651   MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKE-SKL-NGFNGFRGVLYAMR  478
             +RAI+GC+REAMGLEEENR+L+E  ++ L    D   +V + SKL NGFNGFRGVL+A+R
Sbjct  110   LRAISGCKREAMGLEEENRSLLENHLQTLPFWPDEATTVMDSSKLQNGFNGFRGVLHALR  169

Query  477   Nvss-llliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQM  301
              VSS LL I++   +  C    S+ P +        GS    ++ RLQQR+  EM + + 
Sbjct  170   GVSSLLLTILVYGVVYSC----SSDPAAVQTRFPAVGSGLTAAMDRLQQRMTAEMGRGEA  225

Query  300   GGGHGVLLYEFKRSK------AAMdelrgelersgggdedGIREKIESLKACFGVLRSGT  139
                 G+L+YE++RS+       A  E            E   RE++E +K    V+ SG 
Sbjct  226   SA--GILMYEYRRSQAAVEELRAEAEAERRSSGGEAAAEKWWRERVEGVKGWLRVVSSGA  283

Query  138   ENIIGQLDDFFDEIVEGRKKLLDFCS  61
             EN+IGQ+DDFFDEIVEGR+KLLDFCS
Sbjct  284   ENLIGQIDDFFDEIVEGREKLLDFCS  309



>gb|KDP32730.1| hypothetical protein JCGZ_12022 [Jatropha curcas]
Length=211

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 173/209 (83%), Gaps = 12/209 (6%)
 Frame = -3

Query  657  QVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMR  478
            +V+RAI+GCRREA GLEEENRALMETRI+PL LRFD  VS+ ESKLNGFNGFRGVLYAMR
Sbjct  8    KVIRAISGCRREAAGLEEENRALMETRIQPLSLRFDEKVSI-ESKLNGFNGFRGVLYAMR  66

Query  477  NvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMG  298
            NVSSLLL+ILLYGLVYCWP ES+     YEGCLFFGSAFMIS +RLQQRVA E+NQ  + 
Sbjct  67   NVSSLLLMILLYGLVYCWP-ESSFLRGGYEGCLFFGSAFMISTARLQQRVAAEINQ--IN  123

Query  297  GGHGVLLYEFKRSKAAMdelrgelersggg-------dedGIREKIESLKACFGVLRSGT  139
            G  G+LLYEF+RSK AM+ELRGELER  G         E  IRE++E+L  CFGVLRSG 
Sbjct  124  GRPGILLYEFRRSKMAMEELRGELERRCGQGGMVDWETEVEIRERVENLSGCFGVLRSGA  183

Query  138  ENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
            ENI+GQLDDFFDEIVEGRKKLLDFCS HR
Sbjct  184  ENIVGQLDDFFDEIVEGRKKLLDFCS-HR  211



>gb|EMS46824.1| hypothetical protein TRIUR3_20698 [Triticum urartu]
Length=271

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 191/318 (60%), Gaps = 53/318 (17%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLST---NFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGE  817
            +NGF S +  G+D L     S+    FMS  FLQ+A ALLRS HS L+ LVQ+LHLP GE
Sbjct  1    MNGFSSSIAHGLDALHATLASSPDAAFMSAPFLQQAAALLRSLHSQLVHLVQRLHLPPGE  60

Query  816  KWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSH-HHLNPQLSRQVMRAI  640
             WLDEYMDE+S+LWE C V+K+G S ++ Y ++   + ++LD    + NP  +RQVMRAI
Sbjct  61   SWLDEYMDETSRLWEACQVVKAGASALDTYCASAARIDAALDDWLCNPNPHTARQVMRAI  120

Query  639  TGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssll  460
               RR+A+GLE+ENRAL ETRI+P  L  D    V E KLN FNGFRGVLYA+RN SS L
Sbjct  121  NAPRRQAVGLEQENRALAETRIDPASLLLDDRSPV-EFKLNAFNGFRGVLYALRNASSFL  179

Query  459  liillyglvYCWP--AESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHG  286
            L++L+ G V C P  A   HP  +       G+ ++ S+ RL+QRVAEEM   + GG   
Sbjct  180  LMLLVSGTVSCLPDLACCAHPFRTS------GAGYVSSMGRLRQRVAEEM---EAGG---  227

Query  285  VLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFF  106
                                             ++E +K   G+LRSG E ++G+LDDFF
Sbjct  228  ---------------------------------RVEIIKGWVGMLRSGAEGVVGELDDFF  254

Query  105  DEIVEGRKKLLDFCSTHR  52
            DEIVEGRK L D CS HR
Sbjct  255  DEIVEGRKMLSDLCS-HR  271



>ref|XP_006859212.1| hypothetical protein AMTR_s00070p00193550 [Amborella trichopoda]
 gb|ERN20679.1| hypothetical protein AMTR_s00070p00193550 [Amborella trichopoda]
Length=305

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 213/327 (65%), Gaps = 36/327 (11%)
 Frame = -3

Query  993  NSVNGFYSFLTRGIDDLECVFLSTN-FMSIQFLQRALALLRSFHSHLILLVQKLHLPVGE  817
            +SV+GFY+ +  G+DDLE   L    FMS Q++Q+ ++LLRS HSHL  L Q LHLPVG+
Sbjct  2    DSVSGFYAAVAHGLDDLEGSLLCCGGFMSAQWVQQVVSLLRSLHSHLTRLAQTLHLPVGD  61

Query  816  KWLDEYMDESSKLWEVCHVLKSGVSGMENY-YSAGFNLTSSLDSHHHLNPQLSRQVMRAI  640
            KWLDEYMDE+SKLW+VCH+LKSG S ++++ + +   LT +       +   SRQ+MRA+
Sbjct  62   KWLDEYMDETSKLWDVCHLLKSGASALDHFLHHSSLQLTMTFT-----DGGSSRQLMRAV  116

Query  639  TGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKL-----NGF-NGFRGVLYAMR  478
            TGCRREA+GLEEENR L E +          ++S++E++      +G+  GFRGVL AMR
Sbjct  117  TGCRREALGLEEENRLLSEAK---------ALMSLEENQGRCWANSGYAGGFRGVLCAMR  167

Query  477  NvssllliillyglvYCWPAESNHPP-SSYEGCLFFGSAFMISISRLQQRVAEEMNQRQM  301
             VSSLLL +L++ L++   + S H   +  +G     +AF  ++ RLQQRV  E+  R  
Sbjct  168  MVSSLLLTLLVWALLHSSGSSSPHAEVTGGDG----STAFAGALQRLQQRVGAEIEGR--  221

Query  300  GGGHGVLLYEFKRSKAAMdelrgelersgggdedGIR----EKIESLKACFGVLRSGTEN  133
               HG+LL+E++R K   +E+  +LE  GG + +       E++E LK  FG+ R+G E 
Sbjct  222  ---HGILLHEYRRVKGLTEEMWAQLEVRGGQNGNLGGGGFVERVEMLKVWFGMSRTGVEG  278

Query  132  IIGQLDDFFDEIVEGRKKLLDFCSTHR  52
            I+ QLDD FDEIVEGRKKLL+ CS +R
Sbjct  279  IVCQLDDLFDEIVEGRKKLLEICSRNR  305



>gb|ACJ85859.1| unknown [Medicago truncatula]
Length=134

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPSSTNSVNGFYSFLTRGID LE VFL+ NFMSIQFLQR L+LLRS H+ L LLVQKLH
Sbjct  1     MDPSSTNSVNGFYSFLTRGIDGLERVFLTNNFMSIQFLQRTLSLLRSLHTQLTLLVQKLH  60

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV  652
             LPVG+KWLDEYMDESSKLWE CHVLKSG+SG+ENYYSA  N+TS+LDSH H+ PQ+SRQV
Sbjct  61    LPVGDKWLDEYMDESSKLWEACHVLKSGISGIENYYSAASNITSTLDSHIHITPQISRQV  120

Query  651   M  649
             +
Sbjct  121   L  121



>ref|XP_008648352.1| PREDICTED: uncharacterized protein LOC103628940 [Zea mays]
 gb|AFW74228.1| hypothetical protein ZEAMMB73_993042 [Zea mays]
Length=389

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/345 (42%), Positives = 207/345 (60%), Gaps = 39/345 (11%)
 Frame = -3

Query  1002  SSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV  823
             S++N++NGFYS +  G+D L+    +   +S  FLQ+A ALLRS HS L+ LVQ+LHLP 
Sbjct  56    SNSNNMNGFYSSMAHGLDALQRSPHAC--LSAAFLQQAAALLRSLHSQLLHLVQRLHLPP  113

Query  822   GEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSL---------DSHHHLNP  670
             GE WLDEYMDE+S+LW+ C + ++G +G++ Y +A   +  +L          SH   + 
Sbjct  114   GESWLDEYMDETSRLWDACQLARAGAAGLDTYCAAAARVAPALRDWLYGGSGGSHAAAS-  172

Query  669   QLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVL  490
               +R + RAIT  RR A  L ++NRAL + R++P  L  D   S  E KLN FNGFRGVL
Sbjct  173   --ARHLQRAITAPRRHAAALHQDNRALADARLDPASLLLDD-RSPLEFKLNAFNGFRGVL  229

Query  489   YAMRNvssllliillyglvYCWP--------AESNHPPSSYEGCLFFGSAFMISISRLQQ  334
             YA+RN +S LLI+L+ G V C P        A +NH    ++     G  ++ SI+RL+Q
Sbjct  230   YALRNATSFLLILLISGTVTCLPDLTAGCCSASANH----HQLRASAGGGYVASIARLRQ  285

Query  333   RVAEEMNQRQMGGGH-----GVLLYEFKRSKAAMd------elrgelersgggdedGIRE  187
             RV EEM +  + G H     G++++EF++++AA+D      +    +        D + +
Sbjct  286   RVVEEMEECIIAGDHRSHSAGIMMHEFRQARAAIDGLKQDFDRAVAMGGYRDDISDSLVQ  345

Query  186   KIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
             + E +    G+LRSG E +I +LDDFFDEIVEGRK L D CS HR
Sbjct  346   RAEIINGWVGMLRSGAEAVIAELDDFFDEIVEGRKMLSDLCS-HR  389



>gb|KHN06140.1| hypothetical protein glysoja_036005 [Glycine soja]
Length=235

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 122/153 (80%), Gaps = 11/153 (7%)
 Frame = -3

Query  1011  MDP---SSTNSVNGFYSFLTRGIDDLECVFLSTN-FMSIQFLQRALALLRSFHSHLILLV  844
             MDP   S+TN+VNGFY+F++RG+++LE  FL+ N F+S+QFLQ+ L+LLRS H+ L LLV
Sbjct  1     MDPCPSSNTNTVNGFYTFVSRGMEELERAFLANNSFISLQFLQKVLSLLRSLHTQLTLLV  60

Query  843   QKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQL  664
              KLHLP+G+KWLDEYMDE+SKLWE  H+LKS +S  E +YS GFNL SSLDS H      
Sbjct  61    HKLHLPLGDKWLDEYMDETSKLWETSHLLKSAISNFEPFYSQGFNLLSSLDSSHP-----  115

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPL  565
               QV+RAI+GCRREA+GLEE+NRALMETR+  L
Sbjct  116   --QVVRAISGCRREALGLEEQNRALMETRVHTL  146


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 78/97 (80%), Gaps = 8/97 (8%)
 Frame = -3

Query  342  LQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKAC  163
            L+QRVA EM   +   G G+LLYEF+R++ A++ELRGELE + GG    +RE++ES++ C
Sbjct  147  LRQRVAAEM---RGAAGPGILLYEFRRARVAVEELRGELEEAEGG----VRERVESVRVC  199

Query  162  FGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
            FGVLRSG ENI+ QLDDFFDEIVEGRKKLLDFCS HR
Sbjct  200  FGVLRSGAENIVCQLDDFFDEIVEGRKKLLDFCS-HR  235



>ref|XP_003564750.1| PREDICTED: uncharacterized protein LOC100839683 [Brachypodium 
distachyon]
Length=317

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 198/324 (61%), Gaps = 23/324 (7%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            +NGF++ L RG+D+L     S    S+  L RA ALLR  HS L +LV +LHLP G +WL
Sbjct  1    MNGFFTTLARGLDELS-GGGSGGLTSLAALVRAAALLRGLHSQLTMLVGQLHLPPGGRWL  59

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSH-HHLNPQLSRQVMRAITGC  631
            DEYMDE+++LW+ C  LK G++ +E Y SA     ++LD      +P  +RQVMRAI+  
Sbjct  60   DEYMDETARLWDACLALKLGLAAVERYCSAASCAAAALDDWLQDPSPLSTRQVMRAISAS  119

Query  630  RREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLN-GFNGFRGVLYAMRNvssllli  454
            RREAM  EEENRAL E+RI PL LR D + +    +L+ GFNGFRG+LYA+ N SSLLL+
Sbjct  120  RREAMAAEEENRALSESRIAPLSLRLDELRAADACRLSGGFNGFRGLLYALHNASSLLLL  179

Query  453  illyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGH--GVL  280
            IL    V   P +   P +        G  FM SI+ LQ+R+AEE++    G G   G+ 
Sbjct  180  ILAGAAVSSSPPDGAFPSADSAA----GGGFMASIAALQKRMAEEVSA---GAGEEGGIR  232

Query  279  LYEFKRSKAAMdelrgelersg-----------ggdedGIREKIESLKACFGVLRSGTEN  133
            ++EF+R +AA +  R E+ER+                  ++ K E LKA   VLR+GT+ 
Sbjct  233  MHEFRRVRAAAEAAREEVERAVAAAGAGRKCCGEQLSGAVKCKAEELKAWLDVLRTGTDG  292

Query  132  IIGQLDDFFDEIVEGRKKLLDFCS  61
            ++ QLDDF D+IVEGRK+L D CS
Sbjct  293  LVCQLDDFLDDIVEGRKELSDLCS  316



>emb|CDM85197.1| unnamed protein product [Triticum aestivum]
Length=308

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 187/314 (60%), Gaps = 13/314 (4%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            VN F++ L RG+DDL     +    S+  L RA ALLR  HS L++LV +LHLP G +WL
Sbjct  2    VNAFFATLARGLDDLSG---AGGLSSLPALLRAAALLRGLHSQLMVLVGQLHLPPGGRWL  58

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSH-HHLNPQLSRQVMRAITGC  631
            DEYMDE+++LW+ C  +K G++ +E Y +A     ++LD      +P  +RQVMRAI+  
Sbjct  59   DEYMDETARLWDACLAVKLGLAAVERYCAAASCAAAALDDWLQDPSPLSTRQVMRAISAS  118

Query  630  RREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvsslllii  451
            RREAM  EEENRAL E+RI PL L+ D      +++L+GFNGFRG+LYA+ N SSLLL+I
Sbjct  119  RREAMAAEEENRALSESRIAPLSLQLD-ERRAADARLSGFNGFRGLLYALHNASSLLLLI  177

Query  450  llyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYE  271
            L  G V   P  S+    S          FM SI+ LQ+R+AEE       G  G++  +
Sbjct  178  LAGGAVAGSPRSSSDGADSSRS----DDGFMSSIATLQKRMAEEAAGDDGDGAPGMIRMQ  233

Query  270  ----FKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFD  103
                 + +  A  E       +GG     +++K   LKA   VLR+GT+ +  QLDDF D
Sbjct  234  ELRRARAAAEAAREEVERAAAAGGKCGGAVKDKAGELKAWLEVLRAGTDGLACQLDDFLD  293

Query  102  EIVEGRKKLLDFCS  61
            +IVEGRK+L D CS
Sbjct  294  DIVEGRKELSDLCS  307



>ref|NP_001044961.1| Os01g0875000 [Oryza sativa Japonica Group]
 dbj|BAB86227.1| P0648C09.16 [Oryza sativa Japonica Group]
 dbj|BAB92443.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06875.1| Os01g0875000 [Oryza sativa Japonica Group]
 gb|EAZ14342.1| hypothetical protein OsJ_04264 [Oryza sativa Japonica Group]
Length=318

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 179/284 (63%), Gaps = 17/284 (6%)
 Frame = -3

Query  870  FHSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLD  691
             HS L LLV +LHLP G +WLDEYMDE+++LWE C  +K G++ +E Y +A     +++D
Sbjct  37   LHSQLTLLVGQLHLPPGGRWLDEYMDETARLWEACLAVKVGLAAVERYCAAASCAAAAMD  96

Query  690  SH-HHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKL  520
                  +P  +RQVMRAI+  RREAM  EEENRAL E RI PL L+ D   ++   +++L
Sbjct  97   DWLQDPSPLSTRQVMRAISASRREAMAAEEENRALSEARIAPLSLQLDERLLLRAADARL  156

Query  519  NGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRL  340
            +GFNGFRG+LYA+ N SSLLL++L  G V    A +   P S +G    G  F+ SI+ L
Sbjct  157  SGFNGFRGLLYALHNASSLLLLVLASGAVS--CAAAAAGPCSADGAADAGG-FVASIAML  213

Query  339  QQRVAEEMNQRQMGGGH--GVLLYEFKRSKAAMdelrgelersgggdedG---------I  193
            QQR+AEE +     G    G+ +YEF+ ++AA++    E+ER+                +
Sbjct  214  QQRMAEEADADGSAGAARGGIRMYEFRCARAAVEAAHEEVERAVAAGPRKQQCEDGDGGV  273

Query  192  REKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
            ++K++ LKA   VLR+GT+ ++ QLDDF D+IVEGRK+L D CS
Sbjct  274  KDKVDELKAWLDVLRTGTDGLVCQLDDFLDDIVEGRKELSDLCS  317



>ref|NP_001170097.1| uncharacterized protein LOC100384015 [Zea mays]
 gb|ACN35783.1| unknown [Zea mays]
 gb|AFW84427.1| hypothetical protein ZEAMMB73_465109 [Zea mays]
Length=321

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 134/328 (41%), Positives = 188/328 (57%), Gaps = 27/328 (8%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            +N F++ L RG+D+L     +    S+  L RA +LLR  HS L L+V +LHLP G +WL
Sbjct  1    MNAFFTSLARGLDEL---GRAGGLSSLPALLRAASLLRGLHSQLTLMVGQLHLPPGGRWL  57

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSH-HHLNPQLSRQVMRAITGC  631
            DEYMDE+++LW+ C  +K G++ +E Y +A     ++LD      +P  S QVMRAI+  
Sbjct  58   DEYMDETARLWDACLAVKLGLASVERYCAAASCAAAALDDWLQDPSPLSSSQVMRAISVS  117

Query  630  RREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKLNGFNGFRGVLYAMRNvsslll  457
            RREAM  EEENRAL + RI PL L+ D   ++   +++L GFNGFRG+L+A+ N SSLLL
Sbjct  118  RREAMAAEEENRALADARIAPLSLQLDERLLLRATDARLTGFNGFRGLLHALHNASSLLL  177

Query  456  iillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG--GHGV  283
            +IL  G V C  A      +   G     + F+ SI  LQQR+AEE    +  G    G+
Sbjct  178  LILASGAVSCAAAAGGPCGADDAG-----AGFVASIVMLQQRMAEEAADAESDGPGAPGI  232

Query  282  LLYEFK--------------RSKAAMdelrgelersgggdedGIREKIESLKACFGVLRS  145
             + EF+              R+ AA                  +++K+E LKA   VLR+
Sbjct  233  GMCEFRCARAAVEAAREEVERAAAAAAAAAAAAAGRKCEGGGVVKDKVEELKAWLDVLRT  292

Query  144  GTENIIGQLDDFFDEIVEGRKKLLDFCS  61
            GT +++ QLDDF D+IVEGRK+L D CS
Sbjct  293  GTHSLVCQLDDFLDDIVEGRKELSDLCS  320



>ref|XP_008674768.1| PREDICTED: uncharacterized protein LOC103650942 [Zea mays]
 tpg|DAA56588.1| TPA: hypothetical protein ZEAMMB73_923839 [Zea mays]
Length=315

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 137/320 (43%), Positives = 188/320 (59%), Gaps = 17/320 (5%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            +N F++ L RG+DDL     +    S+  L RA ALLR  HS L L+V +LHLP G +WL
Sbjct  1    MNAFFTSLARGLDDL---GRAGGLSSLSALLRAAALLRGLHSQLTLMVGQLHLPPGGRWL  57

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSH-HHLNPQLSRQVMRAITGC  631
            DEYMDE+++LW+ C  LK G++ +E Y +A     ++LD      +P  +RQVMRAI+  
Sbjct  58   DEYMDETARLWDACLALKLGLASVERYCAAASCAAAALDDWLQDPSPLSTRQVMRAISVS  117

Query  630  RREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKLNGFNGFRGVLYAMRNvsslll  457
            RREAM  EEENRAL + RI PL L  D   ++   +++L GFNGFRG+LYA+ N SSLLL
Sbjct  118  RREAMAAEEENRALADARIAPLSLHLDERLLLRATDARLAGFNGFRGLLYALHNASSLLL  177

Query  456  iillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLL  277
            +IL  G V C  A       + +        F  SI+ LQQR+AEE      G   G+ +
Sbjct  178  LILASGAVSCAAAAGGPCAGADDA---GSDGFTASIAMLQQRLAEEAESDGPGAAPGIRM  234

Query  276  YEFK--------RSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQ  121
             EF+          +          +  GGG    +++K+E LKA   VLR+GT++++ Q
Sbjct  235  CEFRCARAAVEAAREEVERAAAAGRKCEGGGGGSAVKDKVEELKAWLDVLRTGTDSLVCQ  294

Query  120  LDDFFDEIVEGRKKLLDFCS  61
            LDDF D+IVEGRK+L D CS
Sbjct  295  LDDFLDDIVEGRKELSDLCS  314



>ref|XP_004952827.1| PREDICTED: uncharacterized protein LOC101782732 [Setaria italica]
Length=320

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 192/320 (60%), Gaps = 13/320 (4%)
 Frame = -3

Query  1005  PSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLP  826
             P S+++   FY+ L RG+DDL+    S+ F+S+  L+ ALALLR+ H+ L  LV  LHLP
Sbjct  6     PPSSSTAAAFYATLARGLDDLDRSLASSAFLSLPSLRAALALLRAAHAGLARLVASLHLP  65

Query  825   VGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMR  646
              G  WLDEYMDE+S+L + C  L+ G + +E Y      L S L      +P LSRQV R
Sbjct  66    GGAAWLDEYMDEASRLCDACRALRLGAAAVEGYAGGAAQLASLL-MQAPSSPHLSRQVAR  124

Query  645   AITGCRREAMGLEEENRALMETRIEPLCLRF-DGVVSVKESKLNGFNGFRGVLYAMRNvs  469
             AI+ CRREAM L+EENRA++E R E L LR  +GV +  ++KL GFNGFRGVL A R ++
Sbjct  125   AISVCRREAMALKEENRAVVEARAEALALRLSEGVPA--DAKLGGFNGFRGVLCATRMLA  182

Query  468   sllliillyglvYCWPAESNHPPSSYEGC-LFFGSAFMISIS---RLQQRVAEEMNQRQM  301
             S LL +L +G+++ WP       +    C  +FG AF  ++S   +     A        
Sbjct  183   SFLLTLLSWGVLHYWPDPGAGAAAVSGDCAAYFGPAFASALSRAQQRAAAEAGRSAAAAG  242

Query  300   GGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQ  121
             GGG GV+++EF+R++AA++E +  +ER G          + +     G LR   E+++  
Sbjct  243   GGGAGVMMHEFRRARAAVEEAKEAVERGGDVAAAAAEVGLRA-----GALRGACEDVLAL  297

Query  120   LDDFFDEIVEGRKKLLDFCS  61
             +DD FDE+VE RKKLLD CS
Sbjct  298   IDDLFDEVVEARKKLLDLCS  317



>ref|XP_002453972.1| hypothetical protein SORBIDRAFT_04g022520 [Sorghum bicolor]
 gb|EES06948.1| hypothetical protein SORBIDRAFT_04g022520 [Sorghum bicolor]
Length=320

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 201/324 (62%), Gaps = 22/324 (7%)
 Frame = -3

Query  1005  PSSTNSVNGFYSFLTRGIDDLE-----CVFLSTNFMSIQFLQRALALLRSFHSHLILLVQ  841
             PSS+ +   FY+ L RG+DDL+         S+ F+S+  L+ ALALL + H+ L  LV 
Sbjct  7     PSSSTAA-AFYATLARGLDDLDRALAAASSSSSAFLSLPTLRAALALLHAAHAGLARLVA  65

Query  840   KLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLS  661
              LHLP G  WLDEYMDE+S+L + C  L+ G + +E Y  +   L S L      +P LS
Sbjct  66    SLHLPGGAAWLDEYMDEASRLCDACRALRLGAAAVEGYAGSAAQLASLL-MQAPSSPHLS  124

Query  660   RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRF-DGVVSVKESKLNGFNGFRGVLYA  484
             RQV RAI+ CRREAM L+EENRAL+ETR E L LR  +GV +  ++KL GFNGFRGVL A
Sbjct  125   RQVARAISVCRREAMALKEENRALVETRAEALALRLSEGVPA--DAKLGGFNGFRGVLCA  182

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEG--CLFFGSAFMISISRLQQRVAEEMNQ  310
              R ++S LL +L +G+++ WPA    P +   G    +FG+AF  ++SR QQR A E  +
Sbjct  183   TRMLTSFLLTLLSWGVLHYWPA----PNAGAAGDCAAYFGAAFASALSRAQQRAAAEAGR  238

Query  309   RQMG-GGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTEN  133
                  GG GV+++EF+R++AA+++ +  +ER G          + +     G LR+  E+
Sbjct  239   SVAAPGGAGVMMHEFRRARAAVEDAKDAVERGGDVAAAAAEVGLRA-----GALRAACED  293

Query  132   IIGQLDDFFDEIVEGRKKLLDFCS  61
             ++  +DD FDE+VE RKKLLD CS
Sbjct  294   VLALIDDLFDEVVEARKKLLDLCS  317



>gb|EAZ05303.1| hypothetical protein OsI_27508 [Oryza sativa Indica Group]
Length=314

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 184/321 (57%), Gaps = 22/321 (7%)
 Frame = -3

Query  978  FYSFLTRGIDDLE--CVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLD  805
            FYS + +G++ L          FMS  F+Q+A AL+RS H+ L+ +V +LHLP GE+WLD
Sbjct  4    FYSSIGQGVEALHRRLAVGEVGFMSAAFVQQAAALVRSVHAQLLEVVGRLHLPAGERWLD  63

Query  804  EYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV--MRAITGC  631
            EYMDE+S+LW+ C ++++G S +  Y SA  +        HHL       +   RAI   
Sbjct  64   EYMDETSRLWDACLLVRAGASALHAYSSAAAHAI------HHLYDHDDDYIHAARAINAP  117

Query  630  RREAMGLEEENRALMETRI-EPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvss-lll  457
            RR A GL ++NRAL+   I +P  L      S ++  LN FNGFR +LYA+RN +S LL 
Sbjct  118  RRHAAGLLQDNRALLHDNIHDPASLLLLDHRSPRDLNLNAFNGFRALLYALRNATSFLLA  177

Query  456  iillyglvYCWPAESNHPPSSYEGC-LFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVL  280
            I+L   +  C P   +H  S+     L     +  S++RL+ RVA+EM         G+L
Sbjct  178  ILLSATVSSCLP---DHLISTCTPLPLPTAPGYASSMARLRHRVAQEMRALAAPAADGIL  234

Query  279  LYEFKRSKAAMdelrgelersgg-----gdedGIREKIESLKACFGVLRSGTENIIGQLD  115
            +YEF++++AA+D L+ +L+R           + + E+   +K C  +L SG E +I +LD
Sbjct  235  MYEFRQARAAIDSLKADLDRVVATGTGYAHREDMAERAHLVKGCLAMLSSGAEAVIAELD  294

Query  114  DFFDEIVEGRKKLLDFCSTHR  52
            D FD+IVEGRK L D CS HR
Sbjct  295  DLFDDIVEGRKMLSDLCS-HR  314



>dbj|BAK01269.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=312

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 187/317 (59%), Gaps = 15/317 (5%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            VN F++ L RG+DDL     +    S+  L RA ALLR  HS L+LLV +LHLP G +WL
Sbjct  2    VNAFFATLARGLDDLSG---AGGLSSLPALLRAAALLRGLHSQLMLLVGQLHLPPGGRWL  58

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSH-HHLNPQLSRQVMRAITGC  631
            DEYMDE+++LW+ C  +K G++ +E Y +A     ++LD      +P  +RQVMRAI+  
Sbjct  59   DEYMDETARLWDACLAVKLGLAAVERYCAAASCAAAALDDWLLDPSPLSTRQVMRAISAS  118

Query  630  RREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvsslllii  451
            RREAM  EEENRAL E+RI PL L+ D      +++L+GFNGFRG+LYA+ N SSLLL+I
Sbjct  119  RREAMAAEEENRALSESRIAPLSLQLD-ERRAADARLSGFNGFRGLLYALHNASSLLLLI  177

Query  450  llyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYE  271
            L  G V   P  S+   +  +     G  FM SI+ LQ+R+AEE       G  G++  +
Sbjct  178  LAGGAVAGSPCSSSSDGADDDDDKNNG--FMASIATLQKRMAEEAADAS-DGAPGMIRMQ  234

Query  270  FKRSKAAMdelrgelersgg-------gdedGIREKIESLKACFGVLRSGTENIIGQLDD  112
              R   A  E   E               +  ++ K   LKA   VLR+GT+ ++ QLDD
Sbjct  235  ELRRARAAAEAAREEVERAAAGGGKCGDRDGAVKGKAGELKAWLEVLRAGTDGLVCQLDD  294

Query  111  FFDEIVEGRKKLLDFCS  61
            F D+IVEGRK+L D CS
Sbjct  295  FLDDIVEGRKELSDLCS  311



>dbj|BAD08928.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ41239.1| hypothetical protein OsJ_25745 [Oryza sativa Japonica Group]
Length=314

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 124/319 (39%), Positives = 182/319 (57%), Gaps = 18/319 (6%)
 Frame = -3

Query  978  FYSFLTRGIDDLE--CVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLD  805
            FYS + +G++ L          FMS  F+Q+A AL+RS H+ L+ +V +LHLP GE+WLD
Sbjct  4    FYSSIGQGVEALHRSLAVGEVGFMSAAFVQQAAALVRSVHAQLLEVVGRLHLPAGERWLD  63

Query  804  EYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRR  625
            EYMDE+S+LW+ C ++++G S +  Y +A  +    L  H            RAI   RR
Sbjct  64   EYMDETSRLWDACLLVRAGASALHAYSAAAAHAIHHLYDH----DDDYIHAARAINAPRR  119

Query  624  EAMGLEEENRALMETRI-EPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvss-lllii  451
             A GL ++NRAL+   I +P  L      S ++  LN FNGFR +LYA+RN +S LL I+
Sbjct  120  HAAGLLQDNRALLHDNILDPASLLLLDHRSPRDLNLNAFNGFRALLYALRNATSFLLAIL  179

Query  450  llyglvYCWPAESNHPPSSYEGC-LFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLY  274
            L   +  C P   +H  S+     L     +  S++RL+ RVA+EM         G+L+Y
Sbjct  180  LSATVSSCLP---DHLISTCTPLPLPTAPGYASSMARLRHRVAQEMRALAAPAADGILMY  236

Query  273  EFKRSKAAMdelrgelersgggde-----dGIREKIESLKACFGVLRSGTENIIGQLDDF  109
            EF++++AA+D L+ +L+R           + + E+   +K C  +L SG E +I +LDD 
Sbjct  237  EFRQARAAIDSLKADLDRVVATGTGYAHREDMAERAHLVKGCLAMLSSGAEAVIAELDDL  296

Query  108  FDEIVEGRKKLLDFCSTHR  52
            FD+IVEGRK L D CS HR
Sbjct  297  FDDIVEGRKMLSDLCS-HR  314



>ref|NP_001060781.1| Os08g0104800 [Oryza sativa Japonica Group]
 dbj|BAF22695.1| Os08g0104800 [Oryza sativa Japonica Group]
 dbj|BAG95050.1| unnamed protein product [Oryza sativa Japonica Group]
Length=315

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 124/319 (39%), Positives = 182/319 (57%), Gaps = 18/319 (6%)
 Frame = -3

Query  978  FYSFLTRGIDDLE--CVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLD  805
            FYS + +G++ L          FMS  F+Q+A AL+RS H+ L+ +V +LHLP GE+WLD
Sbjct  5    FYSSIGQGVEALHRSLAVGEVGFMSAAFVQQAAALVRSVHAQLLEVVGRLHLPAGERWLD  64

Query  804  EYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCRR  625
            EYMDE+S+LW+ C ++++G S +  Y +A  +    L  H            RAI   RR
Sbjct  65   EYMDETSRLWDACLLVRAGASALHAYSAAAAHAIHHLYDH----DDDYIHAARAINAPRR  120

Query  624  EAMGLEEENRALMETRI-EPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvss-lllii  451
             A GL ++NRAL+   I +P  L      S ++  LN FNGFR +LYA+RN +S LL I+
Sbjct  121  HAAGLLQDNRALLHDNILDPASLLLLDHRSPRDLNLNAFNGFRALLYALRNATSFLLAIL  180

Query  450  llyglvYCWPAESNHPPSSYEGC-LFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLY  274
            L   +  C P   +H  S+     L     +  S++RL+ RVA+EM         G+L+Y
Sbjct  181  LSATVSSCLP---DHLISTCTPLPLPTAPGYASSMARLRHRVAQEMRALAAPAADGILMY  237

Query  273  EFKRSKAAMdelrgelersgggde-----dGIREKIESLKACFGVLRSGTENIIGQLDDF  109
            EF++++AA+D L+ +L+R           + + E+   +K C  +L SG E +I +LDD 
Sbjct  238  EFRQARAAIDSLKADLDRVVATGTGYAHREDMAERAHLVKGCLAMLSSGAEAVIAELDDL  297

Query  108  FDEIVEGRKKLLDFCSTHR  52
            FD+IVEGRK L D CS HR
Sbjct  298  FDDIVEGRKMLSDLCS-HR  315



>ref|XP_004970748.1| PREDICTED: uncharacterized protein LOC101775305 [Setaria italica]
Length=316

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 183/319 (57%), Gaps = 14/319 (4%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            +N F++ L RG+DDL     +    S+  L RA ALLR  HS L L+V +LHLP G +WL
Sbjct  1    MNAFFTSLARGLDDL---GRAGGLSSLPALLRAAALLRGLHSQLTLMVGQLHLPPGGRWL  57

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSH-HHLNPQLSRQVMRAITGC  631
            DEYMDE+++LW+ C  +K G++ +E Y +A     ++LD      +P  +RQVMRAI+  
Sbjct  58   DEYMDETARLWDACLAVKLGLASVERYCAAASCAAAALDDWLQDPSPLATRQVMRAISAS  117

Query  630  RREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKLNGFNGFRGVLYAMRN-vssll  460
            RREAM  EEENRAL + RI PL L+ D   ++   +++L GFNGFRG+LYA+ N  S LL
Sbjct  118  RREAMAAEEENRALADARIAPLSLQLDERLLLRATDARLTGFNGFRGLLYALHNASSLLL  177

Query  459  liillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVL  280
            LI+    +             S       G  FM SI+ LQQR+AEE      G    + 
Sbjct  178  LILASGAVSRAAAGGGPCAAGSASADAAAGGGFMASIAMLQQRMAEEAESDGPGAPR-IR  236

Query  279  LYEFK------RSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQL  118
            + EF+       +     E      R   G    +++K+E LKA   VLR+GT++++ QL
Sbjct  237  MCEFRCARAAVEAAREEVERAAAAGRKCEGGGGVVKDKVEELKAWLDVLRTGTDSLVCQL  296

Query  117  DDFFDEIVEGRKKLLDFCS  61
            DDF D+IVEGRK+L D CS
Sbjct  297  DDFLDDIVEGRKELSDLCS  315



>gb|EAY76676.1| hypothetical protein OsI_04631 [Oryza sativa Indica Group]
Length=318

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 121/284 (43%), Positives = 172/284 (61%), Gaps = 17/284 (6%)
 Frame = -3

Query  870  FHSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLD  691
             HS L LLV +LHLP G +WLDEYMDE+++LWE C  +K G++ +E Y +A     +++D
Sbjct  37   LHSQLTLLVGQLHLPPGGRWLDEYMDETARLWEACLAVKVGLAAVERYCAAASCAAAAMD  96

Query  690  SH-HHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKL  520
                  +P  +RQVMRAI+  RREAM  EEENRAL E RI PL L+ D   ++   +++L
Sbjct  97   DWLQDPSPLSTRQVMRAISASRREAMAAEEENRALSEARIAPLSLQLDERLLLRAADARL  156

Query  519  NGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRL  340
            +GFNGFRG+LYA+ N SSLLL++L  G V    A +   P S +G    G  F+ SI+ L
Sbjct  157  SGFNGFRGLLYALHNASSLLLLVLASGAVS--CAAAAAGPCSADGAADAG-GFVASIAML  213

Query  339  QQRV--AEEMNQRQMGGGHGVLLYEFK---------RSKAAMdelrgelersgggdedGI  193
            QQR+    + +        G+ +YEF+         R +       G  ++     + GI
Sbjct  214  QQRMAEEADADGGAGAARGGIRMYEFRCARAAVEAAREEVERAVAAGPRKQQCEDGDGGI  273

Query  192  REKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
            ++K++ LKA   VLR+GT+ ++ QLDDF D+IVEGRK+L D CS
Sbjct  274  KDKVDELKAWLDVLRTGTDGLVCQLDDFLDDIVEGRKELSDLCS  317



>ref|XP_003572612.1| PREDICTED: uncharacterized protein LOC100826877 [Brachypodium 
distachyon]
Length=316

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 200/322 (62%), Gaps = 14/322 (4%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             M PSS+ +   FY+ L RG+DDL+    S +F+S+  L+ ALALLR+ H+ L  LV  LH
Sbjct  1     MKPSSSTAA-AFYATLARGLDDLDRSLASGSFLSLPSLRAALALLRAAHAGLTRLVASLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLD-SHHHLNPQLSRQ  655
             LP G  WLDEYMDE+S+L + C  L+ G + +E + ++  +  S L  S    +P LSRQ
Sbjct  60    LPGGAAWLDEYMDETSRLCDACAALRLGAAAIEAFSASAAHAASLLQTSASGASPNLSRQ  119

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRF-DGVVSVKESKLNGFNGFRGVLYAMR  478
             V RAI+ CRREA  L+EENRAL+ETR E L LR  +GV       L+GFNGFRGVL A R
Sbjct  120   VTRAISVCRREASALKEENRALVETRGEELALRLSEGVPPDAAKALSGFNGFRGVLCATR  179

Query  477   NvssllliillyglvYCWP---AESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQR  307
              ++S LL +L +GL++  P   A S  P     G   FG AF  ++SR QQR A E ++ 
Sbjct  180   MLASFLLTLLSWGLLHYSPSSRAGSTAPGDC--GGAHFGPAFASALSRAQQRAAAEADRA  237

Query  306   QMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENII  127
                   G ++YEF+R++ A+++L+  ++R GG       E++       G LRSG ++++
Sbjct  238   SA---AGAMMYEFRRARTAVEQLKDAMDRGGGSGAGAAAEEVAQWA---GTLRSGCDDMV  291

Query  126   GQLDDFFDEIVEGRKKLLDFCS  61
               +DD FDEIVEGRKKLLD CS
Sbjct  292   ALIDDLFDEIVEGRKKLLDLCS  313



>gb|KEH28047.1| hypothetical protein MTR_5g460870 [Medicago truncatula]
Length=259

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 149/195 (76%), Gaps = 13/195 (7%)
 Frame = -3

Query  618  MGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllliillyg  439
            MGLEEENRALMETR++ L L FD  VSV ESKLNGFNGFRGVLYAMRN+SS+LL ILL+G
Sbjct  1    MGLEEENRALMETRVQLLSLCFDERVSV-ESKLNGFNGFRGVLYAMRNISSMLLTILLHG  59

Query  438  lvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRS  259
            LVY  P  S+   + YEG +F GS  M+S +RLQQRVA EM++ +     G+LLYEF+ +
Sbjct  60   LVYRCPVTSD-TVARYEGWMFHGSGLMMSAARLQQRVAAEMSEAE----PGMLLYEFRHA  114

Query  258  KAAMdelrgelersgggdedG------IREKIESLKACFGVLRSGTENIIGQLDDFFDEI  97
            +A+++ELRGELER+             +RE++E ++ CFGVL+SG +NI+ QLDDFFDEI
Sbjct  115  RASVEELRGELERNVSSQVVQWEMEDGLRERVECVRMCFGVLKSGADNIVSQLDDFFDEI  174

Query  96   VEGRKKLLDFCSTHR  52
            VEGRKKLLDFCS HR
Sbjct  175  VEGRKKLLDFCS-HR  188



>gb|KCW60115.1| hypothetical protein EUGRSUZ_H02848 [Eucalyptus grandis]
Length=301

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 181/318 (57%), Gaps = 39/318 (12%)
 Frame = -3

Query  954  IDDLE--CVFLSTNFMSIQFLQRALALLRSFHSHLILL--------VQKLHLPVGEKWLD  805
            +D+LE  C+   T  MSIQFLQRAL LL SF S+L           VQK +LPV +KWLD
Sbjct  1    MDNLEQSCLAAGTRVMSIQFLQRALTLLSSFLSNLAATPPPPSPRRVQKHNLPVADKWLD  60

Query  804  EYMDESSKLWEVCHVL-KSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGCR  628
            EYMD+SS+LW+VC +L KSGVS +E+  S+  N            P  +R    AI+ CR
Sbjct  61   EYMDKSSELWDVCQLLLKSGVSALESSSSSTLNY-----------PLWAR----AISRCR  105

Query  627  REAMGLEEENRALMETR--IEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRNvssllli  454
            REA  LE +NR L++     + L LR+D       +  NGF GFRGVL  M NV+SLLL 
Sbjct  106  REAAVLEAQNRRLLQEAGMRQLLQLRYD---ECSATFANGFFGFRGVLREMHNVNSLLLT  162

Query  453  illyglvYCWPAES-----NHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGH  289
            +LL GLVY  P E       H  S  +         + S +RL+Q +  EMN+   GG  
Sbjct  163  VLLSGLVYHRPGEGFFSSRPHRSSHEDEQPRMLPWILASAARLEQSMEMEMNRTGSGGRA  222

Query  288  GVLLYEFKRSKAAMdelr---gelersgggdedGIREKIESLKACFGVLRSGTENIIGQL  118
             +++ E++R KA M+E+R    E  ++   D   +RE++E L+ C GVLR G + ++ Q+
Sbjct  223  TIMVEEYRRVKAGMEEIRGCLEEGGKAAEDDGGRMRERVEDLRGCLGVLRDGADGMVWQI  282

Query  117  DDFFDEIVEGRKKLLDFC  64
            DD FDEI E RKK+   C
Sbjct  283  DDLFDEITEERKKIFHLC  300



>ref|XP_010026769.1| PREDICTED: uncharacterized protein LOC104417151 [Eucalyptus grandis]
Length=335

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 137/345 (40%), Positives = 186/345 (54%), Gaps = 59/345 (17%)
 Frame = -3

Query  954  IDDLE--CVFLSTNFMSIQFLQRALALLRSFHSHLILL--------VQKLHLPVGEKWLD  805
            +D+LE  C+   T  MSIQFLQRAL LL SF S+L           VQK +LPV +KWLD
Sbjct  1    MDNLEQSCLAAGTRVMSIQFLQRALTLLSSFLSNLAATPPPPSPRRVQKHNLPVADKWLD  60

Query  804  EYMDESSKLWEVCH-VLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQV--------  652
            EYMD+SS+LW+VC  +LKSGVS +E+  S+  N        + L+P  S Q+        
Sbjct  61   EYMDKSSELWDVCQLLLKSGVSALESSSSSTLN--------YPLSPHFSCQLWSLSVVQE  112

Query  651  -------------------MRAITGCRREAMGLEEENRALMETR--IEPLCLRFDGVVSV  535
                                RAI+ CRREA  LE +NR L++     + L LR+D     
Sbjct  113  DSVFDDLTDMTPIGGLNSWARAISRCRREAAVLEAQNRRLLQEAGMRQLLQLRYD---EC  169

Query  534  KESKLNGFNGFRGVLYAMRNvssllliillyglvYCWPAES-----NHPPSSYEGCLFFG  370
              +  NGF GFRGVL  M NV+SLLL +LL GLVY  P E       H  S  +      
Sbjct  170  SATFANGFFGFRGVLREMHNVNSLLLTVLLSGLVYHRPGEGFFSSRPHRSSHEDEQPRML  229

Query  369  SAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelr---gelersgggded  199
               + S +RL+Q +  EMN+   GG   +++ E++R KA M+E+R    E  ++   D  
Sbjct  230  PWILASAARLEQSMEMEMNRTGSGGRATIMVEEYRRVKAGMEEIRGCLEEGGKAAEDDGG  289

Query  198  GIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFC  64
             +RE++E L+ C GVLR G + ++ Q+DD FDEI E RKK+   C
Sbjct  290  RMRERVEDLRGCLGVLRDGADGMVWQIDDLFDEITEERKKIFHLC  334



>gb|EAY86253.1| hypothetical protein OsI_07624 [Oryza sativa Indica Group]
Length=316

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 125/324 (39%), Positives = 188/324 (58%), Gaps = 20/324 (6%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLE----CVFLSTNFMSIQFLQRALALLRSFHSHLILLV  844
             M PS + +V  FY  L RG+D+LE        +  F+S   L+ ALAL+R+ H+ L  LV
Sbjct  1     MKPSPS-TVAAFYGTLARGLDELERSLAASSAAAEFVSAASLRAALALIRAAHAGLARLV  59

Query  843   QKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQL  664
               LHLP G  WLDEYMDE+S+L + C  L+ G + +E Y  +   L S+L S H     L
Sbjct  60    GSLHLPGGAAWLDEYMDETSRLCDACRALRLGAASLEGYSDSASRLASALRSSH-----L  114

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYA  484
             S +V RA++ CRR+AM + EENR L+ETR E L LR    V   ++K  GFNGFRGVL A
Sbjct  115   SFEVTRAMSACRRDAMAIREENRVLVETRAEALALRLAETVP-PDAKFTGFNGFRGVLCA  173

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFG---SAFMISISRLQQRVAEEMN  313
              R ++S LL +L +G+++ WP ++     + +   +FG   ++ +    +     A  ++
Sbjct  174   TRMLTSFLLTLLSWGVLHYWP-DAGGAGGATDCGAYFGAAFASALARAQQRAAAAAAAVS  232

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTEN  133
                +  G G +++EF+R++AA+++ R  ++R+G          + +       LRSG E+
Sbjct  233   PSVVDAGGGAMMHEFRRARAAVEQARDAVDRAGDVAAAAAEVALRA-----DALRSGCED  287

Query  132   IIGQLDDFFDEIVEGRKKLLDFCS  61
             +I  +DD FDE+ EGRKKLLD CS
Sbjct  288   VIALIDDLFDEVAEGRKKLLDLCS  311



>ref|XP_002443702.1| hypothetical protein SORBIDRAFT_07g000580 [Sorghum bicolor]
 gb|EES13197.1| hypothetical protein SORBIDRAFT_07g000580 [Sorghum bicolor]
Length=308

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 118/304 (39%), Positives = 164/304 (54%), Gaps = 53/304 (17%)
 Frame = -3

Query  876  RSFHSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSS  697
            RS HS L+ LVQ+LHLP GE WLDEYMDE+S+LWE C + ++G +G++ Y +A   +  +
Sbjct  29   RSLHSQLLHLVQRLHLPPGESWLDEYMDETSRLWEACQLARAGAAGLDAYCAAAARVAPA  88

Query  696  LDSHHHLNPQLS----------RQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG  547
            L    +                R + RAIT  RR A+ L ++NRAL + R++P  L  D 
Sbjct  89   LRDWLYGGSGSGGSHSHATAAVRHLQRAITAPRRHAVALHQDNRALADARLDPASLLLDD  148

Query  546  VVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGS  367
              S  E KLN FNGFRGVLYA+RN +S LL++L+ G V C P  +        GC     
Sbjct  149  -RSPLEFKLNAFNGFRGVLYALRNATSFLLVLLISGTVTCLPDLT-------AGC-----  195

Query  366  AFMISISRLQQRVAEEMNQRQMGGGH------------GVLLYEFKRSKAAMdelrgele  223
                        VA    Q +  GG             G+++YEF++++AA+D L+ + +
Sbjct  196  ----------SAVAHHHQQLRASGGDGRMHHRRRRRGGGIMMYEFRQARAAIDGLKQDFD  245

Query  222  rsggg-------dedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFC  64
            R             D + ++ E +    G+LRSG E +I +LDDFFDEIVEGRK L D C
Sbjct  246  RVVAMGGGYCDDIGDSLGQRAEIINGWVGMLRSGAEAVIAELDDFFDEIVEGRKMLSDLC  305

Query  63   STHR  52
            S HR
Sbjct  306  S-HR  308



>ref|NP_001047106.1| Os02g0552200 [Oryza sativa Japonica Group]
 dbj|BAF09020.1| Os02g0552200 [Oryza sativa Japonica Group]
Length=316

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 188/324 (58%), Gaps = 20/324 (6%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLE----CVFLSTNFMSIQFLQRALALLRSFHSHLILLV  844
             M PS + +V  FY  L RG+D+LE        +  F+S   L+ ALAL+R+ H+ L  LV
Sbjct  1     MKPSPS-TVAAFYGTLARGLDELERSLAASSAAAEFVSAASLRAALALIRAAHAGLARLV  59

Query  843   QKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQL  664
               LHLP G  WLDEYMDE+S+L + C  L+ G + +E Y  +   L S+L S H     L
Sbjct  60    GSLHLPGGAAWLDEYMDETSRLCDACRALRLGAASLEGYSDSASRLASALRSSH-----L  114

Query  663   SRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYA  484
             S +V RA++ CRR+AM + EENR L+ETR E L LR    +   ++K  GFNGFRGVL A
Sbjct  115   SFEVTRAMSACRRDAMAIREENRVLVETRAEALALRLAETIP-PDAKFTGFNGFRGVLCA  173

Query  483   MRNvssllliillyglvYCWPAESNHPPSSYEGCLFFG---SAFMISISRLQQRVAEEMN  313
              R ++S LL +L +G+++ WP ++     + +   +FG   ++ +    +     A  ++
Sbjct  174   TRMLTSFLLTLLSWGVLHYWP-DAGGAGGATDCGAYFGAAFASALARAQQRAAAAAAAVS  232

Query  312   QRQMGGGHGVLLYEFKRSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTEN  133
                +  G G +++EF+R++AA+++ R  ++R+G          + +       LRSG E+
Sbjct  233   PSVVDAGGGAMMHEFRRARAAVEQARDAVDRAGDVAAAAAEVALRA-----DALRSGCED  287

Query  132   IIGQLDDFFDEIVEGRKKLLDFCS  61
             +I  +DD FDE+ EGRKKLLD CS
Sbjct  288   VIALIDDLFDEVAEGRKKLLDLCS  311



>ref|XP_004504194.1| PREDICTED: uncharacterized protein LOC101493759 [Cicer arietinum]
Length=156

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = -3

Query  999  STNSVNGFYSFLTRGIDDLECVFLS--TNFMSIQFLQRALALLRSFHSHLILLVQKLHLP  826
            ++NS   FY+FLT+ +++L   F S   NFMSIQF+   L+ L+SFHS L LLVQ L LP
Sbjct  2    ASNSCTNFYNFLTQELNELHQSFYSHNNNFMSIQFISNVLSSLQSFHSQLTLLVQNLSLP  61

Query  825  VGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMR  646
            VG KWLDEYMDESS+LW++CHVLKS +SG+ENY S+G N+ +SLD +HHLNP+LS QV+ 
Sbjct  62   VGGKWLDEYMDESSRLWDICHVLKSSISGIENYSSSGSNIATSLDGYHHLNPELSHQVVI  121

Query  645  AITGCRREAMGLEEENRALMETRIEP  568
                 +R  + +   +     + IEP
Sbjct  122  LFFVKKRFILYIVVIDVLNFVSFIEP  147



>dbj|BAD15487.1| hypothetical protein [Oryza sativa Japonica Group]
Length=357

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 191/346 (55%), Gaps = 33/346 (10%)
 Frame = -3

Query  1023  SPMAMDPSSTNSVNGFYSFLTRGIDDLE----CVFLSTNFMSIQFLQRALALLRSFHSHL  856
             S +AM PS + +V  FY  L RG+D+LE        +  F+S   L+ ALAL+R+ H+ L
Sbjct  15    SSLAMKPSPS-TVAAFYGTLARGLDELERSLAASSAAAEFVSAASLRAALALIRAAHAGL  73

Query  855   ILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHH--  682
               LV  LHLP G  WLDEYMDE+S+L + C  L+ G + +E Y  +   L S+L S H  
Sbjct  74    ARLVGSLHLPGGAAWLDEYMDETSRLCDACRALRLGAASLEGYSDSASRLASALRSSHLS  133

Query  681   ----------------HLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFD  550
                              +   L  QV RA++ CRR+AM + EENR L+ETR E L LR  
Sbjct  134   FEVSHSHAAAAASAAVVVTIDLWVQVTRAMSACRRDAMAIREENRVLVETRAEALALRLA  193

Query  549   GVVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFG  370
               +   ++K  GFNGFRGVL A R ++S LL +L +G+++ WP ++     + +   +FG
Sbjct  194   ETIP-PDAKFTGFNGFRGVLCATRMLTSFLLTLLSWGVLHYWP-DAGGAGGATDCGAYFG  251

Query  369   ---SAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelersgggded  199
                ++ +    +     A  ++   +  G G +++EF+R++AA+++ R  ++R+G     
Sbjct  252   AAFASALARAQQRAAAAAAAVSPSVVDAGGGAMMHEFRRARAAVEQARDAVDRAGDVAAA  311

Query  198   GIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
                  + +       LRSG E++I  +DD FDE+ EGRKKLLD CS
Sbjct  312   AAEVALRA-----DALRSGCEDVIALIDDLFDEVAEGRKKLLDLCS  352



>gb|EPS59828.1| hypothetical protein M569_14978, partial [Genlisea aurea]
Length=118

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  996  TNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGE  817
            +NSVNGFY FL  GID+L  +  +TN MS+ FLQR L LL SFHS L+LLV KLHLPVGE
Sbjct  1    SNSVNGFYGFLAAGIDEL-FLLSNTNLMSLHFLQRLLPLLTSFHSRLLLLVHKLHLPVGE  59

Query  816  KWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAI  640
            KWLDEYMDE+S +W VCHV+KSG+S ++ YYS+   + SSL+S+  LNP LSRQV   +
Sbjct  60   KWLDEYMDETSTIWNVCHVIKSGISAVDRYYSSALRVVSSLESNRRLNPHLSRQVSSPV  118



>gb|EPS70985.1| hypothetical protein M569_03777, partial [Genlisea aurea]
Length=197

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 131/203 (65%), Gaps = 11/203 (5%)
 Frame = -3

Query  654  VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
            ++ AI  CRREA  ++E NRALME RIEPL L+    V   ESKLNGF+GFRGVLYAMRN
Sbjct  1    IIGAIVACRREAAAMQEANRALMEMRIEPLSLKLCEKVCCVESKLNGFSGFRGVLYAMRN  60

Query  474  vssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGG  295
            VSSLLL ILL GLVY  P E +    S+         +M S +RLQQR++      Q+ G
Sbjct  61   VSSLLLTILLRGLVYSRPGEESDTGESHHH-YHKVVGYMASTARLQQRLSG-----QISG  114

Query  294  GHGVLLYEFKRSKAAMdelrgeler-----sgggdedGIREKIESLKACFGVLRSGTENI  130
              G+LL+E +RS  AM+E+R ELER          E+ + E++ESLK     +  G E+I
Sbjct  115  RSGILLHELRRSMVAMEEVRTELERGGDNGVEWEWEEEMGERVESLKRWLSAMGGGCESI  174

Query  129  IGQLDDFFDEIVEGRKKLLDFCS  61
            IGQ++D  +EIV+GRKKL DFC+
Sbjct  175  IGQVEDLLEEIVQGRKKLSDFCT  197



>ref|XP_006646526.1| PREDICTED: uncharacterized protein LOC102706068 [Oryza brachyantha]
Length=256

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = -3

Query  870  FHSHLILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLD  691
             HS L LLV +LHLP G +WLDEYMDE+++LW+ C  +K G++ +E Y +A     +++D
Sbjct  37   LHSQLTLLVGQLHLPPGGRWLDEYMDETARLWDACLAVKLGLAAVERYCTAASCAAAAMD  96

Query  690  SH-HHLNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKL  520
                  +P  +RQV+RAI+  RREAM  EEENRAL E RI PL L+ D   ++   +++L
Sbjct  97   DWLQDPSPLSTRQVLRAISASRREAMAAEEENRALSEARIAPLSLQLDERLLLRAADARL  156

Query  519  NGFNGFRGVLYAMRN  475
            +GFNGFRG+LYA+ N
Sbjct  157  SGFNGFRGLLYALHN  171


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  195  IREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
            +++K++ LKA   VLR+GT+ ++ QLDDF D+IVEGRK+L D CS
Sbjct  211  VKDKVDELKAWLDVLRTGTDGLVCQLDDFLDDIVEGRKELSDLCS  255



>ref|XP_003523470.2| PREDICTED: uncharacterized protein LOC100777252 [Glycine max]
Length=141

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 10/122 (8%)
 Frame = -3

Query  396  SYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelers  217
             YEGCLF GSAFM+S +RLQQRVA E+    MGG  G+LL+EF+RSK AM+ELRGELER 
Sbjct  23   GYEGCLFLGSAFMMSTARLQQRVAAEIGH--MGGSPGMLLHEFRRSKVAMEELRGELERR  80

Query  216  gggde-------dGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCST  58
            G G +         IRE++E+L+ CFGVLRSG +NI+ QLDDFFDEIVEGRK+LLDFCS 
Sbjct  81   GSGSQGVEWESEVAIRERVENLRTCFGVLRSGADNIVAQLDDFFDEIVEGRKRLLDFCS-  139

Query  57   HR  52
            HR
Sbjct  140  HR  141



>gb|KDO50098.1| hypothetical protein CISIN_1g037305mg, partial [Citrus sinensis]
Length=82

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = -3

Query  1011  MDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLH  832
             MDPS + SVNGFY+ L  G+DDL   F + NFMSIQFLQ+ L+ L  FHS L +LVQKLH
Sbjct  1     MDPSFS-SVNGFYTLLNHGLDDLGHSFNTHNFMSIQFLQKVLSSLCYFHSQLTVLVQKLH  59

Query  831   LPVGEKWLDEYMDESSKLWEVCH  763
             LPVGEKWLDEYMDESS+LWE CH
Sbjct  60    LPVGEKWLDEYMDESSRLWEACH  82



>ref|XP_002458849.1| hypothetical protein SORBIDRAFT_03g041420 [Sorghum bicolor]
 gb|EES03969.1| hypothetical protein SORBIDRAFT_03g041420 [Sorghum bicolor]
Length=197

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 118/199 (59%), Gaps = 16/199 (8%)
 Frame = -3

Query  618  MGLEEENRALMETRIEPLCLRFDGVV---SVKESKLNGFNGFRGVLYAMRNvssllliil  448
            M  EEENRAL + RI PL L+ D  +   +   ++L GFNGFRG+LYA+ N SSLLL+IL
Sbjct  1    MAAEEENRALSDARIAPLSLQLDERLLLRATDAARLTGFNGFRGLLYALHNASSLLLLIL  60

Query  447  lyglvYCWPAESNHP---PSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLL  277
              G V C  A +  P     +  G +  G+ FM SI+ LQQR+AEE    +  G  G+ +
Sbjct  61   ASGAVSCAAAAAGGPCAADDTAGGGVDAGAGFMASIAMLQQRMAEEA---ESDGAAGIRM  117

Query  276  YEFK-------RSKAAMdelrgelersgggdedGIREKIESLKACFGVLRSGTENIIGQL  118
             EF+        ++  ++ +     +  G     +++K+E LKA   VLR+GT++++ QL
Sbjct  118  CEFRCARAAVEAAREEVERVAATGRKCEGATGGVVKDKVEELKAWVDVLRTGTDSLVCQL  177

Query  117  DDFFDEIVEGRKKLLDFCS  61
            DDF D+IVEGRK+L D CS
Sbjct  178  DDFLDDIVEGRKELSDLCS  196



>gb|KHN01196.1| hypothetical protein glysoja_008098 [Glycine soja]
Length=177

 Score = 79.3 bits (194),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = -3

Query  336  QRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgelersg-ggdedGIREKIESLKACF  160
            Q+VA+E+ Q    G  G+LL EF+++K AM+EL+ ELER      +  I+ K+++LK CF
Sbjct  85   QKVAQEIGQN--NGQRGILLLEFQQAKIAMEELKVELERMVGYDAQYEIQAKVDNLKHCF  142

Query  159  GVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCS  61
            G+LR G E I  QLDDFFDEIVEGRK LL+ CS
Sbjct  143  GLLRCGVETITRQLDDFFDEIVEGRKMLLNMCS  175


 Score = 39.3 bits (90),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 5/75 (7%)
 Frame = -2

Query  613  TGGREQGINGDKNRA--TMPKV*WGGFSEGVKAEWVQWVQGSPICNEECQLSSAHHLTLW  440
             G  +Q ++G+KN    TM K        G+K + VQW+    +CNEEC L +++   +W
Sbjct  14   IGRGKQKLDGNKNACIETMSK---PKHVYGIKVKQVQWLLRCSLCNEECYLIASNDFAIW  70

Query  439  PSLLLACRIKPPPKQ  395
              +LL   +  P  Q
Sbjct  71   GCILLVFLMLWPTTQ  85



>gb|EYU26522.1| hypothetical protein MIMGU_mgv1a023906mg, partial [Erythranthe 
guttata]
Length=84

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 8/85 (9%)
 Frame = -3

Query  972  SFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWLDEYMD  793
            S +T+ +++L+ +FLS NFMSI  LQ   + LRSFHS L LL +K+ L       DEYMD
Sbjct  6    SSVTKEVENLDRLFLSRNFMSINLLQEVFSSLRSFHSQLTLL-EKIRL-------DEYMD  57

Query  792  ESSKLWEVCHVLKSGVSGMENYYSA  718
            +SS+LWE  + LKSG+S MENYYS+
Sbjct  58   KSSRLWEARYALKSGISSMENYYSS  82



>gb|KHN47067.1| hypothetical protein glysoja_018434 [Glycine soja]
Length=72

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = -3

Query  195  IREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
            IRE++E+L+ CFGVLRSG +NI+ QLDDFFDEIVEGRK+LLDFCS HR
Sbjct  26   IRERVENLRTCFGVLRSGADNIVAQLDDFFDEIVEGRKRLLDFCS-HR  72



>ref|XP_006659739.1| PREDICTED: uncharacterized protein LOC102710720 [Oryza brachyantha]
Length=181

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFL--STNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEK  814
            +N FYS + +G+D L C        FMS  FLQ+A AL+RS HS L+ LV +LHLP GE 
Sbjct  1    MNSFYSSIGQGLDALHCRLDGGEVAFMSGPFLQQAAALVRSMHSQLLQLVHRLHLPAGES  60

Query  813  WLDEYMDESSKLW  775
            WLDEYMDE+S+L+
Sbjct  61   WLDEYMDETSRLY  73


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = -3

Query  363  FMISISRLQQRVAEEMNQRQMGG---GHGVLLYEFKRSKAAMdelrgelersgggde---  202
            ++ S++RL+QRVA+EM          G  +++YEF++++A +D L+ EL+R         
Sbjct  73   YVSSMARLRQRVADEMAAAAADHSAAGTTIMMYEFRQARAGIDTLKVELDRLRATGYGDP  132

Query  201  dGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDFCSTHR  52
            + I ++ E +K    +LRSG E +I +LDDFFD+IVEGRK L D CS HR
Sbjct  133  EEIADRAELIKGWVDMLRSGAEAVIAELDDFFDDIVEGRKVLSDLCS-HR  181



>gb|EMT16953.1| hypothetical protein F775_12281 [Aegilops tauschii]
Length=117

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVGEKWL  808
            VN F++ L RG+DDL     +    S+  L RA ALLR  HS L++LV +LHLP G +WL
Sbjct  2    VNAFFATLARGLDDLSG---AGGLSSLPALLRAAALLRGLHSQLMVLVGQLHLPPGGRWL  58

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLD  691
            DEYMDE+++LW+ C  +K G++ +E Y +A     ++LD
Sbjct  59   DEYMDETARLWDACLAVKLGLAAVERYCAAASCAAAALD  97



>ref|XP_001773729.1| predicted protein [Physcomitrella patens]
 gb|EDQ61486.1| predicted protein [Physcomitrella patens]
Length=361

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 172/365 (47%), Gaps = 44/365 (12%)
 Frame = -3

Query  1077  LKFPFSLNTPNSLNF-FLTSPMAMDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQF  901
             L  PFSL+  ++ N  F   P+         +  F + L   +D L+       F+SI +
Sbjct  17    LNLPFSLHRSHANNVAFKRHPL---------LQEFDTRLRDRLDSLKPAGDEKGFLSIDW  67

Query  900   LQRALALLRSFHSHLILLVQKLHLPVG----EKWLDEYMDESSKLWEVCHVLKSGVSGME  733
               +A++++ + H+++  L+ + HL +     +KW+DEY+D+S+KL +VC+VLK G+S +E
Sbjct  68    FLQAMSVVLATHANVESLIPESHLTLSLQRDDKWIDEYLDDSAKLLDVCNVLKEGISDVE  127

Query  732   NYYSAGFNLTSSLDSHHHLNPQLSRQVM-----RAITGCRREAMGLEEENR-ALMETRIE  571
             +Y      +   L  H+  N ++S ++       A+T C+      + E R    ++++E
Sbjct  128   HY-----QMLVQLALHNLDNKEISGELKYSRARNALTECKEAIKKKDTEYRQGFPKSKLE  182

Query  570   PLC--LRFDG--VVSVKESKLNGFNGFRGVLYAMRNvssllliillyglvYCWPAESNHP  403
                  LR  G  +V+ K  +    NGF   +Y  + V+++LL  LL   + C P     P
Sbjct  183   NCSSMLRTMGEKLVNPKGQEAMKGNGFLNAIYGAK-VTTILLCGLLVTALACKP---KRP  238

Query  402   PSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHGVLLYEFKRSKAAMdelrgele  223
              +S      +   +  S++ LQQRV EE ++R+   G   LL E     A++  L   L+
Sbjct  239   LTSLSVASHY--KWSASLTTLQQRVKEETDKRK-NKGSIALLRELDSVDASVRRLHEILD  295

Query  222   r--------sgggdedGIREKIESLKACFGVLRSGTENIIGQLDDFFDEIVEGRKKLLDF  67
             R                + +++E L+     L  G   +  Q+++ F  ++  R  LLD 
Sbjct  296   RHLNGRAFPLSREQSQELAQEVEFLRKHSSDLGQGLTPLEVQVNELFKTLIASRLALLDI  355

Query  66    CSTHR  52
              S+ R
Sbjct  356   ISSAR  360



>gb|EAZ19409.1| hypothetical protein OsJ_34964 [Oryza sativa Japonica Group]
Length=190

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 70/122 (57%), Gaps = 5/122 (4%)
 Frame = -3

Query  678  LNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKLNGFNG  505
            L+P L+R VMRAI+  RREAM  EEENRAL E RI  L L+ D   ++   +++L+GFNG
Sbjct  61   LSP-LARLVMRAISASRREAMAAEEENRALSEARIASLSLQLDERLLLRAADARLSGFNG  119

Query  504  FRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVA  325
            FRG+L A +   +      L   + C        P S EG    G  FM SI+ LQQR+ 
Sbjct  120  FRGLLRAAQRQLAAAPRPHLRRRLLCRRRHRGG-PCSAEGAADTGG-FMASIAMLQQRMV  177

Query  324  EE  319
            EE
Sbjct  178  EE  179



>ref|XP_009345453.1| PREDICTED: uncharacterized protein LOC103937250 isoform X1 [Pyrus 
x bretschneideri]
Length=149

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 5/81 (6%)
 Frame = -3

Query  483  MRNvssllliillyglvYCWPAESNHPPSSY-EGCLFFGSAFMISISRLQQRVAEEMNQ-  310
            MRNVSSLLL+ILLYGLV C P ES+     Y EGC+ FGS+FMIS +RLQQRVA E+ Q 
Sbjct  1    MRNVSSLLLMILLYGLVSCLPEESSFCRGGYNEGCMIFGSSFMISTARLQQRVAAEIGQI  60

Query  309  RQMGGGHGVLLYEFKRSKAAM  247
            R+     GVL++EF+RSKAAM
Sbjct  61   RER---PGVLMWEFRRSKAAM  78



>gb|EAZ08655.1| hypothetical protein OsI_30926 [Oryza sativa Indica Group]
Length=189

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 69/122 (57%), Gaps = 6/122 (5%)
 Frame = -3

Query  678  LNPQLSRQVMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKLNGFNG  505
            L+P L+R VMRAI+  RREAM   EENRAL E RI  L L+ D   ++   +++L+GFNG
Sbjct  61   LSP-LARLVMRAISASRREAMAA-EENRALSEARIASLSLQLDERLLLRAADARLSGFNG  118

Query  504  FRGVLYAMRNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVA  325
            FRG+L A +   +      L   + C        P S EG    G  FM SI+ LQQR+ 
Sbjct  119  FRGLLRAAQRQLAAAPRPHLRRRLLCRRRHRGG-PCSAEGAADTGG-FMASIAMLQQRMV  176

Query  324  EE  319
            EE
Sbjct  177  EE  178



>ref|XP_001754282.1| predicted protein [Physcomitrella patens]
 gb|EDQ80732.1| predicted protein [Physcomitrella patens]
Length=381

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 70/114 (61%), Gaps = 8/114 (7%)
 Frame = -3

Query  1005  PSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLP  826
             P  ++++  F + LT  +++L+    S  F+S+  L  A++++ + HS++  L+ +  L 
Sbjct  28    PCQSSALQEFETRLTERLEELKLSGESKGFLSLDLLLHAMSVILATHSNVERLIPESQLS  87

Query  825   VGEK----WLDEYMDESSKLWEVCHVLKSGVSGMENYYS----AGFNLTSSLDS  688
             + ++    W+DEY D+S+KL +VC+VLK G++ +ENY      A  NL SS++S
Sbjct  88    LSQQVDNSWVDEYFDDSAKLLDVCNVLKEGITEVENYQMLVQLALHNLESSIES  141



>ref|XP_001757786.1| predicted protein [Physcomitrella patens]
 gb|EDQ77426.1| predicted protein [Physcomitrella patens]
Length=357

 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -3

Query  978  FYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVG---EKWL  808
            F + L    D L+       F+SI +L +AL+++ S HS +  L+  L  P+    +KW+
Sbjct  38   FETKLVEKFDALKEAGEELGFLSIDWLLQALSVVLSTHSSVEALIPNLTFPLSNRDDKWV  97

Query  807  DEYMDESSKLWEVCHVLKSGVSGMENY  727
            DEY+D+S+KL +VC+VLK G+S +E Y
Sbjct  98   DEYLDDSAKLLDVCNVLKEGISELEQY  124



>gb|ABA95137.1| Transposable element protein, putative, MuDR [Oryza sativa Japonica 
Group]
Length=1905

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = -3

Query  654   VMRAITGCRREAMGLEEENRALMETRIEPLCLRFDG--VVSVKESKLNGFNGFRGVLYAM  481
             VMRAI+  RREAM  EEENRAL E RI  L L+ D   ++   +++L+GFNGFRG+L A 
Sbjct  1257  VMRAISASRREAMAAEEENRALSEARIASLSLQLDERLLLRAADARLSGFNGFRGLLRAA  1316

Query  480   RNvssllliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAE  322
             +   +      L   + C       P S+ EG    G  FM SI+ LQQR+A+
Sbjct  1317  QRQLAAAPRPHLRRRLLCRRRHRGGPCSA-EGAADTG-GFMASIAMLQQRMAD  1367



>ref|XP_001771433.1| predicted protein [Physcomitrella patens]
 gb|EDQ63823.1| predicted protein [Physcomitrella patens]
Length=546

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 121/242 (50%), Gaps = 15/242 (6%)
 Frame = -3

Query  978  FYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQK----LHLPVGEKW  811
            F + L   +D L+       F+S+ +L +A++++ + H+++ +L+ +    L L   +KW
Sbjct  43   FETRLKERLDALKPAGEEKGFLSVDWLLQAMSIVLATHANVEVLIPESQLSLSLSRDDKW  102

Query  810  LDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHLNPQLSRQVMRAITGC  631
            +DEY+D+S+KL +VC+VLK G+S +E+Y         +LD+          +   A+  C
Sbjct  103  VDEYLDDSAKLLDVCNVLKEGISEVEHYQMLVQLALHTLDNKEIYGELKHSRARNALAEC  162

Query  630  RREAMGLEEENR-ALMETRIEPLC--LRFDG--VVSVKESKLNGFNGFRGVLYAMRNvss  466
            +   +  + E R    ++++E     LR  G  +V+ K  +    NGF   +Y  + V++
Sbjct  163  KEAIVRKDTEYRQGFPKSKLENCSSMLRTIGEKLVNPKGQEAYKGNGFLNAIYGAK-VTT  221

Query  465  llliillyglvYCWPAESNHPPSSYEGCLFFGSAFMISISRLQQRVAEEMNQRQMGGGHG  286
            + L  LL   + C P     P ++      +   +  S+  LQQRV EE ++R+  G   
Sbjct  222  IFLCGLLVTALACKP---KRPLATLSVASHY--KWSPSLISLQQRVKEETDKRKNKGSIA  276

Query  285  VL  280
            +L
Sbjct  277  LL  278



>ref|XP_010930671.1| PREDICTED: uncharacterized protein LOC105051771 isoform X1 [Elaeis 
guineensis]
Length=328

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -3

Query  996  TNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVG-  820
            T   + F S LT+ +  LE  F +T+ +S+++   A++LL+     L++L +K  LP+  
Sbjct  19   TEDASNFCSSLTKDLKRLEQSF-ATDSVSLKWSVEAMSLLKKMQVELLVLFKKSKLPISY  77

Query  819  ---EKWLDEYMDESSKLWEVCHVLKSGVSGMENY  727
               E W D+YM E++ L + C+ LKS VSG+  Y
Sbjct  78   GAEEDWFDQYMKETATLLDFCNSLKSAVSGINRY  111



>ref|XP_010256523.1| PREDICTED: protein BPS1, chloroplastic-like [Nelumbo nucifera]
Length=325

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 89/179 (50%), Gaps = 25/179 (14%)
 Frame = -3

Query  990  SVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV---G  820
             V+ F S ++  +  L+   L+T  +S+++   A+++L+  H  L+LL+++  LP+   G
Sbjct  27   DVDKFCSSVSADVKKLQQ-SLATGAVSLRWSMEAMSVLKKIHIELLLLIERSRLPISLDG  85

Query  819  EKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLT----SSLDSHHHLNPQLSRQV  652
            E WLD+YM  +  L + C++LKS +SG+ N Y    + T       DS   +N       
Sbjct  86   EDWLDQYMKVTVMLLDFCNLLKSAISGI-NRYRMMVDFTVRKLCDCDSGVAIN-------  137

Query  651  MRAITGCRREAMGLEEENRALMETRIEPLCLRFDGVVSVKESKLNGFNGFRGVLYAMRN  475
                   R E   LE +++ L     +P  +R D +V V + K    NG   V++A ++
Sbjct  138  -------RIEVERLERDSKKLYGNE-KPRDVRLDELV-VPKYKFKRKNGANPVIFAAKS  187



>ref|XP_007019960.1| Uncharacterized protein TCM_036338 [Theobroma cacao]
 gb|EOY17185.1| Uncharacterized protein TCM_036338 [Theobroma cacao]
Length=323

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 56/99 (57%), Gaps = 7/99 (7%)
 Frame = -3

Query  1005  PSS-TNSVNGFYSFLTRGID--DLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQK-  838
             PSS TN+      F + GID   L+ V LS N +S+Q+ +  + LLR  H HL+  VQK 
Sbjct  18    PSSFTNADESIRVFASLGIDLQKLQ-VSLSENSLSLQWCRDVVNLLRKMHFHLLCFVQKS  76

Query  837   --LHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENY  727
                 L  G   L+EYM+ES  L + C+ LKS +SGM  Y
Sbjct  77    EPTMLWEGVNCLEEYMEESLILLDFCNCLKSAISGMNRY  115



>ref|XP_001784434.1| predicted protein [Physcomitrella patens]
 gb|EDQ50741.1| predicted protein [Physcomitrella patens]
Length=361

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 56/88 (64%), Gaps = 4/88 (5%)
 Frame = -3

Query  978  FYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV----GEKW  811
            F + L+  +D L+       ++SI +L +A++++ + H ++  L+ +  L +     +KW
Sbjct  42   FENRLSDSLDSLKPACEEKGYLSIHWLLQAMSVVLATHINVEALISESQLTLCLQRDDKW  101

Query  810  LDEYMDESSKLWEVCHVLKSGVSGMENY  727
            L+EY+D+S+KL +VC+VLK G+S +E Y
Sbjct  102  LNEYLDDSAKLLDVCNVLKEGISEVEQY  129



>gb|AFK38947.1| unknown [Medicago truncatula]
Length=55

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  61   AAEIQELLPPFNNFIKEIIKLPNDILSPRSQNPKTSLQTLNFFSD  195
              ++Q+LLP FNN IKEIIKL N+I+S RS+N K + Q +N FS+
Sbjct  2    TTKVQKLLPSFNNLIKEIIKLSNNIISTRSKNTKRASQIINSFSN  46



>ref|XP_001771624.1| predicted protein [Physcomitrella patens]
 gb|EDQ63538.1| predicted protein [Physcomitrella patens]
Length=376

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 61/94 (65%), Gaps = 6/94 (6%)
 Frame = -3

Query  984  NGFYSFLTRGIDDLECVFLS---TNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV---  823
            +    F TR ++ LE + LS     F+S+ +L +A++++ + H++L  L+    L +   
Sbjct  32   SALQQFETRLMEWLEALKLSGEVQGFLSVNWLLQAMSVVLATHTNLGRLIPDSELSLCQG  91

Query  822  GEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYS  721
             +KW+++Y+D+++KL +VC+VL+ G++ +ENY +
Sbjct  92   TDKWIEDYLDDNAKLLDVCNVLRDGIADVENYQT  125



>ref|XP_006851239.1| hypothetical protein AMTR_s00180p00025240 [Amborella trichopoda]
 gb|ERN12820.1| hypothetical protein AMTR_s00180p00025240 [Amborella trichopoda]
Length=305

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 71/141 (50%), Gaps = 4/141 (3%)
 Frame = -3

Query  1035  FFLTSPMAMDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHL  856
             FFL      D + +  V  FY  L+  +  L     +  F+ +Q+  +A+ +L + H+ L
Sbjct  11    FFLN--YKTDKAKSCLVFSFYDSLSEALLSLRNSLGTRAFVDLQWCVQAMKILSTMHTGL  68

Query  855   ILLVQKLHLPVGEKWLDEYMDESSKLWEVCHVLKSGVSGMENYYSAGFNLTSSLDSHHHL  676
             +LL+   +  + +KWLD+YMD +  L +VC+ LK+ VS +E Y         S+  H   
Sbjct  69    LLLLID-NPSLRQKWLDQYMDHTIFLLDVCNSLKAAVSSLEKYRLLTEFAIESIKGHTR-  126

Query  675   NPQLSRQVMRAITGCRREAMG  613
             +P++    M+ +T  + E  G
Sbjct  127   DPEVLVMEMQRLTMKKNELQG  147



>ref|XP_011046701.1| PREDICTED: uncharacterized protein LOC105141230 [Populus euphratica]
Length=293

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 53/90 (59%), Gaps = 5/90 (6%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV---GE  817
            +N F S L   I +LE   L+ N +S+Q++  A  LL+  H   + + QK  +P+   G 
Sbjct  1    MNTFSSLLI-DIKNLETS-LAKNSLSLQWILEATNLLKKMHFQFLEIFQKSEVPMFWDGG  58

Query  816  KWLDEYMDESSKLWEVCHVLKSGVSGMENY  727
            K+LDEYM+ES  + + C+ L+S +S M+ Y
Sbjct  59   KYLDEYMEESLNILDFCNALRSAISTMDMY  88



>ref|XP_009420548.1| PREDICTED: protein BPS1, chloroplastic-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 58/100 (58%), Gaps = 10/100 (10%)
 Frame = -3

Query  1026  TSPMAMDPSSTNSVNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILL  847
             ++P+  D S+      F + LT  +  LE + L+ + +S+++   A+++L+     L+ L
Sbjct  16    STPLTEDAST------FCTSLTEDLKGLE-LSLAKDSISLRWFVEAMSVLKRMQVRLLAL  68

Query  846   VQKLHLPV---GEKWLDEYMDESSKLWEVCHVLKSGVSGM  736
             ++K  LP+    E W D+YM ES+ L + C+ +KS +SG+
Sbjct  69    LKKSELPISCEAEDWFDQYMQESASLLDFCNSMKSALSGI  108



>gb|ADE77690.1| unknown [Picea sitchensis]
Length=375

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV---GE  817
            +N F + LT  +  LE   L  + +++ ++Q+A+ +L + H+ L  L+  L  P     E
Sbjct  37   LNAFETSLTTRLKQLEPKILK-DMINLSWMQQAMGVLSAIHADLKSLITDLQFPATEWDE  95

Query  816  KWLDEYMDESSKLWEVCHVLKSGVSGMENY  727
            KW++EY+D++ KL ++C  L   +S +E +
Sbjct  96   KWMNEYLDDTVKLLDICLALNVEISKLEYF  125



>ref|XP_011001795.1| PREDICTED: uncharacterized protein LOC105108963 [Populus euphratica]
Length=293

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = -3

Query  930  LSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV---GEKWLDEYMDESSKLWEVCHV  760
            L+ N +S+Q++  A  LL+  H   + + QK  +P+   G K+LDEYM+ES  + + C+ 
Sbjct  18   LAKNSLSLQWILEATNLLKKMHFQFLEIFQKSEVPMFWDGGKYLDEYMEESLNILDFCNA  77

Query  759  LKSGVSGMENY  727
            L+S +S M+ Y
Sbjct  78   LRSAISTMDMY  88



>ref|XP_002325994.2| hypothetical protein POPTR_0019s11410g [Populus trichocarpa]
 gb|EEF00376.2| hypothetical protein POPTR_0019s11410g [Populus trichocarpa]
Length=293

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = -3

Query  987  VNGFYSFLTRGIDDLECVFLSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPV---GE  817
            +N F S L   I +LE   L+ N +S+Q+   A  LL+  H   + + QK  +P+   G 
Sbjct  1    MNTFSSLLI-DIKNLESS-LAKNSLSLQWCLEATNLLKKMHFQFLEIFQKSEVPLFWDGG  58

Query  816  KWLDEYMDESSKLWEVCHVLKSGVSGMENY  727
             +LDEYM+ES  + + C+ L+S +S M+ Y
Sbjct  59   NYLDEYMEESLNILDFCNALRSAISTMDRY  88



>ref|XP_008790220.1| PREDICTED: protein BPS1, chloroplastic-like [Phoenix dactylifera]
Length=303

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = -3

Query  930  LSTNFMSIQFLQRALALLRSFHSHLILLVQKLHLPVG----EKWLDEYMDESSKLWEVCH  763
            L+ + +S+++   A++LL+     L++L +K  LP+     E W D+YM E++ L + C+
Sbjct  17   LARDSVSLKWSVEAMSLLKKMQVELLVLFKKSKLPISYGAEEDWFDQYMKETATLLDFCN  76

Query  762  VLKSGVSGMENY  727
             LKS  SG+  Y
Sbjct  77   SLKSAASGINRY  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3225594928680