BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6376_g1_i1 len=1270 path=[1:0-603 605:604-1269]

Length=1270
                                                                      Score     E

ref|XP_009771111.1|  PREDICTED: protein MKS1-like                       184   5e-51   
ref|XP_009588201.1|  PREDICTED: protein MKS1-like                       183   1e-50   
ref|XP_006362807.1|  PREDICTED: protein MKS1-like                       177   2e-48   
ref|XP_010320062.1|  PREDICTED: protein MKS1-like                       174   5e-47   
ref|XP_009594473.1|  PREDICTED: protein MKS1-like                       167   5e-45   
emb|CDP18280.1|  unnamed protein product                                165   3e-44   
ref|XP_009799266.1|  PREDICTED: protein MKS1-like                       164   9e-44   
ref|XP_011101648.1|  PREDICTED: protein MKS1                            151   4e-39   
ref|XP_006363916.1|  PREDICTED: protein MKS1-like                       142   1e-35   
ref|XP_007019435.1|  VQ motif-containing protein, putative              140   4e-35   
ref|XP_004242290.1|  PREDICTED: protein MKS1-like                       136   2e-33   
ref|XP_002526136.1|  Protein MKS1, putative                             125   3e-29   Ricinus communis
ref|XP_002306685.1|  VQ motif-containing family protein                 122   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010244000.1|  PREDICTED: protein MKS1-like                       122   4e-28   
ref|XP_010664970.1|  PREDICTED: protein MKS1                            120   1e-27   
gb|EYU17429.1|  hypothetical protein MIMGU_mgv1a012956mg                119   1e-27   
ref|XP_002302188.1|  VQ motif-containing family protein                 120   2e-27   Populus trichocarpa [western balsam poplar]
gb|KCW69207.1|  hypothetical protein EUGRSUZ_F02723                     118   3e-27   
ref|XP_010062140.1|  PREDICTED: protein MKS1                            118   6e-27   
ref|XP_011042820.1|  PREDICTED: protein MKS1-like                       117   7e-27   
ref|XP_010999806.1|  PREDICTED: protein MKS1-like                       115   4e-26   
ref|XP_004502599.1|  PREDICTED: protein MKS1-like                       113   2e-25   
ref|XP_003527972.2|  PREDICTED: protein MKS1-like                       114   2e-25   
ref|XP_010102094.1|  hypothetical protein L484_001827                   112   4e-25   
ref|XP_010247250.1|  PREDICTED: protein MKS1                            111   1e-24   
gb|KDP43028.1|  hypothetical protein JCGZ_25214                         109   9e-24   
emb|CBI35491.3|  unnamed protein product                                104   2e-22   
ref|XP_003602152.1|  Protein MKS1                                       103   5e-22   
gb|KHN44242.1|  Protein MKS1                                            102   1e-21   
ref|XP_003522552.2|  PREDICTED: protein MKS1-like                       102   2e-21   
gb|AFK48226.1|  unknown                                                 102   2e-21   
ref|XP_007141010.1|  hypothetical protein PHAVU_008G159700g             102   2e-21   
ref|XP_007137554.1|  hypothetical protein PHAVU_009G136500g             102   3e-21   
ref|XP_003544100.1|  PREDICTED: protein MKS1-like                       101   3e-21   
ref|XP_006434425.1|  hypothetical protein CICLE_v10002106mg             102   3e-21   
gb|EPS74170.1|  hypothetical protein M569_00585                         100   1e-20   
ref|XP_009408290.1|  PREDICTED: protein MKS1-like                     99.0    2e-20   
ref|XP_003543946.1|  PREDICTED: uncharacterized protein LOC100809190  97.4    8e-20   
ref|XP_010931050.1|  PREDICTED: protein MKS1-like                     96.3    2e-19   
gb|KDO83658.1|  hypothetical protein CISIN_1g045610mg                 95.9    5e-19   
ref|XP_006472947.1|  PREDICTED: protein MKS1-like                     95.5    7e-19   
ref|XP_008799745.1|  PREDICTED: protein MKS1-like                     94.4    1e-18   
ref|XP_010680147.1|  PREDICTED: protein MKS1                          93.2    5e-18   
ref|XP_009404341.1|  PREDICTED: protein MKS1-like                     92.4    5e-18   
ref|XP_008785895.1|  PREDICTED: protein MKS1-like                     89.7    4e-17   
ref|XP_010912071.1|  PREDICTED: protein MKS1-like                     87.4    3e-16   
emb|CDP04747.1|  unnamed protein product                              86.7    4e-16   
gb|KHN09235.1|  Protein MKS1                                          85.5    7e-16   
ref|XP_004290549.1|  PREDICTED: protein MKS1-like                     85.9    8e-16   
ref|XP_008784130.1|  PREDICTED: protein MKS1-like                     85.9    9e-16   
ref|XP_010537290.1|  PREDICTED: protein MKS1                          85.9    9e-16   
ref|XP_009419409.1|  PREDICTED: protein MKS1-like                     85.1    2e-15   
ref|NP_001142192.1|  hypothetical protein                             85.9    3e-15   Zea mays [maize]
ref|XP_002443688.1|  hypothetical protein SORBIDRAFT_07g000390        84.3    9e-15   Sorghum bicolor [broomcorn]
ref|XP_007199973.1|  hypothetical protein PRUPE_ppa026048mg           82.4    1e-14   
ref|XP_008237628.1|  PREDICTED: protein MKS1                          82.0    2e-14   
ref|XP_009350442.1|  PREDICTED: protein MKS1-like                     81.6    2e-14   
ref|XP_008349061.1|  PREDICTED: protein MKS1-like                     81.6    3e-14   
ref|XP_009404909.1|  PREDICTED: protein MKS1-like                     81.3    3e-14   
ref|XP_008373255.1|  PREDICTED: protein MKS1                          81.3    4e-14   
gb|EMT30486.1|  hypothetical protein F775_14892                       80.9    6e-14   
ref|XP_009360755.1|  PREDICTED: protein MKS1-like                     80.5    6e-14   
ref|XP_009390050.1|  PREDICTED: protein MKS1-like                     79.7    1e-13   
ref|XP_006854610.1|  hypothetical protein AMTR_s00030p00143350        79.7    1e-13   
ref|XP_004974293.1|  PREDICTED: protein MKS1-like                     79.7    2e-13   
ref|XP_009420897.1|  PREDICTED: protein MKS1-like                     78.2    3e-13   
ref|XP_006659734.1|  PREDICTED: protein MKS1-like                     78.2    4e-13   
dbj|BAD33166.1|  hypothetical protein                                 77.4    5e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ41227.1|  hypothetical protein OsJ_25732                        77.4    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010236394.1|  PREDICTED: protein MKS1-like                     78.2    7e-13   
ref|XP_009420191.1|  PREDICTED: protein MKS1-like                     76.3    2e-12   
ref|XP_010507076.1|  PREDICTED: protein MKS1-like                     75.9    2e-12   
ref|XP_003525114.1|  PREDICTED: protein MKS1-like                     75.5    3e-12   
ref|XP_002885272.1|  hypothetical protein ARALYDRAFT_898238           75.5    3e-12   
ref|XP_010465978.1|  PREDICTED: protein MKS1-like                     75.5    3e-12   
ref|XP_003523237.2|  PREDICTED: protein MKS1-like                     75.9    4e-12   
ref|XP_010649402.1|  PREDICTED: protein MKS1                          75.1    5e-12   
gb|KEH40436.1|  MKS1-like protein                                     73.9    7e-12   
ref|XP_009149609.1|  PREDICTED: protein MKS1                          74.3    8e-12   
emb|CDY50839.1|  BnaA10g28160D                                        74.3    8e-12   
ref|XP_009597714.1|  PREDICTED: protein MKS1-like                     73.9    1e-11   
ref|XP_003532861.1|  PREDICTED: protein MKS1-like                     73.6    1e-11   
ref|XP_009135590.1|  PREDICTED: protein MKS1-like                     73.6    1e-11   
emb|CDY04618.1|  BnaC05g16560D                                        73.2    2e-11   
ref|NP_566616.1|  MAP kinase substrate 1                              73.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00653.1|  hypothetical protein                                 73.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAM60914.1|  unknown                                               73.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090872.1|  hypothetical protein L484_020732                 73.2    2e-11   
ref|XP_010927454.1|  PREDICTED: uncharacterized protein LOC105049495  72.4    3e-11   
ref|XP_009771612.1|  PREDICTED: protein MKS1-like                     72.0    4e-11   
gb|EAY86188.1|  hypothetical protein OsI_07565                        72.8    5e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001173012.1|  Os02g0539500                                     72.8    5e-11   
ref|XP_004503952.1|  PREDICTED: protein MKS1-like                     71.6    6e-11   
ref|XP_010487791.1|  PREDICTED: protein MKS1-like                     71.6    7e-11   
ref|XP_006842306.1|  hypothetical protein AMTR_s00079p00122650        70.9    9e-11   
ref|XP_004289408.1|  PREDICTED: protein MKS1-like                     71.2    9e-11   
emb|CDX75979.1|  BnaC03g40620D                                        70.9    1e-10   
ref|XP_011099774.1|  PREDICTED: protein MKS1                          71.2    1e-10   
dbj|BAO45874.1|  map kinase substrate                                 70.5    1e-10   
ref|NP_001148224.1|  VQ motif family protein                          71.2    1e-10   Zea mays [maize]
ref|XP_006299156.1|  hypothetical protein CARUB_v10015299mg           70.5    2e-10   
emb|CDY68488.1|  BnaC01g43890D                                        70.1    2e-10   
ref|XP_007048304.1|  MAP kinase substrate 1, putative                 69.7    3e-10   
ref|XP_006416316.1|  hypothetical protein EUTSA_v10008673mg           69.7    3e-10   
ref|XP_008232823.1|  PREDICTED: protein MKS1                          69.7    3e-10   
ref|XP_007220783.1|  hypothetical protein PRUPE_ppa1027156mg          69.7    3e-10   
emb|CDY71738.1|  BnaA01g36880D                                        69.7    3e-10   
tpg|DAA37868.1|  TPA: VQ motif family protein                         70.9    3e-10   
gb|AIN36961.1|  MAP kinase substrate 1                                69.3    3e-10   
dbj|BAK07843.1|  predicted protein                                    70.9    4e-10   
ref|XP_009112548.1|  PREDICTED: protein MKS1-like                     68.9    5e-10   
ref|XP_010459840.1|  PREDICTED: protein MKS1 isoform X1               68.9    5e-10   
gb|AFK43245.1|  unknown                                               68.6    5e-10   
ref|XP_003526855.1|  PREDICTED: protein MKS1-like                     68.6    6e-10   
ref|XP_003575090.1|  PREDICTED: protein MKS1-like                     68.9    6e-10   
ref|XP_003630243.1|  Protein MKS1                                     68.6    6e-10   
ref|XP_010498583.1|  PREDICTED: protein MKS1-like isoform X1          68.6    9e-10   
ref|XP_003579720.1|  PREDICTED: protein MKS1-like                     69.7    1e-09   
ref|XP_010925215.1|  PREDICTED: protein MKS1-like                     67.4    1e-09   
ref|XP_004148825.1|  PREDICTED: protein MKS1-like                     67.0    1e-09   
ref|XP_010551173.1|  PREDICTED: protein MKS1                          67.4    1e-09   
ref|XP_010477396.1|  PREDICTED: protein MKS1-like                     67.8    2e-09   
ref|XP_008793991.1|  PREDICTED: protein MKS1-like                     67.0    2e-09   
ref|XP_008387186.1|  PREDICTED: uncharacterized protein LOC103449632  65.5    2e-09   
emb|CDP00632.1|  unnamed protein product                              66.6    3e-09   
ref|XP_008441652.1|  PREDICTED: protein MKS1-like                     66.2    3e-09   
ref|XP_010909697.1|  PREDICTED: uncharacterized protein LOC105035726  65.5    3e-09   
ref|XP_007159824.1|  hypothetical protein PHAVU_002G270600g           66.2    3e-09   
emb|CAH67600.1|  OSIGBa0092M08.12                                     67.8    4e-09   Oryza sativa [red rice]
ref|NP_001173930.1|  Os04g0417600                                     67.8    4e-09   
gb|KFK39183.1|  hypothetical protein AALP_AA3G210900                  65.9    5e-09   
ref|XP_010646867.1|  PREDICTED: protein MKS1                          65.5    5e-09   
ref|XP_008361090.1|  PREDICTED: protein MKS1-like                     65.9    5e-09   
gb|KEH40437.1|  VQ motif protein                                      63.9    6e-09   
ref|XP_009405325.1|  PREDICTED: uncharacterized protein LOC103988511  65.1    7e-09   
ref|XP_006589686.1|  PREDICTED: protein MKS1-like                     65.1    7e-09   
ref|XP_006303502.1|  hypothetical protein CARUB_v10010842mg           65.5    8e-09   
ref|XP_002517232.1|  Protein MKS1, putative                           65.1    8e-09   Ricinus communis
emb|CAN73469.1|  hypothetical protein VITISV_000273                   65.1    1e-08   Vitis vinifera
gb|EYU23797.1|  hypothetical protein MIMGU_mgv1a013271mg              64.7    1e-08   
ref|XP_004249890.1|  PREDICTED: protein MKS1                          64.3    2e-08   
ref|XP_007137701.1|  hypothetical protein PHAVU_009G148500g           64.3    2e-08   
ref|XP_004975599.1|  PREDICTED: protein MKS1-like                     65.9    2e-08   
ref|XP_006350982.1|  PREDICTED: protein MKS1-like                     63.9    2e-08   
ref|XP_009145868.1|  PREDICTED: protein MKS1                          63.5    3e-08   
ref|XP_010926036.1|  PREDICTED: uncharacterized protein LOC105048431  63.5    3e-08   
ref|XP_008351517.1|  PREDICTED: protein MKS1-like                     63.5    3e-08   
ref|XP_008392012.1|  PREDICTED: protein MKS1                          63.5    3e-08   
gb|EMT14223.1|  hypothetical protein F775_17155                       63.2    3e-08   
ref|NP_001170183.1|  uncharacterized protein LOC100384130             64.3    4e-08   Zea mays [maize]
ref|XP_009336419.1|  PREDICTED: protein MKS1-like                     63.2    4e-08   
gb|AFW71726.1|  hypothetical protein ZEAMMB73_802827                  64.3    4e-08   
ref|XP_009408694.1|  PREDICTED: protein MKS1-like                     62.4    4e-08   
emb|CDX99326.1|  BnaC05g34410D                                        62.8    4e-08   
gb|EPS64372.1|  hypothetical protein M569_10412                       62.8    5e-08   
ref|NP_001147120.1|  VQ motif family protein                          63.5    7e-08   Zea mays [maize]
ref|XP_009349864.1|  PREDICTED: protein MKS1-like                     61.2    7e-08   
ref|XP_006382836.1|  hypothetical protein POPTR_0005s05910g           62.0    8e-08   
dbj|BAJ93356.1|  predicted protein                                    62.4    1e-07   
ref|XP_006406577.1|  hypothetical protein EUTSA_v10021464mg           62.0    1e-07   
ref|XP_002452227.1|  hypothetical protein SORBIDRAFT_04g022090        63.2    1e-07   Sorghum bicolor [broomcorn]
ref|NP_683319.1|  VQ motif-containing protein                         62.0    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY00369.1|  BnaC07g14570D                                        61.6    1e-07   
ref|XP_002893157.1|  hypothetical protein ARALYDRAFT_472365           63.2    1e-07   
ref|XP_009390415.1|  PREDICTED: protein MKS1                          60.8    2e-07   
ref|XP_011032353.1|  PREDICTED: protein MKS1-like                     61.2    2e-07   
ref|XP_010263110.1|  PREDICTED: protein MKS1-like                     60.5    2e-07   
ref|XP_009387317.1|  PREDICTED: protein MKS1-like                     60.8    2e-07   
emb|CDX92261.1|  BnaA05g21460D                                        60.8    2e-07   
gb|AFW58215.1|  VQ motif family protein                               62.0    2e-07   
ref|NP_001159105.1|  uncharacterized protein LOC100304178             62.0    3e-07   Zea mays [maize]
gb|AFK40289.1|  unknown                                               60.5    3e-07   
ref|XP_010680256.1|  PREDICTED: protein MKS1                          60.5    3e-07   
ref|XP_006430000.1|  hypothetical protein CICLE_v10013749mg           59.7    3e-07   
ref|XP_008797859.1|  PREDICTED: protein MKS1-like                     60.1    3e-07   
ref|XP_010038921.1|  PREDICTED: protein MKS1-like                     58.5    4e-07   
gb|AFK43976.1|  unknown                                               59.7    4e-07   
ref|XP_009342707.1|  PREDICTED: TMV resistance protein N-like         62.4    6e-07   
ref|XP_002446454.1|  hypothetical protein SORBIDRAFT_06g016290        60.8    7e-07   Sorghum bicolor [broomcorn]
ref|XP_010916386.1|  PREDICTED: protein MKS1                          59.3    8e-07   
ref|XP_007142920.1|  hypothetical protein PHAVU_007G028200g           58.9    8e-07   
ref|XP_009598010.1|  PREDICTED: uncharacterized protein LOC104093884  57.8    1e-06   
ref|XP_006826406.1|  hypothetical protein AMTR_s00004p00151900        59.3    1e-06   
ref|XP_006605245.1|  PREDICTED: protein MKS1-like                     57.4    1e-06   
ref|XP_006469086.1|  PREDICTED: protein MKS1-like                     58.5    1e-06   
ref|XP_008387185.1|  PREDICTED: uncharacterized protein LOC103449631  57.4    1e-06   
ref|XP_011023003.1|  PREDICTED: protein MKS1                          58.2    2e-06   
ref|XP_009362795.1|  PREDICTED: protein MKS1-like                     57.0    2e-06   
ref|XP_007044310.1|  VQ motif-containing protein, putative            58.5    2e-06   
ref|XP_006606887.1|  PREDICTED: uncharacterized protein LOC102663102  57.0    3e-06   
ref|XP_009410007.1|  PREDICTED: protein MKS1-like                     57.0    4e-06   
gb|KHN22584.1|  hypothetical protein glysoja_037734                   55.8    4e-06   
ref|XP_008807120.1|  PREDICTED: protein MKS1-like                     57.0    4e-06   
gb|EYU40762.1|  hypothetical protein MIMGU_mgv1a020379mg              55.8    5e-06   
ref|XP_007202914.1|  hypothetical protein PRUPE_ppa016149mg           55.5    6e-06   
ref|XP_004166845.1|  PREDICTED: uncharacterized protein LOC101226548  55.8    6e-06   
ref|XP_004135399.1|  PREDICTED: uncharacterized protein LOC101211961  55.8    6e-06   
ref|XP_004497082.1|  PREDICTED: uncharacterized protein LOC101495872  55.8    9e-06   
ref|XP_010264057.1|  PREDICTED: protein MKS1-like                     55.5    1e-05   
ref|XP_010110444.1|  hypothetical protein L484_006437                 53.9    2e-05   
ref|XP_002308338.2|  hypothetical protein POPTR_0006s21380g           53.1    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010506791.1|  PREDICTED: 5'-3' exoribonuclease 2-like          55.5    3e-05   
gb|AAF81354.1|AC036104_3  Contains weak similarity to bab503 majo...  56.2    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506802.1|  PREDICTED: 5'-3' exoribonuclease 2-like          55.5    3e-05   
ref|NP_173554.3|  nucleic acid/nucleotide binding protein             55.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KCW90405.1|  hypothetical protein EUGRSUZ_A02544                   52.8    4e-05   
ref|XP_008804594.1|  PREDICTED: protein MKS1-like                     53.5    4e-05   
ref|XP_011076667.1|  PREDICTED: protein MKS1                          54.3    5e-05   
ref|XP_009413867.1|  PREDICTED: uncharacterized protein LOC103995088  53.1    5e-05   
ref|XP_008466850.1|  PREDICTED: uncharacterized protein LOC103504155  52.4    6e-05   
ref|XP_002310503.1|  hypothetical protein POPTR_0007s03770g           53.1    7e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004163883.1|  PREDICTED: protein MKS1-like                     53.5    7e-05   
ref|XP_008460908.1|  PREDICTED: protein MKS1-like                     53.1    8e-05   
ref|XP_002321476.1|  VQ motif-containing family protein               53.1    8e-05   Populus trichocarpa [western balsam poplar]
ref|XP_007028069.1|  Uncharacterized protein TCM_023150               52.8    9e-05   
ref|XP_011007716.1|  PREDICTED: uncharacterized protein LOC105113294  52.8    1e-04   
ref|XP_004147377.1|  PREDICTED: protein MKS1-like                     53.5    1e-04   
emb|CDP16568.1|  unnamed protein product                              51.2    1e-04   
emb|CDX95531.1|  BnaC01g34230D                                        53.9    1e-04   
ref|XP_008443599.1|  PREDICTED: protein MKS1-like                     51.2    1e-04   
emb|CDY18516.1|  BnaA01g26790D                                        53.5    1e-04   
ref|XP_009112790.1|  PREDICTED: formin-like protein 7                 53.5    2e-04   
ref|XP_010529087.1|  PREDICTED: uncharacterized protein LOC104806066  52.8    2e-04   
emb|CDY71985.1|  BnaAnng39520D                                        51.2    2e-04   
ref|XP_006299937.1|  hypothetical protein CARUB_v10016148mg           52.8    2e-04   
ref|XP_010228729.1|  PREDICTED: uncharacterized protein LOC100824434  50.8    2e-04   
ref|XP_006485853.1|  PREDICTED: protein MKS1-like                     51.6    2e-04   
ref|XP_006427805.1|  hypothetical protein CICLE_v10026434mg           52.0    2e-04   
emb|CDY44897.1|  BnaA02g13850D                                        50.8    2e-04   
ref|XP_006440985.1|  hypothetical protein CICLE_v10023791mg           52.0    2e-04   
ref|XP_010099240.1|  hypothetical protein L484_015429                 51.6    2e-04   
gb|KDO58360.1|  hypothetical protein CISIN_1g027415mg                 52.0    2e-04   
ref|XP_009127633.1|  PREDICTED: LOW QUALITY PROTEIN: protein MKS1     50.8    3e-04   
ref|XP_007153386.1|  hypothetical protein PHAVU_003G030700g           51.2    3e-04   
ref|XP_002447362.1|  hypothetical protein SORBIDRAFT_06g033670        50.8    4e-04   Sorghum bicolor [broomcorn]
ref|XP_001756584.1|  predicted protein                                52.4    5e-04   
ref|XP_001762871.1|  predicted protein                                52.0    6e-04   
ref|XP_002318547.1|  VQ motif-containing family protein               50.4    6e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002466329.1|  hypothetical protein SORBIDRAFT_01g005740        50.1    6e-04   Sorghum bicolor [broomcorn]
ref|XP_004981493.1|  PREDICTED: protein MKS1-like                     49.3    0.001   
ref|XP_010465925.1|  PREDICTED: 5'-3' exoribonuclease 2-like          50.8    0.001   



>ref|XP_009771111.1| PREDICTED: protein MKS1-like [Nicotiana sylvestris]
Length=281

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 199/266 (75%), Gaps = 11/266 (4%)
 Frame = +1

Query  82   DLGFWSAMDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqh--pppqapp  255
            D      MD       GKSPRRELQGPRP PL+VRKDSHKIRKPPV P Q    P QAPP
Sbjct  25   DSNLMFPMDDQPEYPAGKSPRRELQGPRPTPLKVRKDSHKIRKPPVVPHQQHHQPAQAPP  84

Query  256  rppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaF  435
            RPPVIIYTVSPK+IHANPSEFM+LVQRLTGPDHS+  + ++++++S ++++S+  S   F
Sbjct  85   RPPVIIYTVSPKVIHANPSEFMTLVQRLTGPDHSSTCSTSATATTSTSSSASASYSYFPF  144

Query  436  QDNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffp  615
            Q+N N    GA+SPAARFAS+E TRTPQGK+  I D+   +   EG+EI S++ERS  FP
Sbjct  145  QENMNT---GAISPAARFASIENTRTPQGKRPLISDMANVVH--EGIEIGSEIERSGLFP  199

Query  616  gvlspspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTIN  795
            G+LSP+PSSLPPIPPNFFSPPS D NPLGFF D +SP LH+ N+N  E + F+ SP+  N
Sbjct  200  GILSPNPSSLPPIPPNFFSPPSQDPNPLGFFYD-LSPVLHS-NKNYFEPS-FLSSPTNNN  256

Query  796  SFISPGRFLISPGTPSLDFFNNIFDL  873
              ISP R  +SPGTPSLD FNN+FD+
Sbjct  257  FMISP-RIFLSPGTPSLDLFNNLFDV  281



>ref|XP_009588201.1| PREDICTED: protein MKS1-like [Nicotiana tomentosiformis]
 ref|XP_009598099.1| PREDICTED: protein MKS1-like [Nicotiana tomentosiformis]
Length=280

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 167/263 (63%), Positives = 200/263 (76%), Gaps = 15/263 (6%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhp--ppqapprppvIIY  276
            MD       GKSPRRELQGPRP PL+VRKDSHKIRKPPV P Q    PPQAPPRPPVIIY
Sbjct  27   MDDQPEHPAGKSPRRELQGPRPTPLKVRKDSHKIRKPPVVPHQQYHQPPQAPPRPPVIIY  86

Query  277  TVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaa----aFQDN  444
            TVSPK+IHANPSEFM+LVQRLTGPDHS+  + + + ++S + A+++  SA+     FQ+N
Sbjct  87   TVSPKVIHANPSEFMTLVQRLTGPDHSSTCSTSVTGTTSTSTAAAAAASASYSYFPFQEN  146

Query  445  FNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvl  624
             N    GA+SPAARFAS+E TRTPQGK+  I D+   +   EG+EI S++ERS FFPG+L
Sbjct  147  VNT---GAISPAARFASIENTRTPQGKRPQICDLANMVH--EGIEIGSEIERSGFFPGIL  201

Query  625  spspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFI  804
            SP+PSSLPPIPPNFFSPPS D NPLGFF D +SP LH+ N+N  E + F+PSPS  N  I
Sbjct  202  SPNPSSLPPIPPNFFSPPSQDPNPLGFFYD-LSPVLHS-NKNYFEPS-FLPSPSNNNFMI  258

Query  805  SPGRFLISPGTPSLDFFNNIFDL  873
            SP R  +SPGTPSLD FNN+FD+
Sbjct  259  SP-RIFLSPGTPSLDLFNNLFDV  280



>ref|XP_006362807.1| PREDICTED: protein MKS1-like [Solanum tuberosum]
Length=276

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 188/271 (69%), Gaps = 26/271 (10%)
 Frame = +1

Query  91   FWSAMDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp--  264
            F S MD  +  S GKSPRRELQGPRPAPL+VRKDSHKIRKPPV PSQ             
Sbjct  22   FDSQMDQPE-NSAGKSPRRELQGPRPAPLKVRKDSHKIRKPPVPPSQQHHHHHQQPLAPP  80

Query  265  ---vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaF  435
               VIIYTVSPK+IHANPSEFM+LVQRLTGP+H +         ++ ++  ++  S   F
Sbjct  81   RPPVIIYTVSPKVIHANPSEFMTLVQRLTGPNHHS---------ATCSSTETATSSFYPF  131

Query  436  QDNFNVGGGGAVSPAARFASVERTRTPQGKK--QPIHDVTADIGMV-EGMEISSDVERsv  606
            Q+N N    GA+SPAARFAS+E+TR P+GKK  +   ++     MV EG+EI +++ER  
Sbjct  132  QENMNT---GAISPAARFASIEKTRVPEGKKLQKNCENIENYNYMVHEGIEIGTEIERGG  188

Query  607  ffpgvlspspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNS--LETNLFMPS  780
             FPG+LSP+PSSLPPIPPNFFSPPS+D NPLGFF D +SP LH NN N    E   F+PS
Sbjct  189  VFPGILSPNPSSLPPIPPNFFSPPSNDPNPLGFFYD-LSPVLHNNNNNKNYFELPNFLPS  247

Query  781  PSTINSFISPGRFLISPGTPSLDFFNNIFDL  873
            PS  N+FISP R  +SPGTP+ D FNN+FD+
Sbjct  248  PSN-NNFISP-RLFLSPGTPTFDLFNNLFDV  276



>ref|XP_010320062.1| PREDICTED: protein MKS1-like [Solanum lycopersicum]
Length=273

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 155/273 (57%), Positives = 189/273 (69%), Gaps = 30/273 (11%)
 Frame = +1

Query  91   FWSAMDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprp---  261
            F S MD  +  + GKSPRRELQGPRPAPL+VRKDSHKIRKPPV PSQH            
Sbjct  19   FDSLMDPPE-NTAGKSPRRELQGPRPAPLKVRKDSHKIRKPPVPPSQHHHHHHQQPLGPP  77

Query  262  --pvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaF  435
              PVIIYTVSPK+IHANPSEFM+LVQRLTGP+H +              ++S   +++ +
Sbjct  78   RPPVIIYTVSPKVIHANPSEFMTLVQRLTGPNHHS-----------ATCSTSETATSSFY  126

Query  436  QDNFNVGGGGAVSPAARFASVERTRTPQGKK--QPIHDVTADIGMV-EGMEISSDVERsv  606
            Q+N N    GA+SPAARFAS+E+TR  +GKK  +   ++     MV EG+EI +D+ERS 
Sbjct  127  QENMNT---GAISPAARFASIEKTRVQEGKKLQKNCENIENYNNMVHEGIEIGTDIERSG  183

Query  607  ffpgvlspspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNS----LETNLFM  774
            FFPG+LSP+PSSL PIPPNFFSPPS+D NPLGFF D +SP LH NN  +     E   F+
Sbjct  184  FFPGILSPNPSSLQPIPPNFFSPPSNDPNPLGFFYD-LSPVLHNNNNVNNKNYFELPNFL  242

Query  775  PSPSTINSFISPGRFLISPGTPSLDFFNNIFDL  873
            PSPS  N+FISP R  +SPGTPS D FNN+FD+
Sbjct  243  PSPSN-NNFISP-RLFLSPGTPSFDLFNNLFDV  273



>ref|XP_009594473.1| PREDICTED: protein MKS1-like [Nicotiana tomentosiformis]
Length=233

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 171/251 (68%), Gaps = 29/251 (12%)
 Frame = +1

Query  130  GKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqh---pppqapprppvIIYTVSPKIIH  300
            GKSP+RELQGPRP PL+VRKDSHKIRKPPV P Q     PPQAPP+PPVIIYTVSPK+IH
Sbjct  9    GKSPKRELQGPRPTPLKVRKDSHKIRKPPVVPHQQHHQLPPQAPPQPPVIIYTVSPKVIH  68

Query  301  ANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPA  480
            ANPSEFM+LVQRLTGP   +            +++ SS  S+  FQ N N+   GA+SPA
Sbjct  69   ANPSEFMTLVQRLTGPGPDS------------SSSFSSSSSSFPFQQNMNI---GAISPA  113

Query  481  ARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlspspsslppipp  660
            ARFAS+E+TRT +GKK  I     DI MVEG+E + +VERS      +     +  P  P
Sbjct  114  ARFASIEKTRTLEGKKPQI----CDIEMVEGIETNREVERSSGLFPGILSPNPASLPPIP  169

Query  661  nffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLISPGTP  840
            + F  P SD NPLGFF D +SP LH+ NRN    + ++ SPS   +FISP R ++SPGTP
Sbjct  170  SNFFSPLSDPNPLGFFND-LSPVLHS-NRNYFGHS-YLSSPS---NFISP-RIILSPGTP  222

Query  841  SLDFFNNIFDL  873
            SLD F+N+FD+
Sbjct  223  SLDLFSNLFDI  233



>emb|CDP18280.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 164/258 (64%), Gaps = 30/258 (12%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD SD  S GKSPRRELQGPRP PL+VRKDSHKIRK P  P Q   PQAPPRPPVIIYTV
Sbjct  1    MDFSDYSS-GKSPRRELQGPRPTPLKVRKDSHKIRK-PPIPPQPSQPQAPPRPPVIIYTV  58

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IHANP+EFM+LVQRLTGPD +         SSS    S    S ++FQD      G
Sbjct  59   SPKVIHANPNEFMTLVQRLTGPDSTC--------SSSTVVNSEVSSSTSSFQD-----FG  105

Query  463  GAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGME-ISSDVERsvffpgvlspsps  639
            GA+SPAARFA++E+ + P GK +       DI +VEGME IS ++ERS      +     
Sbjct  106  GAISPAARFAAIEKAKAPLGKNK-AQVSENDISVVEGMELISGELERSSGLFPGILSPNP  164

Query  640  slppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRF  819
            +     P+ F  P SD NPLGFF D +SP LH+ N+N  E N F+ SPST          
Sbjct  165  ASLQPIPSTFFSPPSDPNPLGFFHD-LSPVLHS-NKNYAE-NSFLFSPST----------  211

Query  820  LISPGTPSLDFFNNIFDL  873
             ISP TP+LD FNN+FDL
Sbjct  212  FISPNTPNLDLFNNLFDL  229



>ref|XP_009799266.1| PREDICTED: protein MKS1-like [Nicotiana sylvestris]
Length=231

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 128/251 (51%), Positives = 158/251 (63%), Gaps = 31/251 (12%)
 Frame = +1

Query  130  GKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp---vIIYTVSPKIIH  300
            GKSP+RELQGPRP PL+VRKDSHKIRKPPV P Q      P  P    VIIYTVSPK+IH
Sbjct  9    GKSPKRELQGPRPTPLKVRKDSHKIRKPPVVPHQQHHQLPPQAPARLPVIIYTVSPKVIH  68

Query  301  ANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPA  480
            ANPSEFM+LVQRLTGPD S+              + SS  S+  FQ+N N+   G +S A
Sbjct  69   ANPSEFMTLVQRLTGPDSSS--------------SFSSSSSSFPFQENMNI---GTISRA  111

Query  481  ARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlspspsslppipp  660
            ARFAS+E+TRT +GK   I     D+ MVEG+E + +VERS      +     +     P
Sbjct  112  ARFASIEKTRTLEGKNPQI----CDMEMVEGIETNREVERSSGVFPGILSPNPASLQPIP  167

Query  661  nffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLISPGTP  840
            + F  P SD NPLGFF D +SP LH+N  +   + L  PS     +FISP R ++SPGTP
Sbjct  168  SNFFSPPSDPNPLGFFND-LSPVLHSNRNHFGHSYLSSPS-----NFISP-RIILSPGTP  220

Query  841  SLDFFNNIFDL  873
            SLD F+N+FD+
Sbjct  221  SLDLFSNLFDV  231



>ref|XP_011101648.1| PREDICTED: protein MKS1 [Sesamum indicum]
Length=243

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 164/262 (63%), Gaps = 24/262 (9%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp----vI  270
            MDM D  S G+SP+RELQGPRP PL+VRKDSHKIRKPPVAP     P      P    VI
Sbjct  1    MDMLDNPS-GRSPKRELQGPRPTPLKVRKDSHKIRKPPVAPPPAAQPYHHTHAPPRPPVI  59

Query  271  IYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFN  450
            IYTVSPKIIHANP+EFMSLVQRLTGP+ +        + S+ +  +SS  SA AF D   
Sbjct  60   IYTVSPKIIHANPNEFMSLVQRLTGPNSTC-------TPSTNSLTTSSSSSAFAFPDK--  110

Query  451  VGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlsp  630
               GGA+SPAARFAS+E+T++P G ++ +  +   IG+VEG+EI  D++R+      +  
Sbjct  111  ---GGAISPAARFASIEKTKSPDGIRKTVQVLDQSIGIVEGIEIRPDIQRTAGQFPGILS  167

Query  631  spsslppippnffsppssDQ-NPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFIS  807
               +  P  P  F  P S+  NPL FF D +SP LH+N   +   ++ +PSPST    IS
Sbjct  168  PNPNTLPPIPPNFFSPPSENYNPLNFFHD-LSPVLHSNRNYNYNLDI-LPSPSTF--IIS  223

Query  808  PGRFLISPGTPSLDFFNNIFDL  873
            P   + SP T  LD F+++FDL
Sbjct  224  PQINMPSPNT--LDLFHSLFDL  243



>ref|XP_006363916.1| PREDICTED: protein MKS1-like [Solanum tuberosum]
Length=245

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 153/264 (58%), Gaps = 32/264 (12%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRK--------ppvapsqhpppqappr  258
            MD S+  S GKSP+RELQGPRP PL++RKDSHKI+K          + P     PQ  PR
Sbjct  1    MDSSE-NSAGKSPKRELQGPRPTPLKLRKDSHKIKKPPVVPRQHHQLPPHHQTQPQPQPR  59

Query  259  ppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQ  438
            PPVIIYTVSPK+IHANPSEFMSLVQRLTGP+  +               SSS +S+  FQ
Sbjct  60   PPVIIYTVSPKVIHANPSEFMSLVQRLTGPNSRS---------------SSSSISSFPFQ  104

Query  439  DNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpg  618
            +N N    GA+SPAARFAS+E TRT +G  +       D+ M +  EI  + E      G
Sbjct  105  ENTN--NIGAISPAARFASIENTRTTKGNIKKSQITNCDMEMSDHEEIEINREIERITSG  162

Query  619  vlspspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINS  798
            V      S  P      S         GFF D +SP L+ NNRN  E + ++PSPS   +
Sbjct  163  VFPQGILSPNPASLQPISSNFFSPPSAGFFHD-LSPELN-NNRNYFEHSNYLPSPS---N  217

Query  799  FISPGRFLISPGTPSLDFFNNIFD  870
            FISP R ++SP TPS D FNNIFD
Sbjct  218  FISP-RIILSPSTPSFDLFNNIFD  240



>ref|XP_007019435.1| VQ motif-containing protein, putative [Theobroma cacao]
 gb|EOY16660.1| VQ motif-containing protein, putative [Theobroma cacao]
Length=231

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 163/257 (63%), Gaps = 26/257 (10%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD SD  +  KSPR+ELQGPRPAPL+VRKDS+KI+KPP+AP     P A  RPPVIIYTV
Sbjct  1    MDSSDFPT-SKSPRKELQGPRPAPLKVRKDSYKIKKPPLAPQPVQQPPAQIRPPVIIYTV  59

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH NPS+FM LVQRLTG          S+S+SS +++  S  S+  F D       
Sbjct  60   SPKVIHTNPSDFMDLVQRLTG----------STSASSGSSSLPSSTSSHPFHDT-----R  104

Query  463  GAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlspspss  642
             A+SPAARFA++E+T++P+GKKQ I +   + G V+G+E++  VER   F   +     +
Sbjct  105  AAISPAARFATIEKTKSPEGKKQQISE--ENFGFVQGVEMNHGVER-TSFFPGILSPGPT  161

Query  643  lppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFL  822
              P     F  P  D N   FF D +SP LH  N+N +E + FMPSPS+ N  I P  ++
Sbjct  162  SLPPISPNFFSPPFDPNSSNFFQD-LSPVLH-GNKNFIEGS-FMPSPSSFN--ILP--YI  214

Query  823  ISPGTPSLDFFNNIFDL  873
             SP TPS+D FNN FDL
Sbjct  215  TSPSTPSIDLFNNFFDL  231



>ref|XP_004242290.1| PREDICTED: protein MKS1-like [Solanum lycopersicum]
Length=240

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 150/263 (57%), Gaps = 35/263 (13%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRK------ppvapsqhpppqapprpp  264
            MD S+  S GKSP+RELQGPRP PL++RKDSHKI+K             H  P  PPRPP
Sbjct  1    MDSSE-NSAGKSPKRELQGPRPTPLKLRKDSHKIKKPPVGPHQHHQLPPHHQPPPPPRPP  59

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDN  444
            +IIYTVSPK+IHANPSEFMSLVQRLTGP+ ++                SS +S+  FQ+N
Sbjct  60   IIIYTVSPKVIHANPSEFMSLVQRLTGPNSTS----------------SSSISSFPFQEN  103

Query  445  FNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvl  624
                   A+SPAARFAS+E TRT +G  +     + D+ MV   EI    E      GV 
Sbjct  104  I-----SAISPAARFASIENTRTTRGNIKRSQITSCDMEMVNHEEIEISREIERSCSGVF  158

Query  625  spspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLE-TNLFMPSPSTINSF  801
                 S  P      S         GFF D +SP LH +NRN  E ++ ++PSPS   +F
Sbjct  159  PQGILSPNPSSLQPISSNFFSPPSAGFFHD-LSPELH-HNRNYFEHSSNYLPSPS---NF  213

Query  802  ISPGRFLISPGTPSLDFFNNIFD  870
            ISP   ++SP TPS D FNNIFD
Sbjct  214  ISPT-IILSPSTPSFDLFNNIFD  235



>ref|XP_002526136.1| Protein MKS1, putative [Ricinus communis]
 gb|EEF36212.1| Protein MKS1, putative [Ricinus communis]
Length=254

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 155/257 (60%), Gaps = 24/257 (9%)
 Frame = +1

Query  133  KSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp--------vIIYTVSP  288
            +SPR+ELQGPRP  L+VRKDSHKI+KPPVAP      Q   +          VIIYTVSP
Sbjct  10   RSPRKELQGPRPPALKVRKDSHKIKKPPVAPQPSQQHQNQQQQYQQSQPRPPVIIYTVSP  69

Query  289  KIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGA  468
            K+IH NPS+FM+LVQRLTG   S+ ++++SSS++   +  +S+ S+  F D       GA
Sbjct  70   KVIHTNPSDFMNLVQRLTG-STSSSSSSSSSSAACSTSNPTSYSSSNPFNDY-----SGA  123

Query  469  VSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlspspsslp  648
            +SPAARFA++E+ ++P    +     + D+G  EG+E+S  +ERS      +     S  
Sbjct  124  ISPAARFATIEKAKSPNENMKQQVQPSGDVGFFEGIEMSQVMERSGNLFHGILSPAPSSL  183

Query  649  pippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLIS  828
            P     F  P SD N + F  D +SP LH  NR+ LE   FMPSPST  +F+SP R   S
Sbjct  184  PPISPNFFSPPSDPNMMSFLHD-LSPALH-GNRSFLE-GTFMPSPST--TFLSP-RLTAS  237

Query  829  PGTPSLDF---FNNIFD  870
            P TPSLD    FNNIFD
Sbjct  238  P-TPSLDLFNNFNNIFD  253



>ref|XP_002306685.1| VQ motif-containing family protein [Populus trichocarpa]
 gb|EEE93681.1| VQ motif-containing family protein [Populus trichocarpa]
Length=236

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 164/259 (63%), Gaps = 39/259 (15%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqh-----pppqapprppv  267
            MD SD     +SPR+ELQGPRP  L++RKDSHKI+KPPVAP           Q  PRPPV
Sbjct  1    MDSSDFPIS-RSPRKELQGPRPPALKIRKDSHKIKKPPVAPQPSHQKPQNQQQIQPRPPV  59

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYT+SPK+IH NP++FM+LVQRLTG                 ++++S+  S +   + F
Sbjct  60   IIYTLSPKVIHTNPNDFMTLVQRLTG-----------------SSSTSTCSSTSTSSNPF  102

Query  448  NVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEG-MEISSDVERsvffpgvl  624
            N    GA+SPAAR+A++E+ ++P  K Q    +  D+G VEG MEI   +ER+   PG+L
Sbjct  103  NDHDCGAISPAARYATIEKAKSP--KDQLKQQLGGDVGFVEGIMEIDQVMERTNLGPGIL  160

Query  625  spspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFI  804
            SP P+SLPPIPPNFFSP S+D N + FF D +SP LH  NRN +E + FMPSPST     
Sbjct  161  SPGPASLPPIPPNFFSPASADPNSVSFFHD-LSPILH-GNRNFIEGS-FMPSPST-----  212

Query  805  SPGRFLISPGTPSLDFFNN  861
                   SP TPS+D FNN
Sbjct  213  -----FFSPSTPSIDLFNN  226



>ref|XP_010244000.1| PREDICTED: protein MKS1-like [Nelumbo nucifera]
Length=260

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 115/263 (44%), Positives = 147/263 (56%), Gaps = 29/263 (11%)
 Frame = +1

Query  97   SAMDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp--vI  270
            S M+ SD  +   SPRRELQGPRP PL+V KDS+KI+KPPVAP    P Q PP+    VI
Sbjct  23   STMNFSDQPTGKPSPRRELQGPRPTPLKVHKDSYKIKKPPVAPQPSQPQQPPPQRRAPVI  82

Query  271  IYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFN  450
            IYTVSPK+IHAN SEFM+LVQRLTGP  ST            + AS    ++++   +  
Sbjct  83   IYTVSPKVIHANASEFMALVQRLTGPSSST-----------SSDASGDAAASSSLPSSSY  131

Query  451  VGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlsp  630
                GA+SPAARFAS+E+T T   K +      AD+GMV G+E+ ++VER       +  
Sbjct  132  ADHSGAISPAARFASIEKTNTSAEKLR-----KADLGMVHGVEMGANVER-TSSIPGILS  185

Query  631  spsslppippnffsppssDQNPLGFFPDF--ISPGLHTNNRNSLETNLFMPSPSTINSFI  804
                  P     F     D   LGF  D   +SP +   N+N +E  LF PSPS   +F+
Sbjct  186  PLPCSLPPISPNFFSSLPDPTSLGFLQDLKDLSP-IFQGNKNYIE-GLFTPSPS---AFL  240

Query  805  SPGRFLISPGTPSLDFFNNIFDL  873
            SP    +SP   SLD F  + DL
Sbjct  241  SPPN--VSPSQ-SLDLFKQLSDL  260



>ref|XP_010664970.1| PREDICTED: protein MKS1 [Vitis vinifera]
 emb|CAN66427.1| hypothetical protein VITISV_029011 [Vitis vinifera]
Length=252

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 146/287 (51%), Gaps = 65/287 (23%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD +D  S GKSPRREL GPRP PL+VRKDSHKIRK    P   P PQA   PPVIIYTV
Sbjct  1    MDSADF-SGGKSPRRELLGPRPTPLKVRKDSHKIRK----PPVVPQPQAQHPPPVIIYTV  55

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPKIIH  PSEFM+LVQRLTG   S+ ++A   S                          
Sbjct  56   SPKIIHTQPSEFMTLVQRLTGLSSSSSSSAPLDS--------------------------  89

Query  463  GAVSPAARFASVERTR-TPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlspsps  639
            GAVSPAARFAS+E+T+ + + +K+     + D+ +VEG+EI   VER   +   +     
Sbjct  90   GAVSPAARFASIEKTKVSAEEEKKKKMQSSGDVDVVEGIEIGGGVER-SGWFPGILSPGP  148

Query  640  slppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTI--NSFI---  804
            S  P     F  P  D   L  F DF SP +H  N+N +E + FMPSPS     SFI   
Sbjct  149  SSLPAISPNFFSPGFDPYSLNIFHDF-SPAVH-GNKNYIEGS-FMPSPSIFGNKSFIEGS  205

Query  805  --------------------SPGRFLISPGTP----SLDFFNNIFDL  873
                                SP  FL +P  P    SLD FNN  D 
Sbjct  206  FMPSPSIFGNKSLIEGSFMPSPSTFLSTPHNPSPTASLDLFNNFLDF  252



>gb|EYU17429.1| hypothetical protein MIMGU_mgv1a012956mg [Erythranthe guttata]
Length=235

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 111/171 (65%), Gaps = 28/171 (16%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRK--------ppvapsqhpppqappr  258
            MD SD+ S   SPR+ELQGPRPAPLRVRKDSHKIRK           +   H    APPR
Sbjct  1    MDFSDVPSGRGSPRKELQGPRPAPLRVRKDSHKIRKPPMAPPAATAASQPFHHHHHAPPR  60

Query  259  ppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQ  438
            PPVIIYTVSPKIIHANP+EFMSLVQRLTGP++S   +A+SSSS+  AAA           
Sbjct  61   PPVIIYTVSPKIIHANPNEFMSLVQRLTGPNNSYSPSASSSSSAFAAAAD----------  110

Query  439  DNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTAD---IGMVEGMEI  582
                   GGAVSPAARFAS+E+T++P G ++  H    D   +G  EG ++
Sbjct  111  -------GGAVSPAARFASIEKTKSPDGGRKQQHVSNLDDQNMGFFEGTDV  154



>ref|XP_002302188.1| VQ motif-containing family protein [Populus trichocarpa]
 gb|EEE81461.1| VQ motif-containing family protein [Populus trichocarpa]
Length=263

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 145/261 (56%), Gaps = 43/261 (16%)
 Frame = +1

Query  100  AMDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp-----  264
            +MD SD     +SPR+ELQGPRP  L++RKDSHKIRKPPVAP           P      
Sbjct  31   SMDSSDFPIS-RSPRKELQGPRPPALKIRKDSHKIRKPPVAPQPFQQQPQNQPPTQQRPP  89

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDN  444
            VIIYTVSPK+IH NP++FM+LVQRLTG                   +SS+  S+  F D+
Sbjct  90   VIIYTVSPKVIHTNPNDFMTLVQRLTG-------------------SSSTSTSSNPFNDD  130

Query  445  FNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEG-MEISSDVERsvffpgv  621
                  GA+SPAARFA++E+  +P+  +Q    +  D+G VEG MEI   +ER       
Sbjct  131  -----CGAISPAARFATIEKANSPK-DQQKQQQLGGDLGYVEGIMEIDRVMER---PSLG  181

Query  622  lspspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSF  801
                      +PP   +  S DQN + FF D +SP LH  NRN +E + FMPSPST   F
Sbjct  182  PGILSPGPASLPPIPPNFFSPDQNSVSFFHD-LSPILH-GNRNFIEGS-FMPSPST---F  235

Query  802  ISPGRFLISPGTPSLDFFNNI  864
            + P   + SP TPS D FNN 
Sbjct  236  VWPR--INSPSTPSTDLFNNF  254



>gb|KCW69207.1| hypothetical protein EUGRSUZ_F02723 [Eucalyptus grandis]
Length=228

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 141/256 (55%), Gaps = 43/256 (17%)
 Frame = +1

Query  130  GKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppq-------apprppvIIYTVSP  288
            GKSPRRELQGPRP  L+VRKDSHKIRKPP+AP Q    Q       APPRPPVIIY VSP
Sbjct  8    GKSPRRELQGPRPPALKVRKDSHKIRKPPMAPPQQQQYQQPSQHLPAPPRPPVIIYAVSP  67

Query  289  KIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGA  468
            K+IH NPSEFMSLVQRLTG   ST+  +                          V  GG 
Sbjct  68   KVIHTNPSEFMSLVQRLTG-ASSTYLPSP-------------------------VASGG-  100

Query  469  VSPAARFASVERTRTPQGKK-QPIHDVTADIGMVEGMEISSDVERsvffpgvlspspssl  645
            VSPAARFA+VER + P+GK+     D+  +I  +  +     VER       +     + 
Sbjct  101  VSPAARFATVERAKPPEGKQIMGGGDILGEIESMGQIGHGGVVER-TGSIPGILSPGPAS  159

Query  646  ppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLI  825
                P+ F  P SD NPL FF D +SP L++   +  + +  + SPS    FISP    I
Sbjct  160  LQPIPSSFFSPLSDPNPLSFFHD-LSPALYSTKNHFTDGSFLLQSPSP---FISP---RI  212

Query  826  SPGTPSLDFFNNIFDL  873
            +   PSLDFF+N FDL
Sbjct  213  TSPAPSLDFFSNFFDL  228



>ref|XP_010062140.1| PREDICTED: protein MKS1 [Eucalyptus grandis]
Length=263

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 141/256 (55%), Gaps = 43/256 (17%)
 Frame = +1

Query  130  GKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppq-------apprppvIIYTVSP  288
            GKSPRRELQGPRP  L+VRKDSHKIRKPP+AP Q    Q       APPRPPVIIY VSP
Sbjct  43   GKSPRRELQGPRPPALKVRKDSHKIRKPPMAPPQQQQYQQPSQHLPAPPRPPVIIYAVSP  102

Query  289  KIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGA  468
            K+IH NPSEFMSLVQRLTG   ST+  +                          V  GG 
Sbjct  103  KVIHTNPSEFMSLVQRLTG-ASSTYLPSP-------------------------VASGG-  135

Query  469  VSPAARFASVERTRTPQGKK-QPIHDVTADIGMVEGMEISSDVERsvffpgvlspspssl  645
            VSPAARFA+VER + P+GK+     D+  +I  +  +     VER       +     + 
Sbjct  136  VSPAARFATVERAKPPEGKQIMGGGDILGEIESMGQIGHGGVVER-TGSIPGILSPGPAS  194

Query  646  ppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLI  825
                P+ F  P SD NPL FF D +SP L++   +  + +  + SPS    FISP    I
Sbjct  195  LQPIPSSFFSPLSDPNPLSFFHD-LSPALYSTKNHFTDGSFLLQSPSP---FISP---RI  247

Query  826  SPGTPSLDFFNNIFDL  873
            +   PSLDFF+N FDL
Sbjct  248  TSPAPSLDFFSNFFDL  263



>ref|XP_011042820.1| PREDICTED: protein MKS1-like [Populus euphratica]
Length=232

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 109/250 (44%), Positives = 143/250 (57%), Gaps = 42/250 (17%)
 Frame = +1

Query  133  KSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp-----vIIYTVSPKII  297
            +SPR+ELQGPRP  L++RKDSHKIRKPPVAP    P      P      VIIYTVSPK+I
Sbjct  10   RSPRKELQGPRPPALKIRKDSHKIRKPPVAPQPFQPQPQNQPPTQPRPPVIIYTVSPKVI  69

Query  298  HANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSP  477
            H NP++FM+LVQRLTG                   +SS+  S+  F D+      GA+SP
Sbjct  70   HTNPNDFMTLVQRLTG-------------------SSSTSTSSNPFNDD-----CGAISP  105

Query  478  AARFASVERTRTPQGKKQPIHDVTADIGMVEGM-EISSDVERsvffpgvlspspsslppi  654
            AAR+A++E+ ++P+  +Q    +  D+G VEG+ EI   +ER                 +
Sbjct  106  AARYATIEKAKSPK-DQQKQQQLGGDLGYVEGITEIDRVMER---PSLGPGILSPGPASL  161

Query  655  ppnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLISPG  834
            PP   +  S DQN + FF D +SP LH  +RN  E + FMPSPST   F+ PG  + SP 
Sbjct  162  PPIPPNFFSPDQNSVSFFHD-LSPILH-GSRNFTEGS-FMPSPST---FMWPG--INSPS  213

Query  835  TPSLDFFNNI  864
            TPS+D FNN 
Sbjct  214  TPSIDLFNNF  223



>ref|XP_010999806.1| PREDICTED: protein MKS1-like [Populus euphratica]
Length=236

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 160/256 (63%), Gaps = 39/256 (15%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqh-----pppqapprppv  267
            MD SD     +SPR+ELQGPRP  L++RKDSHKI+KPPVAP           Q  PRPPV
Sbjct  1    MDSSDFPIS-RSPRKELQGPRPPALKIRKDSHKIKKPPVAPQPSHQKPQNQQQTQPRPPV  59

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYT+SPK+IH NP++FM+LVQRLTG                 ++++S+  S +   + F
Sbjct  60   IIYTLSPKVIHTNPNDFMTLVQRLTG-----------------SSSTSTCSSTSTSSNPF  102

Query  448  NVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEG-MEISSDVERsvffpgvl  624
            N    GA+SPAAR+A++E+ ++P  K Q    +  D+G VEG MEI   +ER    PG+L
Sbjct  103  NDRDCGAISPAARYATIEKAKSP--KDQLKQQLGGDVGFVEGIMEIDQVMERKNLGPGIL  160

Query  625  spspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFI  804
            SP P+SLPPIPPNFFSP S+D N + FF D +SP LH  NRN +E + FMPSPST     
Sbjct  161  SPGPASLPPIPPNFFSPASADPNSVSFFHD-MSPVLH-GNRNFIEGS-FMPSPST-----  212

Query  805  SPGRFLISPGTPSLDF  852
                   SP TPS+D 
Sbjct  213  -----FFSPSTPSIDL  223



>ref|XP_004502599.1| PREDICTED: protein MKS1-like [Cicer arietinum]
Length=237

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 150/265 (57%), Gaps = 51/265 (19%)
 Frame = +1

Query  124  SEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHA  303
            S G+SPRRELQGPRP PLR+ KDSHKI K P  P      Q PPR P+IIYTVSPK+IH 
Sbjct  8    STGRSPRRELQGPRPTPLRIHKDSHKISKKPPLPPPQQQQQQPPRQPIIIYTVSPKVIHT  67

Query  304  NPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAA  483
             P +FM+LVQRLTG   S+ +                        D FN  G G +SPAA
Sbjct  68   TPGDFMNLVQRLTGSTSSSSSNI----------------------DPFN--GDGTISPAA  103

Query  484  RFASVERTRTPQGKKQ------PI----HDVTA-DIGMVEGMEISSD--VERsvff-pgv  621
            R+A+VE+  +P GKKQ      PI    HDV   D+  +E +++ +   +ER      G+
Sbjct  104  RYATVEKAMSPLGKKQVQQRVVPITSTNHDVIMNDVHELEQVQLMNHGILERGNMMFQGI  163

Query  622  lspspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLE--TNLFMPSPSTIN  795
            LSP P+SL PIP NFFSPPSSD N +  F    SP LH+ +RN +E   N F+PSPS   
Sbjct  164  LSPGPASLSPIPSNFFSPPSSDPNMVNNFLHDFSPVLHS-SRNFMEGGANFFLPSPSN--  220

Query  796  SFISPGRFLISPGTPSLDFFNNIFD  870
                     +SP TP++D FN   D
Sbjct  221  --------FVSPHTPTIDLFNYFLD  237



>ref|XP_003527972.2| PREDICTED: protein MKS1-like [Glycine max]
Length=294

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 147/257 (57%), Gaps = 31/257 (12%)
 Frame = +1

Query  133  KSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHAN  306
            +SPRRELQ  GPRP PLR+ KDSHKI+KPP+AP    P Q PPR P+IIYTVSPK+IH  
Sbjct  58   RSPRRELQLQGPRPTPLRINKDSHKIKKPPLAPQPSHPHQPPPRQPIIIYTVSPKVIHTT  117

Query  307  PSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAAR  486
            PS+FM+LVQRLTG   S+ A    S++++               D FN GGGG VSPAAR
Sbjct  118  PSDFMNLVQRLTGSSSSSSAEVVMSNNNNTTHV-----------DPFNNGGGGMVSPAAR  166

Query  487  FASVERTRTPQGKKQPIH-DVTADIGMVEGMEIS---SDVERsvffpgvlsps---pssl  645
            +A++E+  +P GKK  +   V   I  VEG+EIS     +ERS         S    S  
Sbjct  167  YATIEKAMSPMGKKHVLLPSVNNIISDVEGIEISIGDGVLERSQQNMFQGILSPGPASLS  226

Query  646  ppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLE--TNLFMPSPSTINSFISPGRF  819
            P     F  P SSD + + F  D +SP +  + RN  E  ++  +PSPS+  SF      
Sbjct  227  PIPSNFFSPPSSSDPSMISFLRD-LSP-MFQSGRNFTEGGSSFVLPSPSSNFSF------  278

Query  820  LISPGTPSLDFFNNIFD  870
             +SP TPS+D FN   D
Sbjct  279  -VSPHTPSIDLFNYFLD  294



>ref|XP_010102094.1| hypothetical protein L484_001827 [Morus notabilis]
 gb|EXB91953.1| hypothetical protein L484_001827 [Morus notabilis]
Length=254

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 157/263 (60%), Gaps = 20/263 (8%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD SD    GK PR+ELQGPRP PL++ KDS+KIRKPP+AP    PP  PPR PVIIY V
Sbjct  1    MDPSDFP-PGKFPRKELQGPRPTPLKISKDSYKIRKPPLAPQPSQPPARPPRQPVIIYDV  59

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SP+ IH NPS+FM LVQRLTG   S+    AS+S ++ AA++++  +   F ++  +   
Sbjct  60   SPRTIHTNPSDFMDLVQRLTGLPSSSNNGTASTSITTTAASTAASTANPNFYESQAL--T  117

Query  463  GAVSPAARFASVERTRTPQGKKQPIHDVTADI------GMVEGMEISSDVERsvffpgvl  624
            GA+SPA R+A++E+ ++PQG     HD           G++EGMEI  D + +      +
Sbjct  118  GAISPAVRYATIEKAKSPQGNLDHDHDHPHHHDHDHMSGLMEGMEIMQD-QYNKGLFSGV  176

Query  625  spspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINS-F  801
                 +  P  P  F  P SD     FF D +SP ++  NRN LE   FMPSP+   S F
Sbjct  177  LSPGPASLPRIPPSFFSPPSDS----FFHD-LSPLINAANRNFLEGG-FMPSPAAAASYF  230

Query  802  ISPGRFLISPGTPSLDF-FNNIF  867
            ISP   + S  TPS+DF FNNIF
Sbjct  231  ISPR--MTSTSTPSIDFLFNNIF  251



>ref|XP_010247250.1| PREDICTED: protein MKS1 [Nelumbo nucifera]
Length=266

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 110/271 (41%), Positives = 141/271 (52%), Gaps = 50/271 (18%)
 Frame = +1

Query  94   WSAMDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprp--pv  267
            +  MD S+  +   SPRRELQGPRP PL+V KDS+KI+KPPV P    PPQ P +   PV
Sbjct  35   FPVMDFSEPPTGRPSPRRELQGPRPTPLKVSKDSYKIKKPPVPPQPSHPPQPPAQNRPPV  94

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIY VSPK+IH + SEFM+LVQRLTGP  ++                          D  
Sbjct  95   IIYAVSPKVIHTDASEFMTLVQRLTGPSPTS-------------------------SDAS  129

Query  448  NVGGGG---------AVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVER  600
            + G G          A+SPAARFA++E+T T   K +       D+ M  G+E+ ++VER
Sbjct  130  DAGAGASSSAFDTTCAISPAARFAAIEKTNTSPDKSR----RAVDLDMAHGVEMGANVER  185

Query  601  svffpgvlspspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPS  780
                   +     S  P     F  P SD   LGF  + +SP  H  N+N +E+  FM S
Sbjct  186  -TSSIPGILSPLPSSLPPISPNFFSPPSDPTSLGFLHE-LSPIFH-GNKNYIES-FFMSS  241

Query  781  PSTINSFISPGRFLISPGTPSLDFFNNIFDL  873
            PS   +F+SP    ISP TPSLD FN   D 
Sbjct  242  PS---AFLSPPN--ISP-TPSLDLFNPFSDF  266



>gb|KDP43028.1| hypothetical protein JCGZ_25214 [Jatropha curcas]
Length=284

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 149/264 (56%), Gaps = 39/264 (15%)
 Frame = +1

Query  97   SAMDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv---  267
            S MD SD     +SPR+ELQGPRP  L+VRKDSHKI+KPPVAP                 
Sbjct  36   SRMDSSDFPV-ARSPRKELQGPRPPALKVRKDSHKIKKPPVAPQPSQQQPHHHYQQPRQP  94

Query  268  -IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDN  444
             IIYTVSPK+IH NP++FM+LVQRLTG           SSSSS  + ++++     F D+
Sbjct  95   IIIYTVSPKVIHTNPNDFMTLVQRLTG-----------SSSSSSNSTATTYTPPNPFNDD  143

Query  445  FNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvl  624
                 GGA+SPAAR+A++E+ ++P+ +       T D+  +EG+E+S  +ERS+      
Sbjct  144  -----GGAISPAARYATIEKAKSPK-ENNIKQTFTGDMSFLEGIEMSQVMERSLLSSTPT  197

Query  625  --------spspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPS  780
                         +  P     F  P SD N + FF D +SP LH  NRN +E + FMPS
Sbjct  198  GNLLPPGILSPGPASLPPIHQNFFSPQSDPNMVSFFHD-LSPVLH--NRNFMEGS-FMPS  253

Query  781  PSTINSFISPGRFLISPGTPSLDF  852
            PST   F+SP R + SP TPS+D 
Sbjct  254  PST---FLSP-RLMASP-TPSIDL  272



>emb|CBI35491.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 101/243 (42%), Positives = 124/243 (51%), Gaps = 48/243 (20%)
 Frame = +1

Query  160  PRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQRL  339
            PRP PL+VRKDSHKIRKPPV P        P     IIYTVSPKIIH  PSEFM+LVQRL
Sbjct  31   PRPTPLKVRKDSHKIRKPPVVPQPQAQHPPPV----IIYTVSPKIIHTQPSEFMTLVQRL  86

Query  340  TGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFASVERTR-TP  516
            TG   S+ ++A                              GAVSPAARFAS+E+T+ + 
Sbjct  87   TGLSSSSSSSAPL--------------------------DSGAVSPAARFASIEKTKVSA  120

Query  517  QGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlspspsslppippnffsppssDQNP  696
            + +K+     + D+ +VEG+EI   VER   +   +     S  P     F  P  D   
Sbjct  121  EEEKKKKMQSSGDVDVVEGIEIGGGVER-SGWFPGILSPGPSSLPAISPNFFSPGFDPYS  179

Query  697  LGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLISPGTP----SLDFFNNI  864
            L  F DF SP +H  N+N +E + FMPSPST         FL +P  P    SLD FNN 
Sbjct  180  LNIFHDF-SPAVH-GNKNYIEGS-FMPSPST---------FLSTPHNPSPTASLDLFNNF  227

Query  865  FDL  873
             D 
Sbjct  228  LDF  230



>ref|XP_003602152.1| Protein MKS1 [Medicago truncatula]
 gb|AES72403.1| MKS1-like protein [Medicago truncatula]
Length=248

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 153/261 (59%), Gaps = 44/261 (17%)
 Frame = +1

Query  130  GKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv--IIYTVSPKIIHA  303
            G+SPRRELQGPRP PLR+ KDSHKI+KPP+AP Q    Q   +P    IIYTVSPK+IH 
Sbjct  10   GRSPRRELQGPRPTPLRIHKDSHKIKKPPLAPQQQQQQQQYQQPRQPIIIYTVSPKVIHT  69

Query  304  NPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAA  483
             P +FM+LVQRLTG   S+  ++ SSSSSS               D F   G G +SPAA
Sbjct  70   TPGDFMNLVQRLTGSSSSSSTSSTSSSSSSNI-------------DPFR--GDGTISPAA  114

Query  484  RFASVERTRTPQGKK--------QPIHDVTAD-IGMVEGME----ISSDVERsvff-pgv  621
            R+A++E+  +P GKK         PI   T+D I  +EG+E    ++  VER      G+
Sbjct  115  RYATMEKAMSPLGKKQQQQQQIVAPITSFTSDVISDMEGIEQTQLMNHGVERGNMMFQGI  174

Query  622  lspspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLE--TNLFMPSPSTIN  795
            LSP P+SL PIP NFFSPPSSD N    F   +SP LH+  RN +E   N  +PSPS   
Sbjct  175  LSPGPASLSPIPSNFFSPPSSDPNMFNNFLHDLSPALHS-GRNFMEGGANFLLPSPSN--  231

Query  796  SFISPGRFLISPGTPSLDFFN  858
                     +SP TPS+D FN
Sbjct  232  --------FVSPITPSIDLFN  244



>gb|KHN44242.1| Protein MKS1 [Glycine soja]
Length=242

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 101/255 (40%), Positives = 137/255 (54%), Gaps = 33/255 (13%)
 Frame = +1

Query  133  KSPRRELQ--GPRPAPLRVRKDSHKIRKp-pvapsqhpppqapprppvIIYTVSPKIIHA  303
            +SPRRELQ  GPRP PLR+ KDSHKI+KP         P Q PPR P+IIYTVSPK+IH 
Sbjct  12   RSPRRELQLQGPRPTPLRINKDSHKIKKPPLAPQQPSHPHQPPPRQPIIIYTVSPKVIHT  71

Query  304  NPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAA  483
             PS+FM+LVQRLTG   S+     +++++ +              D FN  G G +SPAA
Sbjct  72   TPSDFMNLVQRLTGSSSSSSVVVPNNNNTHV--------------DPFN-NGAGMLSPAA  116

Query  484  RFASVERTRTPQGKKQPIHDVTADIGMVEGMEIS---SDVERsvffpgvlspspsslppi  654
            R+A++E+  +P GKK  +      I  V+G+EI+     +ERS         SP      
Sbjct  117  RYATIEKAMSPMGKKHVLPSGDNIISDVQGIEINIGDGVLERSQQNMFQGILSPGPASLS  176

Query  655  ppnffsppssDQNP--LGFFPDFISPGLHTNNRNSLETNLF-MPSPSTINSFISPGRFLI  825
            P           +P  + F  D +SP +  + RN +E + F +PSPS+  SF       +
Sbjct  177  PIPSNFFSPPSSDPSMVSFLHD-LSP-MFQSGRNFMEGSSFVLPSPSSNFSF-------V  227

Query  826  SPGTPSLDFFNNIFD  870
            SP TPS+D FN   D
Sbjct  228  SPHTPSMDLFNYFLD  242



>ref|XP_003522552.2| PREDICTED: protein MKS1-like [Glycine max]
Length=261

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 102/255 (40%), Positives = 135/255 (53%), Gaps = 33/255 (13%)
 Frame = +1

Query  133  KSPRRELQ--GPRPAPLRVRKDSHKIRKp-pvapsqhpppqapprppvIIYTVSPKIIHA  303
            +SPRRELQ  GPRP PLR+ KDSHKI+KP         P Q PPR P+IIYTVSPK+IH 
Sbjct  31   RSPRRELQLQGPRPTPLRINKDSHKIKKPPLAPQQPSHPHQPPPRQPIIIYTVSPKVIHT  90

Query  304  NPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAA  483
             PS+FM+LVQRLTG              SS +++     +     D FN  G G +SPAA
Sbjct  91   TPSDFMNLVQRLTG--------------SSSSSSVVVPNNNNTHVDPFN-NGAGMLSPAA  135

Query  484  RFASVERTRTPQGKKQPIHDVTADIGMVEGMEIS---SDVERsvffpgvlspspsslppi  654
            R+A++E+  +P GKK  +      I  V+G+EI+     +ERS         SP      
Sbjct  136  RYATIEKAMSPMGKKHVLPSGDNIISDVQGIEINIGDGVLERSQQNMFQGILSPGPASLS  195

Query  655  ppnffsppssDQNP--LGFFPDFISPGLHTNNRNSLETNLF-MPSPSTINSFISPGRFLI  825
            P           +P  + F  D +SP +  + RN +E + F +PSPS+  SF       +
Sbjct  196  PIPSNFFSPPSSDPSMVSFLHD-LSP-MFQSGRNFMEGSSFVLPSPSSNFSF-------V  246

Query  826  SPGTPSLDFFNNIFD  870
            SP TPS+D FN   D
Sbjct  247  SPHTPSMDLFNYFLD  261



>gb|AFK48226.1| unknown [Lotus japonicus]
Length=238

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 151/254 (59%), Gaps = 32/254 (13%)
 Frame = +1

Query  130  GKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANP  309
            G+SPRRELQGPRP PLR+ KDSHKI+KPP+AP    PPQ PPR P+IIYTVSPK+IH  P
Sbjct  10   GRSPRRELQGPRPTPLRINKDSHKIKKPPLAPQASQPPQRPPRQPIIIYTVSPKVIHTTP  69

Query  310  SEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARF  489
            ++FM+LVQRLTG            S++S +++SSS+       D F  G  G VSPAAR+
Sbjct  70   NDFMNLVQRLTG------------STASSSSSSSSFTQVPPANDPFQ-GNTGMVSPAARY  116

Query  490  ASVERTRTPQGKKQPIHDVTAD-----IGMVEGMEISSDVERsvffpgvlspspsslppi  654
            A++E+  +P GKKQ +    AD     +G V+ M     +ER   F G+LSP P+SL PI
Sbjct  117  ATMEKAMSPMGKKQ-VTTTDADMSDVGLGGVQLMNHGVVLERQGMFQGILSPGPASLSPI  175

Query  655  ppnffsppssDQNPLGFFPDF--ISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLIS  828
            P +FFSPP++  +P G    F  +SP  H N          +PSPS            +S
Sbjct  176  PASFFSPPAASSDP-GMASSFQDLSPAFHRNFMEGGGGGFILPSPSN----------FVS  224

Query  829  PGTPSLDFFNNIFD  870
            P T S+D FN   D
Sbjct  225  PHTQSIDLFNYFLD  238



>ref|XP_007141010.1| hypothetical protein PHAVU_008G159700g [Phaseolus vulgaris]
 gb|ESW13004.1| hypothetical protein PHAVU_008G159700g [Phaseolus vulgaris]
Length=237

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 146/257 (57%), Gaps = 28/257 (11%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            M+  D+ S G+S +R+LQGPRP+PLRV K+SHKI+KPPV P     P  P +P  IIYTV
Sbjct  1    MNSQDIPS-GRSSKRQLQGPRPSPLRVNKESHKIKKPPVVPLPCQLPAPPRQPV-IIYTV  58

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH  PSEFMSLVQRLTG   S+ ++                       DN ++ G 
Sbjct  59   SPKVIHTTPSEFMSLVQRLTGSSSSSSSSNKVLIDPLNDNKDHGG-------DNNDLSGN  111

Query  463  GAVSPAARFASVERTRTPQG-KKQPIHD-VTADIGMVEGMEISSD--VERsvffpgvlsp  630
               S  A +A +E  R  Q  K+QP    V  D+G   G +I SD  +ER   F G+LSP
Sbjct  112  LVPSTTAWYAGIEMVRPSQSIKEQPSESRVDVDVG---GSDIVSDGVLERPSMFRGILSP  168

Query  631  spsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISP  810
             P+ L PIP NF SPPS+D N + FF D +SP LH+ NRN +E    M SPS        
Sbjct  169  GPALLSPIPSNFVSPPSTDPNMVSFFQD-LSPVLHS-NRNFMEGTFIMSSPSN-------  219

Query  811  GRFLISPGTPSLDFFNN  861
                +SP TPS+D FNN
Sbjct  220  ---FVSPRTPSIDLFNN  233



>ref|XP_007137554.1| hypothetical protein PHAVU_009G136500g [Phaseolus vulgaris]
 gb|ESW09548.1| hypothetical protein PHAVU_009G136500g [Phaseolus vulgaris]
Length=277

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 136/254 (54%), Gaps = 31/254 (12%)
 Frame = +1

Query  133  KSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHAN  306
            +SPRRELQ  GPRP PLR+ KDSHKI+KPP+AP    P   P +P +I YTVSPK+IH  
Sbjct  47   RSPRRELQLQGPRPTPLRISKDSHKIKKPPLAPQPSHPQPPPRQPIII-YTVSPKVIHTT  105

Query  307  PSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAAR  486
            P++FM+LVQRLTG   S+ + +A+  +                 D FN  GGG VSPAAR
Sbjct  106  PNDFMNLVQRLTGSSSSSSSNSAALPTIIN-------------NDPFN-SGGGMVSPAAR  151

Query  487  FASVERTRTPQGKKQPI-HDVTADIGMVEGMEISSD--VERsvffpgvlspspsslppip  657
            +A+VE+  +P GKK  + H     I  VEG+EI  D  VERS         SP      P
Sbjct  152  YATVEKALSPMGKKPVMGHGDMNIISDVEGIEIMGDGVVERSQQNMFQGILSPGPASLSP  211

Query  658  pnffsppssDQNP--LGFFPDFISPGLHTNNRNSLETNLF-MPSPSTINSFISPGRFLIS  828
                   +   +P  + F  D +SP   +    +  T  F +PSPS+  SF       +S
Sbjct  212  IPSNFFSAPSSDPSMVSFLHD-LSPMFQSGRNFTEGTGAFVLPSPSSNFSF-------VS  263

Query  829  PGTPSLDFFNNIFD  870
            P TPS+D FN   D
Sbjct  264  PHTPSIDLFNYFLD  277



>ref|XP_003544100.1| PREDICTED: protein MKS1-like [Glycine max]
 gb|KHN22188.1| Protein MKS1 [Glycine soja]
Length=237

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 156/264 (59%), Gaps = 36/264 (14%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            M+  D+ S G+SP+RELQGPRP PLR+ KDSHKI++    P   P PQ PPR PVIIYTV
Sbjct  1    MNSQDIPS-GRSPKRELQGPRPTPLRINKDSHKIKR---TPVALPQPQPPPRQPVIIYTV  56

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH  PS+FMSLVQRLTG            SSSS +++S++ +S      N    GG
Sbjct  57   SPKVIHTTPSDFMSLVQRLTG------------SSSSSSSSSTNKVSTEPLNGNKGCNGG  104

Query  463  G---AVSPAARFASVE--RTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvls  627
                A+ P A FA++E  RT T   K+ PI +    +G ++ +     +ER   F G+LS
Sbjct  105  SGSDAILPVAHFATIEMARTATQSTKQHPIENSDDVVGGIDDVVGHGALERPNMFHGILS  164

Query  628  pspsslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLE---TNLFMPSPSTINS  798
            P PSSL PIP NFFSPPS D + +  F D +SP L + +RN +E       MPSPS+   
Sbjct  165  PGPSSLSPIPSNFFSPPSIDPSMVSLFHD-LSPVLRS-SRNFMEGTTATFIMPSPSS---  219

Query  799  FISPGRFLISPGTPSLDFFNNIFD  870
                    +SP TPS+D FNN  D
Sbjct  220  -------FVSPRTPSIDLFNNFSD  236



>ref|XP_006434425.1| hypothetical protein CICLE_v10002106mg [Citrus clementina]
 gb|ESR47665.1| hypothetical protein CICLE_v10002106mg [Citrus clementina]
Length=279

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 114/293 (39%), Positives = 148/293 (51%), Gaps = 50/293 (17%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv-----  267
            MD S      KSPRRELQGPRPAPL+VRKDS+KI+KPPVAP      Q            
Sbjct  1    MDSSSDFPVSKSPRRELQGPRPAPLKVRKDSYKIKKPPVAPPSQQQQQQQHHHHHQAPAP  60

Query  268  ------IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaa  429
                  IIYTVSPK+IH NP++FM+LVQRLTG   S+     +++S + +   +S  S  
Sbjct  61   PPRQPVIIYTVSPKVIHTNPNDFMTLVQRLTGSSSSSTTTTTTTTSFTSSKTVASSSSYD  120

Query  430  aFQDNFNVGGGGAVSPAARFASVERTRTPQGKKQPI----------HDVTADI-------  558
               D+      GA+SPAAR+AS+E+ +     K+ I          H    D        
Sbjct  121  PLGDS-----TGAISPAARYASIEKAKQHSPSKKLIQSHHQYHNHSHSHNEDYHGHTNNN  175

Query  559  --------GMVEGMEISSDVERsvffpgvlspspsslppippnffsppssDQNPLGFFPD  714
                    G VEG+E+  ++ER       +     +  P+ P  F  P SD N   F  D
Sbjct  176  DSNMATGGGFVEGIEMDHNIER-SSLFPGILSPGPTSLPMIPPSFFSPPSDPNSFSFLYD  234

Query  715  FISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLISPGTPSLDFFNNIFDL  873
             +SP LH  N+N +E + FMPSPS  N  ISP    I+  TP +D FNN FD 
Sbjct  235  -LSPVLH-GNKNFIEGS-FMPSPSGFN--ISPH---ITSPTPPIDLFNNFFDF  279



>gb|EPS74170.1| hypothetical protein M569_00585 [Genlisea aurea]
Length=245

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 77/127 (61%), Gaps = 36/127 (28%)
 Frame = +1

Query  130  GKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANP  309
            G+SPRREL GPRP PL+V KDSHKIRKPPVAP Q      PP    IIYTVSPK+IHA+P
Sbjct  30   GRSPRRELLGPRPTPLKVSKDSHKIRKPPVAPQQPAALPRPPV---IIYTVSPKVIHADP  86

Query  310  SEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARF  489
            SEFMSLVQRLT PD ST+                                 G VSPAARF
Sbjct  87   SEFMSLVQRLTCPD-STY--------------------------------DGTVSPAARF  113

Query  490  ASVERTR  510
            AS+ERTR
Sbjct  114  ASIERTR  120



>ref|XP_009408290.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=217

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 83/155 (54%), Gaps = 23/155 (15%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            M+ SD+     SPRRELQGPRP PL+VRKDSHKIRK               R PVIIYTV
Sbjct  1    MEPSDLSLSRPSPRRELQGPRPTPLQVRKDSHKIRK------PPAAAPPQTRQPVIIYTV  54

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IHA+ SEFMSLVQRLTG   S+    A++S                 +   +  GG
Sbjct  55   SPKVIHASRSEFMSLVQRLTGAASSSADPTAAAS-----------------RSRGDSAGG  97

Query  463  GAVSPAARFASVERTRTPQGKKQPIHDVTADIGMV  567
              +SPAAR A  ERT  P   +  +  +  D  M 
Sbjct  98   APLSPAARLAVFERTSHPASNRDVLDQLEIDGPMT  132



>ref|XP_003543946.1| PREDICTED: uncharacterized protein LOC100809190 [Glycine max]
Length=240

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 145/260 (56%), Gaps = 25/260 (10%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            M+  D+ S G+SP+R+LQGPRP PLR+ KDSHKI+K P        PQ P R PVIIYTV
Sbjct  1    MNSQDIPS-GRSPKRQLQGPRPPPLRINKDSHKIKKKPPVAPPSSQPQPPLRQPVIIYTV  59

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH  PS+FMSLVQRLT    S+ +++++  S      +      +           
Sbjct  60   SPKVIHTTPSDFMSLVQRLTSSSSSSSSSSSNKVSIDPLNGNKGHGGGSGI---------  110

Query  463  GAVSPAARFASVE--RTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlspsp  636
              VSPA R+A++E  RT T   K+ PI + + D+G V+ +     ++R   F G+LSP P
Sbjct  111  --VSPAGRYATIEMARTTTQSTKQHPIEN-SDDVGGVDLVGHGVLLKRPNMFHGILSPGP  167

Query  637  sslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFI--SP  810
            SS     P+ F  P S    +G F   +SP L  NNRN      FM   +T  +FI  SP
Sbjct  168  SSSLSPIPSNFFSPPSIDPNMGSFYHDLSPILR-NNRN------FMEGTTTTATFIMPSP  220

Query  811  GRFLISPGTPSLDFFNNIFD  870
              F +SP TPS+D FNN  D
Sbjct  221  SNF-VSPRTPSIDLFNNFSD  239



>ref|XP_010931050.1| PREDICTED: protein MKS1-like [Elaeis guineensis]
Length=230

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 86/137 (63%), Gaps = 22/137 (16%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqappr--ppvIIY  276
            MD SD  +   SPRRELQGPRP PL+VRKDS+KI+KPP  PSQ      PP+   PVIIY
Sbjct  1    MDPSD--APRPSPRRELQGPRPTPLKVRKDSYKIKKPPPGPSQPAAAALPPQHRNPVIIY  58

Query  277  TVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVG  456
            TVSPKIIH  PS+FM+LVQRLTGPD S   +  +S  S  +                   
Sbjct  59   TVSPKIIHTKPSDFMTLVQRLTGPDSSAGPSTDASLPSPSSY------------------  100

Query  457  GGGAVSPAARFASVERT  507
            GGGA+SPAAR A+ E++
Sbjct  101  GGGALSPAARLATFEKS  117



>gb|KDO83658.1| hypothetical protein CISIN_1g045610mg [Citrus sinensis]
Length=286

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 153/301 (51%), Gaps = 59/301 (20%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRK-----------ppvapsqhpppqa  249
            MD S      KSPRRELQGPRPAPL+VRKDS+KI+K                  H  P  
Sbjct  1    MDSSSDFPVSKSPRRELQGPRPAPLKVRKDSYKIKKPPVAPPSQQQQQQQHHHHHQAPAP  60

Query  250  pprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaa  429
            PPR PVIIYTVSPK+IH NP++FM+LVQRLTG      ++++S+++++    S +     
Sbjct  61   PPRQPVIIYTVSPKVIHTNPNDFMTLVQRLTG------SSSSSTTTTTTTTTSFTSSKTV  114

Query  430  aFQDNFNVGGG--GAVSPAARFASVERTRTPQGKKQPIH---------------------  540
            A   +++  G   GA+SPAAR+AS+E+ +     K+ I                      
Sbjct  115  ASSSSYDPLGDSTGAISPAARYASIEKAKQHSPSKKLIQSHHQYRNHNHNHNHSHSHNED  174

Query  541  ----------DVTADIGMVEGMEISSDVERsvffpgvlspspsslppippnffsppssDQ  690
                      ++    G VEG+E+  ++ER       +     +  P+ P  F  P SD 
Sbjct  175  YHGHTNNNDSNMATGGGFVEGIEMDHNIER-SSLFPGILSPGPTSLPMIPPSFFSPPSDP  233

Query  691  NPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLISPGTPSLDFFNNIFD  870
            N   F  D +SP LH  N+N +E + FMPSPS  N  ISP    I+  TP +D FNN FD
Sbjct  234  NSFSFLYD-LSPVLH-GNKNFIEGS-FMPSPSGFN--ISPH---ITSPTPPIDLFNNFFD  285

Query  871  L  873
             
Sbjct  286  F  286



>ref|XP_006472947.1| PREDICTED: protein MKS1-like [Citrus sinensis]
Length=287

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 153/302 (51%), Gaps = 60/302 (20%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp------  264
            MD S      KSPRRELQGPRPAPL+VRKDS+KI+KPPVAP      Q            
Sbjct  1    MDSSSDFPVSKSPRRELQGPRPAPLKVRKDSYKIKKPPVAPPSQQQQQQQQHHHHHQAPA  60

Query  265  ------vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsa  426
                  VIIYTVSPK+IH NP++FM+LVQRLTG      ++++S+++++    S +    
Sbjct  61   PPPRQPVIIYTVSPKVIHTNPNDFMTLVQRLTG------SSSSSTTTTTTTTTSFTSSKT  114

Query  427  aaFQDNFNVGGG--GAVSPAARFASVERTRTPQGKKQPIH--------------------  540
             A   +++  G   GA+SPAAR+AS+E+ +     K+ I                     
Sbjct  115  VASSSSYDPLGDSTGAISPAARYASIEKAKQHSPSKKLIQSHHQYRNHNHNHNHSHSHNE  174

Query  541  -----------DVTADIGMVEGMEISSDVERsvffpgvlspspsslppippnffsppssD  687
                       ++    G VEG+E+  ++ER       +     +  P+ P  F  P SD
Sbjct  175  DYHGHTNNNDSNMATGGGFVEGIEMDHNIER-SSLFPGILSPGPTSLPMIPPSFFSPPSD  233

Query  688  QNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRFLISPGTPSLDFFNNIF  867
             N   F  D +SP LH  N+N +E + FMPSPS  N  ISP    I+  TP +D FNN F
Sbjct  234  PNSFSFLYD-LSPVLH-GNKNFIEGS-FMPSPSGFN--ISPH---ITSPTPPIDLFNNFF  285

Query  868  DL  873
            D 
Sbjct  286  DF  287



>ref|XP_008799745.1| PREDICTED: protein MKS1-like [Phoenix dactylifera]
 ref|XP_008779165.1| PREDICTED: protein MKS1-like [Phoenix dactylifera]
Length=241

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 84/143 (59%), Gaps = 28/143 (20%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv-----  267
            MD SD+     SPRRELQGPRP PL+VRKDS+KI+KPP A SQ      PP  P      
Sbjct  1    MDPSDVPRP--SPRRELQGPRPTPLKVRKDSYKIKKPPPASSQPGAAAPPPPQPPPPHNR  58

Query  268  ---IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQ  438
               IIYTVSPKIIH  PS+FM+LVQRLTGPD S   +  +S  S  +             
Sbjct  59   PPVIIYTVSPKIIHTKPSDFMTLVQRLTGPDSSAGPSTDASLPSPSSY------------  106

Query  439  DNFNVGGGGAVSPAARFASVERT  507
                  GGGA+SPAAR A+ E++
Sbjct  107  ------GGGALSPAARLAAFEKS  123



>ref|XP_010680147.1| PREDICTED: protein MKS1 [Beta vulgaris subsp. vulgaris]
Length=293

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 100/157 (64%), Gaps = 21/157 (13%)
 Frame = +1

Query  103  MDMSDMQSEG-KSPRRELQGPRPAPLRVRKDSHKIRKppvapsq-----hpppqapprpp  264
            MD  D    G + PR+ELQGPRPAPL+VRK+SHKIRKPPVAPS        PP  PPR P
Sbjct  1    MDHPDSPGGGSRPPRKELQGPRPAPLKVRKESHKIRKPPVAPSAFPPQHQQPPPQPPRQP  60

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDN  444
            VIIYTVSPK+IH +P+EFM+LVQRLTGPD++T ++ +SSSS S          +     +
Sbjct  61   VIIYTVSPKVIHTHPNEFMTLVQRLTGPDYATTSSTSSSSSYSQHHHHHHPPPSHNASSS  120

Query  445  FNVGG---------------GGAVSPAARFASVERTR  510
              + G                G++SPAARFAS+E+T+
Sbjct  121  SILAGFSSSSTTHHTMAHHISGSISPAARFASIEKTK  157



>ref|XP_009404341.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=233

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 90/169 (53%), Gaps = 36/169 (21%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp-----v  267
            MD S+ +    SPRRELQGPRPAPLRV ++S KI+KPPVAP  H      P+P      V
Sbjct  1    MDPSEPR---PSPRRELQGPRPAPLRVSRESRKIKKPPVAPPPHHQYPPEPQPQHDRDPV  57

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            +IYTVSPKIIHANPSEFMSLVQRLTGP     A  +  S                     
Sbjct  58   VIYTVSPKIIHANPSEFMSLVQRLTGPGSDPSAEPSLPSP--------------------  97

Query  448  NVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDV  594
                GGA+SPAAR A+ E+  +P           A  G V G EI  + 
Sbjct  98   ----GGALSPAARIATFEKAASPHASDL----YRARTGAVGGFEIEGEA  138



>ref|XP_008785895.1| PREDICTED: protein MKS1-like [Phoenix dactylifera]
Length=228

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 148/264 (56%), Gaps = 43/264 (16%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD S++++   SPRRELQGPRP PL+V+KDSHKI+K          P    RPPVIIY V
Sbjct  1    MDPSELRTGRPSPRRELQGPRPTPLKVQKDSHKIKK------PPVVPPPQHRPPVIIYAV  54

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH  P +FMSLVQRLTG   S+ +AAA+++S S                N N   G
Sbjct  55   SPKVIHTTPGDFMSLVQRLTGASSSSSSAAAAAASRSP--------------SNVNT-AG  99

Query  463  GAVSPAARFASVER---TRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlsps  633
             A SPAAR A++E+       + +++   DV   +G+  G   ++ + R   FPG+LSP 
Sbjct  100  EAPSPAARLAAIEKGAHNLDGEMQRKNGEDVLDQLGIDGG---TTTIHRHSSFPGILSPV  156

Query  634  psslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPG  813
            P+SLP I PNFFSP S + N LGFF + +SP     N+N +E N F+         +SP 
Sbjct  157  PASLPSISPNFFSPRSMETNSLGFFHE-LSPAFQA-NKNFVE-NTFL---------VSPN  204

Query  814  RFLISPGTPS----LDFFNNIFDL  873
             FL +P  PS     D FN   D 
Sbjct  205  NFLTTPVVPSPGAYWDLFNQYQDF  228



>ref|XP_010912071.1| PREDICTED: protein MKS1-like [Elaeis guineensis]
Length=226

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 22/134 (16%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD S+ ++   SPRRELQGPRP PL+V+KDSHKI+K          P    RPPVIIYTV
Sbjct  1    MDPSEQRTRRPSPRRELQGPRPTPLKVQKDSHKIKK------PPLAPPPQHRPPVIIYTV  54

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH  P +FMSLVQRLTG               + +++S++  +A     N N   G
Sbjct  55   SPKVIHTTPGDFMSLVQRLTG---------------ASSSSSAAAAAAPRSPSNVNT-TG  98

Query  463  GAVSPAARFASVER  504
             A+SPAAR A++E+
Sbjct  99   EALSPAARLATIEK  112



>emb|CDP04747.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 123/279 (44%), Gaps = 83/279 (30%)
 Frame = +1

Query  103  MDMSDMQSEGK-SPRRELQGPRPAPLRVRKDSHKIRKppvaps-----------qhpppq  246
            MD  D  + G+ SPRRELQGPRPAPL+V KDSHKI+KPPVAP              P   
Sbjct  1    MDPQDFSTGGRPSPRRELQGPRPAPLKVSKDSHKIKKPPVAPQLHHLNQPAPPHLQPTVD  60

Query  247  apprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsa  426
            +  R PV+IY VSPK+IH   ++FM+LVQRLTG                           
Sbjct  61   SEHRQPVVIYAVSPKVIHTTVNDFMNLVQRLTG---------------------------  93

Query  427  aaFQDNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIG--MVEGMEISSDVER  600
             + +        G +SPAAR ASVE+    + +K+    V +D    ++E +E +S    
Sbjct  94   RSPRPGNTPTAAGDLSPAARLASVEKASPSEREKERQQRVGSDFAEDLMEILEGTS----  149

Query  601  svffpgvlspspsslppippnffsppssDQNP------LGFFPDFISPGLHTNNRNSL--  756
                                         QNP       G  P    PGL +   +    
Sbjct  150  -------------------------FEMGQNPGILSPAPGTLPPVSLPGLFSPAPDPFLN  184

Query  757  ETNLFMPSPSTINSFISPGRFLISPGTPSLDFFNNIFDL  873
              N+F+PSPS + S  SP   LISP  PS D FN  FD 
Sbjct  185  WNNMFLPSPSFLLS--SP---LISPSIPSYDLFNTFFDF  218



>gb|KHN09235.1| Protein MKS1 [Glycine soja]
Length=199

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            M+  D+ S G+SP+R+LQGPRP PLR+ KDSHKI+K P        PQ P R PVIIYTV
Sbjct  1    MNSQDIPS-GRSPKRQLQGPRPPPLRINKDSHKIKKKPPVAPPSSQPQPPLRQPVIIYTV  59

Query  283  SPKIIHANPSEFMSLVQRLT  342
            SPK+IH  PS+FMSLVQRLT
Sbjct  60   SPKVIHTTPSDFMSLVQRLT  79



>ref|XP_004290549.1| PREDICTED: protein MKS1-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 63/85 (74%), Gaps = 5/85 (6%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqappr--ppvI  270
            MD SD  + GKSPR+ELQ  GPRPAPL++ KDSHKI+KPPV P      Q       PVI
Sbjct  1    MDFSDYPT-GKSPRKELQLQGPRPAPLKIHKDSHKIKKPPVVPQPSQANQPHQPPRQPVI  59

Query  271  IYTVSPKIIHANPSEFMSLVQRLTG  345
            IYTVSPKIIH NPS+FM+LVQRLTG
Sbjct  60   IYTVSPKIIHTNPSDFMNLVQRLTG  84



>ref|XP_008784130.1| PREDICTED: protein MKS1-like [Phoenix dactylifera]
Length=236

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 90/171 (53%), Gaps = 36/171 (21%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp------  264
            MD S M     SPRRELQGPRP PL+VRKDS+KI+KPP AP+      A           
Sbjct  1    MDPSGMPRP--SPRRELQGPRPTPLKVRKDSYKIKKPPPAPAGPSHTAAAAAAAAAPHHR  58

Query  265  --vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQ  438
              VIIYTVSPKIIH  PS+FM+LVQRLTGPD S  A+  S S                  
Sbjct  59   PPVIIYTVSPKIIHTKPSDFMNLVQRLTGPDSSADASLPSPSY-----------------  101

Query  439  DNFNVGGGGAVSPAARFASVERT-RTPQG--KKQPIHDVTADIGMVEGMEI  582
                  G GA+SPAAR A+ E++  +P G   +    DV A   M  G  +
Sbjct  102  ------GSGALSPAARLATFEKSAHSPHGDRTRSSALDVAAQFDMDVGGPV  146



>ref|XP_010537290.1| PREDICTED: protein MKS1 [Tarenaya hassleriana]
Length=230

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 31/145 (21%)
 Frame = +1

Query  103  MDMSDMQSEGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqh---------pppqap  252
            MD S+     +SPR RE+ GPRPAPLRVRKDSHKI+KPP+AP Q           P   P
Sbjct  1    MDPSENSQANRSPRSREILGPRPAPLRVRKDSHKIKKPPLAPPQQHHPHQEAPPLPAPPP  60

Query  253  prppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
            PR PVIIYTVSPKIIH NPS+FM+LVQRLTG   S+ +++  +++               
Sbjct  61   PRAPVIIYTVSPKIIHTNPSDFMTLVQRLTGKTASSSSSSGFATA---------------  105

Query  433  FQDNFNVGGGGAVSPAARFASVERT  507
                  V G G++SPAAR+A+ E+ 
Sbjct  106  ------VRGDGSISPAARYAATEKA  124



>ref|XP_009419409.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=243

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            M  SD+    +S RREL GPRP PL+VRKDS+KIRKPP+A  Q   P    R P+IIYTV
Sbjct  1    MSSSDLPMGEQSSRRELHGPRPTPLKVRKDSYKIRKPPMAAPQQAAPPPQQRRPIIIYTV  60

Query  283  SPKIIHANPSEFMSLVQRLTG  345
            SPK+IH  P++FMS+VQRLTG
Sbjct  61   SPKVIHTTPTDFMSVVQRLTG  81



>ref|NP_001142192.1| hypothetical protein [Zea mays]
 gb|ACF87856.1| unknown [Zea mays]
 gb|AFW74203.1| hypothetical protein ZEAMMB73_323577 [Zea mays]
Length=324

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFM  321
            RRELQGPRPAPLR+ KDSHKI+KP     QH  P    R PVI+YTVSPK++HA PSEFM
Sbjct  22   RRELQGPRPAPLRLHKDSHKIKKPGPPQPQHVGPVQQVRQPVIVYTVSPKVVHAKPSEFM  81

Query  322  SLVQRLTG  345
            S+VQRLTG
Sbjct  82   SVVQRLTG  89



>ref|XP_002443688.1| hypothetical protein SORBIDRAFT_07g000390 [Sorghum bicolor]
 gb|EES13183.1| hypothetical protein SORBIDRAFT_07g000390 [Sorghum bicolor]
Length=315

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqappr-ppvIIYTVSPKIIHANPSEF  318
            RRELQGPRPAPL+VRKDSHKIRKPP                PVIIYTVSPK++HA P EF
Sbjct  24   RRELQGPRPAPLKVRKDSHKIRKPPAPQPGGGGGPVQQVRQPVIIYTVSPKVVHAEPGEF  83

Query  319  MSLVQRLTG  345
            MS+VQRLTG
Sbjct  84   MSVVQRLTG  92



>ref|XP_007199973.1| hypothetical protein PRUPE_ppa026048mg [Prunus persica]
 gb|EMJ01172.1| hypothetical protein PRUPE_ppa026048mg [Prunus persica]
Length=217

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 58/83 (70%), Gaps = 9/83 (11%)
 Frame = +1

Query  124  SEGKSPRRELQ--GPRPAPLRVRKDSHKIRK-------ppvapsqhpppqapprppvIIY  276
            S GKSPRRELQ  GPRP PLRV KDSHKI+K           PSQ P     PR PVIIY
Sbjct  4    SAGKSPRRELQLQGPRPTPLRVHKDSHKIKKPPIVPQPSSQPPSQQPHLYQQPRQPVIIY  63

Query  277  TVSPKIIHANPSEFMSLVQRLTG  345
            TVSPK+IH NPSEFM LVQRLTG
Sbjct  64   TVSPKVIHTNPSEFMDLVQRLTG  86



>ref|XP_008237628.1| PREDICTED: protein MKS1 [Prunus mume]
Length=217

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 57/83 (69%), Gaps = 9/83 (11%)
 Frame = +1

Query  124  SEGKSPRRELQ--GPRPAPLRVRKDSHKIRK-------ppvapsqhpppqapprppvIIY  276
            S GKSPRRELQ  GPRP PLRV KDSHKI+K           PS  P     PR PVIIY
Sbjct  4    SAGKSPRRELQLQGPRPTPLRVHKDSHKIKKPPIVPQPSSQPPSHQPHLYQQPRQPVIIY  63

Query  277  TVSPKIIHANPSEFMSLVQRLTG  345
            TVSPK+IH NPS+FM LVQRLTG
Sbjct  64   TVSPKVIHTNPSDFMDLVQRLTG  86



>ref|XP_009350442.1| PREDICTED: protein MKS1-like [Pyrus x bretschneideri]
Length=219

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 58/84 (69%), Gaps = 10/84 (12%)
 Frame = +1

Query  124  SEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqappr--------ppvII  273
            S GKSPRRELQ  GPRP PLR+ KDSHKI+KPPV P     P    +         PVII
Sbjct  4    STGKSPRRELQLQGPRPTPLRIHKDSHKIKKPPVVPQPSQQPNQQQQPHHYQQPRQPVII  63

Query  274  YTVSPKIIHANPSEFMSLVQRLTG  345
            YTVSPK+IH NPSEFM LVQRLTG
Sbjct  64   YTVSPKVIHTNPSEFMDLVQRLTG  87



>ref|XP_008349061.1| PREDICTED: protein MKS1-like [Malus domestica]
Length=219

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 56/84 (67%), Gaps = 10/84 (12%)
 Frame = +1

Query  124  SEGKSPRRELQ--GPRPAPLRVRKDSHKIRK--------ppvapsqhpppqapprppvII  273
            S GKSPRRELQ  GPRP PLR+ KDSHKI+K              Q P     PR PVII
Sbjct  4    STGKSPRRELQLQGPRPTPLRIHKDSHKIKKPPVVPQPSQQPNQQQQPHHYQQPRQPVII  63

Query  274  YTVSPKIIHANPSEFMSLVQRLTG  345
            YTVSPK+IH NPSEFM LVQRLTG
Sbjct  64   YTVSPKVIHTNPSEFMDLVQRLTG  87



>ref|XP_009404909.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=219

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 77/146 (53%), Gaps = 34/146 (23%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvap------sqhpppqapprpp  264
            MD S+ +    SPRRELQGPRP PL+V K+S+KI+KPP          Q P P    RPP
Sbjct  1    MDPSEPR---PSPRRELQGPRPTPLKVSKESYKIKKPPAPSHPVAPPPQPPQPTQALRPP  57

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDN  444
            V+IY +SPKIIH  P EFM+LVQRLTGPD S                           D 
Sbjct  58   VVIYAISPKIIHVEPGEFMTLVQRLTGPDSSA-------------------------ADL  92

Query  445  FNVGGGGAVSPAARFASVERTRTPQG  522
                  GA+SPAAR A+ E +  P+ 
Sbjct  93   SLPSPTGALSPAARIATFESSAPPRA  118



>ref|XP_008373255.1| PREDICTED: protein MKS1 [Malus domestica]
Length=225

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 58/84 (69%), Gaps = 10/84 (12%)
 Frame = +1

Query  124  SEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqappr--------ppvII  273
            S GKSPRRELQ  GPRP PL++ KDSHKI+KPPV P     P    +         PVII
Sbjct  4    STGKSPRRELQLQGPRPTPLKIHKDSHKIKKPPVVPQPSQLPNQQQQPHHYQQPRQPVII  63

Query  274  YTVSPKIIHANPSEFMSLVQRLTG  345
            YTVSPK+IH NPSEFM LVQRLTG
Sbjct  64   YTVSPKVIHTNPSEFMDLVQRLTG  87



>gb|EMT30486.1| hypothetical protein F775_14892 [Aegilops tauschii]
Length=254

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 9/66 (14%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            ELQGPRPAPLRV KDSHKI+KPP +  + P          IIYTVSPK++HANP EFMS+
Sbjct  19   ELQGPRPAPLRVHKDSHKIKKPPASQVRQPV---------IIYTVSPKVVHANPGEFMSV  69

Query  328  VQRLTG  345
            VQRLTG
Sbjct  70   VQRLTG  75



>ref|XP_009360755.1| PREDICTED: protein MKS1-like [Pyrus x bretschneideri]
Length=235

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 59/84 (70%), Gaps = 10/84 (12%)
 Frame = +1

Query  124  SEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqappr--------ppvII  273
            S GKSPRRELQ  GPRP PL++ KDSHKI+KPPVAP     P    +         PVII
Sbjct  4    SPGKSPRRELQLQGPRPTPLKIHKDSHKIKKPPVAPQPSQQPNQQQQPHHYQQPRQPVII  63

Query  274  YTVSPKIIHANPSEFMSLVQRLTG  345
            YTVSPK+IH NPSEFM LVQRLTG
Sbjct  64   YTVSPKVIHTNPSEFMDLVQRLTG  87



>ref|XP_009390050.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=223

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 58/79 (73%), Gaps = 9/79 (11%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv---------IIYTVSP  288
            SPRRELQGPRPAPLRV KDS+KI+KPPVAPS H  P A   P           IIY VSP
Sbjct  9    SPRRELQGPRPAPLRVSKDSYKIKKPPVAPSHHSQPPADLPPRPPPQQHRDPVIIYAVSP  68

Query  289  KIIHANPSEFMSLVQRLTG  345
            KIIH +PSEFM+LVQRLTG
Sbjct  69   KIIHTDPSEFMTLVQRLTG  87



>ref|XP_006854610.1| hypothetical protein AMTR_s00030p00143350 [Amborella trichopoda]
 gb|ERN16077.1| hypothetical protein AMTR_s00030p00143350 [Amborella trichopoda]
Length=204

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +1

Query  130  GKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp----vIIYTVSPKII  297
            GK PR+ELQGPRPAPL+VRKDSHKI+KPP             +      VIIYTVSPK+I
Sbjct  9    GKPPRKELQGPRPAPLKVRKDSHKIKKPPTGLPPQNSLPLNHQTQNRPPVIIYTVSPKVI  68

Query  298  HANPSEFMSLVQRLTG  345
            H   S+FM+LVQ LTG
Sbjct  69   HTKASDFMTLVQSLTG  84



>ref|XP_004974293.1| PREDICTED: protein MKS1-like [Setaria italica]
Length=260

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 79/152 (52%), Gaps = 35/152 (23%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMS  324
            RELQGPRPAPL+VRK SHKIRKPP    + P          IIYT+SPK++HA+ SEFMS
Sbjct  20   RELQGPRPAPLKVRKGSHKIRKPPPQQVREPV---------IIYTLSPKVVHADASEFMS  70

Query  325  LVQRLTG-----------PDHST--------FaaaassssssiaaassswlsaaaFQDNF  447
            +VQRLTG           PDH          F   +S  SS+ AA          FQ   
Sbjct  71   VVQRLTGATASSSSSSSVPDHQIQASSLPPWFPFFSSGQSSASAALLQPPAPHFPFQLQH  130

Query  448  NVGGGG-------AVSPAARFASVERTRTPQG  522
                GG        +SPAAR A++E+ R+  G
Sbjct  131  QQAAGGPHDLNQQVISPAARLAAIEQARSSSG  162



>ref|XP_009420897.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=205

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 8/75 (11%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSE  315
            SPRR++QGPRP PL+V KDS+KI+KPPVAP    P          IY VSPKIIHA P E
Sbjct  9    SPRRQVQGPRPTPLKVSKDSYKIKKPPVAPPPRVPLV--------IYAVSPKIIHAQPGE  60

Query  316  FMSLVQRLTGPDHST  360
            FM+LVQRLTGP  S 
Sbjct  61   FMTLVQRLTGPSSSA  75



>ref|XP_006659734.1| PREDICTED: protein MKS1-like [Oryza brachyantha]
Length=214

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 11/71 (15%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            E+QGPRPAPL+V KDSHKIRKP                  IIYT+SPK++HANP++FMS+
Sbjct  16   EMQGPRPAPLKVSKDSHKIRKPQQLRQPV-----------IIYTMSPKVVHANPADFMSV  64

Query  328  VQRLTGPDHST  360
            VQRLTG   +T
Sbjct  65   VQRLTGAPRTT  75



>dbj|BAD33166.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ05284.1| hypothetical protein OsI_27487 [Oryza sativa Indica Group]
Length=207

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 8/67 (12%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMS  324
            RELQGPRPAPL+VRK+SHKIRK          P    R PVIIYT+SPK++HAN ++FMS
Sbjct  17   RELQGPRPAPLKVRKESHKIRK--------QEPVQQLRQPVIIYTMSPKVVHANAADFMS  68

Query  325  LVQRLTG  345
            +VQRLTG
Sbjct  69   VVQRLTG  75



>gb|EAZ41227.1| hypothetical protein OsJ_25732 [Oryza sativa Japonica Group]
Length=207

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 8/67 (12%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMS  324
            RELQGPRPAPL+VRK+SHKIRK          P    R PVIIYT+SPK++HAN ++FMS
Sbjct  17   RELQGPRPAPLKVRKESHKIRK--------QEPVQQLRQPVIIYTMSPKVVHANAADFMS  68

Query  325  LVQRLTG  345
            +VQRLTG
Sbjct  69   VVQRLTG  75



>ref|XP_010236394.1| PREDICTED: protein MKS1-like [Brachypodium distachyon]
Length=276

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 8/67 (12%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMS  324
            RE+QGPRPAPLRV K+SH+IRKPP    Q  P         IIYTVSPK+IHA+PS+FMS
Sbjct  20   REMQGPRPAPLRVHKESHRIRKPPPPQPQRQPV--------IIYTVSPKVIHADPSDFMS  71

Query  325  LVQRLTG  345
            +VQRLTG
Sbjct  72   VVQRLTG  78



>ref|XP_009420191.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=214

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 121/257 (47%), Gaps = 45/257 (18%)
 Frame = +1

Query  103  MDMSDMQSEG-KSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYT  279
            M  SD+  +G ++ RREL GPRPAPLR+RKDS+K++K        P      RPP+IIY 
Sbjct  1    MGCSDLAMDGGQASRRELLGPRPAPLRIRKDSYKLKK-------PPVAPPQHRPPIIIYA  53

Query  280  VSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGG  459
            +SPK+IH  P +FMS+VQRLTG                     ++  S+++   +  +  
Sbjct  54   ISPKVIHTTPDDFMSVVQRLTG---------------------AAAASSSSSSADAPLAT  92

Query  460  GGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVERsvffpgvlspsps  639
            G   SPAARFA  E+    QG       ++AD+    G   +S ++R       +     
Sbjct  93   GEVFSPAARFAVFEKPA--QGA------ISADLLGTGGG--TSTLDRPSASFHGILSPVP  142

Query  640  slppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGRF  819
            S  P         S+ Q  + F  + +SP +H         N FMPSPS   +F+S G  
Sbjct  143  SSLPWISPNLFASSTGQTQISFV-NELSPAIHGGRSFPETINCFMPSPS---NFLS-GGM  197

Query  820  LISPGTPSLDFFNNIFD  870
            + SP     D FN   D
Sbjct  198  VPSPAA-FWDLFNQYQD  213



>ref|XP_010507076.1| PREDICTED: protein MKS1-like [Camelina sativa]
Length=223

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 85/173 (49%), Gaps = 38/173 (22%)
 Frame = +1

Query  103  MDMSDMQSEG--KSPRRELQ--GPRPAPLRVRKDSHKI------RKppvapsqhpppqap  252
            MD S+  + G  ++ +R+LQ  GPRP+PL V KDSHKI         P      P     
Sbjct  1    MDPSEYFAGGDQQNQKRQLQICGPRPSPLSVHKDSHKIIKKPPKHPAPPQNRDQPQQPYV  60

Query  253  prppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
            PR PV+IY VSPK++HA  SEFM++VQRLTG     F                       
Sbjct  61   PREPVVIYAVSPKVVHATASEFMNVVQRLTGISSEVF-----------------------  97

Query  433  FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSD  591
                   GGGG VSPAAR AS E   +P+G K+P   V  D  +   ME +++
Sbjct  98   ----LESGGGGNVSPAARLASTENA-SPRGGKEPPVVVARDDEIPTAMEEAAE  145



>ref|XP_003525114.1| PREDICTED: protein MKS1-like [Glycine max]
Length=208

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 78/148 (53%), Gaps = 32/148 (22%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRK---ppvapsqhpppqapprppvIIYTVSPKIIHANPSEF  318
            +LQG RP PLRV KDSHKIRK   PP A    PPP    R PVIIYTVSPK++H   S+F
Sbjct  23   QLQGTRPPPLRVSKDSHKIRKPPLPPTAHQPAPPPPPEQRKPVIIYTVSPKVLHVTVSDF  82

Query  319  MSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFASV  498
            M++VQRLTGP                             + N   G    VSPAAR AS+
Sbjct  83   MNVVQRLTGPSSGA-------------------------EPNLRAGD---VSPAARLASI  114

Query  499  ERTRTPQGKKQPIHDVTADIGMVEGMEI  582
            ERT   + +K    D    + M+EG+E+
Sbjct  115  ERTSPSEREKVRSEDNDVTL-MLEGVEV  141



>ref|XP_002885272.1| hypothetical protein ARALYDRAFT_898238 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002885273.1| hypothetical protein ARALYDRAFT_898240 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61531.1| hypothetical protein ARALYDRAFT_898238 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61532.1| hypothetical protein ARALYDRAFT_898240 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 89/170 (52%), Gaps = 39/170 (23%)
 Frame = +1

Query  91   FWSAMDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp  264
            +++  + SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+  P    PP   
Sbjct  6    YFAGGNPSDQQNQ----KRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPNRDQPPPYI  61

Query  265  ----vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
                V+IY VSPK++HA  SEFM++VQRLTG     F                       
Sbjct  62   PREPVVIYAVSPKVVHATASEFMNVVQRLTGISSGVF-----------------------  98

Query  433  FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQP-IHDVTADIGMVEGME  579
                   GGGG VSPAAR AS E   +P+G K+P   + T +I M E  E
Sbjct  99   ----LESGGGGDVSPAARLASTENA-SPRGGKEPAARNETVEITMEEAAE  143



>ref|XP_010465978.1| PREDICTED: protein MKS1-like [Camelina sativa]
Length=221

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 86/173 (50%), Gaps = 37/173 (21%)
 Frame = +1

Query  103  MDMSDMQSEG--KSPRRELQ--GPRPAPLRVRKDSHKI------RKppvapsqhpppqap  252
            MD S+  + G  ++ +R+LQ  GPRP+PL V KDSHKI         P      P     
Sbjct  1    MDPSEYFAGGDQQNQKRQLQICGPRPSPLSVHKDSHKIIKKPPKHPAPPQNRDQPQQPYV  60

Query  253  prppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
            PR PV+IY VSPK++HA  SEFM++VQRLTG     F  +                    
Sbjct  61   PREPVVIYAVSPKVVHATASEFMNVVQRLTGISSEVFLESG-------------------  101

Query  433  FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSD  591
                   GGGG VSPAAR AS E   +P+G K+P   V  D  +   ME +++
Sbjct  102  -------GGGGNVSPAARLASTENA-SPRGGKEPPVVVATDDEIPTAMEEAAE  146



>ref|XP_003523237.2| PREDICTED: protein MKS1-like [Glycine max]
Length=280

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 82/160 (51%), Gaps = 41/160 (26%)
 Frame = +1

Query  139  PRRE--LQGPRPAPLRVRKDSHKIRKppvapsqhp--------ppqapprppvIIYTVSP  288
            P++E  LQGPRP PL+V KDSHKI+KPP  P+ H               R PVIIY+VSP
Sbjct  82   PKKEVQLQGPRPPPLKVSKDSHKIKKPPPHPAHHHHNHPHAPPEQNLQQREPVIIYSVSP  141

Query  289  KIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGA  468
            K+IH  P +FM +VQRLTG                                 +   G G 
Sbjct  142  KVIHVTPGDFMDVVQRLTGASSG----------------------------EYPPAGRGD  173

Query  469  VSPAARFASVERTRTPQGKKQPIHDVTADIGMV--EGMEI  582
            VSPAAR AS+E+T +P  +++ +H    DI  +  EG+E+
Sbjct  174  VSPAARLASIEKT-SPSERERVLHYKDDDIAWMLEEGVEV  212



>ref|XP_010649402.1| PREDICTED: protein MKS1 [Vitis vinifera]
Length=243

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 84/142 (59%), Gaps = 32/142 (23%)
 Frame = +1

Query  127  EGKSPRR---ELQGPRPAPLRVRKDSHKIRKppva------psqhpppqapprppvIIYT  279
            +G SP+R   ++QGPRP+PL+V K+SHKI+KPP A       +  PPP+   R PVIIYT
Sbjct  32   DGPSPQRRELQIQGPRPSPLKVSKESHKIKKPPTAPLPAHRQTAPPPPENQNREPVIIYT  91

Query  280  VSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGG  459
            +SPK+IH   ++F+S+VQRLTG +++T  +A                       +    G
Sbjct  92   ISPKVIHTTVNDFLSVVQRLTG-NYATSPSA----------------------SDLAASG  128

Query  460  GGAVSPAARFASVERTRTPQGK  525
             G +SPAAR AS+E+T  P+ +
Sbjct  129  AGDLSPAARLASIEKTSPPKER  150



>gb|KEH40436.1| MKS1-like protein [Medicago truncatula]
Length=199

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 57/84 (68%), Gaps = 9/84 (11%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRR---ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvII  273
            M+  +  + G+SP +   +LQGPRP PLR+ K+SHKI+KPP+AP   P          II
Sbjct  1    MNFPNDTTYGRSPIQRGHQLQGPRPTPLRINKNSHKIKKPPLAPQAQPRLPV------II  54

Query  274  YTVSPKIIHANPSEFMSLVQRLTG  345
            Y VSPKIIH  PSEFMSLVQRLTG
Sbjct  55   YMVSPKIIHTTPSEFMSLVQRLTG  78



>ref|XP_009149609.1| PREDICTED: protein MKS1 [Brassica rapa]
Length=230

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 87/164 (53%), Gaps = 28/164 (17%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv------------  267
            + KSPR +E+ GPRP PL++RKDSHKI K P    Q    Q P                 
Sbjct  2    DNKSPRSKEILGPRPTPLKIRKDSHKIIKKPPLAPQPLQSQPPQLHEQEPSQLLPPRGPV  61

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYTVSPKIIH +P+ FM+LVQRLTG   +    ++SS        +S+    +A  D  
Sbjct  62   IIYTVSPKIIHTHPNNFMTLVQRLTGKTSTPTIPSSSSPYPLALDYTSASRDTSAVFD--  119

Query  448  NVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGME  579
                 G++SPAAR+A++E+            +V+ ++G V G+E
Sbjct  120  --ASRGSISPAARYAAMEKA-----------NVSNELGFVGGIE  150



>emb|CDY50839.1| BnaA10g28160D [Brassica napus]
Length=230

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 87/164 (53%), Gaps = 28/164 (17%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv------------  267
            + KSPR +E+ GPRP PL++RKDSHKI K P    Q    Q P                 
Sbjct  2    DNKSPRSKEILGPRPTPLKIRKDSHKIIKKPPLAPQPLQSQPPQLHEQKPSQLLPPRGPV  61

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYTVSPKIIH +P+ FM+LVQRLTG   +    ++SS        +S+    +A  D  
Sbjct  62   IIYTVSPKIIHTHPNNFMTLVQRLTGKTSTPTIPSSSSPYPLALDYTSASRDTSAVFD--  119

Query  448  NVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGME  579
                 G++SPAAR+A++E+            +V+ ++G V G+E
Sbjct  120  --ASRGSISPAARYAAMEKA-----------NVSNELGFVGGIE  150



>ref|XP_009597714.1| PREDICTED: protein MKS1-like [Nicotiana tomentosiformis]
Length=224

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 74/141 (52%), Gaps = 30/141 (21%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqh--------pppqapprppvIIYTVSPKII  297
            RRELQGPRP PL+V KDS+KI+KPPVAP  H         P  +     VIIY VSPK+ 
Sbjct  21   RRELQGPRPTPLKVNKDSYKIKKPPVAPPPHPPPHTAAGAPSTSQNPQTVIIYAVSPKVY  80

Query  298  HANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSP  477
            H   S+FMS+VQRLTG   S+   + S +S                       G G +SP
Sbjct  81   HTTVSDFMSVVQRLTGSSTSSMEPSTSGAS----------------------SGDGNLSP  118

Query  478  AARFASVERTRTPQGKKQPIH  540
            AA+ AS+E+  +P     P +
Sbjct  119  AAKLASMEKASSPSATIPPAY  139



>ref|XP_003532861.1| PREDICTED: protein MKS1-like [Glycine max]
Length=198

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 78/147 (53%), Gaps = 40/147 (27%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapp-rppvIIYTVSPKIIHANPSEFMS  324
            +LQG RP PLRV KDSHKIRKPP+ P+ H P   P  R PVIIY VSPK++H    +FM+
Sbjct  23   QLQGTRPPPLRVSKDSHKIRKPPLPPTAHQPAALPEHRKPVIIYAVSPKVLHVPAGDFMN  82

Query  325  LVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFASVER  504
            +VQRLTGP                                      G VSPAAR AS+ER
Sbjct  83   VVQRLTGPS------------------------------------SGDVSPAARLASIER  106

Query  505  TRTPQGKKQPIHDVTADIG-MVEGMEI  582
            T   + +K  +H    D+  M+EG+E+
Sbjct  107  TSPSEREK--VHSEDNDVKLMLEGVEV  131



>ref|XP_009135590.1| PREDICTED: protein MKS1-like [Brassica rapa]
 emb|CDX82333.1| BnaA03g34880D [Brassica napus]
Length=214

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 82/162 (51%), Gaps = 39/162 (24%)
 Frame = +1

Query  124  SEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh------pppqapprppvIIYT  279
            S+ ++P+R+LQ  GPRP+PL V KDSHKI+KPP  P+              PR PV+IY 
Sbjct  13   SDQQTPKRQLQICGPRPSPLSVNKDSHKIKKPPRHPAPPPQHHRDQAQPYAPREPVVIYA  72

Query  280  VSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGG  459
            VSPK++H   S+FM++VQRLTG     F                                
Sbjct  73   VSPKVVHTTTSDFMNVVQRLTGISSEVF---------------------------LESRN  105

Query  460  GGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEIS  585
             G VSPAAR A+ E   +P+G K+P+   TA   M E  E+S
Sbjct  106  DGDVSPAARLAATENA-SPRGGKEPVEISTA---MEEAAELS  143



>emb|CDY04618.1| BnaC05g16560D [Brassica napus]
Length=230

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 90/164 (55%), Gaps = 28/164 (17%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp------------v  267
            + KSPR +E+ GPRP PL++RKDSHKI K P    Q    Q P                V
Sbjct  2    DNKSPRSKEILGPRPTPLKIRKDSHKIIKKPPLAPQPLQSQPPQLTEREPSQLLPPRGPV  61

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYTVSPKIIH +P+ FM+LVQRLTG   ++   ++SS S+     +S+    +A  D  
Sbjct  62   IIYTVSPKIIHTHPNNFMTLVQRLTGKTSTSTIPSSSSPSTLALDYTSASRDTSAVFD--  119

Query  448  NVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGME  579
                 G++SPAAR+A++E+            + + ++G V G+E
Sbjct  120  --ASRGSISPAARYAAMEKA-----------NASNELGFVGGVE  150



>ref|NP_566616.1| MAP kinase substrate 1 [Arabidopsis thaliana]
 sp|Q8LGD5.2|MKS1_ARATH RecName: Full=Protein MKS1; AltName: Full=Protein MAP kinase 
4 substrate 1 [Arabidopsis thaliana]
 dbj|BAB01795.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABD43001.1| At3g18690 [Arabidopsis thaliana]
 gb|AEE76132.1| MAP kinase substrate 1 [Arabidopsis thaliana]
Length=222

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 89/173 (51%), Gaps = 41/173 (24%)
 Frame = +1

Query  91   FWSAMDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp  264
            +++  + SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+  P    PP   
Sbjct  6    YFAGGNPSDQQNQ----KRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPNRDQPPPYI  61

Query  265  ----vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
                V+IY VSPK++HA  SEFM++VQRLTG     F                       
Sbjct  62   PREPVVIYAVSPKVVHATASEFMNVVQRLTGISSGVF-----------------------  98

Query  433  FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQP-IHDVTADI--GMVEGMEI  582
                   GGGG VSPAAR AS E   +P+G K+P   D T +I   M E  E 
Sbjct  99   ----LESGGGGDVSPAARLASTENA-SPRGGKEPAARDETVEINTAMEEAAEF  146



>dbj|BAF00653.1| hypothetical protein [Arabidopsis thaliana]
Length=222

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 89/173 (51%), Gaps = 41/173 (24%)
 Frame = +1

Query  91   FWSAMDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp  264
            +++  + SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+  P    PP   
Sbjct  6    YFAGGNPSDQQNQ----KRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPNRDQPPPYI  61

Query  265  ----vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
                V+IY VSPK++HA  SEFM++VQRLTG     F                       
Sbjct  62   PREPVVIYAVSPKVVHATASEFMNVVQRLTGISSGVF-----------------------  98

Query  433  FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQP-IHDVTADI--GMVEGMEI  582
                   GGGG VSPAAR AS E   +P+G K+P   D T +I   M E  E 
Sbjct  99   ----LESGGGGDVSPAARLASTENA-SPRGGKEPAARDETVEINTAMEEAAEF  146



>gb|AAM60914.1| unknown [Arabidopsis thaliana]
Length=222

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 89/173 (51%), Gaps = 41/173 (24%)
 Frame = +1

Query  91   FWSAMDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp  264
            +++  + SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+  P    PP   
Sbjct  6    YFAGGNPSDQQNQ----KRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPNRDQPPPYI  61

Query  265  ----vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
                V+IY VSPK++HA  SEFM++VQRLTG     F                       
Sbjct  62   PREPVVIYAVSPKVVHATASEFMNVVQRLTGISSGVF-----------------------  98

Query  433  FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQP-IHDVTADI--GMVEGMEI  582
                   GGGG VSPAAR AS E   +P+G K+P   D T +I   M E  E 
Sbjct  99   ----LESGGGGDVSPAARLASTENA-SPRGGKEPAARDETVEINTAMEEAAEF  146



>ref|XP_010090872.1| hypothetical protein L484_020732 [Morus notabilis]
 gb|EXB40997.1| hypothetical protein L484_020732 [Morus notabilis]
Length=230

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 69/137 (50%), Gaps = 42/137 (31%)
 Frame = +1

Query  139  PRREL--QGPRPAPLRVRKDSHKIRKppvapsqhpppqappr------------ppvIIY  276
            P+REL  QGPRP+PL+V KDSHKIRKPP  P                        PVIIY
Sbjct  23   PKRELNLQGPRPSPLKVSKDSHKIRKPPPVPRPTHTHAHTTTTSFPSSSDQIRHEPVIIY  82

Query  277  TVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVG  456
            TVSPK+IHA  ++FMS+VQRLTG                            A   + +  
Sbjct  83   TVSPKVIHATVTDFMSIVQRLTG----------------------------AASPSSSFS  114

Query  457  GGGAVSPAARFASVERT  507
            G G +SPAAR AS+ERT
Sbjct  115  GAGDLSPAARLASIERT  131



>ref|XP_010927454.1| PREDICTED: uncharacterized protein LOC105049495 [Elaeis guineensis]
Length=208

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp--vIIY  276
            M  S+  + G SPR+EL+G RP  L+VRKD +KI+K PVAP    P   PP+    VIIY
Sbjct  1    MYSSEPPTGGASPRQELRGARPPRLKVRKDPYKIKKAPVAPPSPRPTAPPPQHRPPVIIY  60

Query  277  TVSPKIIHANPSEFMSLVQRLTG  345
            TVSPK+IH  P+EFMSLVQRLTG
Sbjct  61   TVSPKVIHTTPNEFMSLVQRLTG  83



>ref|XP_009771612.1| PREDICTED: protein MKS1-like [Nicotiana sylvestris]
Length=225

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 76/151 (50%), Gaps = 30/151 (20%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppva--------psqhpppqapprppvIIYTVSPKII  297
            R ELQGPRP PL+V KDS+KI+KPPVA         +   P  +     VIIY VSPK+ 
Sbjct  22   RGELQGPRPTPLKVNKDSYKIKKPPVAPPPHPLPHTAALAPSTSQNPQTVIIYAVSPKVY  81

Query  298  HANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSP  477
            H   S+FMS+VQRLTG   S+   + S +S                       G G +SP
Sbjct  82   HTTVSDFMSVVQRLTGSSTSSMEPSTSGAS----------------------SGDGNLSP  119

Query  478  AARFASVERTRTPQGKKQPIHDVTADIGMVE  570
            AA+ AS+E+  +P     P    +  + +++
Sbjct  120  AAKLASIEKASSPSASVPPASAASDSLDILD  150



>gb|EAY86188.1| hypothetical protein OsI_07565 [Oryza sativa Indica Group]
Length=275

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 95/170 (56%), Gaps = 22/170 (13%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvaps-----------qhpppqa  249
            MD SD +   +S  R+LQGPRP  L V KDSHK+RKPPV P              P  Q 
Sbjct  1    MDASDGRPSPRS--RQLQGPRPPRLAVSKDSHKVRKPPVVPQPRGGGGVVAGPSRPQQQQ  58

Query  250  pprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaass------ssssiaaass  411
             PR PVIIY  SPK+IH  PSEFM+LVQRLTGP  +  AA A+       + +S ++++S
Sbjct  59   QPRAPVIIYDASPKVIHTRPSEFMALVQRLTGPGSAAVAAVAAPVAAGFHAEASSSSSAS  118

Query  412  swlsaaaFQ--DNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTAD  555
            +      FQ    F +    A+SPAAR+A++ER+  P       H  TAD
Sbjct  119  ASALQPQFQLPQEFMLSPTAALSPAARYAAIERSVRPLPPTT-AHYYTAD  167



>ref|NP_001173012.1| Os02g0539500 [Oryza sativa Japonica Group]
 dbj|BAD28841.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH01613.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91741.1| Os02g0539500 [Oryza sativa Japonica Group]
Length=275

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 95/170 (56%), Gaps = 22/170 (13%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvaps-----------qhpppqa  249
            MD SD +   +S  R+LQGPRP  L V KDSHK+RKPPV P              P  Q 
Sbjct  1    MDASDGRPSPRS--RQLQGPRPPRLAVSKDSHKVRKPPVVPQPRGGGGVVAGPSRPQQQQ  58

Query  250  pprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaass------ssssiaaass  411
             PR PVIIY  SPK+IH  PSEFM+LVQRLTGP  +  AA A+       + +S ++++S
Sbjct  59   QPRAPVIIYDASPKVIHTRPSEFMALVQRLTGPGSAAVAAVAAPVAAGFHTEASSSSSAS  118

Query  412  swlsaaaFQ--DNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTAD  555
            +      FQ    F +    A+SPAAR+A++ER+  P       H  TAD
Sbjct  119  ASALPPQFQLPQEFMLSPTAALSPAARYAAIERSVRPLPPTT-AHYYTAD  167



>ref|XP_004503952.1| PREDICTED: protein MKS1-like [Cicer arietinum]
Length=211

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 89/170 (52%), Gaps = 41/170 (24%)
 Frame = +1

Query  103  MDMSDMQSEGKS---PRRELQ--GPRPAPLRVRKDSHKIRKppvapsq---hpppqappr  258
            M++ D  S G S   P++ELQ  G RP PLRV K+SH IRKPP+ P+     P   +  R
Sbjct  1    MNLPDFHSGGTSTPSPKKELQIQGTRPPPLRVSKESHTIRKPPLPPAVHHHPPAGASQHR  60

Query  259  ppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQ  438
             P+IIY+VSPK++H   S+FM +VQRLTGP                              
Sbjct  61   QPLIIYSVSPKVLHVTVSDFMDVVQRLTGPS----------------------------A  92

Query  439  DNFNVGGGGAVSPAARFASVERTR-TPQGKKQPIHDVTADI-GMVEGMEI  582
                    GA+SPAAR AS+ERT  T + K Q I D   D+  +++G+E+
Sbjct  93   GEETPQQSGAISPAARLASIERTSPTEREKAQNIDD---DLTWLLDGIEM  139



>ref|XP_010487791.1| PREDICTED: protein MKS1-like [Camelina sativa]
Length=225

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 85/173 (49%), Gaps = 37/173 (21%)
 Frame = +1

Query  103  MDMSDMQSEG--KSPRRELQ--GPRPAPLRVRKDSHKI------RKppvapsqhpppqap  252
            MD S+  + G  ++ +R+LQ  GPRP+PL V KDSHKI         P      P     
Sbjct  1    MDPSEYFAGGDQQNQKRQLQICGPRPSPLSVHKDSHKIIKKPPKHPAPPQNRDQPQQPYV  60

Query  253  prppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
            PR PV+IY VSPK++HA  SEFM++VQRLTG     F  +                    
Sbjct  61   PREPVVIYAVSPKVVHATASEFMNVVQRLTGISSEIFLESG-------------------  101

Query  433  FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSD  591
                   G GG VSPAAR AS E   +P+G K+P   V  D  +   ME +++
Sbjct  102  -------GSGGNVSPAARLASTENA-SPRGGKEPPMVVPRDDEIPTAMEEAAE  146



>ref|XP_006842306.1| hypothetical protein AMTR_s00079p00122650 [Amborella trichopoda]
 gb|ERN03981.1| hypothetical protein AMTR_s00079p00122650 [Amborella trichopoda]
Length=207

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFM  321
            RRE+QGPRP PLR+ +DSH I K   +     P     R P+IIYT SPKIIH    +FM
Sbjct  11   RREIQGPRPTPLRISRDSHLIHKNSSSSQNGAPCGKRQRDPIIIYTESPKIIHTQAHDFM  70

Query  322  SLVQRLTG  345
            +LVQRLTG
Sbjct  71   ALVQRLTG  78



>ref|XP_004289408.1| PREDICTED: protein MKS1-like [Fragaria vesca subsp. vesca]
Length=229

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 73/144 (51%), Gaps = 44/144 (31%)
 Frame = +1

Query  109  MSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppv---------apsqhpppqapp  255
            M+   S   +P++ELQ  GPRPAPL++ KDS KI+KPP           P  H  P    
Sbjct  1    MNPPPSLPATPKKELQLQGPRPAPLKLSKDSVKIKKPPPHPHLLRHNPPPQHHSLPPPQH  60

Query  256  rppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaF  435
              P++IYTVSPK+IHA+ +EFMSLVQRLTGP  S                          
Sbjct  61   HQPIVIYTVSPKVIHASVNEFMSLVQRLTGPSSSP-------------------------  95

Query  436  QDNFNVGGGGAVSPAARFASVERT  507
                     G +SPAAR AS+E+T
Sbjct  96   --------PGNLSPAARLASIEKT  111



>emb|CDX75979.1| BnaC03g40620D [Brassica napus]
Length=212

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 77/158 (49%), Gaps = 39/158 (25%)
 Frame = +1

Query  133  KSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqappr------ppvIIYTVSP  288
            ++P+R+LQ  GPRP+PL V KDSHKI+KPP  P+  P              PV+IY VSP
Sbjct  16   QTPKRQLQICGPRPSPLSVNKDSHKIKKPPRHPAPPPQHHRDQAPLYPPREPVVIYAVSP  75

Query  289  KIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGA  468
            K++H   S+FM++VQRLTG     F                                 G 
Sbjct  76   KVVHTTTSDFMNVVQRLTGISSEVF---------------------------LESRNDGD  108

Query  469  VSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEI  582
            VSPAAR A+ E   +P+G K+P+   TA   M E  E 
Sbjct  109  VSPAARLAATENA-SPRGGKEPVESSTA---MEEAAEF  142



>ref|XP_011099774.1| PREDICTED: protein MKS1 [Sesamum indicum]
Length=238

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 77/157 (49%), Gaps = 48/157 (31%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRK--------------ppvapsqhpppqapprppvII  273
            SPR+ELQGPRP  L+V KDS+KI+K                 A S  P   A  R PVII
Sbjct  21   SPRKELQGPRPTALKVNKDSYKIKKPPVAPPPHNNPPPSTAHAHSAAPQQAAEDRKPVII  80

Query  274  YTVSPKIIHANPSEFMSLVQRLTG--PDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            Y+VSPK+IH   S+FM LVQRLTG   D  T                           + 
Sbjct  81   YSVSPKVIHTTVSDFMDLVQRLTGNSADDGT---------------------------SS  113

Query  448  NVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADI  558
            +  G G +SPAAR AS+E+T   + +     ++TA+I
Sbjct  114  SAAGPGDISPAARLASIEKTSPAKDR-----EITANI  145



>dbj|BAO45874.1| map kinase substrate [Acacia mangium]
Length=207

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 75/154 (49%), Gaps = 39/154 (25%)
 Frame = +1

Query  142  RREL--QGPRPAPLRVRKDSHKIRKpp----vapsqhpppqapprppvIIYTVSPKIIHA  303
            RREL  QGPRP+PL V K+SHKIRKPP           P Q     PVIIY+VSPK+IH 
Sbjct  17   RRELALQGPRPSPLSVSKESHKIRKPPLPRHAYRPAAVPCQQEQPQPVIIYSVSPKVIHV  76

Query  304  NPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAA  483
               +FM +VQRLTGP                                      G VSPAA
Sbjct  77   PVDDFMKVVQRLTGPSS-------------------------------PASRSGDVSPAA  105

Query  484  RFASVERTRTPQGKKQPIHDVTADIGMVEGMEIS  585
            R AS+E+T     +K+   +    + ++EG+E+S
Sbjct  106  RLASIEKTSP--SEKERFQNGDEMMDLLEGVEVS  137



>ref|NP_001148224.1| VQ motif family protein [Zea mays]
 gb|ACG30228.1| VQ motif family protein [Zea mays]
Length=275

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 75/162 (46%), Gaps = 45/162 (28%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppq----------ap  252
            MD         +PRR+LQGPRP  L VR +SH I+KP  + +   P Q           P
Sbjct  1    MDPPSSSGRPTTPRRQLQGPRPPRLNVRMESHAIKKPSASGAPPAPGQGRPRDHHHHPQP  60

Query  253  prppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaa  432
             R PVIIY  SPK+IHA PSEFM+LVQRLTGP                   + +      
Sbjct  61   GRAPVIIYDASPKVIHAKPSEFMALVQRLTGPG------------------AQAQHERHV  102

Query  433  FQDNFNVGGGG-----------------AVSPAARFASVERT  507
              D+    GGG                 A+SPAAR A++ER+
Sbjct  103  ADDDATANGGGVLGQAFLPPXLLLSPSAAMSPAARLATIERS  144



>ref|XP_006299156.1| hypothetical protein CARUB_v10015299mg [Capsella rubella]
 gb|EOA32054.1| hypothetical protein CARUB_v10015299mg [Capsella rubella]
Length=217

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 77/153 (50%), Gaps = 36/153 (24%)
 Frame = +1

Query  103  MDMSD-MQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhppp-----qappr  258
            MD S+ +  + ++ +R+LQ  GPRP+PL V KDS KI K P      P          PR
Sbjct  1    MDPSEYLGGDQQNQKRQLQICGPRPSPLSVHKDSRKIIKKPPKHPAPPQNRDHPPPYVPR  60

Query  259  ppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQ  438
             PV+IY VSPK++HA  SEFM++VQRLTG     F                         
Sbjct  61   EPVVIYAVSPKVVHATASEFMNVVQRLTGISSEVF-------------------------  95

Query  439  DNFNVGGGGAVSPAARFASVERTRTPQGKKQPI  537
                 GGGG VSPAAR AS E   +P+G K P+
Sbjct  96   --LESGGGGNVSPAARLASTENA-SPRGGKDPV  125



>emb|CDY68488.1| BnaC01g43890D [Brassica napus]
Length=217

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 87/170 (51%), Gaps = 44/170 (26%)
 Frame = +1

Query  112  SDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-----pppqapprppvI  270
            SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+         P    R PV+
Sbjct  13   SDQQNQ----KRQLQICGPRPSPLSVNKDSHKIKKPPKHPAPPPQHRDQAPLYAAREPVV  68

Query  271  IYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFN  450
            IY VSPK++H   S+FM++VQRLTG   + F                             
Sbjct  69   IYAVSPKVVHTTASDFMNVVQRLTGISSAVF---------------------------LE  101

Query  451  VGGGGAVSPAARFASVERTRTPQGKKQPI---HDVTADI--GMVEGMEIS  585
             G GG VSPAAR A+ E   +P+G K+P+    D T +I   M E  E+S
Sbjct  102  SGNGGDVSPAARLAATENA-SPRGGKEPVMAAKDETVEIATAMEEAAELS  150



>ref|XP_007048304.1| MAP kinase substrate 1, putative [Theobroma cacao]
 gb|EOX92461.1| MAP kinase substrate 1, putative [Theobroma cacao]
Length=222

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 70/149 (47%), Gaps = 36/149 (24%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKp------pvapsqhpppqapprppvIIYTVSPKIIHANP  309
            ++QGPRP PL+V KDSHKI+KP         P+         R PVIIY VSPK+IHA  
Sbjct  17   QIQGPRPTPLKVSKDSHKIKKPPHPPSHAAGPAAAAAADQRRREPVIIYAVSPKVIHAEE  76

Query  310  SEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARF  489
            S+FMS+VQR TG                                + N  G G VSPAAR 
Sbjct  77   SDFMSIVQRYTG------------------------------LSSGNFSGDGDVSPAARL  106

Query  490  ASVERTRTPQGKKQPIHDVTADIGMVEGM  576
            A+ E+      +K     V  + GM EG+
Sbjct  107  AATEKASPSSREKIGDVGVAGEGGMEEGL  135



>ref|XP_006416316.1| hypothetical protein EUTSA_v10008673mg [Eutrema salsugineum]
 gb|ESQ34669.1| hypothetical protein EUTSA_v10008673mg [Eutrema salsugineum]
Length=230

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 78/137 (57%), Gaps = 20/137 (15%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsq----------hpppqapprppvII  273
            + KSPR RE+ GPRP PL+V KDSHKI K P                PP   PPR PVII
Sbjct  2    DNKSPRTREIMGPRPTPLKVNKDSHKITKKPPLAPPQQPPPQLQRREPPQPLPPRAPVII  61

Query  274  YTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNV  453
            YT+SP+IIH +P  FM+LVQRLTG   ++  ++ S+ +   A+  +S             
Sbjct  62   YTISPRIIHTHPDNFMALVQRLTGNTSTSTTSSTSAPNHMSASEDTSGTMD---------  112

Query  454  GGGGAVSPAARFASVER  504
               G++SPAAR+AS E+
Sbjct  113  ASRGSISPAARYASTEK  129



>ref|XP_008232823.1| PREDICTED: protein MKS1 [Prunus mume]
Length=230

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 64/126 (51%), Gaps = 36/126 (29%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqh------pppqapprppvIIYTVSPKIIHANP  309
            +L GPRP+PL+V K+S KI+KPP  P                R PV+IYTVSPK+IHA  
Sbjct  16   QLHGPRPSPLKVNKESVKIKKPPPHPRPDPNPNPNQHADVEQRQPVVIYTVSPKVIHATV  75

Query  310  SEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARF  489
            SEFMSLVQRLTGP  S+                                G G +SPAAR 
Sbjct  76   SEFMSLVQRLTGPSPSS------------------------------SPGDGGLSPAARL  105

Query  490  ASVERT  507
            AS+ +T
Sbjct  106  ASIHKT  111



>ref|XP_007220783.1| hypothetical protein PRUPE_ppa1027156mg [Prunus persica]
 gb|EMJ21982.1| hypothetical protein PRUPE_ppa1027156mg [Prunus persica]
Length=231

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 64/126 (51%), Gaps = 36/126 (29%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqh------pppqapprppvIIYTVSPKIIHANP  309
            +L GPRP+PL+V K+S KI+KPP  P                R PV+IYTVSPK+IHA  
Sbjct  16   QLHGPRPSPLKVNKESVKIKKPPPHPRPDPNPNPNQHADVEQRQPVVIYTVSPKVIHATV  75

Query  310  SEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARF  489
            SEFMSLVQRLTGP  S+                                G G +SPAAR 
Sbjct  76   SEFMSLVQRLTGPSPSSSP------------------------------GDGGLSPAARL  105

Query  490  ASVERT  507
            AS+ +T
Sbjct  106  ASIHKT  111



>emb|CDY71738.1| BnaA01g36880D [Brassica napus]
Length=217

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 85/167 (51%), Gaps = 40/167 (24%)
 Frame = +1

Query  124  SEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-----pppqapprppvIIYTV  282
            S+ ++ +R+LQ  GPRP+PL V KDSHKI+KPP  P+         P    R PV+IY V
Sbjct  13   SDQQNQKRQLQICGPRPSPLSVNKDSHKIKKPPKHPAPPPQHRDQAPLYAAREPVVIYAV  72

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK++H   S+FM++VQRLTG   + F                              G G
Sbjct  73   SPKVVHTTASDFMNVVQRLTGNSSAVF---------------------------LESGNG  105

Query  463  GAVSPAARFASVERTRTPQGKKQPI---HDVTADI--GMVEGMEISS  588
            G VSPAAR A+ E   +P+G K+P+    D T +I   M E  E S 
Sbjct  106  GDVSPAARLAATENA-SPRGGKEPVMAAKDETVEIATAMEEAAEFSC  151



>tpg|DAA37868.1| TPA: VQ motif family protein [Zea mays]
Length=315

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 75/163 (46%), Gaps = 46/163 (28%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppq-----------a  249
            MD         +PRR+LQGPRP  L VR +SH I+KP  + +   P Q            
Sbjct  40   MDPPSSSGRPTTPRRQLQGPRPPRLNVRMESHAIKKPSASGAPPAPGQGRPRDHHHHHPQ  99

Query  250  pprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaa  429
            P R PVIIY  SPK+IHA PSEFM+LVQRLTGP                   + +     
Sbjct  100  PGRAPVIIYDASPKVIHAKPSEFMALVQRLTGPG------------------AQAQHERH  141

Query  430  aFQDNFNVGGGG-----------------AVSPAARFASVERT  507
               D+    GGG                 A+SPAAR A++ER+
Sbjct  142  VADDDATANGGGVLGQAFLPPELLLSPSAAMSPAARLATIERS  184



>gb|AIN36961.1| MAP kinase substrate 1 [Brassica napus]
Length=217

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 86/171 (50%), Gaps = 44/171 (26%)
 Frame = +1

Query  112  SDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-----pppqapprppvI  270
            SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+         P    R PV+
Sbjct  13   SDQQNQ----KRQLQICGPRPSPLSVNKDSHKIKKPPKHPAPPPQHRDQAPLYAAREPVV  68

Query  271  IYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFN  450
            IY VSPK++H   S+FM++VQRLTG   + F                             
Sbjct  69   IYAVSPKVVHTTASDFMNVVQRLTGNSSAVF---------------------------LE  101

Query  451  VGGGGAVSPAARFASVERTRTPQGKKQPI---HDVTADI--GMVEGMEISS  588
             G GG VSPAAR A+ E   +P+G K+P+    D T +I   M E  E S 
Sbjct  102  SGNGGDVSPAARLAATENA-SPRGGKEPVMAAKDETVEIATAMEEAAEFSC  151



>dbj|BAK07843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score = 70.9 bits (172),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 90/198 (45%), Gaps = 28/198 (14%)
 Frame = +1

Query  13   YPLNHFHTSDLSVFDRIID------------SRLRDLGFWSAMDMSDMQSEGKSPRRELQ  156
            +PL+H     LS   R++              R+R +     MD +       +PRR+LQ
Sbjct  6    HPLSHSRPGALSPLLRVLSRAVAGPPLPSEHDRIR-VAALPRMDATSPSGRPTTPRRQLQ  64

Query  157  --GPRPAPLRVRKDSHKIRKppvapsqh----------pppqapprppvIIYTVSPKIIH  300
              GPRP  L VR +SH I+KP  AP+                 PPR PVIIY  SPKIIH
Sbjct  65   LQGPRPPRLSVRPESHAIKKPSGAPAHAQGQGHARREDKQQGQPPREPVIIYDASPKIIH  124

Query  301  ANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPA  480
              PSEFM+LVQRLTGP         S + +       +    +       +    A+SPA
Sbjct  125  TKPSEFMALVQRLTGPGSGAL---PSEAQTQDYQMDEAMPGQSFLPPELLLSPSAAMSPA  181

Query  481  ARFASVERTRTPQGKKQP  534
            AR A++ER+  P     P
Sbjct  182  ARLATIERSVRPMPAPTP  199



>ref|XP_009112548.1| PREDICTED: protein MKS1-like [Brassica rapa]
Length=217

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 85/170 (50%), Gaps = 44/170 (26%)
 Frame = +1

Query  112  SDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-----pppqapprppvI  270
            SD Q++    +R+LQ  GPRPAPL V KDSHKI+KPP  P+         P    R PV+
Sbjct  13   SDQQNQ----KRQLQICGPRPAPLSVNKDSHKIKKPPKHPAPPPQHRDQAPLYAAREPVV  68

Query  271  IYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFN  450
            IY VSPK++H   S+FM++VQRLTG   + F                             
Sbjct  69   IYAVSPKVVHTTASDFMNVVQRLTGISSAVF---------------------------LE  101

Query  451  VGGGGAVSPAARFASVERTRTPQGKKQPI---HDVTADI--GMVEGMEIS  585
             G GG VSPAAR A  E   +P+G K+P+    D T +I   M E  E S
Sbjct  102  SGNGGDVSPAARLALTENA-SPRGGKEPVMAAKDETVEIATAMEEAAEFS  150



>ref|XP_010459840.1| PREDICTED: protein MKS1 isoform X1 [Camelina sativa]
Length=239

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 83/142 (58%), Gaps = 22/142 (15%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp------------v  267
            + +SPR R + GPRPAPL+VR DSHKI K P    Q PPPQ P                V
Sbjct  2    DNRSPRSRGILGPRPAPLKVRGDSHKIIKKPPLAPQQPPPQPPQIHQQEQRQTRPPGGPV  61

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYTVSPKIIH +P+ FM+LVQRLTG   S+  +++SSS++  A   +S    A+     
Sbjct  62   IIYTVSPKIIHTHPNNFMTLVQRLTGKTSSSTTSSSSSSTAMSAPNDTSASFDASH----  117

Query  448  NVGGGGAVSPAARFASVERTRT  513
                 G +SPAARFAS ER  T
Sbjct  118  -----GLISPAARFASTERANT  134



>gb|AFK43245.1| unknown [Medicago truncatula]
 gb|KEH20895.1| MKS1-like protein [Medicago truncatula]
 gb|AET04719.2| MKS1-like protein [Medicago truncatula]
Length=214

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 86/164 (52%), Gaps = 36/164 (22%)
 Frame = +1

Query  112  SDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh----pppqapprppvII  273
            S + +   SPRRELQ  G RP PLRV K+S  IRKPP+ P+      P   +  R P+II
Sbjct  8    SGVGTSTPSPRRELQIQGTRPPPLRVSKESRTIRKPPLPPAAAHHHQPAGASQHRQPLII  67

Query  274  YTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNV  453
            Y+VSPK++H   S+FM +VQRLTGP     A                             
Sbjct  68   YSVSPKVLHIPVSDFMDVVQRLTGPSAGEEAPQQ--------------------------  101

Query  454  GGGGAVSPAARFASVERTRTPQGKKQPIHDVTADI-GMVEGMEI  582
               GAVSPAAR AS+ERT +P  +++    V  D+  ++EG+E+
Sbjct  102  --SGAVSPAARLASIERT-SPTERERIQQTVDEDLTWLLEGVEM  142



>ref|XP_003526855.1| PREDICTED: protein MKS1-like [Glycine max]
Length=222

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 52/167 (31%)
 Frame = +1

Query  139  PRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhp---------ppqapprppvIIYTVS  285
            P++ELQ  GPRP PL+V K+SHKI+KPP  P+ H                R PVIIY+VS
Sbjct  14   PKKELQLQGPRPPPLKVSKESHKIKKPPPHPAHHHHNYPHAPPDQNLQQQREPVIIYSVS  73

Query  286  PKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVG---  456
            PK+IH  P +FM +VQRLTG                                  ++G   
Sbjct  74   PKVIHVTPGDFMDVVQRLTG---------------------------------ASIGEEP  100

Query  457  --GGGAVSPAARFASVERTRTPQGKKQPI-HDVTADIGMV--EGMEI  582
              G G VSPAAR AS+E+T   + +++ + H++  +I  +  EG+E+
Sbjct  101  PSGRGDVSPAARLASIEKTSPSERERERVLHNIDDNIAWMLGEGVEV  147



>ref|XP_003575090.1| PREDICTED: protein MKS1-like [Brachypodium distachyon]
Length=254

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 79/156 (51%), Gaps = 28/156 (18%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRR---ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqappr-----  258
            MD S   S+ +SPR    +LQGPRP  L V KDSHKI+KPP+ P  H   QA        
Sbjct  1    MDASS--SDRQSPRSRQLQLQGPRPPRLSVSKDSHKIKKPPMVPLPHGAQQAARSRHPLA  58

Query  259  ---------ppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaass  411
                      PVIIY  SPK+IH  PSEFM+LVQRLTGP           ++     A  
Sbjct  59   HHPQQQQQRQPVIIYDASPKVIHTQPSEFMALVQRLTGPG--------LPAAHHSIQAEE  110

Query  412  swlsaaaFQ-DNFNVGGGGAVSPAARFASVERTRTP  516
                   FQ   F +     +SPAAR+A++ER+  P
Sbjct  111  PSAVPPQFQPQEFMLSPTAGLSPAARYAAIERSVRP  146



>ref|XP_003630243.1| Protein MKS1 [Medicago truncatula]
Length=226

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 86/164 (52%), Gaps = 36/164 (22%)
 Frame = +1

Query  112  SDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh----pppqapprppvII  273
            S + +   SPRRELQ  G RP PLRV K+S  IRKPP+ P+      P   +  R P+II
Sbjct  8    SGVGTSTPSPRRELQIQGTRPPPLRVSKESRTIRKPPLPPAAAHHHQPAGASQHRQPLII  67

Query  274  YTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNV  453
            Y+VSPK++H   S+FM +VQRLTGP     A                             
Sbjct  68   YSVSPKVLHIPVSDFMDVVQRLTGPSAGEEAPQQ--------------------------  101

Query  454  GGGGAVSPAARFASVERTRTPQGKKQPIHDVTADI-GMVEGMEI  582
               GAVSPAAR AS+ERT +P  +++    V  D+  ++EG+E+
Sbjct  102  --SGAVSPAARLASIERT-SPTERERIQQTVDEDLTWLLEGVEM  142



>ref|XP_010498583.1| PREDICTED: protein MKS1-like isoform X1 [Camelina sativa]
Length=238

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 83/142 (58%), Gaps = 22/142 (15%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp------------v  267
            + +SPR R + GPRPAPL+VR DSHKI K P    Q PPPQ P                V
Sbjct  2    DNRSPRSRGILGPRPAPLKVRGDSHKIIKKPPLAPQQPPPQPPQIHQQEQRQTRPPGGPV  61

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYTVSPKIIH +P+ FM+LVQRLTG   S+  +++SSS+S  A   +S    A+     
Sbjct  62   IIYTVSPKIIHTHPNNFMTLVQRLTGKTSSSTTSSSSSSTSISAPNDTSASFDASH----  117

Query  448  NVGGGGAVSPAARFASVERTRT  513
                 G +SPAARFAS ER  T
Sbjct  118  -----GLISPAARFASTERANT  134



>ref|XP_003579720.1| PREDICTED: protein MKS1-like [Brachypodium distachyon]
Length=335

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 83/168 (49%), Gaps = 23/168 (14%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhppp-----------  243
            MD         +PRR+LQ  GPRP  L VR +SH I+KP  AP+Q               
Sbjct  42   MDSPSSSGRPTTPRRQLQLQGPRPPRLNVRPESHAIKKPSGAPAQAQAQGRRDQQQQPHG  101

Query  244  qapprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswls  423
              P R PVIIY  SPKIIH  PSEF++LVQRLTGP  S     + + + +         +
Sbjct  102  PPPARAPVIIYDASPKIIHTKPSEFLALVQRLTGPSSSAGPFPSEAHAQTQDQDYQMEDA  161

Query  424  aaaFQDNF-----NVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTA  552
                Q +F      +    A+SPAAR A++ER+      + P+H + A
Sbjct  162  VQLGQSSFLPPELLLSPSAAMSPAARLATIERS-----VRNPMHTLPA  204



>ref|XP_010925215.1| PREDICTED: protein MKS1-like [Elaeis guineensis]
Length=179

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 49/79 (62%), Gaps = 16/79 (20%)
 Frame = +1

Query  109  MSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSP  288
            MS ++S GK    ELQGPRPA L +R ++ +IRKP   P              IIY VSP
Sbjct  1    MSSLRSHGKV---ELQGPRPAHLMIRNETRRIRKPARNPV-------------IIYVVSP  44

Query  289  KIIHANPSEFMSLVQRLTG  345
            KIIHA  SEFM+LVQRLTG
Sbjct  45   KIIHAEASEFMALVQRLTG  63



>ref|XP_004148825.1| PREDICTED: protein MKS1-like [Cucumis sativus]
 gb|KGN47476.1| hypothetical protein Csa_6G338080 [Cucumis sativus]
Length=177

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 7/66 (11%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            +LQGPRP+ L++ KDSHKI+KPP+ P Q   P        IIYTVSPKIIH +P+EF  L
Sbjct  8    QLQGPRPSALKITKDSHKIKKPPLPPPQPHRPV-------IIYTVSPKIIHTDPTEFKDL  60

Query  328  VQRLTG  345
            VQRLTG
Sbjct  61   VQRLTG  66



>ref|XP_010551173.1| PREDICTED: protein MKS1 [Tarenaya hassleriana]
Length=215

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 122/259 (47%), Gaps = 59/259 (23%)
 Frame = +1

Query  115  DMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqapp---rppvIIYT  279
            D  S+ +  +R+LQ  GPRP+PL V KDSHKI+KPP  P  H PP+A     R PV+IY 
Sbjct  10   DKASDQQEQKRQLQIHGPRPSPLSVSKDSHKIKKPPKPPPPHAPPRAAVFVPREPVVIYA  69

Query  280  VSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGG  459
            +SPK++H   S+FM++VQRLTG                        +S+  FQ++     
Sbjct  70   ISPKVVHTTVSDFMTVVQRLTG------------------------ISSGVFQES----D  101

Query  460  GGAVSPAARFASVERTRTPQGKKQPIHDVTADI-GMVEGMEISSDVERsvffpgvlspsp  636
             G +SPAAR A+ E   +P+  K+P  D   D+ G+ E  E +  + R            
Sbjct  102  AGGLSPAARLAATENA-SPR-VKEPARDAANDVAGISEAAEEAVGLGRPPGILSPSPAML  159

Query  637  sslppippnffsppssDQNPLGFFPDFISPGLHTNNRNSLETNLFMPSPSTINSFISPGR  816
              +                P G F   +S G+ +     + +   M SPS +     PG 
Sbjct  160  PVV----------------PAGIFSPAVSAGMFSP--AGMMSPFVMFSPSYM-----PGS  196

Query  817  FLISPGTPSLDFFNNIFDL  873
             ++S  T S DFF+ I+DL
Sbjct  197  SMVSSPTLSSDFFSQIWDL  215



>ref|XP_010477396.1| PREDICTED: protein MKS1-like [Camelina sativa]
Length=237

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 82/142 (58%), Gaps = 22/142 (15%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp------------v  267
            + +SPR R + GPRP PL+VR DSHKI K P    Q PPPQ P                V
Sbjct  2    DNRSPRSRGILGPRPTPLKVRGDSHKIIKKPPLAPQQPPPQPPQIHQQVQPQSRPPGGPV  61

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYTVSPKIIH +P+ FM+LVQRLTG   S+  +++SSS++  A   +S    A+     
Sbjct  62   IIYTVSPKIIHTHPNNFMTLVQRLTGKTSSSTTSSSSSSTAMSAPNDTSASFDASH----  117

Query  448  NVGGGGAVSPAARFASVERTRT  513
                 G +SPAARFAS ER  T
Sbjct  118  -----GLISPAARFASTERANT  134



>ref|XP_008793991.1| PREDICTED: protein MKS1-like [Phoenix dactylifera]
Length=211

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            M+ S+  +   SPR+EL+GPRPA ++ RKD +KI+K P AP              IIYT 
Sbjct  1    MESSEPPTGRLSPRQELRGPRPARVKARKDPYKIKKTPAAPPPPQHRPPV-----IIYTE  55

Query  283  SPKIIHANPSEFMSLVQRLTG  345
             P++IH  PS FMSLVQRLTG
Sbjct  56   PPRVIHTTPSNFMSLVQRLTG  76



>ref|XP_008387186.1| PREDICTED: uncharacterized protein LOC103449632 [Malus domestica]
Length=134

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 41/70 (59%), Gaps = 15/70 (21%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            ELQGPRPAPL V K+S K+ K                   I+Y +SPKIIH  P EFM L
Sbjct  10   ELQGPRPAPLMVSKNSQKVMKKKPV---------------IVYLISPKIIHVQPEEFMGL  54

Query  328  VQRLTGPDHS  357
            VQRLTG +++
Sbjct  55   VQRLTGNNNN  64



>emb|CDP00632.1| unnamed protein product [Coffea canephora]
Length=203

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 46/80 (58%), Gaps = 9/80 (11%)
 Frame = +1

Query  133  KSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp---------vIIYTVS  285
            + PRR + GPRP+PLR+ KDSH I+KP      +                   VIIYT S
Sbjct  9    EEPRRAINGPRPSPLRINKDSHVIQKPSSMNQVYKKAAKEQNTRLSTQQPRQPVIIYTHS  68

Query  286  PKIIHANPSEFMSLVQRLTG  345
            PKIIH  P +FM+LVQ+LTG
Sbjct  69   PKIIHTKPKDFMALVQKLTG  88



>ref|XP_008441652.1| PREDICTED: protein MKS1-like, partial [Cucumis melo]
Length=177

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = +1

Query  133  KSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPS  312
            K  + +LQGPRP+ L++ KDSHKI+KPP+ P Q   P        IIYTVSPKIIH +P+
Sbjct  4    KKRKLQLQGPRPSALKITKDSHKIKKPPLPPPQPHRPV-------IIYTVSPKIIHTDPT  56

Query  313  EFMSLVQRLTG  345
            +F  LVQRLTG
Sbjct  57   QFKDLVQRLTG  67



>ref|XP_010909697.1| PREDICTED: uncharacterized protein LOC105035726 [Elaeis guineensis]
Length=148

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSE  315
            S RRE+QGPRP PL+V KDS KI+K P + +    P +  R PVI+Y  +PK+IH  P +
Sbjct  3    SSRREIQGPRPPPLKVGKDSRKIKK-PTSLTSSQLPPSSRRDPVIVYIHTPKVIHTRPQD  61

Query  316  FMSLVQRLTG  345
            FMSLVQRLTG
Sbjct  62   FMSLVQRLTG  71



>ref|XP_007159824.1| hypothetical protein PHAVU_002G270600g [Phaseolus vulgaris]
 gb|ESW31818.1| hypothetical protein PHAVU_002G270600g [Phaseolus vulgaris]
Length=202

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 71/150 (47%), Gaps = 43/150 (29%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppva----psqhpppqapprppvIIYTVSPKIIHANPSE  315
            +LQG RP PLRV KDSH I K         +  P P    R PVIIYTVSPK+ H   ++
Sbjct  24   QLQGTRPPPLRVSKDSHTIHKTRKPPLPPTAHLPAPPPENRKPVIIYTVSPKVHHVPVND  83

Query  316  FMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFAS  495
            FM++VQRLTGP                                      G VSPAAR A+
Sbjct  84   FMNVVQRLTGPS------------------------------------SGDVSPAARLAA  107

Query  496  VERTRTPQGKKQPIHDVTADIG-MVEGMEI  582
            +ERT   + +K   H    D+  M+EG+E+
Sbjct  108  IERTSPSEREKD--HGGEEDVALMIEGVEV  135



>emb|CAH67600.1| OSIGBa0092M08.12 [Oryza sativa Indica Group]
 gb|EAY94077.1| hypothetical protein OsI_15852 [Oryza sativa Indica Group]
Length=308

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 83/162 (51%), Gaps = 19/162 (12%)
 Frame = +1

Query  121  QSEGKSPRRELQGPRPAPLRVRKDSHKIRKppv-----------------apsqhpppqa  249
            Q +  +PRR+LQGPRP  L VR +SH I+KP                   A ++    Q 
Sbjct  19   QQQPTTPRRQLQGPRPPRLNVRMESHAIKKPSSGAAAAAAAAQAHQLPAQAQARREQQQP  78

Query  250  pprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaa  429
            PPR PVIIY  SPKIIHA P+EFM+LVQRLTGP     A      + +         +A 
Sbjct  79   PPRAPVIIYDASPKIIHAKPNEFMALVQRLTGPGSGPPAPPHQGEAQAQDYPMMDEAAAQ  138

Query  430  a-FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQPIH-DVT  549
              F     +    A+SPAAR A++ER+  P  +  P + D+T
Sbjct  139  QFFPPELLLSPSAAMSPAARLATIERSVRPMPEPAPEYVDIT  180



>ref|NP_001173930.1| Os04g0417600 [Oryza sativa Japonica Group]
 emb|CAD40925.3| OSJNBa0033G16.10 [Oryza sativa Japonica Group]
 dbj|BAH92658.1| Os04g0417600 [Oryza sativa Japonica Group]
Length=308

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 83/162 (51%), Gaps = 19/162 (12%)
 Frame = +1

Query  121  QSEGKSPRRELQGPRPAPLRVRKDSHKIRKppv-----------------apsqhpppqa  249
            Q +  +PRR+LQGPRP  L VR +SH I+KP                   A ++    Q 
Sbjct  19   QQQPTTPRRQLQGPRPPRLNVRMESHAIKKPSSGAAAAAAQAQAHQLPAQAQARREQQQP  78

Query  250  pprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaa  429
            PPR PVIIY  SPKIIHA P+EFM+LVQRLTGP     A      + +         +A 
Sbjct  79   PPRAPVIIYDASPKIIHAKPNEFMALVQRLTGPGSGPPAPPHQGEAQAQDYPMMDEAAAQ  138

Query  430  a-FQDNFNVGGGGAVSPAARFASVERTRTPQGKKQPIH-DVT  549
              F     +    A+SPAAR A++ER+  P  +  P + D+T
Sbjct  139  QFFPPELLLSPSAAMSPAARLATIERSVRPMPEPAPEYVDIT  180



>gb|KFK39183.1| hypothetical protein AALP_AA3G210900 [Arabis alpina]
Length=218

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 86/174 (49%), Gaps = 42/174 (24%)
 Frame = +1

Query  91   FWSAMDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-----pppqa  249
            +++  + SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+         P  
Sbjct  6    YFAGGNPSDQQNQ----KRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPQHRDQAPSY  61

Query  250  pprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaa  429
              R PV+IY VSPK++H   S+FM++VQRLTG     F  ++                  
Sbjct  62   AAREPVVIYAVSPKVVHTTASDFMNVVQRLTGISSGVFLESS------------------  103

Query  430  aFQDNFNVGGGGAVSPAARFASVERTRTPQGKKQPI-HDVTADI--GMVEGMEI  582
                      GG VSPAAR AS E      G K+P+  D T D+   M E  E 
Sbjct  104  ----------GGDVSPAARLASTENASPRGGGKEPVSRDETVDVATAMEEAAEF  147



>ref|XP_010646867.1| PREDICTED: protein MKS1 [Vitis vinifera]
Length=196

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  127  EGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhp--ppqapprppvIIYTVSPKIIH  300
            + + PR+E+ GPRP+PL++ KDSH I KP    S       +   R PVIIYT SPKIIH
Sbjct  8    DEQQPRKEINGPRPSPLKINKDSHSINKPSSTLSFSKPPAAKHQQRHPVIIYTHSPKIIH  67

Query  301  ANPSEFMSLVQRLTG  345
                +FM+LVQ+LTG
Sbjct  68   TQARDFMALVQKLTG  82



>ref|XP_008361090.1| PREDICTED: protein MKS1-like [Malus domestica]
Length=235

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 5/71 (7%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvI-----IYTVSPKIIHANPS  312
            +LQGPRP+PLRV KDS KI+KPP  P  HP P     P        IY+VSPK+IHA  +
Sbjct  18   QLQGPRPSPLRVNKDSVKIKKPPPHPHPHPHPAYTQHPHPPPQPVVIYSVSPKVIHATEN  77

Query  313  EFMSLVQRLTG  345
            EFMSLVQRLTG
Sbjct  78   EFMSLVQRLTG  88



>gb|KEH40437.1| VQ motif protein [Medicago truncatula]
Length=102

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 9/84 (11%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQG---PRPAPLRVRKDSHKIRKppvapsqhpppqapprppvII  273
            M+  +  S  +S +RELQ    PRP PL + K+SHKI+KPP+ P              II
Sbjct  1    MNFPNNISNERSQKRELQLQGLPRPTPLTINKNSHKIKKPPLGPKIQIHEPV------II  54

Query  274  YTVSPKIIHANPSEFMSLVQRLTG  345
            YT SPKIIH +PSEFMSLVQ LTG
Sbjct  55   YTESPKIIHTSPSEFMSLVQSLTG  78



>ref|XP_009405325.1| PREDICTED: uncharacterized protein LOC103988511 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 9/81 (11%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD SD+  +GKS R     PR APL+VR+DS+ I+K PV P   P  + P     IIY V
Sbjct  1    MDSSDLPMDGKSSR-----PRLAPLKVRRDSNAIKKRPVVPPAPPQYRRPI----IIYAV  51

Query  283  SPKIIHANPSEFMSLVQRLTG  345
            SPK++HA PS+FMS+VQRLTG
Sbjct  52   SPKVVHATPSDFMSVVQRLTG  72



>ref|XP_006589686.1| PREDICTED: protein MKS1-like [Glycine max]
Length=191

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = +1

Query  133  KSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPS  312
            + P++ + GPRP+PL + KDSH IRK                   IIYT SPKIIH    
Sbjct  13   QQPKKVINGPRPSPLMINKDSHMIRKETKLQRPQRINPI------IIYTESPKIIHTKAK  66

Query  313  EFMSLVQRLTGPDHST  360
            +FM+LVQRLTG   ST
Sbjct  67   DFMALVQRLTGRSSST  82



>ref|XP_006303502.1| hypothetical protein CARUB_v10010842mg [Capsella rubella]
 gb|EOA36400.1| hypothetical protein CARUB_v10010842mg [Capsella rubella]
Length=237

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 77/142 (54%), Gaps = 22/142 (15%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv------------  267
            + +SPR R + GPRP PL+VR  SHKI K P       PP                    
Sbjct  2    DNRSPRSRGILGPRPTPLKVRGGSHKIIKKPPLAPHPQPPPPQIHEQEEPSQSRPPRGPV  61

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNF  447
            IIYTVSPKIIH +P+ FM+LVQRLTG   S+ A+++SSS    A   +S         +F
Sbjct  62   IIYTVSPKIIHTHPNNFMTLVQRLTGKTSSSTASSSSSSIPMSAPNDTSA--------SF  113

Query  448  NVGGGGAVSPAARFASVERTRT  513
            +    G++SPAARFAS ER  T
Sbjct  114  DA-SRGSISPAARFASTERANT  134



>ref|XP_002517232.1| Protein MKS1, putative [Ricinus communis]
 gb|EEF45132.1| Protein MKS1, putative [Ricinus communis]
Length=227

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 69/151 (46%), Gaps = 46/151 (30%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            +QGPRP  L+V  DSHKI+KPP+ P    P         IIY VSPK+IH   SEFM++V
Sbjct  38   IQGPRPTALKVHHDSHKIKKPPLPPPPQQPV--------IIYAVSPKVIHIKESEFMTVV  89

Query  331  QRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFASVE---  501
            QRLTG     F+                              G G VSPAAR A+ E   
Sbjct  90   QRLTGLSSGDFS-----------------------------SGDGQVSPAARLAATEKAS  120

Query  502  -RTRTPQGKKQPIHDVTAD---IGMVEGMEI  582
             R R P        D  +D   + M+E +EI
Sbjct  121  PRERNPNNSNP--DDGGSDNDLMAMIESVEI  149



>emb|CAN73469.1| hypothetical protein VITISV_000273 [Vitis vinifera]
Length=227

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +1

Query  133  KSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhp--ppqapprppvIIYTVSPKIIHAN  306
            + PR+E+ GPRP+PL++ KDSH I KP    S       +   R PVIIYT SPKIIH  
Sbjct  41   QQPRKEINGPRPSPLKINKDSHSINKPSSTLSFSKPPAAKHQQRHPVIIYTHSPKIIHTQ  100

Query  307  PSEFMSLVQRLTG  345
              +FM+LVQ+LTG
Sbjct  101  ARDFMALVQKLTG  113



>gb|EYU23797.1| hypothetical protein MIMGU_mgv1a013271mg [Erythranthe guttata]
Length=225

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 12/82 (15%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppq------------apprppvIIYT  279
            SPRRELQGPRP+ L+V KDS+KIRKPPVAP   P               A  R PVIIY 
Sbjct  19   SPRRELQGPRPSALKVNKDSYKIRKPPVAPPPPPNNPPPSESEAPPPQPAEDRQPVIIYA  78

Query  280  VSPKIIHANPSEFMSLVQRLTG  345
            VSPK+IH   S+F +LVQRLTG
Sbjct  79   VSPKVIHTTVSDFRNLVQRLTG  100



>ref|XP_004249890.1| PREDICTED: protein MKS1 [Solanum lycopersicum]
Length=231

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 79/156 (51%), Gaps = 29/156 (19%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapp---------rppvIIYTVSPKI  294
            RRELQGPRPAPL+V KDS+KI+KPPVAP  HPPP                VIIY VSPK+
Sbjct  21   RRELQGPRPAPLKVNKDSYKIKKPPVAPPPHPPPHTAAVAPAATTQNPQTVIIYAVSPKV  80

Query  295  IHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVS  474
             H   S+FMS+VQRLTG                    S++     +   + +    G +S
Sbjct  81   YHTTVSDFMSVVQRLTG--------------------STTSSMETSTSGSGSGSADGNLS  120

Query  475  PAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEI  582
            PAA+ AS+E+  +P     P       +   + M+I
Sbjct  121  PAAKLASMEKASSPSTTVPPPAAAAVGMETFDSMDI  156



>ref|XP_007137701.1| hypothetical protein PHAVU_009G148500g [Phaseolus vulgaris]
 gb|ESW09695.1| hypothetical protein PHAVU_009G148500g [Phaseolus vulgaris]
Length=214

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 69/129 (53%), Gaps = 34/129 (26%)
 Frame = +1

Query  139  PRRE--LQGPRPAPLRVRKDSHKIRKppvaps----qhpppqapprppvIIYTVSPKIIH  300
            P++E  LQGPRP PL+VR +S KI+KPP  P+      P    P R PV+IY+VSP++IH
Sbjct  14   PKKEVQLQGPRPPPLKVRNESRKIKKPPPHPADQHHWAPERNQPQRKPVVIYSVSPRVIH  73

Query  301  ANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPA  480
             NP +FM LVQRLTG                          A   +D       G VSPA
Sbjct  74   VNPGDFMDLVQRLTG--------------------------APPGED--PPARRGDVSPA  105

Query  481  ARFASVERT  507
            AR AS+E+T
Sbjct  106  ARLASIEKT  114



>ref|XP_004975599.1| PREDICTED: protein MKS1-like [Setaria italica]
Length=343

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 70/156 (45%), Gaps = 19/156 (12%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqappr-------------ppvIIY  276
            +PRR+LQGPRP  L VR +SH I+KP  + +   P   P R              PVIIY
Sbjct  51   TPRRQLQGPRPPRLNVRMESHAIKKPSGSGAAAVPAAPPARRDQQLQQQQQPQRAPVIIY  110

Query  277  TVSPKIIHANPSEFMSLVQRLTGPDHST------FaaaassssssiaaassswlsaaaFQ  438
              SPK+IH  PSEFM+LVQ LTGP                  +                 
Sbjct  111  DASPKVIHVKPSEFMALVQSLTGPGSGAPQQQQQQHYHHHHQAGDDDDDVLLLGQTTFLP  170

Query  439  DNFNVGGGGAVSPAARFASVERTRTPQGKKQPIHDV  546
                +    A+SPAAR A++ER+  P     P +D+
Sbjct  171  PELLLSPSAAMSPAARLATIERSVRPMAAPAPDYDM  206



>ref|XP_006350982.1| PREDICTED: protein MKS1-like [Solanum tuberosum]
Length=229

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 51/75 (68%), Gaps = 9/75 (12%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapp---------rppvIIYTVSPKI  294
            RRELQGPRPAPLRV KDS+KI+KPPVAP  HPPP                VIIY VSPK+
Sbjct  21   RRELQGPRPAPLRVNKDSYKIKKPPVAPPPHPPPHTAAVAPAATTQNPQTVIIYAVSPKV  80

Query  295  IHANPSEFMSLVQRL  339
             H   S+FMS+VQRL
Sbjct  81   YHTTVSDFMSVVQRL  95



>ref|XP_009145868.1| PREDICTED: protein MKS1 [Brassica rapa]
Length=216

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 87/172 (51%), Gaps = 45/172 (26%)
 Frame = +1

Query  112  SDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-------pppqapprpp  264
            SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P            P   PR P
Sbjct  13   SDQQNQ----KRQLQIYGPRPSPLSVHKDSHKIKKPPKHPVPPPQHHHRDQAPLYAPREP  68

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDN  444
            V+IY VSPK++H   S+FM++VQRLTG     F  +                        
Sbjct  69   VVIYAVSPKVVHTTTSDFMNVVQRLTGISAGVFHES------------------------  104

Query  445  FNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSDVER  600
               G GG VSPAAR A+ E   +P+G K+P    TA     E +EI++ +E 
Sbjct  105  ---GNGGDVSPAARLAATENA-SPRGGKEP----TAAAAKEETVEIATAMEE  148



>ref|XP_010926036.1| PREDICTED: uncharacterized protein LOC105048431 [Elaeis guineensis]
Length=204

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvII-YTVSPKIIHANPSEFM  321
            RE+ GPRPAPL++ KDSH I K   + S         R   II YT SPKIIH    +FM
Sbjct  6    REINGPRPAPLKIHKDSHLIHKQSSSSSSSSSTTHHHRHHPIIIYTHSPKIIHTQARDFM  65

Query  322  SLVQRLTGPDHS  357
            +LVQ+LTG  HS
Sbjct  66   ALVQKLTGLSHS  77



>ref|XP_008351517.1| PREDICTED: protein MKS1-like [Malus domestica]
Length=225

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 7/73 (10%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp-------vIIYTVSPKIIHAN  306
            +LQGPRP+PL+V KDS KI+KP   P  HP     P PP       V+IY+VSPK+IH  
Sbjct  15   QLQGPRPSPLKVNKDSVKIKKPXPHPPPHPASTQHPPPPPPPHPQPVVIYSVSPKVIHTT  74

Query  307  PSEFMSLVQRLTG  345
             +EFMSLVQRLTG
Sbjct  75   ENEFMSLVQRLTG  87



>ref|XP_008392012.1| PREDICTED: protein MKS1 [Malus domestica]
Length=225

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 7/73 (10%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp-------vIIYTVSPKIIHAN  306
            +LQGPRP+PL+V KDS KI+KPP  P  HP     P PP       V+IY+VSPK+IH  
Sbjct  15   QLQGPRPSPLKVNKDSVKIKKPPPHPPPHPASTQHPPPPPPPHPQPVVIYSVSPKVIHTT  74

Query  307  PSEFMSLVQRLTG  345
             +EFMSLVQRLTG
Sbjct  75   ENEFMSLVQRLTG  87



>gb|EMT14223.1| hypothetical protein F775_17155 [Aegilops tauschii]
Length=208

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 51/94 (54%), Gaps = 12/94 (13%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv---  267
            MD +       +PRR+LQ  GPRP  L VR +SH I+KP  AP Q        R      
Sbjct  1    MDATSPSGRPTTPRRQLQLQGPRPPRLSVRPESHAIKKPSGAPPQAQGQGHARREEKQQG  60

Query  268  -------IIYTVSPKIIHANPSEFMSLVQRLTGP  348
                   IIY  SPKIIH  PSEFM+LVQRLTGP
Sbjct  61   QPPREPVIIYDASPKIIHTKPSEFMALVQRLTGP  94



>ref|NP_001170183.1| uncharacterized protein LOC100384130 [Zea mays]
 gb|ACN36131.1| unknown [Zea mays]
Length=287

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 81/148 (55%), Gaps = 25/148 (17%)
 Frame = +1

Query  136  SPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqappr------------------  258
            SPR R+LQGPRP  L V KDSHK+RKPPVAP +       P                   
Sbjct  10   SPRSRQLQGPRPPRLAVSKDSHKVRKPPVAPQRQQHQHQQPAAQLQQQQHQYHQQQQQQG  69

Query  259  -ppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaF  435
              PVIIY  SPK+IH  P +FM+LVQRLTGP  ++     +   ++ AAA  S  +A  F
Sbjct  70   RQPVIIYDASPKVIHTKPGDFMALVQRLTGPGSTS----QAQFDAAAAAAGPSHPAAMEF  125

Query  436  QD-NFNVGGGGAVSPAARFASVERTRTP  516
            +   F +    A+SPAAR A++ER+  P
Sbjct  126  EPREFLLSPTAALSPAARLAAIERSVRP  153



>ref|XP_009336419.1| PREDICTED: protein MKS1-like [Pyrus x bretschneideri]
 ref|XP_009336420.1| PREDICTED: protein MKS1-like [Pyrus x bretschneideri]
Length=232

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 5/71 (7%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqa-----pprppvIIYTVSPKIIHANPS  312
            +LQGPRP+PL+V KDS KI+KPP  P  HP         PP  PV+IY+VSPK+IH   +
Sbjct  15   QLQGPRPSPLKVNKDSVKIKKPPPHPHPHPASTQHRPPPPPPQPVVIYSVSPKVIHTTEN  74

Query  313  EFMSLVQRLTG  345
            EFMSL+QRLTG
Sbjct  75   EFMSLIQRLTG  85



>gb|AFW71726.1| hypothetical protein ZEAMMB73_802827 [Zea mays]
Length=287

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 81/148 (55%), Gaps = 25/148 (17%)
 Frame = +1

Query  136  SPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqappr------------------  258
            SPR R+LQGPRP  L V KDSHK+RKPPVAP +       P                   
Sbjct  10   SPRSRQLQGPRPPRLAVSKDSHKVRKPPVAPQRQQHQHQQPAAQLQQQQHQYHQQQQQQG  69

Query  259  -ppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaF  435
              PVIIY  SPK+IH  P +FM+LVQRLTGP  ++     +   ++ AAA  S  +A  F
Sbjct  70   RQPVIIYDASPKVIHTKPGDFMALVQRLTGPGSTS----QAQFDAAAAAAGPSHPAAMEF  125

Query  436  QD-NFNVGGGGAVSPAARFASVERTRTP  516
            +   F +    A+SPAAR A++ER+  P
Sbjct  126  EPREFLLSPTAALSPAARLAAIERSVRP  153



>ref|XP_009408694.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=156

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSE  315
            S RRELQGPRP PL+V +DS +++KP  A +          P  ++Y  +PK+ H  P +
Sbjct  4    SSRRELQGPRPPPLKVSRDSCRVKKPATAAALSRGEHEHREPV-VVYLHTPKVFHTRPQD  62

Query  316  FMSLVQRLTG  345
            FMSLVQRLTG
Sbjct  63   FMSLVQRLTG  72



>emb|CDX99326.1| BnaC05g34410D [Brassica napus]
Length=214

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 86/169 (51%), Gaps = 41/169 (24%)
 Frame = +1

Query  112  SDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-------pppqapprpp  264
            SD+Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+           P   PR P
Sbjct  13   SDLQNQ----KRQLQIYGPRPSPLSVHKDSHKIKKPPKHPAPPPQHHHRDQAPVYAPREP  68

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDN  444
            V+IY VSPK++H   S+FM++VQRLTG     F  +                        
Sbjct  69   VVIYAVSPKVVHTTTSDFMNVVQRLTGISAGVFHES------------------------  104

Query  445  FNVGGGGAVSPAARFASVERTRTPQGKKQPIHDVTADIGMVEGMEISSD  591
               G GG VSPAAR A+ E   +P+G K+P       + +   ME +++
Sbjct  105  ---GNGGDVSPAARLAATENA-SPRGGKEPTAAKEETVEVATAMEEAAE  149



>gb|EPS64372.1| hypothetical protein M569_10412, partial [Genlisea aurea]
Length=214

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 73/142 (51%), Gaps = 37/142 (26%)
 Frame = +1

Query  106  DMSDMQSEGKSP--RRELQGPRPAPLRVRKDSHKIRKppvapsq-------hpppqappr  258
            D  D  + G  P  R++LQGPRP  L++ +DS+KI+KPP+AP           P  +  R
Sbjct  3    DSGDGSTRGSRPSTRKQLQGPRPTALKINQDSYKIKKPPIAPPPPQPPDRLSAPETSENR  62

Query  259  ppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQ  438
             PVIIY VSPKIIH N S+FMSLVQRLTG +                             
Sbjct  63   HPVIIYAVSPKIIHTNVSDFMSLVQRLTGSE----------------------------A  94

Query  439  DNFNVGGGGAVSPAARFASVER  504
             +    G G VSPAAR AS+ER
Sbjct  95   PDPGGSGSGDVSPAARLASIER  116



>ref|NP_001147120.1| VQ motif family protein [Zea mays]
 gb|ACG25542.1| VQ motif family protein [Zea mays]
Length=305

 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD         +PRR+LQGPRP  L VR +SH I+K   +    P          IIY  
Sbjct  35   MDPPSSSGRPTTPRRQLQGPRPPKLNVRAESHAIKKHSGSGVPAPGRAPV-----IIYDA  89

Query  283  SPKIIHANPSEFMSLVQRL  339
            SPK+IH  PSEFM+LVQ L
Sbjct  90   SPKVIHVKPSEFMALVQHL  108



>ref|XP_009349864.1| PREDICTED: protein MKS1-like [Pyrus x bretschneideri]
Length=135

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 43/77 (56%), Gaps = 17/77 (22%)
 Frame = +1

Query  133  KSPRR--ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHAN  306
            KS +R  ELQGPRP  L V K+S K+ K                   I+Y +SPKIIH  
Sbjct  3    KSLKRHLELQGPRPTTLMVSKNSQKVTKKKPV---------------IVYLISPKIIHVQ  47

Query  307  PSEFMSLVQRLTGPDHS  357
            P EFM LVQRLTG +++
Sbjct  48   PEEFMGLVQRLTGNNNN  64



>ref|XP_006382836.1| hypothetical protein POPTR_0005s05910g [Populus trichocarpa]
 gb|ERP60633.1| hypothetical protein POPTR_0005s05910g [Populus trichocarpa]
Length=212

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 77/148 (52%), Gaps = 44/148 (30%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            ++QGPRP+ LR+ + SHKI+KPP+ P + P          IIY VSPKIIHA  S FM++
Sbjct  28   QIQGPRPSALRLHQGSHKIKKPPLPPQRQPV---------IIYAVSPKIIHAEESNFMAV  78

Query  328  VQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFASVERT  507
            VQRLTG   + F+                                G+VSPAAR A+ E+ 
Sbjct  79   VQRLTGLSSADFSH------------------------------DGSVSPAARLAATEKA  108

Query  508  RTPQGKKQP--IHDVTAD--IGMVEGME  579
             +P+   +P  I+D + D  + M+E ++
Sbjct  109  -SPRELTRPSTINDSSNDDLMEMIEELD  135



>dbj|BAJ93356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 55/92 (60%), Gaps = 16/92 (17%)
 Frame = +1

Query  121  QSEGKSPRR---ELQGPRPAPLRVRKDSHKIRKpp-------------vapsqhpppqap  252
            + E +SPR    +LQGPRP  L V KDSHKIRKPP              A   +   QA 
Sbjct  8    EEERQSPRSRQLQLQGPRPPRLSVSKDSHKIRKPPVVPLPHGHGARQLQAAPANRHQQAQ  67

Query  253  prppvIIYTVSPKIIHANPSEFMSLVQRLTGP  348
            PR PVIIY  SPK+IH  P EF++LVQRLTGP
Sbjct  68   PRAPVIIYDASPKVIHTQPGEFLALVQRLTGP  99



>ref|XP_006406577.1| hypothetical protein EUTSA_v10021464mg [Eutrema salsugineum]
 gb|ESQ48030.1| hypothetical protein EUTSA_v10021464mg [Eutrema salsugineum]
Length=226

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 87/175 (50%), Gaps = 44/175 (25%)
 Frame = +1

Query  91   FWSAMDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-------ppp  243
            +++  + SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+           P
Sbjct  6    YFAGGNPSDQQNQ----KRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPQHHHRDQAP  61

Query  244  qapprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswls  423
                R PV+IY VSPK++H   S+FM++VQRLTG     F                    
Sbjct  62   PYAAREPVVIYAVSPKVVHTTASDFMNVVQRLTGISSGVF--------------------  101

Query  424  aaaFQDNFNVGGGGAVSPAARFASVERTRTPQGKKQP-IHDVTADI--GMVEGME  579
                      G GG VSPAAR A+ E   +P+G K+P   D T +I   M E  E
Sbjct  102  -------LESGSGGDVSPAARLAATENA-SPRGGKEPAAKDETVEIATAMEEAAE  148



>ref|XP_002452227.1| hypothetical protein SORBIDRAFT_04g022090 [Sorghum bicolor]
 gb|EES05203.1| hypothetical protein SORBIDRAFT_04g022090 [Sorghum bicolor]
Length=308

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 90/161 (56%), Gaps = 23/161 (14%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapp---------  255
            MD S         R++LQGPRP  L V KDSHK+RKPPVAP +H   Q            
Sbjct  1    MDASSGDRSSPRSRQQLQGPRPPRLAVSKDSHKVRKPPVAPQRHQNQQPAAHPHQQQYQH  60

Query  256  ---------rppvIIYTVSPKIIHANPSEFMSLVQRLTGP---DHSTF-aaaassssssi  396
                     R PVIIY  SPK+IH  P +FM+LVQRLTGP     + F AAAA++  S+ 
Sbjct  61   QYQQQQQQQRQPVIIYDASPKVIHTKPGDFMALVQRLTGPGSISQAQFDAAAATAGPSAA  120

Query  397  aaassswlsaaaFQD-NFNVGGGGAVSPAARFASVERTRTP  516
            A++S S  +A  F+   F +    A+SPAAR A++ER+  P
Sbjct  121  ASSSQSQPAAMEFEPREFLLSPTAALSPAARLAAIERSVRP  161



>ref|NP_683319.1| VQ motif-containing protein [Arabidopsis thaliana]
 gb|AAF81352.1|AC036104_1 Contains weak similarity to alpha-/beta-gliadin class A-II from 
Triticum aestivum gb|M10092 [Arabidopsis thaliana]
 gb|AEE30087.1| VQ motif-containing protein [Arabidopsis thaliana]
Length=239

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 53/86 (62%), Gaps = 13/86 (15%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp------------v  267
            + +SPR R + GPRP PL+VR DSHKI K P     HP PQ P                V
Sbjct  2    DNRSPRSRGILGPRPIPLKVRGDSHKIIKKPPLAPPHPQPQPPQTHQQEPSQSRPPPGPV  61

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTG  345
            IIYTVSP+IIH +P+ FM+LVQRLTG
Sbjct  62   IIYTVSPRIIHTHPNNFMTLVQRLTG  87



>emb|CDY00369.1| BnaC07g14570D [Brassica napus]
Length=234

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 51/83 (61%), Gaps = 16/83 (19%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKpp----------------vapsqhpppqapprppvIIY  276
            +E+ GPRP PL++RK+SHKI K P                    Q P    PPR PVIIY
Sbjct  9    KEILGPRPPPLKIRKESHKIIKKPPLVPQPRLQPPEPAPPQLQQQEPMQSQPPRGPVIIY  68

Query  277  TVSPKIIHANPSEFMSLVQRLTG  345
            TVSPKIIH +P+ FM+LVQRLTG
Sbjct  69   TVSPKIIHTHPNNFMALVQRLTG  91



>ref|XP_002893157.1| hypothetical protein ARALYDRAFT_472365 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69416.1| hypothetical protein ARALYDRAFT_472365 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 55/85 (65%), Gaps = 12/85 (14%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvap-----------sqhpppqapprppvI  270
            + +SPR R + GPRP PL+VR DSHKI K P  P            Q P    PPR PVI
Sbjct  2    DNRSPRSRGILGPRPTPLKVRGDSHKIIKKPPLPPQPQPQPLQIHQQEPSESQPPRGPVI  61

Query  271  IYTVSPKIIHANPSEFMSLVQRLTG  345
            IYTVSPKIIH +P+ FM+LVQRLTG
Sbjct  62   IYTVSPKIIHTHPNNFMTLVQRLTG  86



>ref|XP_009390415.1| PREDICTED: protein MKS1 [Musa acuminata subsp. malaccensis]
Length=179

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMS  324
            RE+ GPR APL++ KDSH I K P + +          P  +IYT SPK+IH   S+FM+
Sbjct  6    REINGPRSAPLKIHKDSHLIHKSPSSSAATGARCQRNHPV-VIYTHSPKVIHTQASDFMA  64

Query  325  LVQRLTG  345
            LVQ+LTG
Sbjct  65   LVQKLTG  71



>ref|XP_011032353.1| PREDICTED: protein MKS1-like [Populus euphratica]
Length=210

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 62/120 (52%), Gaps = 39/120 (33%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            ++QGPRP+ LR+ + SHKI+KPP+ P + P          IIY VSPKIIHA  S FM++
Sbjct  26   QIQGPRPSALRLHQGSHKIKKPPLPPQRQPV---------IIYAVSPKIIHAEESNFMAV  76

Query  328  VQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFASVERT  507
            VQRLTG                               D+F+    G+VSPAAR A+ E+ 
Sbjct  77   VQRLTG----------------------------LSSDDFS--HDGSVSPAARLAATEKA  106



>ref|XP_010263110.1| PREDICTED: protein MKS1-like [Nelumbo nucifera]
Length=158

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 10/70 (14%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSE  315
            SP RELQGPRP+PL+V  +S KI+K          P    R P I Y  SP+IIH  P +
Sbjct  13   SPNRELQGPRPSPLKVGNNSCKIKK----------PPKNCRAPTITYLRSPEIIHTRPQD  62

Query  316  FMSLVQRLTG  345
            FM LVQ+LTG
Sbjct  63   FMDLVQQLTG  72



>ref|XP_009387317.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=208

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp-vIIYTVSPKIIHANPSEFM  321
            RE+ G RPAPL++ KDSH I K   + +         R   VIIYT SPK+IH    +FM
Sbjct  6    REINGSRPAPLKIHKDSHLIYKSSSSSTITTSSYQQQRHHPVIIYTHSPKVIHTQARDFM  65

Query  322  SLVQRLTGPDHST  360
            +LVQ+LTG  HS 
Sbjct  66   ALVQKLTGLSHSA  78



>emb|CDX92261.1| BnaA05g21460D [Brassica napus]
Length=215

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 86/172 (50%), Gaps = 46/172 (27%)
 Frame = +1

Query  112  SDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqh-------pppqapprpp  264
            SD Q++    +R+LQ  GPRP+PL V KDSHKI+KPP  P+           P   PR P
Sbjct  13   SDQQNQ----KRQLQIYGPRPSPLSVHKDSHKIKKPPKHPAPPPQHHHRDQAPLYAPREP  68

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDN  444
            V+IY VSPK++H   S+FM++VQRLTG     F  +                        
Sbjct  69   VVIYAVSPKVVHTTTSDFMNVVQRLTGISAGVFHES------------------------  104

Query  445  FNVGGGGAVSPAARFASVERTRTPQGKKQPI---HDVTADIGMV--EGMEIS  585
               G GG VSPAAR A+ E   +P+G K+P     + T +I M   E  E S
Sbjct  105  ---GNGGDVSPAARLAATENA-SPRGGKEPTAAAKEETVEIAMAMEEAAEFS  152



>gb|AFW58215.1| VQ motif family protein [Zea mays]
Length=300

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD         +PRR+LQGPRP  L VR +SH I+K   +    P          IIY  
Sbjct  35   MDPPSSSGRPTTPRRQLQGPRPPKLNVRAESHAIKKHSGSGVPAPGRAPV-----IIYDA  89

Query  283  SPKIIHANPSEFMSLVQRL  339
            SPK+IH  PS+FM+LVQ L
Sbjct  90   SPKVIHVKPSDFMALVQHL  108



>ref|NP_001159105.1| uncharacterized protein LOC100304178 [Zea mays]
 gb|ACL52922.1| unknown [Zea mays]
Length=300

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            MD         +PRR+LQGPRP  L VR +SH I+K   +    P          IIY  
Sbjct  35   MDPPSSSGRPTTPRRQLQGPRPPKLNVRAESHAIKKHSGSGVPAPGRAPV-----IIYDA  89

Query  283  SPKIIHANPSEFMSLVQRL  339
            SPK+IH  PS+FM+LVQ L
Sbjct  90   SPKVIHVKPSDFMALVQHL  108



>gb|AFK40289.1| unknown [Lotus japonicus]
Length=190

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            + G RP+PLRV KDSH IRK   + +    P        IIYT SPK+IH  P +FM+LV
Sbjct  20   INGERPSPLRVNKDSHLIRKSSKSYNTQRNPI-------IIYTKSPKVIHTKPHDFMALV  72

Query  331  QRLTG  345
            Q LTG
Sbjct  73   QSLTG  77



>ref|XP_010680256.1| PREDICTED: protein MKS1 [Beta vulgaris subsp. vulgaris]
Length=231

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 69/139 (50%), Gaps = 34/139 (24%)
 Frame = +1

Query  115  DMQSEGKSPRR-----ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprp---pvI  270
            D   E  SP +     ++QGPRP+PL++ KDSHKI+KPP+ P     P   P     PVI
Sbjct  2    DPHPENPSPPKRDNQIQIQGPRPSPLKINKDSHKIKKPPIVPKPPNNPPPLPATGNQPVI  61

Query  271  IYTVSPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFN  450
            IY++SPK I   PS F S+VQ LTG D +                              N
Sbjct  62   IYSISPKPIVVEPSNFRSIVQHLTGKDST--------------------------PPESN  95

Query  451  VGGGGAVSPAARFASVERT  507
              G   VSPAARFAS+ERT
Sbjct  96   FSGETPVSPAARFASIERT  114



>ref|XP_006430000.1| hypothetical protein CICLE_v10013749mg [Citrus clementina]
 gb|ESR43240.1| hypothetical protein CICLE_v10013749mg [Citrus clementina]
Length=160

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 45/75 (60%), Gaps = 10/75 (13%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRK--DSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSE  315
            R++LQGPRPA L++ K  DS KI K P    +  P         +IY VSPKIIH  P E
Sbjct  25   RKKLQGPRPAALKIGKCSDSSKIIKKPPIHQKRSPV--------VIYLVSPKIIHVRPEE  76

Query  316  FMSLVQRLTGPDHST  360
            FM LVQRLTG   +T
Sbjct  77   FMGLVQRLTGNQAAT  91



>ref|XP_008797859.1| PREDICTED: protein MKS1-like [Phoenix dactylifera]
Length=209

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMS  324
            RE+ GPRPA L++ KDSH I K   + S H   Q       IIYT SPKIIH    +FM+
Sbjct  6    REISGPRPASLKIHKDSHLIHKQSSSSSTHHHHQRHHPV--IIYTHSPKIIHTQARDFMA  63

Query  325  LVQRLTGPDHST  360
            LVQ+LTG  HST
Sbjct  64   LVQKLTGLSHST  75



>ref|XP_010038921.1| PREDICTED: protein MKS1-like [Eucalyptus grandis]
Length=107

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFM  321
            R  LQGP+PA L V K+S KI+K   A S   P         I+Y  SPKIIH  P EFM
Sbjct  11   RVRLQGPKPAELAVSKESTKIKKKVRATSGLAPV--------IVYLKSPKIIHVRPEEFM  62

Query  322  SLVQRLTGPDHSTF  363
             LVQ+LTG    T 
Sbjct  63   GLVQKLTGKSDQTV  76



>gb|AFK43976.1| unknown [Lotus japonicus]
Length=194

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 42/76 (55%), Gaps = 14/76 (18%)
 Frame = +1

Query  118  MQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKII  297
            M+   + P   + GPRP+PL + KDSH IRK  V                IIYT SPK+I
Sbjct  1    MRPTSEKPIGVINGPRPSPLMINKDSHIIRKQRVPI--------------IIYTQSPKVI  46

Query  298  HANPSEFMSLVQRLTG  345
            H    +FM+LVQRLTG
Sbjct  47   HTKAQDFMALVQRLTG  62



>ref|XP_009342707.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1260

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 47/121 (39%), Positives = 62/121 (51%), Gaps = 13/121 (11%)
 Frame = +1

Query  28    FHTSDLSVFDRIIDS--RLRDLGFWSAMDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDS  195
              HT   S +   +D   RL+    ++ MD S      K PRR+LQ  GPRP PL++ KDS
Sbjct  1065  LHTKSRSEWKTELDKWKRLQPYFTFNGMDYS----TEKYPRRKLQLKGPRPTPLKMNKDS  1120

Query  196   HKIRK-----ppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQRLTGPDHST  360
              KI+K          S           PV+IY+VSPK+I ++PS  M LVQ LTG   S 
Sbjct  1121  VKIKKPPVVRSSPRRSYAQDYSLTSPSPVVIYSVSPKVIRSSPSGLMDLVQSLTGLPPSN  1180

Query  361   F  363
             +
Sbjct  1181  Y  1181



>ref|XP_002446454.1| hypothetical protein SORBIDRAFT_06g016290 [Sorghum bicolor]
 gb|EES10782.1| hypothetical protein SORBIDRAFT_06g016290 [Sorghum bicolor]
Length=331

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 50/85 (59%), Gaps = 16/85 (19%)
 Frame = +1

Query  136  SPRRELQGPRPAPLRVRKDSHKIRKppvapsqhp----------------ppqapprppv  267
            +PRR+LQGPRP  L VR +SH I+KP  + S                   P Q   R PV
Sbjct  14   TPRRQLQGPRPPRLNVRMESHAIKKPSGSGSSGVVPPGGQGHGRPRDHHHPQQPGGRAPV  73

Query  268  IIYTVSPKIIHANPSEFMSLVQRLT  342
            IIY  SPK+IHA PSEFM+LVQRLT
Sbjct  74   IIYDASPKVIHAKPSEFMALVQRLT  98



>ref|XP_010916386.1| PREDICTED: protein MKS1 [Elaeis guineensis]
Length=216

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 44/81 (54%), Gaps = 9/81 (11%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp---------vIIYTVSPKII  297
            RE+ GPRPAPL++ KDSH I K   + S                     VIIYT SPKII
Sbjct  6    REINGPRPAPLKIHKDSHLIHKQSSSSSSSTTTTTTTSSSSSSTQRHHPVIIYTHSPKII  65

Query  298  HANPSEFMSLVQRLTGPDHST  360
            H    +FM+LVQ+LTG   ST
Sbjct  66   HTQARDFMALVQKLTGLSKST  86



>ref|XP_007142920.1| hypothetical protein PHAVU_007G028200g [Phaseolus vulgaris]
 gb|ESW14914.1| hypothetical protein PHAVU_007G028200g [Phaseolus vulgaris]
Length=196

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  139  PRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp-vIIYTVSPKIIHANPSE  315
            P++ + G RP+PL + KDSH IRKP          Q P R   +IIYT SPK+IH    +
Sbjct  14   PKKVINGYRPSPLVINKDSHMIRKPSTCVDAQTKLQRPQRITPIIIYTESPKVIHTKAKD  73

Query  316  FMSLVQRLTG  345
            FM+LVQRLTG
Sbjct  74   FMALVQRLTG  83



>ref|XP_009598010.1| PREDICTED: uncharacterized protein LOC104093884 [Nicotiana tomentosiformis]
Length=138

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 3/70 (4%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhppp--qapprppvIIYTVSPKIIHANPSE  315
            RR + GPRP PL++ K+SH IRKP  + +              VIIYT SPKIIH    +
Sbjct  10   RRIINGPRPCPLKI-KESHAIRKPSNSSTVQVMARPLKKQNGQVIIYTESPKIIHTEARD  68

Query  316  FMSLVQRLTG  345
            FM+LVQ+LTG
Sbjct  69   FMALVQKLTG  78



>ref|XP_006826406.1| hypothetical protein AMTR_s00004p00151900 [Amborella trichopoda]
 gb|ERM93643.1| hypothetical protein AMTR_s00004p00151900 [Amborella trichopoda]
Length=239

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTV  282
            M  S  QS      RELQG RP+PL V K S KI+K        P     P    IIYT 
Sbjct  1    MASSHQQSRRLVSGRELQGQRPSPLMVNKGSRKIKKAHHVAPLPPSVPYRPPV--IIYTR  58

Query  283  SPKIIHANPSEFMSLVQRLTG  345
            SPK+IHA   +FM+LVQRLTG
Sbjct  59   SPKVIHAKAHDFMTLVQRLTG  79



>ref|XP_006605245.1| PREDICTED: protein MKS1-like [Glycine max]
 gb|KHN43591.1| hypothetical protein glysoja_002174 [Glycine soja]
Length=124

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 8/76 (11%)
 Frame = +1

Query  118  MQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKII  297
            M S+  S  ++LQGP+PA L + ++S KI K     S H P         I++  SPK+I
Sbjct  1    MNSQAASRHKQLQGPKPASLIINRNSTKISKQKQHLSHHSPV--------IVHLKSPKVI  52

Query  298  HANPSEFMSLVQRLTG  345
            H  P EFMSLVQ+LTG
Sbjct  53   HVRPEEFMSLVQQLTG  68



>ref|XP_006469086.1| PREDICTED: protein MKS1-like [Citrus sinensis]
Length=221

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 44/78 (56%), Gaps = 9/78 (12%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv---------IIYTVSPKII  297
            RE+ GPRP+PL++ KDSH I K P + S         +            IIY  SPK+I
Sbjct  21   REINGPRPSPLKINKDSHVIHKLPSSSSNSLLLVHNNKQEQEQDQQRRPVIIYAHSPKVI  80

Query  298  HANPSEFMSLVQRLTGPD  351
            H  P +FM+LVQ+LTG D
Sbjct  81   HTQPRDFMALVQKLTGSD  98



>ref|XP_008387185.1| PREDICTED: uncharacterized protein LOC103449631 [Malus domestica]
Length=134

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 43/77 (56%), Gaps = 17/77 (22%)
 Frame = +1

Query  133  KSPRR--ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHAN  306
            KS RR  ELQGPRPAPL V K+S K+ K                     Y +SPKIIH  
Sbjct  2    KSSRRHLELQGPRPAPLMVSKNSQKVMKKKPVVV---------------YLISPKIIHVQ  46

Query  307  PSEFMSLVQRLTGPDHS  357
            P EFM LVQRLTG +++
Sbjct  47   PEEFMGLVQRLTGNNNN  63



>ref|XP_011023003.1| PREDICTED: protein MKS1 [Populus euphratica]
Length=202

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 61/119 (51%), Gaps = 39/119 (33%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            +QGPRP+PL+V  DSHKI+KPP  P + P          IIY VSPKIIHA  S FM++V
Sbjct  20   IQGPRPSPLKVNPDSHKIKKPPPPPPKQPV---------IIYAVSPKIIHAEESNFMAVV  70

Query  331  QRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFASVERT  507
            QRLTG                               D+F+    G+VSPAAR A+ E+ 
Sbjct  71   QRLTG----------------------------LSSDDFS--HDGSVSPAARLAATEKA  99



>ref|XP_009362795.1| PREDICTED: protein MKS1-like [Pyrus x bretschneideri]
Length=134

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 43/77 (56%), Gaps = 17/77 (22%)
 Frame = +1

Query  133  KSPRR--ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHAN  306
            KS RR  ELQGPRPAPL V K+S K+ K                     Y +SPKIIH  
Sbjct  2    KSLRRHLELQGPRPAPLMVSKNSQKVMKKKPVVV---------------YLISPKIIHVQ  46

Query  307  PSEFMSLVQRLTGPDHS  357
            P EFM LVQRLTG +++
Sbjct  47   PEEFMGLVQRLTGNNNN  63



>ref|XP_007044310.1| VQ motif-containing protein, putative, partial [Theobroma cacao]
 gb|EOY00142.1| VQ motif-containing protein, putative, partial [Theobroma cacao]
Length=273

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 46/89 (52%), Gaps = 10/89 (11%)
 Frame = +1

Query  109  MSDMQSEGKSPRREL--QGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv-----  267
            MS + S  + PRR+L   G RP+PL++ KDSH I+K                        
Sbjct  52   MSPVNSHERPPRRDLMINGLRPSPLKINKDSHFIQKSSGLVLSQAAAAPLKNQYQQQQRQ  111

Query  268  ---IIYTVSPKIIHANPSEFMSLVQRLTG  345
               IIYT SPKIIH    +FM+LVQ+LTG
Sbjct  112  GPIIIYTHSPKIIHTQARDFMALVQKLTG  140



>ref|XP_006606887.1| PREDICTED: uncharacterized protein LOC102663102 [Glycine max]
Length=179

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 6/66 (9%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            ++ GPRP+ L + KDSH IRK                   IIYT SPK+IH    +FM+L
Sbjct  6    QINGPRPSSLVINKDSHMIRKETKLQRPQRINPI------IIYTESPKVIHTKAKDFMAL  59

Query  328  VQRLTG  345
            VQRLTG
Sbjct  60   VQRLTG  65



>ref|XP_009410007.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis]
Length=213

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 42/78 (54%), Gaps = 6/78 (8%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv------IIYTVSPKIIHAN  306
            RE+ G RPAPL++ KDSH I K   + S                   IIYT SPK+IH  
Sbjct  6    REIHGSRPAPLKIHKDSHLIHKASSSSSSSSTTTNASSQQQQRHRPVIIYTHSPKVIHTQ  65

Query  307  PSEFMSLVQRLTGPDHST  360
              +FM+LVQ+LTG   ST
Sbjct  66   AHDFMALVQKLTGLSRST  83



>gb|KHN22584.1| hypothetical protein glysoja_037734 [Glycine soja]
Length=119

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +1

Query  118  MQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKII  297
            M S+  S +++LQGP+PA L + ++S KI K       H  P        I++  SPK+I
Sbjct  1    MNSQATSRQKQLQGPKPASLMINRNSTKISKKQKQHLSHHSPV-------IVHLKSPKVI  53

Query  298  HANPSEFMSLVQRLT  342
            H  P EFMSLVQ+LT
Sbjct  54   HVRPEEFMSLVQQLT  68



>ref|XP_008807120.1| PREDICTED: protein MKS1-like [Phoenix dactylifera]
Length=208

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMS  324
            RE+ G RPAPL++ KD+  I K   + +     +  P    IIYT SPKIIH    +FM+
Sbjct  6    REINGSRPAPLKIHKDTQLIHKQSSSSTATTHHRHHPV---IIYTHSPKIIHTQARDFMA  62

Query  325  LVQRLTGPDHST  360
            LVQ+LTG   ST
Sbjct  63   LVQKLTGLSRST  74



>gb|EYU40762.1| hypothetical protein MIMGU_mgv1a020379mg, partial [Erythranthe 
guttata]
Length=133

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 10/65 (15%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            + G RP+PLR+ KDSH I K P    Q            IIYT SPK+IHA   +FM++V
Sbjct  2    INGSRPSPLRINKDSHAIHKIPSKRQQPV----------IIYTHSPKVIHAQARDFMAMV  51

Query  331  QRLTG  345
            Q+LTG
Sbjct  52   QKLTG  56



>ref|XP_007202914.1| hypothetical protein PRUPE_ppa016149mg, partial [Prunus persica]
 gb|EMJ04113.1| hypothetical protein PRUPE_ppa016149mg, partial [Prunus persica]
Length=118

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 6/66 (9%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            ELQGPRP PL V K+S +         +    Q     PVI+Y +SPK+IH  P EFM L
Sbjct  7    ELQGPRPKPLVVSKNSRQ------EMKKKKQQQPISSNPVIVYLISPKVIHVQPQEFMDL  60

Query  328  VQRLTG  345
            VQRLTG
Sbjct  61   VQRLTG  66



>ref|XP_004166845.1| PREDICTED: uncharacterized protein LOC101226548 [Cucumis sativus]
Length=141

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            E+ GPRP+PL +   S  IRKP                  IIYT SPKIIH +P +FM+L
Sbjct  8    EINGPRPSPLLIHNHSRLIRKPVQLRQPL-----------IIYTHSPKIIHTHPKDFMAL  56

Query  328  VQRLTG  345
            VQRLTG
Sbjct  57   VQRLTG  62



>ref|XP_004135399.1| PREDICTED: uncharacterized protein LOC101211961 [Cucumis sativus]
 gb|KGN52089.1| hypothetical protein Csa_5G609750 [Cucumis sativus]
Length=143

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            E+ GPRP+PL +   S  IRKP                  IIYT SPKIIH +P +FM+L
Sbjct  8    EINGPRPSPLLIHNHSRLIRKPVQLRQPL-----------IIYTHSPKIIHTHPKDFMAL  56

Query  328  VQRLTG  345
            VQRLTG
Sbjct  57   VQRLTG  62



>ref|XP_004497082.1| PREDICTED: uncharacterized protein LOC101495872 [Cicer arietinum]
Length=194

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 18/75 (24%)
 Frame = +1

Query  139  PRRELQGPRPAPLRVRK--DSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPS  312
            P++ + GPRP+PL +RK    HK ++ P+                IIYT SPKIIH    
Sbjct  16   PKKVINGPRPSPLMIRKPNSCHKQQRVPI----------------IIYTQSPKIIHTKAQ  59

Query  313  EFMSLVQRLTGPDHS  357
            +FM+LVQRLTG  H+
Sbjct  60   DFMALVQRLTGMSHN  74



>ref|XP_010264057.1| PREDICTED: protein MKS1-like [Nelumbo nucifera]
Length=220

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 47/86 (55%), Gaps = 18/86 (21%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRK------------------ppvapsqhpppqapprppv  267
            R+E+ GPRP+PL++ KDSH I+K                       S     Q   +PPV
Sbjct  13   RKEINGPRPSPLKINKDSHFIQKPSSSAHSSSSTSPSSLSAVAATASVKQQHQQQRQPPV  72

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTG  345
            IIYT SPKIIH    +FM+LVQ+LTG
Sbjct  73   IIYTHSPKIIHTQARDFMALVQKLTG  98



>ref|XP_010110444.1| hypothetical protein L484_006437 [Morus notabilis]
 gb|EXC26386.1| hypothetical protein L484_006437 [Morus notabilis]
Length=119

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 35/65 (54%), Gaps = 10/65 (15%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            LQGPRP PL + + S KI K                   ++Y  SPKIIH  P EFMSLV
Sbjct  8    LQGPRPTPLTISRSSAKITKIKQRAPPPI----------VVYLRSPKIIHVRPEEFMSLV  57

Query  331  QRLTG  345
            Q+LTG
Sbjct  58   QQLTG  62



>ref|XP_002308338.2| hypothetical protein POPTR_0006s21380g [Populus trichocarpa]
 gb|EEE91861.2| hypothetical protein POPTR_0006s21380g [Populus trichocarpa]
Length=99

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 36/66 (55%), Gaps = 7/66 (11%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            +LQ PRPAPL V K+S KI+K          P        I+Y  SP IIH  P +FM  
Sbjct  8    KLQCPRPAPLMVSKNSSKIKKTAAPNQGRSSPV-------IVYLKSPDIIHVRPEDFMGT  60

Query  328  VQRLTG  345
            VQRLTG
Sbjct  61   VQRLTG  66



>ref|XP_010506791.1| PREDICTED: 5'-3' exoribonuclease 2-like [Camelina sativa]
Length=287

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  175  LRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQRLTG  345
            L+V KDSH I+K P   S      A  R PVIIYT +PKIIH NP +FM+LVQ+LTG
Sbjct  37   LKVNKDSHVIKKQPSPSSSSSVAAAKHRHPVIIYTHTPKIIHTNPKDFMALVQKLTG  93



>gb|AAF81354.1|AC036104_3 Contains weak similarity to bab503 major core protein from Simian 
T-cell lymphotrophic virus type 1 gb|AF230486 [Arabidopsis 
thaliana]
Length=430

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 50/86 (58%), Gaps = 13/86 (15%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvI-----------  270
            + +SPR R   GP+P PL+VR DSHKI K P     HP PQ P                 
Sbjct  2    DNRSPRSRGNMGPKPTPLKVRGDSHKIIKKPPLAPPHPQPQPPQTHQQEPSQSRPPPGPV  61

Query  271  -IYTVSPKIIHANPSEFMSLVQRLTG  345
             IYTV+P+IIH +P+ FM+LVQRLTG
Sbjct  62   NIYTVTPRIIHTHPNNFMTLVQRLTG  87



>ref|XP_010506802.1| PREDICTED: 5'-3' exoribonuclease 2-like [Camelina sativa]
Length=288

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  175  LRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQRLTG  345
            L+V KDSH I+K P   S      A  R PVIIYT +PKIIH NP +FM+LVQ+LTG
Sbjct  37   LKVNKDSHVIKKQPSPSSSSSVAAAKHRHPVIIYTHTPKIIHTNPKDFMALVQKLTG  93



>ref|NP_173554.3| nucleic acid/nucleotide binding protein [Arabidopsis thaliana]
 gb|AEE30084.1| nucleic acid/nucleotide binding protein [Arabidopsis thaliana]
Length=421

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 50/86 (58%), Gaps = 13/86 (15%)
 Frame = +1

Query  127  EGKSPR-RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvI-----------  270
            + +SPR R   GP+P PL+VR DSHKI K P     HP PQ P                 
Sbjct  2    DNRSPRSRGNMGPKPTPLKVRGDSHKIIKKPPLAPPHPQPQPPQTHQQEPSQSRPPPGPV  61

Query  271  -IYTVSPKIIHANPSEFMSLVQRLTG  345
             IYTV+P+IIH +P+ FM+LVQRLTG
Sbjct  62   NIYTVTPRIIHTHPNNFMTLVQRLTG  87



>gb|KCW90405.1| hypothetical protein EUGRSUZ_A02544 [Eucalyptus grandis]
Length=101

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 0/71 (0%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            LQGPRP P+ V + S ++                     I+Y  SPK+IH  P EFM LV
Sbjct  16   LQGPRPEPMAVNRSSTEMIPKQDFVPARTTSCRRQPATKIVYLRSPKVIHVKPEEFMGLV  75

Query  331  QRLTGPDHSTF  363
            Q+LTG   S+ 
Sbjct  76   QQLTGNQSSSL  86



>ref|XP_008804594.1| PREDICTED: protein MKS1-like [Phoenix dactylifera]
Length=185

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 15/79 (19%)
 Frame = +1

Query  109  MSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSP  288
            MS ++S G+  +  L+ P PA L +R ++ +I+KP   P              IIY VSP
Sbjct  1    MSSLRSHGR--KVGLRRPPPAHLTIRNETRRIQKPARKPV-------------IIYMVSP  45

Query  289  KIIHANPSEFMSLVQRLTG  345
            KIIHA  SEFM+LVQRLTG
Sbjct  46   KIIHAEASEFMALVQRLTG  64



>ref|XP_011076667.1| PREDICTED: protein MKS1 [Sesamum indicum]
Length=229

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 49/102 (48%), Gaps = 21/102 (21%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQGPRPAPLRVRKDSHKIRKp---------------------pv  219
            M  S  Q    + +  + GPRP+PLR+ KDSH I KP                       
Sbjct  1    MSPSKFQDSEVTTKGVINGPRPSPLRINKDSHAIHKPSSSPSSHQPVNENSAHLASGPKQ  60

Query  220  apsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQRLTG  345
               Q     +  R PVIIYT SPK+IHA   +FMSLVQ+LTG
Sbjct  61   QQQQQQQSLSAKRQPVIIYTHSPKVIHAQARDFMSLVQKLTG  102



>ref|XP_009413867.1| PREDICTED: uncharacterized protein LOC103995088 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 14/69 (20%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            +QGP P P+ V ++S +I+K    P              +IYTVSP++IHA  SEFM+LV
Sbjct  5    VQGPAPPPV-VDEESRRIQKNKRKPV-------------VIYTVSPEVIHAEASEFMALV  50

Query  331  QRLTGPDHS  357
            QRLTGP  S
Sbjct  51   QRLTGPGSS  59



>ref|XP_008466850.1| PREDICTED: uncharacterized protein LOC103504155 [Cucumis melo]
Length=131

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 12/66 (18%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            ++ G RP+PL +  DS  +RKP +                IIYT SPKIIH +P +FM+L
Sbjct  8    QINGLRPSPLLIHNDSRLVRKPQLRQPL------------IIYTHSPKIIHTHPKDFMAL  55

Query  328  VQRLTG  345
            VQRLTG
Sbjct  56   VQRLTG  61



>ref|XP_002310503.1| hypothetical protein POPTR_0007s03770g [Populus trichocarpa]
 gb|EEE90953.1| hypothetical protein POPTR_0007s03770g [Populus trichocarpa]
Length=205

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 60/122 (49%), Gaps = 39/122 (32%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFM  321
            + ++QGPRP+ L++ +DSHKI+KPP  P + P          +IY VSPK IH   S FM
Sbjct  20   QLQIQGPRPSALKLNQDSHKIKKPPPPPPKQPV---------VIYAVSPKTIHTEESNFM  70

Query  322  SLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGGGAVSPAARFASVE  501
            ++VQRLTG     F                       F D       G+VSPAAR A+ E
Sbjct  71   AVVQRLTGLSSGDF-----------------------FHD-------GSVSPAARLAATE  100

Query  502  RT  507
            + 
Sbjct  101  KA  102



>ref|XP_004163883.1| PREDICTED: protein MKS1-like [Cucumis sativus]
 gb|KGN62143.1| hypothetical protein Csa_2G302100 [Cucumis sativus]
Length=212

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 80/166 (48%), Gaps = 50/166 (30%)
 Frame = +1

Query  136  SPRR---ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv--------IIYTV  282
            +PR+   +LQGPRP  LRV ++S KI+KPP  P   P P  PP PP         IIY +
Sbjct  14   TPRKKEIQLQGPRPPQLRVSQESRKIKKPPPHPQPVPQPGRPPLPPGPSQWPQPLIIYDI  73

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH   + FMS+VQRLTG                              Q +  V  G
Sbjct  74   SPKVIHVAENNFMSVVQRLTG------------------------------QSSTAVTDG  103

Query  463  GAVSPAARFASVERTRTPQGKKQPIH--------DVTADIGMVEGM  576
              +SPAAR A++E+      +++ I+        +V+ ++G + G+
Sbjct  104  D-LSPAARLATIEKASPRSEREREINVSDMMDLAEVSVELGQIPGI  148



>ref|XP_008460908.1| PREDICTED: protein MKS1-like [Cucumis melo]
Length=212

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 80/166 (48%), Gaps = 50/166 (30%)
 Frame = +1

Query  136  SPRR---ELQGPRPAPLRVRKDSHKIRKppvapsqhpppq--------apprppvIIYTV  282
            +PR+   +LQGPRP  LRV ++S KI+KPP  P   PPP         +    P+IIY +
Sbjct  14   TPRKKEIQLQGPRPPQLRVSQESRKIKKPPPHPQPVPPPGRPPLPPGPSQWPQPLIIYDI  73

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH   + FMS+VQRLTG                              Q +  V  G
Sbjct  74   SPKVIHVAENNFMSVVQRLTG------------------------------QSSTAVTDG  103

Query  463  GAVSPAARFASVERTRTPQGKKQPIH--------DVTADIGMVEGM  576
              +SPAAR A++E+      +++ I+        +V+ ++G + G+
Sbjct  104  D-LSPAARLATIEKASPRSEREREINVSDMMDLAEVSVELGQIPGI  148



>ref|XP_002321476.1| VQ motif-containing family protein [Populus trichocarpa]
 gb|EEF05603.1| VQ motif-containing family protein [Populus trichocarpa]
Length=200

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 38/68 (56%), Gaps = 8/68 (12%)
 Frame = +1

Query  166  PAPLRVRKDSHKIRKppvapsqhpppqapprppv--------IIYTVSPKIIHANPSEFM  321
            P PL+V KDSH I+K   +P       A              IIYT SPKIIH NP +FM
Sbjct  19   PPPLKVNKDSHMIKKSFPSPPSSSSSSASSLAVTGPIKPHPVIIYTHSPKIIHTNPKDFM  78

Query  322  SLVQRLTG  345
            +LVQ+LTG
Sbjct  79   ALVQKLTG  86



>ref|XP_007028069.1| Uncharacterized protein TCM_023150 [Theobroma cacao]
 gb|EOY08571.1| Uncharacterized protein TCM_023150 [Theobroma cacao]
Length=191

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 40/74 (54%), Gaps = 7/74 (9%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFM  321
            R +LQGPRPAPL       K+        +   P      PV+IY  SPKIIH  P EFM
Sbjct  66   RDQLQGPRPAPL-------KVCNSSSKMKKSSHPDRSKINPVVIYLRSPKIIHVRPEEFM  118

Query  322  SLVQRLTGPDHSTF  363
            SLVQ LTG D ++ 
Sbjct  119  SLVQSLTGKDSTSI  132



>ref|XP_011007716.1| PREDICTED: uncharacterized protein LOC105113294 [Populus euphratica]
 ref|XP_011009319.1| PREDICTED: uncharacterized protein LOC105114469 [Populus euphratica]
Length=199

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 8/68 (12%)
 Frame = +1

Query  166  PAPLRVRKDSHKIRKppvapsqhpppqapprppv--------IIYTVSPKIIHANPSEFM  321
            P PL+V KDSH I+K   +P       A              IIYT SPK+IH NP +FM
Sbjct  19   PPPLKVNKDSHMIKKSFPSPPSSSSSSASSLAVTGPIKPHPVIIYTHSPKVIHTNPKDFM  78

Query  322  SLVQRLTG  345
            +LVQ+LTG
Sbjct  79   ALVQKLTG  86



>ref|XP_004147377.1| PREDICTED: protein MKS1-like [Cucumis sativus]
Length=241

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 78/166 (47%), Gaps = 50/166 (30%)
 Frame = +1

Query  136  SPRR---ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv--------IIYTV  282
            +PR+   +LQGPRP  LRV ++S KI+KPP  P   P P  PP PP         IIY +
Sbjct  14   TPRKKEIQLQGPRPPQLRVSQESRKIKKPPPHPQPVPQPGRPPLPPGPSQWPQPLIIYDI  73

Query  283  SPKIIHANPSEFMSLVQRLTGPDHSTFaaaassssssiaaassswlsaaaFQDNFNVGGG  462
            SPK+IH   + FMS+VQRLTG   +                                   
Sbjct  74   SPKVIHVAENNFMSVVQRLTGQSSTAVT-------------------------------D  102

Query  463  GAVSPAARFASVERTRTPQGKKQPIH--------DVTADIGMVEGM  576
            G +SPAAR A++E+      +++ I+        +V+ ++G + G+
Sbjct  103  GDLSPAARLATIEKASPRSEREREINVSDMMDLAEVSVELGQIPGI  148



>emb|CDP16568.1| unnamed protein product [Coffea canephora]
Length=85

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 44/80 (55%), Gaps = 12/80 (15%)
 Frame = +1

Query  103  MDMSDMQSEGK-SPRRELQGPRPAPLRVRKDSHKIRK-----------ppvapsqhpppq  246
            MD  D  + G+ SPRRELQGP P PL+V KDSHKI+K            P  P   P   
Sbjct  1    MDPQDFSTGGRQSPRRELQGPSPTPLKVSKDSHKIKKPPVAPQLHHLNHPAQPHLQPTVD  60

Query  247  apprppvIIYTVSPKIIHAN  306
               R PV+IY VSPK+IH  
Sbjct  61   NEHRQPVVIYAVSPKVIHTT  80



>emb|CDX95531.1| BnaC01g34230D [Brassica napus]
Length=280

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = +1

Query  160  PRPAPL-RVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQR  336
            P P+PL ++ KDSH I+KPP   S       P +P  IIYT +PK+IH NP +FM+LVQ+
Sbjct  27   PSPSPLLKLNKDSHVIKKPPSPSSSSSTAAKPRQPV-IIYTNTPKVIHTNPKDFMALVQK  85

Query  337  LTGPDH  354
            LTG  H
Sbjct  86   LTGMSH  91



>ref|XP_008443599.1| PREDICTED: protein MKS1-like [Cucumis melo]
Length=107

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 36/66 (55%), Gaps = 4/66 (6%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            +L+GPRP PL V K S  I K           ++P     IIY  SPKIIH  P EF S 
Sbjct  11   QLRGPRPPPLTVNKSSTNIFKKSTKNPNQRNRRSPI----IIYLRSPKIIHVRPEEFKSF  66

Query  328  VQRLTG  345
            VQRLTG
Sbjct  67   VQRLTG  72



>emb|CDY18516.1| BnaA01g26790D [Brassica napus]
Length=274

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = +1

Query  160  PRPAPL-RVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQR  336
            P P+PL ++ KDSH I+KPP   S       P +P  IIYT +PK+IH NP +FM+LVQ+
Sbjct  27   PSPSPLLKLNKDSHVIKKPPSPSSSSSTAAKPRQPV-IIYTNTPKVIHTNPKDFMALVQK  85

Query  337  LTGPDH  354
            LTG  H
Sbjct  86   LTGMSH  91



>ref|XP_009112790.1| PREDICTED: formin-like protein 7 [Brassica rapa]
Length=287

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = +1

Query  160  PRPAPL-RVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQR  336
            P P+PL ++ KDSH I+KPP   S       P +P  IIYT +PK+IH NP +FM+LVQ+
Sbjct  27   PSPSPLLKLNKDSHVIKKPPSPSSSSSTAAKPRQPV-IIYTNTPKVIHTNPKDFMALVQK  85

Query  337  LTGPDH  354
            LTG  H
Sbjct  86   LTGMSH  91



>ref|XP_010529087.1| PREDICTED: uncharacterized protein LOC104806066 [Tarenaya hassleriana]
Length=259

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            L  P    L++R+DSH I+KPP   S      A PR PVIIYT SPK+IH NP++FM+LV
Sbjct  29   LHSPPATSLKIRRDSHFIKKPPSPSSSSAVAVAKPRHPVIIYTHSPKVIHTNPNDFMALV  88

Query  331  QRLTG  345
            Q+LTG
Sbjct  89   QKLTG  93



>emb|CDY71985.1| BnaAnng39520D [Brassica napus]
Length=137

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            EL G RP  L++  +SH I+K           +     PV+IY  SPK+IH     FM+L
Sbjct  8    ELSGSRPPSLKLTGESHSIKKTTSFNVVKQSRRHGRAAPVVIYAHSPKVIHTRAENFMAL  67

Query  328  VQRLTG  345
            VQRLTG
Sbjct  68   VQRLTG  73



>ref|XP_006299937.1| hypothetical protein CARUB_v10016148mg [Capsella rubella]
 gb|EOA32835.1| hypothetical protein CARUB_v10016148mg [Capsella rubella]
Length=268

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = +1

Query  112  SDMQSEGKSPRRE------LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppv--  267
            S    +   P+RE      L  P P+ L+V KDSH I+KPP          A  +P    
Sbjct  3    STFNGQAHHPKREPNENGILYPPSPSTLKVNKDSHVIKKPPAPSPSSSSSAAAAKPRHPV  62

Query  268  IIYTVSPKIIHANPSEFMSLVQRLTG  345
            IIYT +PKIIH NP +FM+LVQ+LTG
Sbjct  63   IIYTHTPKIIHTNPKDFMALVQKLTG  88



>ref|XP_010228729.1| PREDICTED: uncharacterized protein LOC100824434 [Brachypodium 
distachyon]
Length=134

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 13/82 (16%)
 Frame = +1

Query  109  MSDMQSEGKSPRRE---LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYT  279
            M+ M +   SPR+    L+GPRP PL+V   S          +             I+Y 
Sbjct  1    MTAMTASSSSPRKPGGGLRGPRPQPLKVSSPSRPPAAASKKSAAPV----------IVYE  50

Query  280  VSPKIIHANPSEFMSLVQRLTG  345
             +PK++HA P EFM++VQRLTG
Sbjct  51   HTPKVVHARPQEFMTVVQRLTG  72



>ref|XP_006485853.1| PREDICTED: protein MKS1-like, partial [Citrus sinensis]
Length=197

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  172  PLRVRKDSHKIRKppvapsqhpppqapprpp-vIIYTVSPKIIHANPSEFMSLVQRLTG  345
            PL++ KDSH I+K   + +       P     VIIYT SPKIIH +P +FM+LVQ+LTG
Sbjct  4    PLKINKDSHFIKKSSASAAVTSTSLPPSHRHPVIIYTHSPKIIHTHPRDFMALVQKLTG  62



>ref|XP_006427805.1| hypothetical protein CICLE_v10026434mg [Citrus clementina]
 gb|ESR41045.1| hypothetical protein CICLE_v10026434mg [Citrus clementina]
Length=223

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppq----apprpp  264
            MD S++ S G+  + +LQ  GPRP PL + +DSHKI+KPP  P      Q    +  + P
Sbjct  1    MDSSNLPSAGQRRQDQLQIQGPRPPPLSIHRDSHKIKKPPKPPLPPTEQQPHHHSERQQP  60

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTG  345
            VIIY++SPK+I+   ++FM+ VQRLTG
Sbjct  61   VIIYSISPKVINVTVADFMTTVQRLTG  87



>emb|CDY44897.1| BnaA02g13850D [Brassica napus]
Length=137

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            EL G RP  L++  +SH I+K           +     PV+IY  SPK+IH     FM+L
Sbjct  8    ELSGSRPPSLKLTGESHSIKKTTSFNVFKQSRRHGRAAPVVIYAHSPKVIHTRAENFMAL  67

Query  328  VQRLTG  345
            VQRLTG
Sbjct  68   VQRLTG  73



>ref|XP_006440985.1| hypothetical protein CICLE_v10023791mg [Citrus clementina]
 gb|ESR54225.1| hypothetical protein CICLE_v10023791mg [Citrus clementina]
Length=222

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  172  PLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQRLTG  345
            PL++ KDSH I+K   + S         R PVIIYT SPKIIH +P +FM LVQ+LTG
Sbjct  30   PLKINKDSHFIKKSSASASASVSLPPSHRHPVIIYTHSPKIIHTHPRDFMVLVQKLTG  87



>ref|XP_010099240.1| hypothetical protein L484_015429 [Morus notabilis]
 gb|EXB77504.1| hypothetical protein L484_015429 [Morus notabilis]
Length=189

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            ++ G RP+PL++ K+SH I KP      +PP +  P    IIYT SP+IIH  P  FM++
Sbjct  8    KINGARPSPLKINKESHTIYKPSNHHQMNPPQRHQPV---IIYTHSPRIIHTEPRNFMAV  64

Query  328  VQRLTG  345
            VQ LTG
Sbjct  65   VQNLTG  70



>gb|KDO58360.1| hypothetical protein CISIN_1g027415mg [Citrus sinensis]
Length=223

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = +1

Query  103  MDMSDMQSEGKSPRRELQ--GPRPAPLRVRKDSHKIRKppvapsqhpppq----apprpp  264
            MD S++ S G+  + +LQ  GPRP PL + +DSHKI+KPP  P      Q    +  + P
Sbjct  1    MDSSNLPSAGQRRQDQLQIQGPRPPPLSIHRDSHKIKKPPKPPLPPTEQQPHHHSERQQP  60

Query  265  vIIYTVSPKIIHANPSEFMSLVQRLTG  345
            VIIY++SPK+I+   ++FM+ VQRLTG
Sbjct  61   VIIYSISPKVINVTVADFMTTVQRLTG  87



>ref|XP_009127633.1| PREDICTED: LOW QUALITY PROTEIN: protein MKS1 [Brassica rapa]
Length=148

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            EL G RP  L++  +SH I+K           +     PV+IY  SPK+IH     FM+L
Sbjct  8    ELSGSRPPSLKLTGESHSIKKTTSFNVFKQSRRHGRAAPVVIYAHSPKVIHTRAENFMAL  67

Query  328  VQRLTG  345
            VQRLTG
Sbjct  68   VQRLTG  73



>ref|XP_007153386.1| hypothetical protein PHAVU_003G030700g [Phaseolus vulgaris]
 gb|ESW25380.1| hypothetical protein PHAVU_003G030700g [Phaseolus vulgaris]
Length=176

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  RELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprpp-vIIYTVSPKIIHANPSEFM  321
            + L G RP+ L + K S  IRK P + S             +IIYT SPKIIH  P +FM
Sbjct  9    QALNGSRPSSLTINKYSRLIRKKPSSSSSTSHLALTQDQNPIIIYTKSPKIIHTKPRDFM  68

Query  322  SLVQRLTG  345
            +LVQRLTG
Sbjct  69   ALVQRLTG  76



>ref|XP_002447362.1| hypothetical protein SORBIDRAFT_06g033670 [Sorghum bicolor]
 gb|EES11690.1| hypothetical protein SORBIDRAFT_06g033670 [Sorghum bicolor]
Length=189

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +1

Query  148  ELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSL  327
            +LQGPRPAPL+V   +       +   +    QAPPR PVIIY  SP+++HA+P+EF S+
Sbjct  23   QLQGPRPAPLKVSTST---TGAEMVVKKRRLHQAPPRQPVIIYVESPRVVHAHPAEFKSV  79

Query  328  VQRLTG  345
            VQRLTG
Sbjct  80   VQRLTG  85



>ref|XP_001756584.1| predicted protein [Physcomitrella patens]
 gb|EDQ78538.1| predicted protein [Physcomitrella patens]
Length=392

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +1

Query  169  APLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQRLTG  345
            +PL+V KDSH+IRKPP+   Q            II+T SPK+IH  P +FMSLVQ+LTG
Sbjct  44   SPLKVSKDSHRIRKPPLPLPQVQYRPPI-----IIHTYSPKVIHTQPDDFMSLVQKLTG  97



>ref|XP_001762871.1| predicted protein [Physcomitrella patens]
 gb|EDQ72372.1| predicted protein [Physcomitrella patens]
Length=394

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 5/68 (7%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFM  321
            R++ +  R + L+V KDSH+IRK P    Q            II+T SPK+I+A P EFM
Sbjct  124  RKQRERLRTSALKVGKDSHRIRKTPFPLPQVQYRPPI-----IIHTYSPKVIYAEPDEFM  178

Query  322  SLVQRLTG  345
            SLVQ+LTG
Sbjct  179  SLVQKLTG  186



>ref|XP_002318547.1| VQ motif-containing family protein [Populus trichocarpa]
 gb|EEE96767.1| VQ motif-containing family protein [Populus trichocarpa]
Length=199

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 38/74 (51%), Gaps = 14/74 (19%)
 Frame = +1

Query  166  PAPLRVRKDSHKIRKppvapsqhpppqapprpp--------------vIIYTVSPKIIHA  303
            P PL+V KDSH I+K     S      +                   VIIYT SPKIIH 
Sbjct  16   PPPLKVNKDSHMIKKSSPPSSSSSSSSSSASSSLGIVGPVKPPQRHPVIIYTHSPKIIHT  75

Query  304  NPSEFMSLVQRLTG  345
            NP +FMSLVQ+LTG
Sbjct  76   NPKDFMSLVQKLTG  89



>ref|XP_002466329.1| hypothetical protein SORBIDRAFT_01g005740 [Sorghum bicolor]
 gb|EER93327.1| hypothetical protein SORBIDRAFT_01g005740 [Sorghum bicolor]
Length=171

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  151  LQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLV  330
            L+GPRP PL+V   S     P    ++ PP     + PVI+Y  +PK+IHA P EFM++V
Sbjct  25   LRGPRPLPLKVSSSSRGSSPPTTTSNKAPPSTTTKKHPVIVYEHTPKVIHARPQEFMTVV  84

Query  331  QRLTG  345
            QRLTG
Sbjct  85   QRLTG  89



>ref|XP_004981493.1| PREDICTED: protein MKS1-like [Setaria italica]
Length=160

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 7/68 (10%)
 Frame = +1

Query  142  RRELQGPRPAPLRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFM  321
            +R L+GPRP PL+V   S          S    P        I+Y  +PK++HA P EFM
Sbjct  18   KRGLRGPRPQPLKVSASSRGSSPTASKSSSTKKPV-------IVYEHTPKVVHARPQEFM  70

Query  322  SLVQRLTG  345
            ++VQRLTG
Sbjct  71   TVVQRLTG  78



>ref|XP_010465925.1| PREDICTED: 5'-3' exoribonuclease 2-like [Camelina sativa]
Length=287

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  175  LRVRKDSHKIRKppvapsqhpppqapprppvIIYTVSPKIIHANPSEFMSLVQRLTG  345
            L+V KDSH I+KPP   S      A  R PVIIYT +PKIIH NP +FM+LVQ+LTG
Sbjct  37   LKVNKDSHVIKKPPSPSSSSSAAAAKHRHPVIIYTHTPKIIHTNPKDFMALVQKLTG  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3237541576564